2Q44A

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at1g77540
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein At1g77540
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 25
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q44A00
4E8OA 5CNPA 4HNXB 3FIXA 2BL1A 2Q0YA 1XIXA 4E2AA 2JEVA 4CAXA 1M44A 5F46A 2B5GB 1Y9WA 4QVTA 2P6EA 4XNHB 3VWEA 4PSWA 1S5KA 1KZFA 1YR0A 3CXQA 1M4IA 4KVME 2EVNA 5KTCA 3F0AA 1QSTA 1BO4A 1UFHA 1M1DA 5E96A 2GIVA 3I9SA 2R8VA 4U9YA 2QMLA 2HQYA 5DWNA 4UWIA 4H89A 3S6FA 1K4JA 1Q2YA 5EBVA 3E0KA 3ZZIA 4AB7A 1XEBA 2C27A 1WK4A 3G8WA 2R98A 1YVOA 3C26A 1MJ9A 2OZGA 2ZW6A 3D2MA 5JQ4A 3NE7A 4OLLA 1R57A 2PSWA 4NF1A 2PC1A 2PR1A 2OB0A 4KVOE 3EY5A 3WR7A 1Y9KA 2JDCA 2FT0A 2D4OA 3TFYA 4FD5A 2JDDA 3GYAA 2VI7A 2EUIA 5ISVA 1XMTA 4R3LA 1KUXA 2J8MA 1NMTA 3K9UA 4YGOA 4CS0B 1OZPA 2X7BA 3G3SA 4PK2A 2VQYA 3FXTA 2HUZA 4KOYA 4KLWA 2ZW7A 2B3UA 3EC4A 4XPDC 1YREA 3TO9A 2RC4A 1SQHA 4GS4A 2PRBA 2OH1A 1J4JA 1S7NA 5HH1A 5IX3A 1IIDA 2Q4VA 4NEXA 1N71A 2B4DB 2Q44A 1Z9UA 4JJXA 5C88A 2HV2A 4MJ8A 2J8NA 2ZPAA 1Q2CA 2K5TA 1B6BA 3TCVA 2WPXA 5IB0A 2ZW4A 2A4NA 3ZJ0A 1RO5A 3R9EA 3B8GA 3F5BA 4MHDA 4M85A 2JLMA 4Y49C 3SHPA 2Z11A 2FSRA 4CRZB 4KUAA 2CNSA 2Z0ZA 4J3GA 4F6AA 4IUSA 3BLNA 3IWGA 4AVCA 2B4DA 2J8RA 4KOUA 4PK3A 4QC6A 4B5PB 4HNWB 4RS2A 1QSRA 2I79A 5F48A 2QIRA 2Q4YA 3N7ZA 3CXSA 5H86A 1MJBA 2PQ8A 3MGDA 2REEA 5KTDA 1S7FA 3PGPA 2G0BA 1VKCA 2B5GA 2I00A 4OAEA 3T90A 5J8FA 3GY9A 2BUEA 2REFA 4K30A 2F5IA 2Z10A 2AE6A 3TT2A 1I12A 2CNMA 4UA3A 3PP9A 1Z4RA 3CXPA 3BJ8A 3TOBA 2GANA 4M3SA 2ZW5A 4B5PA 1TIQA 2B58A 3H4QA 4BMHA 4R57A 4MY3A 1S7KA 4JD6A 4AG9A 3W6SA 4YRHA 2ARHA 4XNHC 2O28A 4KZTA 4I49A 2OU2A 4MBUA 1YLEA 2BEIA 1KUYA 3W91A 4RI1A 4II9A 3EXNA 4YFJA 4R87A 3EFAA 1YVKA 1ON0A 3S6KA 4B5OA 4NXYA 4JXRA 3R95A 3QB8A 4NSQA 1YGHA 3DR6A 4KOWA 1NSLA 5F47A 4KLVA 3DR8A 4AG7A 1U6MA 1S60A 2B3VA 3R96A 2VZYA 2ZXVA 2NMTA 3VWDA 2P6GA 3TOAA 2ATRA 2GE3A 2OZUA 1NE9A 3LD2A 1Y7RA 4DNCA 1M4DA 4KOVA 3P2HA 1I1DA 1QSMA 4AVBA 2IL4A 1MJAA 1P4NA 2PDOA 1KUVA 5JPHA 4HNYB 1CJWA 4JLYA 2BSWA 4X5KA 3DNSA 3OWCA 4PSXA 1MK4A 4R3KA 5GCNA 2KCWA 1QSOA 1S3ZA 4QBJA 3TO6A 3V8IA 2AJ6A 4U9ZA 5FVJA 5HMNA 3LODA 4QB9A 3P2FA 2DXQA 4UWJA 3R9FA 2OZHA 3EO4A 1LRZA 4HKFA 2R1IA 4U5YA 1Q2DA 3FB3A 4KOXA 4XPKA 3IGRA 1B87A 5H84A 2PR8A 2FS5A 3I3GA 2Y0MA 4JWPA 2FIWA 3SXNA 3GKRA 4MY0A 4FD7A 3S6GA 2P6FA 4E0AA 4OADA 1IICA 4XPDB 1S7LA 2FIAA 1M4GA 1XF8A 4F0YA 4NCZA 4EVYA 2Q7BA 4L8AA 1L0CA 4ORFA 2CY2A 4IF5A 3PZJA 3KKWA 2P0WA 3RYOA 1FY7A 4LX9A 1Z4EA 3DDDA 2VZZA 2FL4A 4MI4A 2D4PA 5DWMA 2WPWA 1YK3A 3JUWA 4PV6A 4XPLA 4KUBA 3R1KA 3TTHA 5IV0A 3JVNA 3FBUA 2B4BA 4AVAA 1GHEA 1RXTA 4Y49B 3UY5A 2FCKA 1PUAA 1PU9A 4UBRA 3T9YA 4CRYB 2FXFA 4CAVA 3FYNA 3DSBA 4FD4A 2G3TA 1CM0A 4JXQA 3D3SA 4KOSA 2QECA 3QAHA 3D8PA 2VXKA 5EC4A 5F49A 3FNCA 4FD6A 4KOTA 4KVXA 3SXOA 1IB1E 2H5MA 3S6HA 1V0CA 3R9GA 3TO7A 5J8CA 1I21A 4QUSA 5C82A 2VEZA 2G3AA 1QSNA 2R7HA 1IYLA 1YX0A 3W6XA 1VHSA 3F8KA 1XE4A 2VBQA 2FE7A 2Q04A 4ONUA 3TE4A 4CAWA 3BJ7A 4ZBGA 4R9MA 1BOBA 1P0HA 4H6ZA 4L89A 3D2PA 1WWZA 5KTAA 1IYKA 4KORA 5I0CA 4H6UA 2CNTA 4LUAA 3FRMA
chains in the Genus database with same CATH superfamily
4E8OA 5CNPA 4HNXB 2C6GA 1GYTA 2PJ6A 3FIXA 3SJXA 2BL1A 2Q0YA 1XIXA 2ZEHA 1IU8A 4E2AA 2EWBA 2JEVA 4NFRA 4CAXA 1M44A 5F46A 3FMCA 4P4DA 3FH4A 4B12A 3CT9A 4OC4A 2QJ8A 2O53A 1VIXA 2B5GB 1Y9WA 4ZY2A 4QVTA 2WSAA 1LANA 2P6EA 4XNHB 2ZOGA 3V7ZA 3VWEA 4PSWA 1VHEA 1IOIA 1S5KA 1KZFA 4NJRA 1YR0A 3VATA 4A33A 2EK9A 3CXQA 4B10A 4MFQA 1M4IA 4KVME 3WC7A 5LYFA 2YNEA 4UFVA 4UEEA 2EO8A 2EVNA 3A9LA 5KTCA 3F0AA 1TF9A 2VL1A 1QSTA 5HVFA 1X10A 3VH9A 5A28A 1BO4A 1UFHA 2DEAA 1M1DA 5E96A 1ZLIA 2GIVA 3I9SA 3SJEA 1ELMP 2R8VA 4A2ZA 4M6IA 1Z8TA 4U9YA 2QMLA 3CPXA 2HQYA 5DWNA 1Z2LA 4UWIA 4ZY1A 4R7MA 4H89A 4CYOA 2DF5A 3S6FA 3NA6A 2BCOA 1K4JA 2CF4A 1LCPA 1QQ9A 4MHNA 4W9YA 4A31A 4OC3A 5I4MA 1Q2YA 5EBVA 2PJAA 3E0KA 3ZZIA 1BPMA 1XEBA 4AB7A 2IMOA 2C27A 2ZEGA 1QMUA 2YNDA 2YNCA 1WK4A 4UEZA 3G8WA 2R98A 1YVOA 1Z8WA 1CP7A 3MRUA 1LAMA 1IY7A 3C26A 4DJLA 3NE8A 1MJ9A 4NGSA 5HXDA 4C7HA 2Z3KA 3SJFA 5JM6A 1ARMA 2OZGA 1R3NA 2ZW6A 4KSAA 4P44A 4CYQA 3D2MA 4PXCA 5G21A 5JQ4A 4HPSA 1TKJA 3NE7A 3GLJA 4OLLA 3S9LA 1R57A 5G1ZA 2PSWA 3LACA 2PC1A 2PR1A 1HDQA 3N5FA 3PBBA 4MHYA 4NF1A 4OP4A 5AG5A 1ZG7A 2OB0A 3ISZA 3D7HA 4KVOE 4MRIA 2IJZA 3EY5A 1Y9KA 4KS9A 4P4EA 2JDCA 3WR7A 4OMEA 2FT0A 3HLPA 1XJOA 3PB7X 5K8PA 2POKA 2D4OA 2ZOFA 5AGEA 5K8OA 2V8VA 3TFYA 1HEEA 4FD5A 1XBUA 2JDDA 3BHXA 4Z65A 2CXAA 2VI7A 3GYAA 4K3NA 1TKFA 2EUIA 5ISVA 1XMTA 4R3LA 1KUXA 2J8MA 1NMTA 3K9UA 4YGOA 4CS0B 1OZPA 4CYNA 8CPAA 3KQXA 2X7BA 3PFEA 3G3SA 4PK2A 2VQYA 3GUXA 3H8EA 4PQAA 4PXDA 2GFQA 4C2YA 1CX8A 2C6CA 3FXTA 2HUZA 4KOYA 3WC6A 3T8WA 4WWVA 3WC5A 2Q51A 3JTKA 4KLWA 4UEFA 4KSIA 1AUGA 4YU9A 3KL9A 5K8NA 4X8IA 4R8FA 2B3UA 2ZW7A 2ODFA 1JQGA 3H8FA 3EC4A 3NH4A 4XPDC 1YREA 1ZG8A 3TO9A 2RC4A 4F9VA 3D7FA 1SQHA 4GS4A 3SI1A 3DGVA 2PRBA 2OH1A 1J4JA 1S7NA 5HH1A 5IX3A 1IIDA 1PCAA 4B13A 2Q4VA 4NEXA 1Z8LA 4NGRA 1N71A 2B4DB 4ZX8A 2Q44A 1Z9UA 4KSFA 3KHXA 4JJXA 3B3TA 4MCRA 5C88A 2ABZA 1ZG9A 2HV2A 3BXMA 4UIBA 4MHZA 4MJ8A 4NGQA 5EMIA 2J8NA 1CBXA 3FVLA 2PCUA 1Q2CA 2WUUA 2ZPAA 4X3RA 2K5TA 1B6BA 3PEIA 3TCVA 2WPXA 4Q38A 5IB0A 4OC1A 4MCPA 2ZW4A 1YLOA 1IGBA 2XEIA 5ELYA 2A4NA 3ZJ0A 5LYLA 1RO5A 3K2KA 3D67A 3R9EA 3B8GA 2V77A 3F5BA 1BLLE 3KR5A 4M85A 4MHDA 5F09A 1ELLP 2JLMA 1F2OA 3K9TA 3PRTA 4Y49C 2PVVA 3SHPA 2PJ5A 5JGFA 2Z11A 5IB9A 2FSRA 4CRZB 4RN7A 4BINA 4FAIA 4KUAA 2CNSA 2Z0ZA 4J3GA 4F6AA 4IUSA 3BLNA 3IWGA 4WJBA 4A32A 4AVCA 2B4DA 3GB0A 5G22A 2BO9A 2PJ1A 2J8RA 4A38A 1TKHA 4KOUA 1F2PA 4R6TA 4MFLA 4PK3A 3TX8A 4QC6A 4AXVA 4B5PB 4UIAA 1XFOA 4HNWB 4UFWA 3FEDA 4RS2A 4MFKA 2PJ8A 3RNZA 1QSRA 2XEGA 4A37A 2I79A 2PJBA 5F48A 2QIRA 3B3VA 2Q4YA 3N7ZA 2YGWA 3CXSA 5H86A 1MJBA 2PQ8A 3MGDA 2REEA 5JH9A 5KTDA 2AFMA 1IOFA 2DPSA 5AG7A 1S7FA 5CBMA 2Q43A 3LMSA 3PGPA 4NGNA 2G0BA 4G1PA 1VKCA 2B5GA 2I00A 2ZEOA 1VGYA 1AYEA 3JRUA 4OAEA 3T90A 4MFJA 4CGPA 5J8FA 3GY9A 2BUEA 1NSAA 2REFA 4K30A 3KQZA 2F5IA 2Z10A 4P4BA 4MCSA 1TXRA 2AE6A 3V38A 3TT2A 1I12A 2CNMA 4UA3A 3SI0A 4YWYA 2WZNA 4C2XA 1YSJA 3PP9A 1Z4RA 3CXPA 3BJ8A 3RZAA 3TOBA 1ARLA 2GANA 1PYTB 1ZLHA 4M3SA 2ZW5A 4PPZA 3H5ZA 4B5PA 2ZEDA 1TIQA 4CGMA 5THWA 2B58A 3H4QA 4BMHA 4DUKA 4X2TA 4R57A 3IC1A 1S7KA 4MY3A 4JD6A 4AG9A 2V8GA 2GU2A 3W6SA 4FBEA 3KZWA 2PJ9A 3B2YA 4YRHA 2ARHA 4XNHC 2O28A 4P10A 1ZO0A 4KZTA 4I49A 2OU2A 3QAYA 1YLEA 2YNCC 4MBUA 2BEIA 1KUYA 3PB9X 3W91A 2AFXA 2CTCA 4RI1A 3KR4A 4II9A 3EXNA 2PRQA 3B3SA 4YFJA 2RB7A 4R87A 3EFAA 1YVKA 1ON0A 2ANPA 2QYVA 3PFOA 4NXYA 3S6KA 4B5OA 5D8NA 1VHOA 3D7GA 4JXRA 3R95A 2AFOA 3QB8A 4NSQA 1YGHA 3DR6A 4KOWA 1NSLA 5F47A 4NGTA 4IHMA 2PIZA 4KLVA 3DR8A 3SI2A 4AG7A 1U6MA 4RUHA 1S60A 2B3VA 3R96A 2OR4A 1BAVA 2PVWA 2VZYA 4CAFA 2ZXVA 3KASA 2PJ4A 4M6HA 2QVPA 4OC5A 4F9UA 5AG4A 3IU1A 2NMTA 3NH5A 3VWDA 4GXHA 2P6GA 1UWYA 5J1QA 3LWUA 3I1UA 3CZXA 3TOAA 4A39A 2ATRA 2GE3A 4BD9A 4B11A 1LOKA 2OZUA 4GM5A 2PJ7A 1NE9A 1Y7EA 3LD2A 1Y7RA 4EWTA 4DNCA 4JZ0A 3B7IA 1M4DA 4KOVA 4UCNA 6CPAA 3P2HA 1I1DA 1QSMA 4AVBA 1Q7LA 2IL4A 2IQ6A 1MJAA 1P4NA 4MFZA 2Z3NA 2C6PA 2J9AA 2PDOA 2G9DA 3B3CA 1BPNA 2V8DA 4CGLA 1KUVA 1X12A 2PE3A 2NYQA 2XEFA 4HNYB 1YMEA 4C2ZA 5JPHA 5LRKA 1CJWA 1HDUA 3KI9A 2BSWA 2PJ0A 2AFSA 4JLYA 4X5KA 3DNSA 3OWCA 4PSXA 3IU2A 1LFWA 2PJ2A 1KWMA 1MK4A 3CPAA 4R3KA 5GCNA 5HVGA 3FEEA 3S9MA 2KCWA 4MFPA 1QSOA 3B35A 1DE4C 1S3ZA 2Z3LA 2ZEPA 3TO6A 4OC2A 3V8IA 4QBJA 2AJ6A 1Y0RA 4U9ZA 5FVJA 5HMNA 3LODA 3QNVA 4QB9A 2RFHA 3P2FA 7CPAA 4UFXA 2DXQA 4UWJA 3R9FA 1FT7A 3RO0A 4C7IA 2EK8A 1XRYA 2OZHA 2PJ3A 4MXUA 5DS0A 3KGQA 3KHZA 2Z3MA 3WABA 3IFEA 3RAMA 2AFWA 2FVGA 4MCQA 2OOTA 4P6YA 4A30A 5K8MA 5G20A 3EO4A 1LRZA 4HKFA 4ZGYB 1Z5RA 5A27A 2R1IA 1R43A 4U5YA 3IWEA 1CPSA 1Q2DA 1FNOA 2NSMA 3FB3A 5BWAB 2JBJA 4KOXA 4XPKA 1XMBA 3IGRA 3BI1A 4R76A 4H2KA 1YW4A 3NFZA 3D68A 1B87A 2I3CA 2Z3OA 3BI0A 3IJ3A 4PXEA 3IO1A 5H84A 3D7DA 2PR8A 2GREA 1Z8XA 2FS5A 3I3GA 3IIBA 5HVHA 2Y0MA 4JWPA 2FIWA 3IWWA 3SXNA 4CYPA 3FJUA 3GKRA 4MY0A 4OIWA 2GLFA 2Q7SA 3IEHA 4FD7A 5LYIA 2BOAA 3S6GA 1H8LA 1EE3P 2P6FA 4E0AA 1DTDA 4OADA 3HUVA 4EMEA 1IICA 3H8GA 4XPDB 1A2ZA 1S7LA 2XEJA 4MMOA 4P45A 4M6GA 2O4HA 2FIAA 1M4GA 2ZEMA 1XF8A 3VARA 4F0YA 4NCZA 4IAVA 4EVYA 2Q7BA 4L8AA 2PIYA 1F57A 1L0CA 3D66A 2CY2A 1RTQA 4ORFA 3PB6X 5AG6A 4IF5A 2Z3PA 3PB8X 4FUUA 3PZJA 4UF4A 4DYOA 4F0XA 1CP6A 2ZEEA 3KKWA 4PXBA 5D29A 2P0WA 3WT4A 3RYOA 4OIDA 3B3WA 4TNUA 1FY7A 4LX9A 1Z4EA 3DDDA 2VZZA 2FL4A 4MI4A 4CPAA 4OC0A 2D4PA 5DWMA 2WPWA 4MHPA 1YK3A 3JUWA 4PV6A 4XPLA 4KUBA 3R1KA 3FECA 4JYWA 3TTHA 5IV0A 2C1CA 1OBRA 1M4LA 3D4UA 2B4BA 3FBUA 3JVNA 1XOVA 2DPTA 4Q7AA 4AVAA 4B14A 2CTBA 4IK2A 4FWUA 1GHEA 1RXTA 4Y49B 3RBUA 3UY5A 4P4JA 2FCKA 4OKOA 1PUAA 1YQEA 1JWQA 2WYRA 1PU9A 3FX6A 4UBRA 2HC9A 3T9YA 4CRYB 2ZELA 2FXFA 1Y0YA 4F8ZA 4CAVA 3CDXA 3SJGA 3FYNA 3DSBA 4FD4A 2AFUA 3DLJA 2G3TA 3NH8A 2F8HA 1CG2A 3MN8A 1CM0A 4JXQA 3D3SA 4O23A 3TC8A 4ZI6A 4KOSA 2V8HA 3S9NA 2QECA 3QAHA 3PBEA 2PJCA 3D8PA 1CPXA 2VXKA 5EC4A 4EFDA 4NGPA 5F49A 3FNCA 4FD6A 4C68A 4KOTA 4ZX9A 4KVXA 1YW6A 3SXOA 4BBHA 1IB1E 2AFZA 5CPAA 2H5MA 5LYDA 3GIUA 4CAEA 1TF8A 4Q36A 3S6HA 1V0CA 3R9GA 2GLJA 3TO7A 4CGNA 1LAPA 4ONWA 1AMPA 4ZYQA 5J8CA 4LQ6A 1I21A 4QUSA 4B6ZA 2VEZA 4UCPA 5C82A 2G3AA 4UCMA 1QSNA 2R7HA 4A95A 2JEWA 1IYLA 2HB6A 1YX0A 4TWEA 5LRJA 3W6XA 4CGOA 1VHSA 2EBJA 4NJQA 3F8KA 1XE4A 2Q4ZA 2VBQA 2FE7A 2Q04A 2ZEFA 3ISXA 4ONUA 4P4FA 4ZY0A 3TE4A 4CAWA 3BJ7A 2F7VA 4ZBGA 4R9MA 4P4IA 4A94A 1BOBA 1P0HA 2ZENA 3FF3A 4H6ZA 4L89A 4NGMA 3D2PA 1WWZA 5KTAA 1IYKA 4LQGA 5LRGA 2CIJA 3L2NA 4KORA 3PB4X 4H6UA 2CNTA 5I0CA 2JBKA 4LUAA 3FRMA
chains in the Genus database with same CATH topology
4E8OA 5CNPA 4HNXB 3FIXA 2BL1A 2Q0YA 1XIXA 4E2AA 2JEVA 4CAXA 1M44A 5F46A 4B12A 2B5GB 1Y9WA 4QVTA 2WSAA 2P6EA 4XNHB 3VWEA 4PSWA 1S5KA 1KZFA 1YR0A 4A33A 3CXQA 4B10A 4MFQA 1M4IA 4KVME 2YNEA 4UFVA 2EVNA 3A9LA 5KTCA 3F0AA 1QSTA 1BO4A 1UFHA 1M1DA 5E96A 2GIVA 3I9SA 2R8VA 4A2ZA 4U9YA 2QMLA 2HQYA 5DWNA 4UWIA 4H89A 4CYOA 3S6FA 1K4JA 4A31A 1Q2YA 5EBVA 3E0KA 3ZZIA 4AB7A 1XEBA 2C27A 2YNDA 2YNCA 1WK4A 3G8WA 2R98A 1YVOA 3C26A 1MJ9A 4C7HA 2Z3KA 2OZGA 2ZW6A 4KSAA 4CYQA 3D2MA 5G21A 5JQ4A 3NE7A 4OLLA 1R57A 5G1ZA 2PSWA 4NF1A 2PC1A 2PR1A 5AG5A 5A28A 2OB0A 4KVOE 3EY5A 4KS9A 1Y9KA 3WR7A 2JDCA 2FT0A 2D4OA 5AGEA 3TFYA 4FD5A 2JDDA 2CXAA 2VI7A 3GYAA 2EUIA 5ISVA 1XMTA 4R3LA 1KUXA 2J8MA 1NMTA 3K9UA 4YGOA 4CS0B 1OZPA 4CYNA 2X7BA 3G3SA 4PK2A 2VQYA 4C2YA 3FXTA 2HUZA 4KOYA 3JTKA 4KLWA 2ZW7A 2B3UA 3EC4A 4XPDC 1YREA 3TO9A 2RC4A 1SQHA 4GS4A 2PRBA 2OH1A 1J4JA 1S7NA 5HH1A 5IX3A 1IIDA 4B13A 2Q4VA 4NEXA 1N71A 2B4DB 2Q44A 1Z9UA 4KSFA 4JJXA 5C88A 2HV2A 4MJ8A 2J8NA 2WUUA 1Q2CA 2ZPAA 2K5TA 1B6BA 3TCVA 2WPXA 4Q38A 5IB0A 2ZW4A 2A4NA 3ZJ0A 1RO5A 3R9EA 3B8GA 3F5BA 4MHDA 4M85A 2JLMA 4Y49C 3SHPA 2Z11A 2FSRA 4CRZB 4KUAA 2CNSA 2Z0ZA 4J3GA 4F6AA 4IUSA 3BLNA 3IWGA 4A32A 4AVCA 2B4DA 5G22A 2J8RA 4KOUA 4MFLA 4PK3A 4QC6A 4B5PB 4HNWB 4UFWA 4RS2A 4MFKA 1QSRA 2I79A 5F48A 2QIRA 2Q4YA 3N7ZA 2YGWA 3CXSA 5H86A 1MJBA 2PQ8A 3MGDA 2REEA 5KTDA 2DPSA 5AG7A 1S7FA 3PGPA 2G0BA 1VKCA 2B5GA 2I00A 4OAEA 4CGPA 3T90A 4MFJA 5J8FA 3GY9A 2BUEA 2REFA 4K30A 2F5IA 2Z10A 2AE6A 3TT2A 1I12A 2CNMA 4UA3A 4C2XA 3PP9A 1Z4RA 3CXPA 3BJ8A 3TOBA 2GANA 4M3SA 2ZW5A 3H5ZA 4B5PA 1TIQA 4CGMA 2B58A 3H4QA 4BMHA 4R57A 4MY3A 1S7KA 4JD6A 4AG9A 3W6SA 4YRHA 2ARHA 4XNHC 2O28A 1ZO0A 4KZTA 4I49A 2OU2A 4MBUA 1YLEA 2YNCC 2BEIA 1KUYA 3W91A 4RI1A 4II9A 3EXNA 4YFJA 4R87A 3EFAA 1YVKA 1ON0A 3S6KA 4B5OA 4NXYA 4JXRA 3R95A 3QB8A 4NSQA 1YGHA 3DR6A 4KOWA 1NSLA 5F47A 4KLVA 3DR8A 4AG7A 1U6MA 1S60A 2B3VA 3R96A 2VZYA 4CAFA 2ZXVA 5AG4A 3IU1A 2NMTA 3VWDA 2P6GA 3TOAA 2ATRA 2GE3A 4B11A 2OZUA 1NE9A 3LD2A 1Y7RA 4DNCA 1M4DA 4KOVA 4UCNA 3P2HA 1I1DA 1QSMA 4AVBA 2IL4A 1MJAA 1P4NA 4MFZA 2Z3NA 2PDOA 4CGLA 1KUVA 5JPHA 4HNYB 4C2ZA 1CJWA 4JLYA 2BSWA 4X5KA 3OWCA 3DNSA 4PSXA 3IU2A 1MK4A 4R3KA 5GCNA 2KCWA 4MFPA 1QSOA 1S3ZA 2Z3LA 3TO6A 4QBJA 3V8IA 2AJ6A 4U9ZA 5FVJA 5HMNA 3LODA 4QB9A 3P2FA 4UFXA 2DXQA 4UWJA 3R9FA 4C7IA 2OZHA 2Z3MA 4A30A 5G20A 3EO4A 1LRZA 4HKFA 4ZGYB 5A27A 2R1IA 4U5YA 3IWEA 1Q2DA 3FB3A 5BWAB 4KOXA 4XPKA 3IGRA 1B87A 2Z3OA 5H84A 2PR8A 2FS5A 3I3GA 2Y0MA 4JWPA 2FIWA 3SXNA 4CYPA 3GKRA 4MY0A 4FD7A 3S6GA 2P6FA 4E0AA 4OADA 1IICA 4XPDB 1S7LA 2FIAA 1M4GA 1XF8A 4F0YA 4NCZA 4EVYA 2Q7BA 4L8AA 1L0CA 4ORFA 2CY2A 5AG6A 4IF5A 2Z3PA 3PZJA 4F0XA 3KKWA 2P0WA 3RYOA 1FY7A 4LX9A 1Z4EA 3DDDA 2VZZA 2FL4A 4MI4A 2D4PA 5DWMA 2WPWA 1YK3A 3JUWA 4PV6A 4XPLA 4KUBA 3R1KA 3TTHA 5IV0A 3JVNA 3FBUA 2B4BA 4B14A 2DPTA 4AVAA 1GHEA 1RXTA 4Y49B 3UY5A 2FCKA 1PUAA 1PU9A 4UBRA 3T9YA 4CRYB 2FXFA 4CAVA 3FYNA 3DSBA 4FD4A 2G3TA 1CM0A 4JXQA 3D3SA 4KOSA 2QECA 3QAHA 3D8PA 2VXKA 5EC4A 5F49A 3FNCA 4FD6A 4C68A 4KOTA 4KVXA 3SXOA 4BBHA 1IB1E 2H5MA 4CAEA 4Q36A 3S6HA 1V0CA 3R9GA 3TO7A 4CGNA 5J8CA 1I21A 4QUSA 5C82A 2VEZA 4UCPA 2G3AA 4UCMA 1QSNA 2R7HA 4A95A 1IYLA 1YX0A 3W6XA 4CGOA 1VHSA 3F8KA 1XE4A 2VBQA 2FE7A 2Q04A 4ONUA 3TE4A 4CAWA 3BJ7A 4ZBGA 4R9MA 1BOBA 1P0HA 4H6ZA 4L89A 3D2PA 1WWZA 5KTAA 1IYKA 4KORA 5I0CA 4H6UA 2CNTA 4LUAA 3FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E8O A;  5CNP A;  4HNX B;  3FIX A;  2BL1 A;  2Q0Y A;  1XIX A;  4E2A A;  2JEV A;  4CAX A;  1M44 A;  5F46 A;  2B5G B;  1Y9W A;  4QVT A;  2P6E A;  4XNH B;  3VWE A;  4PSW A;  1S5K A;  1KZF A;  1YR0 A;  3CXQ A;  1M4I A;  4KVM E;  2EVN A;  5KTC A;  3F0A A;  1QST A;  1BO4 A;  1UFH A;  1M1D A;  5E96 A;  2GIV A;  3I9S A;  2R8V A;  4U9Y A;  2QML A;  2HQY A;  5DWN A;  4UWI A;  4H89 A;  3S6F A;  1K4J A;  1Q2Y A;  5EBV A;  3E0K A;  3ZZI A;  4AB7 A;  1XEB A;  2C27 A;  1WK4 A;  3G8W A;  2R98 A;  1YVO A;  3C26 A;  1MJ9 A;  2OZG A;  2ZW6 A;  3D2M A;  5JQ4 A;  3NE7 A;  4OLL A;  1R57 A;  2PSW A;  4NF1 A;  2PC1 A;  2PR1 A;  2OB0 A;  4KVO E;  3EY5 A;  3WR7 A;  1Y9K A;  2JDC A;  2FT0 A;  2D4O A;  3TFY A;  4FD5 A;  2JDD A;  3GYA A;  2VI7 A;  2EUI A;  5ISV A;  1XMT A;  4R3L A;  1KUX A;  2J8M A;  1NMT A;  3K9U A;  4YGO A;  4CS0 B;  1OZP A;  2X7B A;  3G3S A;  4PK2 A;  2VQY A;  3FXT A;  2HUZ A;  4KOY A;  4KLW A;  2ZW7 A;  2B3U A;  3EC4 A;  4XPD C;  1YRE A;  3TO9 A;  2RC4 A;  1SQH A;  4GS4 A;  2PRB A;  2OH1 A;  1J4J A;  1S7N A;  5HH1 A;  5IX3 A;  1IID A;  2Q4V A;  4NEX A;  1N71 A;  2B4D B;  2Q44 A;  1Z9U A;  4JJX A;  5C88 A;  2HV2 A;  4MJ8 A;  2J8N A;  2ZPA A;  1Q2C A;  2K5T A;  1B6B A;  3TCV A;  2WPX A;  5IB0 A;  2ZW4 A;  2A4N A;  3ZJ0 A;  1RO5 A;  3R9E A;  3B8G A;  3F5B A;  4MHD A;  4M85 A;  2JLM A;  4Y49 C;  3SHP A;  2Z11 A;  2FSR A;  4CRZ B;  4KUA A;  2CNS A;  2Z0Z A;  4J3G A;  4F6A A;  4IUS A;  3BLN A;  3IWG A;  4AVC A;  2B4D A;  2J8R A;  4KOU A;  4PK3 A;  4QC6 A;  4B5P B;  4HNW B;  4RS2 A;  1QSR A;  2I79 A;  5F48 A;  2QIR A;  2Q4Y A;  3N7Z A;  3CXS A;  5H86 A;  1MJB A;  2PQ8 A;  3MGD A;  2REE A;  5KTD A;  1S7F A;  3PGP A;  2G0B A;  1VKC A;  2B5G A;  2I00 A;  4OAE A;  3T90 A;  5J8F A;  3GY9 A;  2BUE A;  2REF A;  4K30 A;  2F5I A;  2Z10 A;  2AE6 A;  3TT2 A;  1I12 A;  2CNM A;  4UA3 A;  3PP9 A;  1Z4R A;  3CXP A;  3BJ8 A;  3TOB A;  2GAN A;  4M3S A;  2ZW5 A;  4B5P A;  1TIQ A;  2B58 A;  3H4Q A;  4BMH A;  4R57 A;  4MY3 A;  1S7K A;  4JD6 A;  4AG9 A;  3W6S A;  4YRH A;  2ARH A;  4XNH C;  2O28 A;  4KZT A;  4I49 A;  2OU2 A;  4MBU A;  1YLE A;  2BEI A;  1KUY A;  3W91 A;  4RI1 A;  4II9 A;  3EXN A;  4YFJ A;  4R87 A;  3EFA A;  1YVK A;  1ON0 A;  3S6K A;  4B5O A;  4NXY A;  4JXR A;  3R95 A;  3QB8 A;  4NSQ A;  1YGH A;  3DR6 A;  4KOW A;  1NSL A;  5F47 A;  4KLV A;  3DR8 A;  4AG7 A;  1U6M A;  1S60 A;  2B3V A;  3R96 A;  2VZY A;  2ZXV A;  2NMT A;  3VWD A;  2P6G A;  3TOA A;  2ATR A;  2GE3 A;  2OZU A;  1NE9 A;  3LD2 A;  1Y7R A;  4DNC A;  1M4D A;  4KOV A;  3P2H A;  1I1D A;  1QSM A;  4AVB A;  2IL4 A;  1MJA A;  1P4N A;  2PDO A;  1KUV A;  5JPH A;  4HNY B;  1CJW A;  4JLY A;  2BSW A;  4X5K A;  3DNS A;  3OWC A;  4PSX A;  1MK4 A;  4R3K A;  5GCN A;  2KCW A;  1QSO A;  1S3Z A;  4QBJ A;  3TO6 A;  3V8I A;  2AJ6 A;  4U9Z A;  5FVJ A;  5HMN A;  3LOD A;  4QB9 A;  3P2F A;  2DXQ A;  4UWJ A;  3R9F A;  2OZH A;  3EO4 A;  1LRZ A;  4HKF A;  2R1I A;  4U5Y A;  1Q2D A;  3FB3 A;  4KOX A;  4XPK A;  3IGR A;  1B87 A;  5H84 A;  2PR8 A;  2FS5 A;  3I3G A;  2Y0M A;  4JWP A;  2FIW A;  3SXN A;  3GKR A;  4MY0 A;  4FD7 A;  3S6G A;  2P6F A;  4E0A A;  4OAD A;  1IIC A;  4XPD B;  1S7L A;  2FIA A;  1M4G A;  1XF8 A;  4F0Y A;  4NCZ A;  4EVY A;  2Q7B A;  4L8A A;  1L0C A;  4ORF A;  2CY2 A;  4IF5 A;  3PZJ A;  3KKW A;  2P0W A;  3RYO A;  1FY7 A;  4LX9 A;  1Z4E A;  3DDD A;  2VZZ A;  2FL4 A;  4MI4 A;  2D4P A;  5DWM A;  2WPW A;  1YK3 A;  3JUW A;  4PV6 A;  4XPL A;  4KUB A;  3R1K A;  3TTH A;  5IV0 A;  3JVN A;  3FBU A;  2B4B A;  4AVA A;  1GHE A;  1RXT A;  4Y49 B;  3UY5 A;  2FCK A;  1PUA A;  1PU9 A;  4UBR A;  3T9Y A;  4CRY B;  2FXF A;  4CAV A;  3FYN A;  3DSB A;  4FD4 A;  2G3T A;  1CM0 A;  4JXQ A;  3D3S A;  4KOS A;  2QEC A;  3QAH A;  3D8P A;  2VXK A;  5EC4 A;  5F49 A;  3FNC A;  4FD6 A;  4KOT A;  4KVX A;  3SXO A;  1IB1 E;  2H5M A;  3S6H A;  1V0C A;  3R9G A;  3TO7 A;  5J8C A;  1I21 A;  4QUS A;  5C82 A;  2VEZ A;  2G3A A;  1QSN A;  2R7H A;  1IYL A;  1YX0 A;  3W6X A;  1VHS A;  3F8K A;  1XE4 A;  2VBQ A;  2FE7 A;  2Q04 A;  4ONU A;  3TE4 A;  4CAW A;  3BJ7 A;  4ZBG A;  4R9M A;  1BOB A;  1P0H A;  4H6Z A;  4L89 A;  3D2P A;  1WWZ A;  5KTA A;  1IYK A;  4KOR A;  5I0C A;  4H6U A;  2CNT A;  4LUA A;  3FRM A; 
#chains in the Genus database with same CATH topology
 4E8O A;  5CNP A;  4HNX B;  2C6G A;  1GYT A;  2PJ6 A;  3FIX A;  3SJX A;  2BL1 A;  2Q0Y A;  1XIX A;  2ZEH A;  1IU8 A;  4E2A A;  2EWB A;  2JEV A;  4NFR A;  4CAX A;  1M44 A;  5F46 A;  3FMC A;  4P4D A;  3FH4 A;  4B12 A;  3CT9 A;  4OC4 A;  2QJ8 A;  2O53 A;  1VIX A;  2B5G B;  1Y9W A;  4ZY2 A;  4QVT A;  2WSA A;  1LAN A;  2P6E A;  4XNH B;  2ZOG A;  3V7Z A;  3VWE A;  4PSW A;  1VHE A;  1IOI A;  1S5K A;  1KZF A;  4NJR A;  1YR0 A;  3VAT A;  4A33 A;  2EK9 A;  3CXQ A;  4B10 A;  4MFQ A;  1M4I A;  4KVM E;  3WC7 A;  5LYF A;  2YNE A;  4UFV A;  4UEE A;  2EO8 A;  2EVN A;  3A9L A;  5KTC A;  3F0A A;  1TF9 A;  2VL1 A;  1QST A;  5HVF A;  1X10 A;  3VH9 A;  5A28 A;  1BO4 A;  1UFH A;  2DEA A;  1M1D A;  5E96 A;  1ZLI A;  2GIV A;  3I9S A;  3SJE A;  1ELM P;  2R8V A;  4A2Z A;  4M6I A;  1Z8T A;  4U9Y A;  2QML A;  3CPX A;  2HQY A;  5DWN A;  1Z2L A;  4UWI A;  4ZY1 A;  4R7M A;  4H89 A;  4CYO A;  2DF5 A;  3S6F A;  3NA6 A;  2BCO A;  1K4J A;  2CF4 A;  1LCP A;  1QQ9 A;  4MHN A;  4W9Y A;  4A31 A;  4OC3 A;  5I4M A;  1Q2Y A;  5EBV A;  2PJA A;  3E0K A;  3ZZI A;  1BPM A;  1XEB A;  4AB7 A;  2IMO A;  2C27 A;  2ZEG A;  1QMU A;  2YND A;  2YNC A;  1WK4 A;  4UEZ A;  3G8W A;  2R98 A;  1YVO A;  1Z8W A;  1CP7 A;  3MRU A;  1LAM A;  1IY7 A;  3C26 A;  4DJL A;  3NE8 A;  1MJ9 A;  4NGS A;  5HXD A;  4C7H A;  2Z3K A;  3SJF A;  5JM6 A;  1ARM A;  2OZG A;  1R3N A;  2ZW6 A;  4KSA A;  4P44 A;  4CYQ A;  3D2M A;  4PXC A;  5G21 A;  5JQ4 A;  4HPS A;  1TKJ A;  3NE7 A;  3GLJ A;  4OLL A;  3S9L A;  1R57 A;  5G1Z A;  2PSW A;  3LAC A;  2PC1 A;  2PR1 A;  1HDQ A;  3N5F A;  3PBB A;  4MHY A;  4NF1 A;  4OP4 A;  5AG5 A;  1ZG7 A;  2OB0 A;  3ISZ A;  3D7H A;  4KVO E;  4MRI A;  2IJZ A;  3EY5 A;  1Y9K A;  4KS9 A;  4P4E A;  2JDC A;  3WR7 A;  4OME A;  2FT0 A;  3HLP A;  1XJO A;  3PB7 X;  5K8P A;  2POK A;  2D4O A;  2ZOF A;  5AGE A;  5K8O A;  2V8V A;  3TFY A;  1HEE A;  4FD5 A;  1XBU A;  2JDD A;  3BHX A;  4Z65 A;  2CXA A;  2VI7 A;  3GYA A;  4K3N A;  1TKF A;  2EUI A;  5ISV A;  1XMT A;  4R3L A;  1KUX A;  2J8M A;  1NMT A;  3K9U A;  4YGO A;  4CS0 B;  1OZP A;  4CYN A;  8CPA A;  3KQX A;  2X7B A;  3PFE A;  3G3S A;  4PK2 A;  2VQY A;  3GUX A;  3H8E A;  4PQA A;  4PXD A;  2GFQ A;  4C2Y A;  1CX8 A;  2C6C A;  3FXT A;  2HUZ A;  4KOY A;  3WC6 A;  3T8W A;  4WWV A;  3WC5 A;  2Q51 A;  3JTK A;  4KLW A;  4UEF A;  4KSI A;  1AUG A;  4YU9 A;  3KL9 A;  5K8N A;  4X8I A;  4R8F A;  2B3U A;  2ZW7 A;  2ODF A;  1JQG A;  3H8F A;  3EC4 A;  3NH4 A;  4XPD C;  1YRE A;  1ZG8 A;  3TO9 A;  2RC4 A;  4F9V A;  3D7F A;  1SQH A;  4GS4 A;  3SI1 A;  3DGV A;  2PRB A;  2OH1 A;  1J4J A;  1S7N A;  5HH1 A;  5IX3 A;  1IID A;  1PCA A;  4B13 A;  2Q4V A;  4NEX A;  1Z8L A;  4NGR A;  1N71 A;  2B4D B;  4ZX8 A;  2Q44 A;  1Z9U A;  4KSF A;  3KHX A;  4JJX A;  3B3T A;  4MCR A;  5C88 A;  2ABZ A;  1ZG9 A;  2HV2 A;  3BXM A;  4UIB A;  4MHZ A;  4MJ8 A;  4NGQ A;  5EMI A;  2J8N A;  1CBX A;  3FVL A;  2PCU A;  1Q2C A;  2WUU A;  2ZPA A;  4X3R A;  2K5T A;  1B6B A;  3PEI A;  3TCV A;  2WPX A;  4Q38 A;  5IB0 A;  4OC1 A;  4MCP A;  2ZW4 A;  1YLO A;  1IGB A;  2XEI A;  5ELY A;  2A4N A;  3ZJ0 A;  5LYL A;  1RO5 A;  3K2K A;  3D67 A;  3R9E A;  3B8G A;  2V77 A;  3F5B A;  1BLL E;  3KR5 A;  4M85 A;  4MHD A;  5F09 A;  1ELL P;  2JLM A;  1F2O A;  3K9T A;  3PRT A;  4Y49 C;  2PVV A;  3SHP A;  2PJ5 A;  5JGF A;  2Z11 A;  5IB9 A;  2FSR A;  4CRZ B;  4RN7 A;  4BIN A;  4FAI A;  4KUA A;  2CNS A;  2Z0Z A;  4J3G A;  4F6A A;  4IUS A;  3BLN A;  3IWG A;  4WJB A;  4A32 A;  4AVC A;  2B4D A;  3GB0 A;  5G22 A;  2BO9 A;  2PJ1 A;  2J8R A;  4A38 A;  1TKH A;  4KOU A;  1F2P A;  4R6T A;  4MFL A;  4PK3 A;  3TX8 A;  4QC6 A;  4AXV A;  4B5P B;  4UIA A;  1XFO A;  4HNW B;  4UFW A;  3FED A;  4RS2 A;  4MFK A;  2PJ8 A;  3RNZ A;  1QSR A;  2XEG A;  4A37 A;  2I79 A;  2PJB A;  5F48 A;  2QIR A;  3B3V A;  2Q4Y A;  3N7Z A;  2YGW A;  3CXS A;  5H86 A;  1MJB A;  2PQ8 A;  3MGD A;  2REE A;  5JH9 A;  5KTD A;  2AFM A;  1IOF A;  2DPS A;  5AG7 A;  1S7F A;  5CBM A;  2Q43 A;  3LMS A;  3PGP A;  4NGN A;  2G0B A;  4G1P A;  1VKC A;  2B5G A;  2I00 A;  2ZEO A;  1VGY A;  1AYE A;  3JRU A;  4OAE A;  3T90 A;  4MFJ A;  4CGP A;  5J8F A;  3GY9 A;  2BUE A;  1NSA A;  2REF A;  4K30 A;  3KQZ A;  2F5I A;  2Z10 A;  4P4B A;  4MCS A;  1TXR A;  2AE6 A;  3V38 A;  3TT2 A;  1I12 A;  2CNM A;  4UA3 A;  3SI0 A;  4YWY A;  2WZN A;  4C2X A;  1YSJ A;  3PP9 A;  1Z4R A;  3CXP A;  3BJ8 A;  3RZA A;  3TOB A;  1ARL A;  2GAN A;  1PYT B;  1ZLH A;  4M3S A;  2ZW5 A;  4PPZ A;  3H5Z A;  4B5P A;  2ZED A;  1TIQ A;  4CGM A;  5THW A;  2B58 A;  3H4Q A;  4BMH A;  4DUK A;  4X2T A;  4R57 A;  3IC1 A;  1S7K A;  4MY3 A;  4JD6 A;  4AG9 A;  2V8G A;  2GU2 A;  3W6S A;  4FBE A;  3KZW A;  2PJ9 A;  3B2Y A;  4YRH A;  2ARH A;  4XNH C;  2O28 A;  4P10 A;  1ZO0 A;  4KZT A;  4I49 A;  2OU2 A;  3QAY A;  1YLE A;  2YNC C;  4MBU A;  2BEI A;  1KUY A;  3PB9 X;  3W91 A;  2AFX A;  2CTC A;  4RI1 A;  3KR4 A;  4II9 A;  3EXN A;  2PRQ A;  3B3S A;  4YFJ A;  2RB7 A;  4R87 A;  3EFA A;  1YVK A;  1ON0 A;  2ANP A;  2QYV A;  3PFO A;  4NXY A;  3S6K A;  4B5O A;  5D8N A;  1VHO A;  3D7G A;  4JXR A;  3R95 A;  2AFO A;  3QB8 A;  4NSQ A;  1YGH A;  3DR6 A;  4KOW A;  1NSL A;  5F47 A;  4NGT A;  4IHM A;  2PIZ A;  4KLV A;  3DR8 A;  3SI2 A;  4AG7 A;  1U6M A;  4RUH A;  1S60 A;  2B3V A;  3R96 A;  2OR4 A;  1BAV A;  2PVW A;  2VZY A;  4CAF A;  2ZXV A;  3KAS A;  2PJ4 A;  4M6H A;  2QVP A;  4OC5 A;  4F9U A;  5AG4 A;  3IU1 A;  2NMT A;  3NH5 A;  3VWD A;  4GXH A;  2P6G A;  1UWY A;  5J1Q A;  3LWU A;  3I1U A;  3CZX A;  3TOA A;  4A39 A;  2ATR A;  2GE3 A;  4BD9 A;  4B11 A;  1LOK A;  2OZU A;  4GM5 A;  2PJ7 A;  1NE9 A;  1Y7E A;  3LD2 A;  1Y7R A;  4EWT A;  4DNC A;  4JZ0 A;  3B7I A;  1M4D A;  4KOV A;  4UCN A;  6CPA A;  3P2H A;  1I1D A;  1QSM A;  4AVB A;  1Q7L A;  2IL4 A;  2IQ6 A;  1MJA A;  1P4N A;  4MFZ A;  2Z3N A;  2C6P A;  2J9A A;  2PDO A;  2G9D A;  3B3C A;  1BPN A;  2V8D A;  4CGL A;  1KUV A;  1X12 A;  2PE3 A;  2NYQ A;  2XEF A;  4HNY B;  1YME A;  4C2Z A;  5JPH A;  5LRK A;  1CJW A;  1HDU A;  3KI9 A;  2BSW A;  2PJ0 A;  2AFS A;  4JLY A;  4X5K A;  3DNS A;  3OWC A;  4PSX A;  3IU2 A;  1LFW A;  2PJ2 A;  1KWM A;  1MK4 A;  3CPA A;  4R3K A;  5GCN A;  5HVG A;  3FEE A;  3S9M A;  2KCW A;  4MFP A;  1QSO A;  3B35 A;  1DE4 C;  1S3Z A;  2Z3L A;  2ZEP A;  3TO6 A;  4OC2 A;  3V8I A;  4QBJ A;  2AJ6 A;  1Y0R A;  4U9Z A;  5FVJ A;  5HMN A;  3LOD A;  3QNV A;  4QB9 A;  2RFH A;  3P2F A;  7CPA A;  4UFX A;  2DXQ A;  4UWJ A;  3R9F A;  1FT7 A;  3RO0 A;  4C7I A;  2EK8 A;  1XRY A;  2OZH A;  2PJ3 A;  4MXU A;  5DS0 A;  3KGQ A;  3KHZ A;  2Z3M A;  3WAB A;  3IFE A;  3RAM A;  2AFW A;  2FVG A;  4MCQ A;  2OOT A;  4P6Y A;  4A30 A;  5K8M A;  5G20 A;  3EO4 A;  1LRZ A;  4HKF A;  4ZGY B;  1Z5R A;  5A27 A;  2R1I A;  1R43 A;  4U5Y A;  3IWE A;  1CPS A;  1Q2D A;  1FNO A;  2NSM A;  3FB3 A;  5BWA B;  2JBJ A;  4KOX A;  4XPK A;  1XMB A;  3IGR A;  3BI1 A;  4R76 A;  4H2K A;  1YW4 A;  3NFZ A;  3D68 A;  1B87 A;  2I3C A;  2Z3O A;  3BI0 A;  3IJ3 A;  4PXE A;  3IO1 A;  5H84 A;  3D7D A;  2PR8 A;  2GRE A;  1Z8X A;  2FS5 A;  3I3G A;  3IIB A;  5HVH A;  2Y0M A;  4JWP A;  2FIW A;  3IWW A;  3SXN A;  4CYP A;  3FJU A;  3GKR A;  4MY0 A;  4OIW A;  2GLF A;  2Q7S A;  3IEH A;  4FD7 A;  5LYI A;  2BOA A;  3S6G A;  1H8L A;  1EE3 P;  2P6F A;  4E0A A;  1DTD A;  4OAD A;  3HUV A;  4EME A;  1IIC A;  3H8G A;  4XPD B;  1A2Z A;  1S7L A;  2XEJ A;  4MMO A;  4P45 A;  4M6G A;  2O4H A;  2FIA A;  1M4G A;  2ZEM A;  1XF8 A;  3VAR A;  4F0Y A;  4NCZ A;  4IAV A;  4EVY A;  2Q7B A;  4L8A A;  2PIY A;  1F57 A;  1L0C A;  3D66 A;  2CY2 A;  1RTQ A;  4ORF A;  3PB6 X;  5AG6 A;  4IF5 A;  2Z3P A;  3PB8 X;  4FUU A;  3PZJ A;  4UF4 A;  4DYO A;  4F0X A;  1CP6 A;  2ZEE A;  3KKW A;  4PXB A;  5D29 A;  2P0W A;  3WT4 A;  3RYO A;  4OID A;  3B3W A;  4TNU A;  1FY7 A;  4LX9 A;  1Z4E A;  3DDD A;  2VZZ A;  2FL4 A;  4MI4 A;  4CPA A;  4OC0 A;  2D4P A;  5DWM A;  2WPW A;  4MHP A;  1YK3 A;  3JUW A;  4PV6 A;  4XPL A;  4KUB A;  3R1K A;  3FEC A;  4JYW A;  3TTH A;  5IV0 A;  2C1C A;  1OBR A;  1M4L A;  3D4U A;  2B4B A;  3FBU A;  3JVN A;  1XOV A;  2DPT A;  4Q7A A;  4AVA A;  4B14 A;  2CTB A;  4IK2 A;  4FWU A;  1GHE A;  1RXT A;  4Y49 B;  3RBU A;  3UY5 A;  4P4J A;  2FCK A;  4OKO A;  1PUA A;  1YQE A;  1JWQ A;  2WYR A;  1PU9 A;  3FX6 A;  4UBR A;  2HC9 A;  3T9Y A;  4CRY B;  2ZEL A;  2FXF A;  1Y0Y A;  4F8Z A;  4CAV A;  3CDX A;  3SJG A;  3FYN A;  3DSB A;  4FD4 A;  2AFU A;  3DLJ A;  2G3T A;  3NH8 A;  2F8H A;  1CG2 A;  3MN8 A;  1CM0 A;  4JXQ A;  3D3S A;  4O23 A;  3TC8 A;  4ZI6 A;  4KOS A;  2V8H A;  3S9N A;  2QEC A;  3QAH A;  3PBE A;  2PJC A;  3D8P A;  1CPX A;  2VXK A;  5EC4 A;  4EFD A;  4NGP A;  5F49 A;  3FNC A;  4FD6 A;  4C68 A;  4KOT A;  4ZX9 A;  4KVX A;  1YW6 A;  3SXO A;  4BBH A;  1IB1 E;  2AFZ A;  5CPA A;  2H5M A;  5LYD A;  3GIU A;  4CAE A;  1TF8 A;  4Q36 A;  3S6H A;  1V0C A;  3R9G A;  2GLJ A;  3TO7 A;  4CGN A;  1LAP A;  4ONW A;  1AMP A;  4ZYQ A;  5J8C A;  4LQ6 A;  1I21 A;  4QUS A;  4B6Z A;  2VEZ A;  4UCP A;  5C82 A;  2G3A A;  4UCM A;  1QSN A;  2R7H A;  4A95 A;  2JEW A;  1IYL A;  2HB6 A;  1YX0 A;  4TWE A;  5LRJ A;  3W6X A;  4CGO A;  1VHS A;  2EBJ A;  4NJQ A;  3F8K A;  1XE4 A;  2Q4Z A;  2VBQ A;  2FE7 A;  2Q04 A;  2ZEF A;  3ISX A;  4ONU A;  4P4F A;  4ZY0 A;  3TE4 A;  4CAW A;  3BJ7 A;  2F7V A;  4ZBG A;  4R9M A;  4P4I A;  4A94 A;  1BOB A;  1P0H A;  2ZEN A;  3FF3 A;  4H6Z A;  4L89 A;  4NGM A;  3D2P A;  1WWZ A;  5KTA A;  1IYK A;  4LQG A;  5LRG A;  2CIJ A;  3L2N A;  4KOR A;  3PB4 X;  4H6U A;  2CNT A;  5I0C A;  2JBK A;  4LUA A;  3FRM A; 
#chains in the Genus database with same CATH homology
 4E8O A;  5CNP A;  4HNX B;  3FIX A;  2BL1 A;  2Q0Y A;  1XIX A;  4E2A A;  2JEV A;  4CAX A;  1M44 A;  5F46 A;  4B12 A;  2B5G B;  1Y9W A;  4QVT A;  2WSA A;  2P6E A;  4XNH B;  3VWE A;  4PSW A;  1S5K A;  1KZF A;  1YR0 A;  4A33 A;  3CXQ A;  4B10 A;  4MFQ A;  1M4I A;  4KVM E;  2YNE A;  4UFV A;  2EVN A;  3A9L A;  5KTC A;  3F0A A;  1QST A;  1BO4 A;  1UFH A;  1M1D A;  5E96 A;  2GIV A;  3I9S A;  2R8V A;  4A2Z A;  4U9Y A;  2QML A;  2HQY A;  5DWN A;  4UWI A;  4H89 A;  4CYO A;  3S6F A;  1K4J A;  4A31 A;  1Q2Y A;  5EBV A;  3E0K A;  3ZZI A;  4AB7 A;  1XEB A;  2C27 A;  2YND A;  2YNC A;  1WK4 A;  3G8W A;  2R98 A;  1YVO A;  3C26 A;  1MJ9 A;  4C7H A;  2Z3K A;  2OZG A;  2ZW6 A;  4KSA A;  4CYQ A;  3D2M A;  5G21 A;  5JQ4 A;  3NE7 A;  4OLL A;  1R57 A;  5G1Z A;  2PSW A;  4NF1 A;  2PC1 A;  2PR1 A;  5AG5 A;  5A28 A;  2OB0 A;  4KVO E;  3EY5 A;  4KS9 A;  1Y9K A;  3WR7 A;  2JDC A;  2FT0 A;  2D4O A;  5AGE A;  3TFY A;  4FD5 A;  2JDD A;  2CXA A;  2VI7 A;  3GYA A;  2EUI A;  5ISV A;  1XMT A;  4R3L A;  1KUX A;  2J8M A;  1NMT A;  3K9U A;  4YGO A;  4CS0 B;  1OZP A;  4CYN A;  2X7B A;  3G3S A;  4PK2 A;  2VQY A;  4C2Y A;  3FXT A;  2HUZ A;  4KOY A;  3JTK A;  4KLW A;  2ZW7 A;  2B3U A;  3EC4 A;  4XPD C;  1YRE A;  3TO9 A;  2RC4 A;  1SQH A;  4GS4 A;  2PRB A;  2OH1 A;  1J4J A;  1S7N A;  5HH1 A;  5IX3 A;  1IID A;  4B13 A;  2Q4V A;  4NEX A;  1N71 A;  2B4D B;  2Q44 A;  1Z9U A;  4KSF A;  4JJX A;  5C88 A;  2HV2 A;  4MJ8 A;  2J8N A;  2WUU A;  1Q2C A;  2ZPA A;  2K5T A;  1B6B A;  3TCV A;  2WPX A;  4Q38 A;  5IB0 A;  2ZW4 A;  2A4N A;  3ZJ0 A;  1RO5 A;  3R9E A;  3B8G A;  3F5B A;  4MHD A;  4M85 A;  2JLM A;  4Y49 C;  3SHP A;  2Z11 A;  2FSR A;  4CRZ B;  4KUA A;  2CNS A;  2Z0Z A;  4J3G A;  4F6A A;  4IUS A;  3BLN A;  3IWG A;  4A32 A;  4AVC A;  2B4D A;  5G22 A;  2J8R A;  4KOU A;  4MFL A;  4PK3 A;  4QC6 A;  4B5P B;  4HNW B;  4UFW A;  4RS2 A;  4MFK A;  1QSR A;  2I79 A;  5F48 A;  2QIR A;  2Q4Y A;  3N7Z A;  2YGW A;  3CXS A;  5H86 A;  1MJB A;  2PQ8 A;  3MGD A;  2REE A;  5KTD A;  2DPS A;  5AG7 A;  1S7F A;  3PGP A;  2G0B A;  1VKC A;  2B5G A;  2I00 A;  4OAE A;  4CGP A;  3T90 A;  4MFJ A;  5J8F A;  3GY9 A;  2BUE A;  2REF A;  4K30 A;  2F5I A;  2Z10 A;  2AE6 A;  3TT2 A;  1I12 A;  2CNM A;  4UA3 A;  4C2X A;  3PP9 A;  1Z4R A;  3CXP A;  3BJ8 A;  3TOB A;  2GAN A;  4M3S A;  2ZW5 A;  3H5Z A;  4B5P A;  1TIQ A;  4CGM A;  2B58 A;  3H4Q A;  4BMH A;  4R57 A;  4MY3 A;  1S7K A;  4JD6 A;  4AG9 A;  3W6S A;  4YRH A;  2ARH A;  4XNH C;  2O28 A;  1ZO0 A;  4KZT A;  4I49 A;  2OU2 A;  4MBU A;  1YLE A;  2YNC C;  2BEI A;  1KUY A;  3W91 A;  4RI1 A;  4II9 A;  3EXN A;  4YFJ A;  4R87 A;  3EFA A;  1YVK A;  1ON0 A;  3S6K A;  4B5O A;  4NXY A;  4JXR A;  3R95 A;  3QB8 A;  4NSQ A;  1YGH A;  3DR6 A;  4KOW A;  1NSL A;  5F47 A;  4KLV A;  3DR8 A;  4AG7 A;  1U6M A;  1S60 A;  2B3V A;  3R96 A;  2VZY A;  4CAF A;  2ZXV A;  5AG4 A;  3IU1 A;  2NMT A;  3VWD A;  2P6G A;  3TOA A;  2ATR A;  2GE3 A;  4B11 A;  2OZU A;  1NE9 A;  3LD2 A;  1Y7R A;  4DNC A;  1M4D A;  4KOV A;  4UCN A;  3P2H A;  1I1D A;  1QSM A;  4AVB A;  2IL4 A;  1MJA A;  1P4N A;  4MFZ A;  2Z3N A;  2PDO A;  4CGL A;  1KUV A;  5JPH A;  4HNY B;  4C2Z A;  1CJW A;  4JLY A;  2BSW A;  4X5K A;  3OWC A;  3DNS A;  4PSX A;  3IU2 A;  1MK4 A;  4R3K A;  5GCN A;  2KCW A;  4MFP A;  1QSO A;  1S3Z A;  2Z3L A;  3TO6 A;  4QBJ A;  3V8I A;  2AJ6 A;  4U9Z A;  5FVJ A;  5HMN A;  3LOD A;  4QB9 A;  3P2F A;  4UFX A;  2DXQ A;  4UWJ A;  3R9F A;  4C7I A;  2OZH A;  2Z3M A;  4A30 A;  5G20 A;  3EO4 A;  1LRZ A;  4HKF A;  4ZGY B;  5A27 A;  2R1I A;  4U5Y A;  3IWE A;  1Q2D A;  3FB3 A;  5BWA B;  4KOX A;  4XPK A;  3IGR A;  1B87 A;  2Z3O A;  5H84 A;  2PR8 A;  2FS5 A;  3I3G A;  2Y0M A;  4JWP A;  2FIW A;  3SXN A;  4CYP A;  3GKR A;  4MY0 A;  4FD7 A;  3S6G A;  2P6F A;  4E0A A;  4OAD A;  1IIC A;  4XPD B;  1S7L A;  2FIA A;  1M4G A;  1XF8 A;  4F0Y A;  4NCZ A;  4EVY A;  2Q7B A;  4L8A A;  1L0C A;  4ORF A;  2CY2 A;  5AG6 A;  4IF5 A;  2Z3P A;  3PZJ A;  4F0X A;  3KKW A;  2P0W A;  3RYO A;  1FY7 A;  4LX9 A;  1Z4E A;  3DDD A;  2VZZ A;  2FL4 A;  4MI4 A;  2D4P A;  5DWM A;  2WPW A;  1YK3 A;  3JUW A;  4PV6 A;  4XPL A;  4KUB A;  3R1K A;  3TTH A;  5IV0 A;  3JVN A;  3FBU A;  2B4B A;  4B14 A;  2DPT A;  4AVA A;  1GHE A;  1RXT A;  4Y49 B;  3UY5 A;  2FCK A;  1PUA A;  1PU9 A;  4UBR A;  3T9Y A;  4CRY B;  2FXF A;  4CAV A;  3FYN A;  3DSB A;  4FD4 A;  2G3T A;  1CM0 A;  4JXQ A;  3D3S A;  4KOS A;  2QEC A;  3QAH A;  3D8P A;  2VXK A;  5EC4 A;  5F49 A;  3FNC A;  4FD6 A;  4C68 A;  4KOT A;  4KVX A;  3SXO A;  4BBH A;  1IB1 E;  2H5M A;  4CAE A;  4Q36 A;  3S6H A;  1V0C A;  3R9G A;  3TO7 A;  4CGN A;  5J8C A;  1I21 A;  4QUS A;  5C82 A;  2VEZ A;  4UCP A;  2G3A A;  4UCM A;  1QSN A;  2R7H A;  4A95 A;  1IYL A;  1YX0 A;  3W6X A;  4CGO A;  1VHS A;  3F8K A;  1XE4 A;  2VBQ A;  2FE7 A;  2Q04 A;  4ONU A;  3TE4 A;  4CAW A;  3BJ7 A;  4ZBG A;  4R9M A;  1BOB A;  1P0H A;  4H6Z A;  4L89 A;  3D2P A;  1WWZ A;  5KTA A;  1IYK A;  4KOR A;  5I0C A;  4H6U A;  2CNT A;  4LUA A;  3FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...