2Q44A

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at1g77540
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At1g77540
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 25
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q44A00
1L0CA 2FCKA 4KOTA 5IV0A 3TE4A 4KORA 4HNWB 4KUAA 1IB1E 4FD6A 3W91A 2B4BA 2K5TA 2J8NA 2FIAA 2BSWA 4KLVA 2A4NA 3W6SA 1YREA 4B5OA 3B8GA 1WWZA 3FBUA 4QB9A 4Y49C 3GKRA 4R9MA 4CAXA 2CNTA 1Q2DA 3LD2A 1Z9UA 4OADA 1Q2YA 3CXPA 2P6EA 4KOSA 3ZZIA 3CXQA 2FE7A 5IB0A 2H5MA 2Y0MA 5IX3A 4MBUA 3D2PA 3OWCA 4PV6A 5C88A 3DR8A 5HMNA 4R3LA 1QSNA 3D2MA 3TCVA 1Z4RA 4AG9A 4OAEA 4NEXA 1YGHA 5DWMA 4XNHC 3PP9A 2IL4A 3TTHA 4PSXA 4NXYA 3S6KA 3TO9A 3NE7A 1N71A 3TO7A 2ZW5A 3R9FA 2B5GA 5ISVA 4JLYA 2AE6A 1XE4A 4EVYA 1GHEA 1KUYA 5J8CA 2GE3A 4CRZB 1CM0A 3W6XA 2Q04A 1M1DA 2JEVA 3P2FA 2ARHA 2G3AA 3F5BA 2PRBA 3IGRA 4AVBA 1YLEA 3FNCA 4PK3A 4F6AA 1S7LA 2R8VA 3PZJA 2B58A 1B6BA 3SXNA 1B87A 2QMLA 2WPWA 1S5KA 5JQ4A 4KOXA 4R3KA 1P0HA 3R1KA 3JUWA 4XNHB 4ZBGA 2VQYA 4U9ZA 2G0BA 1QSTA 5C82A 4JWPA 4K30A 1RO5A 1I12A 2PSWA 2Q44A 1IYKA 4KOYA 4MY3A 5DWNA 4I49A 1ON0A 4YGOA 3VWEA 3BJ7A 2ZW6A 1QSOA 1IICA 4NF1A 2Z10A 4KOVA 4H6ZA 3CXSA 2VZYA 2ATRA 3FB3A 1NE9A 3R9GA 4M85A 4J3GA 4R87A 2REEA 3GYAA 4KUBA 1MJAA 1TIQA 1S7FA 3EO4A 2D4OA 2PDOA 2B3VA 1KUXA 2B4DB 2PQ8A 2QIRA 1BO4A 3FYNA 4FD5A 2R98A 1YK3A 4E2AA 1WK4A 2BL1A 4PSWA 4KVME 4QC6A 2GANA 3S6FA 4L8AA 4II9A 4OLLA 1QSMA 2I00A 3T9YA 2BUEA 4QUSA 4GS4A 4B5PB 3DSBA 2OB0A 3I9SA 1NMTA 4UWJA 2B5GB 3EC4A 5KTAA 2WPXA 3FIXA 2OU2A 3QB8A 1VKCA 2OH1A 4JJXA 4U9YA 1M44A 2OZGA 4LUAA 4AG7A 4CAWA 4KVXA 1PU9A 4BMHA 1MK4A 2VZZA 1VHSA 5KTDA 3C26A 3S6GA 4UA3A 4LX9A 4KZTA 3SXOA 1XMTA 1I21A 1Y7RA 1M4IA 2HUZA 2X7BA 1MJBA 4KOUA 5JPHA 3PGPA 1YX0A 1S60A 5FVJA 5EBVA 3E0KA 3D8PA 3TT2A 4JXRA 2DXQA 4HNXB 4IF5A 3F0AA 5HH1A 5H86A 4DNCA 1Y9WA 3FXTA 4ORFA 4UBRA 3V8IA 4YFJA 2GIVA 2RC4A 4HNYB 2R7HA 3TOBA 2REFA 4H6UA 2Q4VA 2D4PA 2PR8A 4KLWA 3EXNA 2AJ6A 1MJ9A 2O28A 4KOWA 2I79A 1KZFA 2QECA 3F8KA 4PK2A 3H4QA 5E96A 1IYLA 3TFYA 1M4GA 3R95A 3GY9A 1NSLA 3DDDA 4MI4A 2JDDA 4E8OA 4FD7A 1I1DA 1OZPA 2FS5A 1CJWA 4U5YA 2Q0YA 2G3TA 5EC4A 2ZXVA 3ZJ0A 1P4NA 2FIWA 2Q4YA 1KUVA 3TOAA 5F49A 1S7NA 2R1IA 4AB7A 3DNSA 4JD6A 4XPLA 4YRHA 1YR0A 1UFHA 3WR7A 2C27A 1Q2CA 2OZUA 2Z11A 4CAVA 2P6FA 4QVTA 2P0WA 4F0YA 4NCZA 3KKWA 5GCNA 3EFAA 3RYOA 2CY2A 3P2HA 1XF8A 1S7KA 4XPDC 1K4JA 3R9EA 4AVAA 3VWDA 1FY7A 3BJ8A 2ZW7A 1LRZA 2B4DA 3IWGA 5I0CA 2PC1A 1R57A 2JDCA 2VXKA 4KVOE 5KTCA 3S6HA 4MJ8A 1IIDA 2CNMA 1QSRA 2NMTA 2CNSA 4M3SA 3MGDA 5F46A 4MHDA 3K9UA 1Z4EA 3N7ZA 4X5KA 4AVCA 4B5PA 4H89A 2KCWA 3UY5A 2J8MA 2PR1A 5F48A 4Y49B 4XPKA 2VBQA 3LODA 4XPDB 2Z0ZA 4FD4A 2Q7BA 4CS0B 1U6MA 2JLMA 5H84A 1M4DA 3G3SA 4MY0A 5J8FA 1SQHA 2OZHA 1XIXA 1PUAA 3I3GA 1YVKA 2FL4A 3D3SA 2VI7A 3G8WA 2BEIA 4QBJA 3DR6A 3T90A 2FXFA 4L89A 5CNPA 5F47A 3TO6A 4UWIA 3JVNA 2P6GA 1YVOA 4IUSA 2HV2A 2ZW4A 2ZPAA 3R96A 4E0AA 2F5IA 3QAHA 1Y9KA 1V0CA 2FT0A 2VEZA 4R57A 2J8RA 2EUIA 4RS2A 4CRYB 3SHPA 1BOBA 1J4JA 4NSQA 4RI1A 1RXTA 1S3ZA 2B3UA 3EY5A 4JXQA 2FSRA 3BLNA 4HKFA 3FRMA 1XEBA 2HQYA 2EVNA 4ONUA
chains in the Genus database with same CATH superfamily
4ZY2A 5AG4A 5J1QA 1L0CA 1CX8A 2AFUA 2FCKA 4KOTA 5IV0A 1GYTA 3TE4A 4KORA 4HNWB 2QVPA 4KUAA 1HEEA 1IB1E 4FD6A 3W91A 2B4BA 4X8IA 2K5TA 2J8NA 1LFWA 2FIAA 2BSWA 2ZEOA 4KLVA 4P4JA 2A4NA 3W6SA 3KR4A 1YREA 4B5OA 3SI1A 3B8GA 1WWZA 1YW4A 3FBUA 4QB9A 4Y49C 4C2YA 3NH4A 2WZNA 5LYIA 4F9UA 2YNCC 4MCSA 3GKRA 4NGPA 4R9MA 4P4BA 4NGQA 2CNTA 4A39A 4CAXA 4BINA 1Q2DA 5THWA 3LD2A 1Z9UA 4OADA 1R3NA 1ZLIA 1Q2YA 3CXPA 2P6EA 5LRKA 4KOSA 2ZOGA 3WC6A 3ZZIA 3CXQA 2FE7A 5IB0A 2H5MA 5DS0A 2VL1A 1VHOA 2Y0MA 3VATA 4B12A 5IX3A 4F9VA 4MBUA 3D2PA 4LQ6A 3OWCA 3WT4A 4PV6A 3PB4X 4IHMA 4R7MA 3FEDA 5C88A 3DR8A 4UEFA 5HMNA 4FWUA 3IEHA 2PIZA 3B3TA 4GM5A 4R3LA 1QSNA 4ZGYB 4P4IA 3D2MA 4R76A 2PJ1A 4DJLA 2AFMA 3TCVA 2EK9A 2Z3PA 3ISXA 5CPAA 4CAFA 1Z4RA 4NGNA 4AG9A 4OAEA 3FF3A 4NEXA 4YU9A 1YGHA 5DWMA 4XNHC 4CGMA 4RUHA 3GB0A 2Q4ZA 3KHXA 3PP9A 2IL4A 4O23A 3TTHA 5F09A 4PSXA 1XFOA 4NXYA 3S6KA 3TO9A 3NE7A 2Q51A 1N71A 3TO7A 2PVWA 2ZW5A 3R9FA 1ZO0A 3RO0A 3S9NA 4NGRA 3NA6A 2B5GA 5ISVA 3D7HA 4ONWA 4JLYA 1NSAA 5G22A 2AE6A 2OOTA 2PE3A 3PFOA 1XE4A 4MHZA 4EVYA 1GHEA 1KUYA 5J8CA 2GE3A 2HC9A 4CRZB 1CM0A 1ELLP 3W6XA 4UFWA 3D7GA 2Q04A 1M1DA 1LANA 2JEVA 1H8LA 3P2FA 3KZWA 1XRYA 3B3SA 2ARHA 4MCRA 2G3AA 3F5BA 2PRBA 3IGRA 4IAVA 2IMOA 4AVBA 1X12A 1YLEA 3FNCA 4PK3A 4F6AA 4KSIA 1CBXA 1S7LA 2R8VA 3PZJA 2IQ6A 2B58A 3BXMA 4CGPA 1B6BA 4B14A 3SXNA 1B87A 2NSMA 1UWYA 2QMLA 4M6GA 5CBMA 2WPWA 5JH9A 1A2ZA 1ELMP 1S5KA 2V77A 5JQ4A 2PJ3A 3FJUA 4KOXA 4MCPA 4MHPA 1Z8LA 4JYWA 1P0HA 4R3KA 4UIAA 4ZI6A 4RN7A 3R1KA 4W9YA 5LYLA 3JUWA 4ZX9A 4OC4A 4XNHB 1XBUA 4ZBGA 3SI0A 4OIDA 3VARA 1JWQA 2VQYA 2ZEEA 3PFEA 2G0BA 4U9ZA 3BI1A 1HDUA 1QSTA 4MFKA 4B13A 5C82A 1TF9A 4JWPA 3IU2A 4K30A 1DE4C 3NH5A 3RZAA 1RO5A 1I12A 4TNUA 2PSWA 4EWTA 2ZEHA 5AGEA 2Q44A 2AFWA 4MFQA 2Q7SA 1IYKA 4MRIA 3B3WA 4KOYA 4MY3A 4CAEA 2CTBA 2CIJA 2JBKA 3PB9X 5DWNA 4F8ZA 4I49A 1YW6A 1ON0A 2O4HA 4YGOA 3VWEA 3BJ7A 4NGSA 3D4UA 5LYDA 2ZW6A 1QSOA 3GIUA 4KS9A 1ARMA 4PPZA 1IICA 4NF1A 1R43A 2PVVA 4P6YA 2Z10A 4KOVA 4C2XA 5BWAB 4H6ZA 5HXDA 3CXSA 2VZYA 3I1UA 5HVHA 5K8OA 2ZEMA 2ATRA 3FB3A 3D67A 1NE9A 3R9GA 3BHXA 2I3CA 4J3GA 4M85A 5JGFA 4R87A 3A9LA 2PJ0A 2ANPA 2REEA 3GYAA 4KUBA 2ZELA 2O53A 1MJAA 1TIQA 5EMIA 1S7FA 1ZG7A 3EO4A 2D4OA 3IWWA 4NFRA 3JTKA 3PB8X 1CPXA 2PDOA 2B3VA 1KUXA 2B4DB 2PQ8A 2QIRA 2Z3NA 3FECA 3V7ZA 1BO4A 1PCAA 1TF8A 3FVLA 3FYNA 4FD5A 4G1PA 4CYNA 2PRQA 2R98A 1YK3A 4E2AA 5G1ZA 3L2NA 2V8GA 4MHNA 1WK4A 2BL1A 3WABA 4BBHA 4PSWA 1BLLE 3DLJA 3MN8A 4KVME 4QC6A 2GANA 3S6FA 4L8AA 4II9A 4PXBA 4C68A 4CYPA 4OLLA 1QSMA 2I00A 2PJ8A 3T9YA 2BUEA 1IU8A 4QUSA 5ELYA 1F2OA 4ZY0A 2Q43A 2C1CA 1PYTB 3TX8A 4DYOA 4GS4A 3QAYA 4CYQA 4B5PB 3KR5A 4HPSA 3DSBA 4PQAA 2OB0A 3I9SA 3CDXA 2PJ7A 1NMTA 4UWJA 3T8WA 2XEFA 2PJ2A 2B5GB 2G9DA 4B6ZA 1XMBA 1HDQA 3EC4A 3SJEA 4KSFA 3IFEA 1LAPA 2FVGA 1F2PA 1TXRA 5KTAA 5AG6A 4PXEA 1Y7EA 4JZ0A 1Q7LA 2WPXA 4LQGA 4NGTA 1XOVA 5A27A 3FIXA 3H5ZA 2OU2A 2Z3MA 3QB8A 4NJRA 1VKCA 2OH1A 4JJXA 4WJBA 1TKFA 4U9YA 3V38A 1M44A 2OZGA 2GLFA 4LUAA 4Q36A 5G21A 4AG7A 4CAWA 2YGWA 4KVXA 1PU9A 1Z8XA 1MK4A 4BMHA 2VZZA 2EWBA 1BPNA 1VHSA 2F7VA 2QYVA 3C26A 3IO1A 5KTDA 1YSJA 3S6GA 1OBRA 4UA3A 1EE3P 1FT7A 4LX9A 4KZTA 3SXOA 1XMTA 2PJBA 3TC8A 4CGLA 2Z3KA 4IK2A 4R6TA 5IB9A 1I21A 1Y7RA 3GUXA 1M4IA 2HUZA 2X7BA 1MJBA 4KOUA 1QQ9A 4CPAA 5JPHA 3PGPA 4A30A 1YX0A 1S60A 1FNOA 2EK8A 5FVJA 4MFLA 2CTCA 5EBVA 3E0KA 3D8PA 2RB7A 3KQZA 2AFSA 3TT2A 4JXRA 4OC5A 4MFPA 4Q38A 5D8NA 2XEJA 2DXQA 4PXDA 4HNXB 4UCNA 4A31A 4IF5A 3F0AA 4K3NA 5HH1A 5H86A 2POKA 4UEEA 4DNCA 1Y9WA 3FXTA 4ORFA 4A95A 4UBRA 2F8HA 3V8IA 4YFJA 4UCPA 1ZG8A 2GIVA 1DTDA 5A28A 2RC4A 1QMUA 4PXCA 4HNYB 2R7HA 2YNCA 3NE8A 3TOBA 2REFA 2EBJA 2XEGA 4H6UA 2Q4VA 2D4PA 5LRGA 2PR8A 4KLWA 4P4FA 3EXNA 2AJ6A 2GLJA 1MJ9A 2O28A 3LMSA 4KOWA 2I79A 4OC1A 3K2KA 4X2TA 4B11A 4ZYQA 1KZFA 2PJ4A 2QECA 4FBEA 2ABZA 3F8KA 4PK2A 2DPTA 4A38A 3H4QA 5JM6A 5E96A 1IYLA 3TFYA 1M4GA 1VGYA 3R95A 3IIBA 3PEIA 7CPAA 2QJ8A 3D7FA 3GY9A 1NSLA 3DDDA 2C6CA 4MI4A 3KI9A 3PB6X 4NGMA 4R8FA 4A37A 2JDDA 2NYQA 4E8OA 3HLPA 4FD7A 1I1DA 2JEWA 3FMCA 1OZPA 3H8FA 2AFXA 2DPSA 1AUGA 4P10A 4X3RA 1KWMA 3NH8A 2FS5A 2PJCA 4OC3A 3CPXA 1CJWA 1XJOA 3HUVA 4KSAA 1Z5RA 2Q0YA 4U5YA 2CF4A 2G3TA 5EC4A 2PJ6A 2DEAA 3WC5A 2ZXVA 3ZJ0A 4FAIA 4OIWA 1AMPA 1RTQA 1P4NA 6CPAA 2FIWA 3PBEA 2Q4YA 1KUVA 3TOAA 5F49A 1S7NA 2R1IA 4OC0A 1VHEA 3IJ3A 1ZLHA 3DNSA 3KQXA 5D29A 4AB7A 4JD6A 4XPLA 4ZY1A 1JQGA 2OR4A 4UIBA 4YRHA 1YR0A 1UFHA 3WR7A 2C27A 3IU1A 1Q2CA 3FH4A 4DUKA 2OZUA 1Y0RA 2Z11A 2V8DA 4CAVA 2P6FA 4QVTA 2DF5A 2P0WA 4F0YA 3LWUA 3KGQA 1CPSA 4NCZA 3KKWA 5G20A 5GCNA 3PB7X 2YNEA 3EFAA 4UF4A 3S9MA 3K9TA 4OKOA 3RYOA 2CY2A 2PJAA 1XF8A 3DGVA 1IGBA 1S7KA 3P2HA 4FUUA 4XPDC 4OC2A 1VIXA 1K4JA 3R9EA 3CT9A 4AVAA 3H8GA 1ARLA 2ZENA 3VWDA 2ODFA 4GXHA 2C6GA 1FY7A 5HVGA 3ISZA 3WC7A 2XEIA 3BJ8A 3RBUA 1LOKA 2HB6A 3FEEA 3VH9A 1Z8TA 3D66A 3N5FA 5LYFA 4M6HA 2ZW7A 4CYOA 1CP7A 3GLJA 3S9LA 1LRZA 3CPAA 4B10A 2B4DA 3IWGA 5I0CA 2PC1A 2WYRA 1R57A 2JDCA 2VXKA 1LCPA 4KVOE 4OP4A 5K8MA 5KTCA 4F0XA 3S6HA 2BO9A 4UEZA 2WUUA 4A94A 4MJ8A 3SJGA 1IIDA 3NFZA 2CNMA 2C6PA 1QSRA 3IWEA 2NMTA 8CPAA 2CNSA 4M3SA 4EFDA 3MGDA 1CG2A 2ZEFA 3IC1A 5F46A 4MHDA 3K9UA 3SI2A 4UCMA 1Z4EA 1Z8WA 3N7ZA 2PJ5A 4Q7AA 4X5KA 1YQEA 4AVCA 3KASA 4B5PA 4H89A 2KCWA 4C7IA 1IOFA 3UY5A 2J8MA 2PR1A 5F48A 4Y49B 4XPKA 4MCQA 2WSAA 2J9AA 2VBQA 2Z3OA 3LODA 3RNZA 2CXAA 4XPDB 2Z0ZA 3B3CA 2Z3LA 4FD4A 2BOAA 3MRUA 2Q7BA 3D68A 3H8EA 4CS0B 1U6MA 2JLMA 4P45A 5H84A 1CP6A 1M4DA 3G3SA 4MY0A 4C2ZA 3CZXA 1SQHA 4WWVA 4A32A 4AXVA 5J8FA 3SJFA 4MXUA 1LAMA 2OZHA 4UFVA 5LRJA 1XIXA 5K8PA 1IY7A 4OMEA 3B3VA 4M6IA 2GREA 3B2YA 3PRTA 5HVFA 4EMEA 1PUAA 3I3GA 4MFJA 1YVKA 2FL4A 2PCUA 3D3SA 2EO8A 3B35A 1TKHA 2VI7A 5AG7A 4A2ZA 2ZEDA 5I4MA 1ZG9A 2GFQA 3G8WA 2BEIA 4MMOA 3PBBA 4QBJA 1IOIA 3DR6A 4MHYA 3T90A 2FXFA 4L89A 2AFOA 5CNPA 5F47A 3TO6A 5K8NA 3D7DA 4UWIA 3JVNA 2P6GA 4ZX8A 3BI0A 3QNVA 2JBJA 3JRUA 3RAMA 1YVOA 2ZEGA 4IUSA 4P44A 2HV2A 4TWEA 2ZW4A 4MFZA 4P4EA 4A33A 2PIYA 2ZPAA 3R96A 2V8HA 1YMEA 2F5IA 2PJ9A 3QAHA 4E0AA 1Y9KA 1M4LA 1V0CA 2BCOA 2FT0A 2IJZA 2V8VA 2YNDA 3KL9A 2AFZA 4NJQA 2VEZA 4R57A 2GU2A 2J8RA 1Z2LA 4UFXA 1Y0YA 2ZEPA 3SJXA 4BD9A 2EUIA 4Z65A 4RS2A 3LACA 5AG5A 4CGNA 4CGOA 4CRYB 4P4DA 3SHPA 2ZOFA 1BAVA 1BOBA 4H2KA 1J4JA 4YWYA 4NSQA 4RI1A 1RXTA 1S3ZA 1TKJA 2B3UA 2RFHA 3FX6A 3EY5A 2FSRA 3BLNA 4JXQA 1YLOA 1BPMA 1AYEA 4HKFA 1F57A 1X10A 3FRMA 4C7HA 3B7IA 3KHZA 1XEBA 2HQYA 2EVNA 4ONUA
chains in the Genus database with same CATH topology
5AG4A 1L0CA 2FCKA 4KOTA 5IV0A 3TE4A 4KORA 4HNWB 4KUAA 1IB1E 4FD6A 3W91A 2B4BA 2K5TA 2J8NA 2FIAA 2BSWA 4KLVA 2A4NA 3W6SA 1YREA 4B5OA 3B8GA 1WWZA 3FBUA 4QB9A 4Y49C 4C2YA 2YNCC 3GKRA 4R9MA 4CAXA 2CNTA 1Q2DA 3LD2A 1Z9UA 4OADA 1Q2YA 3CXPA 2P6EA 4KOSA 3ZZIA 3CXQA 2FE7A 5IB0A 2H5MA 2Y0MA 4B12A 5IX3A 4MBUA 3D2PA 3OWCA 4PV6A 5C88A 3DR8A 5HMNA 4R3LA 1QSNA 4ZGYB 3D2MA 3TCVA 2Z3PA 4CAFA 1Z4RA 4AG9A 4OAEA 4NEXA 1YGHA 5DWMA 4XNHC 4CGMA 3PP9A 2IL4A 3TTHA 4PSXA 4NXYA 3S6KA 3TO9A 3NE7A 1N71A 3TO7A 2ZW5A 3R9FA 1ZO0A 2B5GA 5ISVA 4JLYA 5G22A 2AE6A 1XE4A 4EVYA 1GHEA 1KUYA 5J8CA 2GE3A 4CRZB 1CM0A 3W6XA 4UFWA 2Q04A 1M1DA 2JEVA 3P2FA 2ARHA 2G3AA 3F5BA 2PRBA 3IGRA 4AVBA 1YLEA 3FNCA 4PK3A 4F6AA 1S7LA 2R8VA 3PZJA 2B58A 4CGPA 1B6BA 4B14A 3SXNA 1B87A 2QMLA 2WPWA 1S5KA 5JQ4A 4KOXA 4R3KA 1P0HA 3R1KA 3JUWA 4XNHB 4ZBGA 2VQYA 4U9ZA 2G0BA 4MFKA 1QSTA 4B13A 5C82A 4JWPA 3IU2A 4K30A 1RO5A 1I12A 2PSWA 5AGEA 2Q44A 4MFQA 1IYKA 4KOYA 4MY3A 4CAEA 5DWNA 4I49A 1ON0A 4YGOA 3VWEA 3BJ7A 2ZW6A 1QSOA 4KS9A 1IICA 4NF1A 2Z10A 4KOVA 4C2XA 5BWAB 4H6ZA 3CXSA 2VZYA 2ATRA 3FB3A 1NE9A 3R9GA 4M85A 4J3GA 4R87A 3A9LA 2REEA 3GYAA 4KUBA 1MJAA 1TIQA 1S7FA 3EO4A 2D4OA 3JTKA 2PDOA 2Z3NA 2B3VA 1KUXA 2B4DB 2PQ8A 2QIRA 1BO4A 3FYNA 4FD5A 4CYNA 2R98A 1YK3A 4E2AA 5G1ZA 1WK4A 2BL1A 4BBHA 4PSWA 4KVME 4QC6A 2GANA 3S6FA 4L8AA 4II9A 4C68A 4CYPA 4OLLA 1QSMA 2I00A 3T9YA 2BUEA 4QUSA 4GS4A 4CYQA 4B5PB 3DSBA 2OB0A 3I9SA 1NMTA 4UWJA 2B5GB 3EC4A 4KSFA 5KTAA 5AG6A 2WPXA 5A27A 3FIXA 3H5ZA 2OU2A 2Z3MA 3QB8A 1VKCA 2OH1A 4JJXA 4U9YA 1M44A 2OZGA 4Q36A 4LUAA 5G21A 4AG7A 4CAWA 2YGWA 4KVXA 1PU9A 4BMHA 1MK4A 2VZZA 1VHSA 5KTDA 3C26A 3S6GA 4UA3A 4LX9A 4KZTA 3SXOA 1XMTA 4CGLA 2Z3KA 1I21A 1Y7RA 1M4IA 2HUZA 2X7BA 1MJBA 4KOUA 5JPHA 3PGPA 4A30A 1YX0A 1S60A 5FVJA 4MFLA 5EBVA 3E0KA 3D8PA 3TT2A 4JXRA 4MFPA 4Q38A 2DXQA 4HNXB 4UCNA 4A31A 4IF5A 3F0AA 5HH1A 5H86A 4DNCA 1Y9WA 3FXTA 4ORFA 4A95A 4UBRA 3V8IA 4YFJA 4UCPA 2GIVA 5A28A 2RC4A 4HNYB 2R7HA 2YNCA 3TOBA 2REFA 4H6UA 2Q4VA 2D4PA 2PR8A 4KLWA 3EXNA 2AJ6A 1MJ9A 2O28A 4KOWA 2I79A 4B11A 1KZFA 2QECA 3F8KA 4PK2A 2DPTA 3H4QA 5E96A 1IYLA 3TFYA 1M4GA 3R95A 3GY9A 1NSLA 3DDDA 4MI4A 2JDDA 4E8OA 4FD7A 1I1DA 1OZPA 2DPSA 2FS5A 1CJWA 4KSAA 4U5YA 2Q0YA 2G3TA 5EC4A 2ZXVA 3ZJ0A 1P4NA 2FIWA 2Q4YA 1KUVA 3TOAA 5F49A 1S7NA 2R1IA 4AB7A 3DNSA 4JD6A 4XPLA 4YRHA 1YR0A 1UFHA 3WR7A 2C27A 3IU1A 1Q2CA 2OZUA 2Z11A 4CAVA 2P6FA 4QVTA 2P0WA 4F0YA 4NCZA 3KKWA 5G20A 5GCNA 2YNEA 3EFAA 3RYOA 2CY2A 3P2HA 1XF8A 1S7KA 4XPDC 1K4JA 3R9EA 4AVAA 3VWDA 1FY7A 3BJ8A 2ZW7A 4CYOA 1LRZA 4B10A 2B4DA 3IWGA 5I0CA 2PC1A 1R57A 2JDCA 2VXKA 4KVOE 5KTCA 4F0XA 3S6HA 2WUUA 4MJ8A 1IIDA 2CNMA 1QSRA 3IWEA 2NMTA 2CNSA 4M3SA 3MGDA 5F46A 4MHDA 3K9UA 4UCMA 1Z4EA 3N7ZA 4X5KA 4AVCA 4B5PA 4H89A 2KCWA 4C7IA 3UY5A 2J8MA 2PR1A 5F48A 4Y49B 4XPKA 2WSAA 2VBQA 2Z3OA 3LODA 2CXAA 4XPDB 2Z0ZA 2Z3LA 4FD4A 2Q7BA 4CS0B 1U6MA 2JLMA 5H84A 1M4DA 3G3SA 4C2ZA 4MY0A 5J8FA 1SQHA 4A32A 2OZHA 4UFVA 1XIXA 1PUAA 3I3GA 4MFJA 1YVKA 2FL4A 3D3SA 5AG7A 2VI7A 4A2ZA 3G8WA 2BEIA 4QBJA 3DR6A 3T90A 2FXFA 4L89A 5CNPA 5F47A 3TO6A 4UWIA 3JVNA 2P6GA 1YVOA 4IUSA 2HV2A 2ZW4A 4MFZA 4A33A 2ZPAA 3R96A 4E0AA 2F5IA 3QAHA 1Y9KA 1V0CA 2FT0A 2YNDA 2VEZA 4R57A 4UFXA 2J8RA 2EUIA 4RS2A 5AG5A 4CGNA 4CGOA 4CRYB 3SHPA 1BOBA 1J4JA 4NSQA 4RI1A 1RXTA 1S3ZA 2B3UA 3EY5A 4JXQA 2FSRA 3BLNA 4HKFA 3FRMA 4C7HA 1XEBA 2HQYA 2EVNA 4ONUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0C A;  2FCK A;  4KOT A;  5IV0 A;  3TE4 A;  4KOR A;  4HNW B;  4KUA A;  1IB1 E;  4FD6 A;  3W91 A;  2B4B A;  2K5T A;  2J8N A;  2FIA A;  2BSW A;  4KLV A;  2A4N A;  3W6S A;  1YRE A;  4B5O A;  3B8G A;  1WWZ A;  3FBU A;  4QB9 A;  4Y49 C;  3GKR A;  4R9M A;  4CAX A;  2CNT A;  1Q2D A;  3LD2 A;  1Z9U A;  4OAD A;  1Q2Y A;  3CXP A;  2P6E A;  4KOS A;  3ZZI A;  3CXQ A;  2FE7 A;  5IB0 A;  2H5M A;  2Y0M A;  5IX3 A;  4MBU A;  3D2P A;  3OWC A;  4PV6 A;  5C88 A;  3DR8 A;  5HMN A;  4R3L A;  1QSN A;  3D2M A;  3TCV A;  1Z4R A;  4AG9 A;  4OAE A;  4NEX A;  1YGH A;  5DWM A;  4XNH C;  3PP9 A;  2IL4 A;  3TTH A;  4PSX A;  4NXY A;  3S6K A;  3TO9 A;  3NE7 A;  1N71 A;  3TO7 A;  2ZW5 A;  3R9F A;  2B5G A;  5ISV A;  4JLY A;  2AE6 A;  1XE4 A;  4EVY A;  1GHE A;  1KUY A;  5J8C A;  2GE3 A;  4CRZ B;  1CM0 A;  3W6X A;  2Q04 A;  1M1D A;  2JEV A;  3P2F A;  2ARH A;  2G3A A;  3F5B A;  2PRB A;  3IGR A;  4AVB A;  1YLE A;  3FNC A;  4PK3 A;  4F6A A;  1S7L A;  2R8V A;  3PZJ A;  2B58 A;  1B6B A;  3SXN A;  1B87 A;  2QML A;  2WPW A;  1S5K A;  5JQ4 A;  4KOX A;  4R3K A;  1P0H A;  3R1K A;  3JUW A;  4XNH B;  4ZBG A;  2VQY A;  4U9Z A;  2G0B A;  1QST A;  5C82 A;  4JWP A;  4K30 A;  1RO5 A;  1I12 A;  2PSW A;  2Q44 A;  1IYK A;  4KOY A;  4MY3 A;  5DWN A;  4I49 A;  1ON0 A;  4YGO A;  3VWE A;  3BJ7 A;  2ZW6 A;  1QSO A;  1IIC A;  4NF1 A;  2Z10 A;  4KOV A;  4H6Z A;  3CXS A;  2VZY A;  2ATR A;  3FB3 A;  1NE9 A;  3R9G A;  4M85 A;  4J3G A;  4R87 A;  2REE A;  3GYA A;  4KUB A;  1MJA A;  1TIQ A;  1S7F A;  3EO4 A;  2D4O A;  2PDO A;  2B3V A;  1KUX A;  2B4D B;  2PQ8 A;  2QIR A;  1BO4 A;  3FYN A;  4FD5 A;  2R98 A;  1YK3 A;  4E2A A;  1WK4 A;  2BL1 A;  4PSW A;  4KVM E;  4QC6 A;  2GAN A;  3S6F A;  4L8A A;  4II9 A;  4OLL A;  1QSM A;  2I00 A;  3T9Y A;  2BUE A;  4QUS A;  4GS4 A;  4B5P B;  3DSB A;  2OB0 A;  3I9S A;  1NMT A;  4UWJ A;  2B5G B;  3EC4 A;  5KTA A;  2WPX A;  3FIX A;  2OU2 A;  3QB8 A;  1VKC A;  2OH1 A;  4JJX A;  4U9Y A;  1M44 A;  2OZG A;  4LUA A;  4AG7 A;  4CAW A;  4KVX A;  1PU9 A;  4BMH A;  1MK4 A;  2VZZ A;  1VHS A;  5KTD A;  3C26 A;  3S6G A;  4UA3 A;  4LX9 A;  4KZT A;  3SXO A;  1XMT A;  1I21 A;  1Y7R A;  1M4I A;  2HUZ A;  2X7B A;  1MJB A;  4KOU A;  5JPH A;  3PGP A;  1YX0 A;  1S60 A;  5FVJ A;  5EBV A;  3E0K A;  3D8P A;  3TT2 A;  4JXR A;  2DXQ A;  4HNX B;  4IF5 A;  3F0A A;  5HH1 A;  5H86 A;  4DNC A;  1Y9W A;  3FXT A;  4ORF A;  4UBR A;  3V8I A;  4YFJ A;  2GIV A;  2RC4 A;  4HNY B;  2R7H A;  3TOB A;  2REF A;  4H6U A;  2Q4V A;  2D4P A;  2PR8 A;  4KLW A;  3EXN A;  2AJ6 A;  1MJ9 A;  2O28 A;  4KOW A;  2I79 A;  1KZF A;  2QEC A;  3F8K A;  4PK2 A;  3H4Q A;  5E96 A;  1IYL A;  3TFY A;  1M4G A;  3R95 A;  3GY9 A;  1NSL A;  3DDD A;  4MI4 A;  2JDD A;  4E8O A;  4FD7 A;  1I1D A;  1OZP A;  2FS5 A;  1CJW A;  4U5Y A;  2Q0Y A;  2G3T A;  5EC4 A;  2ZXV A;  3ZJ0 A;  1P4N A;  2FIW A;  2Q4Y A;  1KUV A;  3TOA A;  5F49 A;  1S7N A;  2R1I A;  4AB7 A;  3DNS A;  4JD6 A;  4XPL A;  4YRH A;  1YR0 A;  1UFH A;  3WR7 A;  2C27 A;  1Q2C A;  2OZU A;  2Z11 A;  4CAV A;  2P6F A;  4QVT A;  2P0W A;  4F0Y A;  4NCZ A;  3KKW A;  5GCN A;  3EFA A;  3RYO A;  2CY2 A;  3P2H A;  1XF8 A;  1S7K A;  4XPD C;  1K4J A;  3R9E A;  4AVA A;  3VWD A;  1FY7 A;  3BJ8 A;  2ZW7 A;  1LRZ A;  2B4D A;  3IWG A;  5I0C A;  2PC1 A;  1R57 A;  2JDC A;  2VXK A;  4KVO E;  5KTC A;  3S6H A;  4MJ8 A;  1IID A;  2CNM A;  1QSR A;  2NMT A;  2CNS A;  4M3S A;  3MGD A;  5F46 A;  4MHD A;  3K9U A;  1Z4E A;  3N7Z A;  4X5K A;  4AVC A;  4B5P A;  4H89 A;  2KCW A;  3UY5 A;  2J8M A;  2PR1 A;  5F48 A;  4Y49 B;  4XPK A;  2VBQ A;  3LOD A;  4XPD B;  2Z0Z A;  4FD4 A;  2Q7B A;  4CS0 B;  1U6M A;  2JLM A;  5H84 A;  1M4D A;  3G3S A;  4MY0 A;  5J8F A;  1SQH A;  2OZH A;  1XIX A;  1PUA A;  3I3G A;  1YVK A;  2FL4 A;  3D3S A;  2VI7 A;  3G8W A;  2BEI A;  4QBJ A;  3DR6 A;  3T90 A;  2FXF A;  4L89 A;  5CNP A;  5F47 A;  3TO6 A;  4UWI A;  3JVN A;  2P6G A;  1YVO A;  4IUS A;  2HV2 A;  2ZW4 A;  2ZPA A;  3R96 A;  4E0A A;  2F5I A;  3QAH A;  1Y9K A;  1V0C A;  2FT0 A;  2VEZ A;  4R57 A;  2J8R A;  2EUI A;  4RS2 A;  4CRY B;  3SHP A;  1BOB A;  1J4J A;  4NSQ A;  4RI1 A;  1RXT A;  1S3Z A;  2B3U A;  3EY5 A;  4JXQ A;  2FSR A;  3BLN A;  4HKF A;  3FRM A;  1XEB A;  2HQY A;  2EVN A;  4ONU A; 
#chains in the Genus database with same CATH topology
 4ZY2 A;  5AG4 A;  5J1Q A;  1L0C A;  1CX8 A;  2AFU A;  2FCK A;  4KOT A;  5IV0 A;  1GYT A;  3TE4 A;  4KOR A;  4HNW B;  2QVP A;  4KUA A;  1HEE A;  1IB1 E;  4FD6 A;  3W91 A;  2B4B A;  4X8I A;  2K5T A;  2J8N A;  1LFW A;  2FIA A;  2BSW A;  2ZEO A;  4KLV A;  4P4J A;  2A4N A;  3W6S A;  3KR4 A;  1YRE A;  4B5O A;  3SI1 A;  3B8G A;  1WWZ A;  1YW4 A;  3FBU A;  4QB9 A;  4Y49 C;  4C2Y A;  3NH4 A;  2WZN A;  5LYI A;  4F9U A;  2YNC C;  4MCS A;  3GKR A;  4NGP A;  4R9M A;  4P4B A;  4NGQ A;  2CNT A;  4A39 A;  4CAX A;  4BIN A;  1Q2D A;  5THW A;  3LD2 A;  1Z9U A;  4OAD A;  1R3N A;  1ZLI A;  1Q2Y A;  3CXP A;  2P6E A;  5LRK A;  4KOS A;  2ZOG A;  3WC6 A;  3ZZI A;  3CXQ A;  2FE7 A;  5IB0 A;  2H5M A;  5DS0 A;  2VL1 A;  1VHO A;  2Y0M A;  3VAT A;  4B12 A;  5IX3 A;  4F9V A;  4MBU A;  3D2P A;  4LQ6 A;  3OWC A;  3WT4 A;  4PV6 A;  3PB4 X;  4IHM A;  4R7M A;  3FED A;  5C88 A;  3DR8 A;  4UEF A;  5HMN A;  4FWU A;  3IEH A;  2PIZ A;  3B3T A;  4GM5 A;  4R3L A;  1QSN A;  4ZGY B;  4P4I A;  3D2M A;  4R76 A;  2PJ1 A;  4DJL A;  2AFM A;  3TCV A;  2EK9 A;  2Z3P A;  3ISX A;  5CPA A;  4CAF A;  1Z4R A;  4NGN A;  4AG9 A;  4OAE A;  3FF3 A;  4NEX A;  4YU9 A;  1YGH A;  5DWM A;  4XNH C;  4CGM A;  4RUH A;  3GB0 A;  2Q4Z A;  3KHX A;  3PP9 A;  2IL4 A;  4O23 A;  3TTH A;  5F09 A;  4PSX A;  1XFO A;  4NXY A;  3S6K A;  3TO9 A;  3NE7 A;  2Q51 A;  1N71 A;  3TO7 A;  2PVW A;  2ZW5 A;  3R9F A;  1ZO0 A;  3RO0 A;  3S9N A;  4NGR A;  3NA6 A;  2B5G A;  5ISV A;  3D7H A;  4ONW A;  4JLY A;  1NSA A;  5G22 A;  2AE6 A;  2OOT A;  2PE3 A;  3PFO A;  1XE4 A;  4MHZ A;  4EVY A;  1GHE A;  1KUY A;  5J8C A;  2GE3 A;  2HC9 A;  4CRZ B;  1CM0 A;  1ELL P;  3W6X A;  4UFW A;  3D7G A;  2Q04 A;  1M1D A;  1LAN A;  2JEV A;  1H8L A;  3P2F A;  3KZW A;  1XRY A;  3B3S A;  2ARH A;  4MCR A;  2G3A A;  3F5B A;  2PRB A;  3IGR A;  4IAV A;  2IMO A;  4AVB A;  1X12 A;  1YLE A;  3FNC A;  4PK3 A;  4F6A A;  4KSI A;  1CBX A;  1S7L A;  2R8V A;  3PZJ A;  2IQ6 A;  2B58 A;  3BXM A;  4CGP A;  1B6B A;  4B14 A;  3SXN A;  1B87 A;  2NSM A;  1UWY A;  2QML A;  4M6G A;  5CBM A;  2WPW A;  5JH9 A;  1A2Z A;  1ELM P;  1S5K A;  2V77 A;  5JQ4 A;  2PJ3 A;  3FJU A;  4KOX A;  4MCP A;  4MHP A;  1Z8L A;  4JYW A;  1P0H A;  4R3K A;  4UIA A;  4ZI6 A;  4RN7 A;  3R1K A;  4W9Y A;  5LYL A;  3JUW A;  4ZX9 A;  4OC4 A;  4XNH B;  1XBU A;  4ZBG A;  3SI0 A;  4OID A;  3VAR A;  1JWQ A;  2VQY A;  2ZEE A;  3PFE A;  2G0B A;  4U9Z A;  3BI1 A;  1HDU A;  1QST A;  4MFK A;  4B13 A;  5C82 A;  1TF9 A;  4JWP A;  3IU2 A;  4K30 A;  1DE4 C;  3NH5 A;  3RZA A;  1RO5 A;  1I12 A;  4TNU A;  2PSW A;  4EWT A;  2ZEH A;  5AGE A;  2Q44 A;  2AFW A;  4MFQ A;  2Q7S A;  1IYK A;  4MRI A;  3B3W A;  4KOY A;  4MY3 A;  4CAE A;  2CTB A;  2CIJ A;  2JBK A;  3PB9 X;  5DWN A;  4F8Z A;  4I49 A;  1YW6 A;  1ON0 A;  2O4H A;  4YGO A;  3VWE A;  3BJ7 A;  4NGS A;  3D4U A;  5LYD A;  2ZW6 A;  1QSO A;  3GIU A;  4KS9 A;  1ARM A;  4PPZ A;  1IIC A;  4NF1 A;  1R43 A;  2PVV A;  4P6Y A;  2Z10 A;  4KOV A;  4C2X A;  5BWA B;  4H6Z A;  5HXD A;  3CXS A;  2VZY A;  3I1U A;  5HVH A;  5K8O A;  2ZEM A;  2ATR A;  3FB3 A;  3D67 A;  1NE9 A;  3R9G A;  3BHX A;  2I3C A;  4J3G A;  4M85 A;  5JGF A;  4R87 A;  3A9L A;  2PJ0 A;  2ANP A;  2REE A;  3GYA A;  4KUB A;  2ZEL A;  2O53 A;  1MJA A;  1TIQ A;  5EMI A;  1S7F A;  1ZG7 A;  3EO4 A;  2D4O A;  3IWW A;  4NFR A;  3JTK A;  3PB8 X;  1CPX A;  2PDO A;  2B3V A;  1KUX A;  2B4D B;  2PQ8 A;  2QIR A;  2Z3N A;  3FEC A;  3V7Z A;  1BO4 A;  1PCA A;  1TF8 A;  3FVL A;  3FYN A;  4FD5 A;  4G1P A;  4CYN A;  2PRQ A;  2R98 A;  1YK3 A;  4E2A A;  5G1Z A;  3L2N A;  2V8G A;  4MHN A;  1WK4 A;  2BL1 A;  3WAB A;  4BBH A;  4PSW A;  1BLL E;  3DLJ A;  3MN8 A;  4KVM E;  4QC6 A;  2GAN A;  3S6F A;  4L8A A;  4II9 A;  4PXB A;  4C68 A;  4CYP A;  4OLL A;  1QSM A;  2I00 A;  2PJ8 A;  3T9Y A;  2BUE A;  1IU8 A;  4QUS A;  5ELY A;  1F2O A;  4ZY0 A;  2Q43 A;  2C1C A;  1PYT B;  3TX8 A;  4DYO A;  4GS4 A;  3QAY A;  4CYQ A;  4B5P B;  3KR5 A;  4HPS A;  3DSB A;  4PQA A;  2OB0 A;  3I9S A;  3CDX A;  2PJ7 A;  1NMT A;  4UWJ A;  3T8W A;  2XEF A;  2PJ2 A;  2B5G B;  2G9D A;  4B6Z A;  1XMB A;  1HDQ A;  3EC4 A;  3SJE A;  4KSF A;  3IFE A;  1LAP A;  2FVG A;  1F2P A;  1TXR A;  5KTA A;  5AG6 A;  4PXE A;  1Y7E A;  4JZ0 A;  1Q7L A;  2WPX A;  4LQG A;  4NGT A;  1XOV A;  5A27 A;  3FIX A;  3H5Z A;  2OU2 A;  2Z3M A;  3QB8 A;  4NJR A;  1VKC A;  2OH1 A;  4JJX A;  4WJB A;  1TKF A;  4U9Y A;  3V38 A;  1M44 A;  2OZG A;  2GLF A;  4LUA A;  4Q36 A;  5G21 A;  4AG7 A;  4CAW A;  2YGW A;  4KVX A;  1PU9 A;  1Z8X A;  1MK4 A;  4BMH A;  2VZZ A;  2EWB A;  1BPN A;  1VHS A;  2F7V A;  2QYV A;  3C26 A;  3IO1 A;  5KTD A;  1YSJ A;  3S6G A;  1OBR A;  4UA3 A;  1EE3 P;  1FT7 A;  4LX9 A;  4KZT A;  3SXO A;  1XMT A;  2PJB A;  3TC8 A;  4CGL A;  2Z3K A;  4IK2 A;  4R6T A;  5IB9 A;  1I21 A;  1Y7R A;  3GUX A;  1M4I A;  2HUZ A;  2X7B A;  1MJB A;  4KOU A;  1QQ9 A;  4CPA A;  5JPH A;  3PGP A;  4A30 A;  1YX0 A;  1S60 A;  1FNO A;  2EK8 A;  5FVJ A;  4MFL A;  2CTC A;  5EBV A;  3E0K A;  3D8P A;  2RB7 A;  3KQZ A;  2AFS A;  3TT2 A;  4JXR A;  4OC5 A;  4MFP A;  4Q38 A;  5D8N A;  2XEJ A;  2DXQ A;  4PXD A;  4HNX B;  4UCN A;  4A31 A;  4IF5 A;  3F0A A;  4K3N A;  5HH1 A;  5H86 A;  2POK A;  4UEE A;  4DNC A;  1Y9W A;  3FXT A;  4ORF A;  4A95 A;  4UBR A;  2F8H A;  3V8I A;  4YFJ A;  4UCP A;  1ZG8 A;  2GIV A;  1DTD A;  5A28 A;  2RC4 A;  1QMU A;  4PXC A;  4HNY B;  2R7H A;  2YNC A;  3NE8 A;  3TOB A;  2REF A;  2EBJ A;  2XEG A;  4H6U A;  2Q4V A;  2D4P A;  5LRG A;  2PR8 A;  4KLW A;  4P4F A;  3EXN A;  2AJ6 A;  2GLJ A;  1MJ9 A;  2O28 A;  3LMS A;  4KOW A;  2I79 A;  4OC1 A;  3K2K A;  4X2T A;  4B11 A;  4ZYQ A;  1KZF A;  2PJ4 A;  2QEC A;  4FBE A;  2ABZ A;  3F8K A;  4PK2 A;  2DPT A;  4A38 A;  3H4Q A;  5JM6 A;  5E96 A;  1IYL A;  3TFY A;  1M4G A;  1VGY A;  3R95 A;  3IIB A;  3PEI A;  7CPA A;  2QJ8 A;  3D7F A;  3GY9 A;  1NSL A;  3DDD A;  2C6C A;  4MI4 A;  3KI9 A;  3PB6 X;  4NGM A;  4R8F A;  4A37 A;  2JDD A;  2NYQ A;  4E8O A;  3HLP A;  4FD7 A;  1I1D A;  2JEW A;  3FMC A;  1OZP A;  3H8F A;  2AFX A;  2DPS A;  1AUG A;  4P10 A;  4X3R A;  1KWM A;  3NH8 A;  2FS5 A;  2PJC A;  4OC3 A;  3CPX A;  1CJW A;  1XJO A;  3HUV A;  4KSA A;  1Z5R A;  2Q0Y A;  4U5Y A;  2CF4 A;  2G3T A;  5EC4 A;  2PJ6 A;  2DEA A;  3WC5 A;  2ZXV A;  3ZJ0 A;  4FAI A;  4OIW A;  1AMP A;  1RTQ A;  1P4N A;  6CPA A;  2FIW A;  3PBE A;  2Q4Y A;  1KUV A;  3TOA A;  5F49 A;  1S7N A;  2R1I A;  4OC0 A;  1VHE A;  3IJ3 A;  1ZLH A;  3DNS A;  3KQX A;  5D29 A;  4AB7 A;  4JD6 A;  4XPL A;  4ZY1 A;  1JQG A;  2OR4 A;  4UIB A;  4YRH A;  1YR0 A;  1UFH A;  3WR7 A;  2C27 A;  3IU1 A;  1Q2C A;  3FH4 A;  4DUK A;  2OZU A;  1Y0R A;  2Z11 A;  2V8D A;  4CAV A;  2P6F A;  4QVT A;  2DF5 A;  2P0W A;  4F0Y A;  3LWU A;  3KGQ A;  1CPS A;  4NCZ A;  3KKW A;  5G20 A;  5GCN A;  3PB7 X;  2YNE A;  3EFA A;  4UF4 A;  3S9M A;  3K9T A;  4OKO A;  3RYO A;  2CY2 A;  2PJA A;  1XF8 A;  3DGV A;  1IGB A;  1S7K A;  3P2H A;  4FUU A;  4XPD C;  4OC2 A;  1VIX A;  1K4J A;  3R9E A;  3CT9 A;  4AVA A;  3H8G A;  1ARL A;  2ZEN A;  3VWD A;  2ODF A;  4GXH A;  2C6G A;  1FY7 A;  5HVG A;  3ISZ A;  3WC7 A;  2XEI A;  3BJ8 A;  3RBU A;  1LOK A;  2HB6 A;  3FEE A;  3VH9 A;  1Z8T A;  3D66 A;  3N5F A;  5LYF A;  4M6H A;  2ZW7 A;  4CYO A;  1CP7 A;  3GLJ A;  3S9L A;  1LRZ A;  3CPA A;  4B10 A;  2B4D A;  3IWG A;  5I0C A;  2PC1 A;  2WYR A;  1R57 A;  2JDC A;  2VXK A;  1LCP A;  4KVO E;  4OP4 A;  5K8M A;  5KTC A;  4F0X A;  3S6H A;  2BO9 A;  4UEZ A;  2WUU A;  4A94 A;  4MJ8 A;  3SJG A;  1IID A;  3NFZ A;  2CNM A;  2C6P A;  1QSR A;  3IWE A;  2NMT A;  8CPA A;  2CNS A;  4M3S A;  4EFD A;  3MGD A;  1CG2 A;  2ZEF A;  3IC1 A;  5F46 A;  4MHD A;  3K9U A;  3SI2 A;  4UCM A;  1Z4E A;  1Z8W A;  3N7Z A;  2PJ5 A;  4Q7A A;  4X5K A;  1YQE A;  4AVC A;  3KAS A;  4B5P A;  4H89 A;  2KCW A;  4C7I A;  1IOF A;  3UY5 A;  2J8M A;  2PR1 A;  5F48 A;  4Y49 B;  4XPK A;  4MCQ A;  2WSA A;  2J9A A;  2VBQ A;  2Z3O A;  3LOD A;  3RNZ A;  2CXA A;  4XPD B;  2Z0Z A;  3B3C A;  2Z3L A;  4FD4 A;  2BOA A;  3MRU A;  2Q7B A;  3D68 A;  3H8E A;  4CS0 B;  1U6M A;  2JLM A;  4P45 A;  5H84 A;  1CP6 A;  1M4D A;  3G3S A;  4MY0 A;  4C2Z A;  3CZX A;  1SQH A;  4WWV A;  4A32 A;  4AXV A;  5J8F A;  3SJF A;  4MXU A;  1LAM A;  2OZH A;  4UFV A;  5LRJ A;  1XIX A;  5K8P A;  1IY7 A;  4OME A;  3B3V A;  4M6I A;  2GRE A;  3B2Y A;  3PRT A;  5HVF A;  4EME A;  1PUA A;  3I3G A;  4MFJ A;  1YVK A;  2FL4 A;  2PCU A;  3D3S A;  2EO8 A;  3B35 A;  1TKH A;  2VI7 A;  5AG7 A;  4A2Z A;  2ZED A;  5I4M A;  1ZG9 A;  2GFQ A;  3G8W A;  2BEI A;  4MMO A;  3PBB A;  4QBJ A;  1IOI A;  3DR6 A;  4MHY A;  3T90 A;  2FXF A;  4L89 A;  2AFO A;  5CNP A;  5F47 A;  3TO6 A;  5K8N A;  3D7D A;  4UWI A;  3JVN A;  2P6G A;  4ZX8 A;  3BI0 A;  3QNV A;  2JBJ A;  3JRU A;  3RAM A;  1YVO A;  2ZEG A;  4IUS A;  4P44 A;  2HV2 A;  4TWE A;  2ZW4 A;  4MFZ A;  4P4E A;  4A33 A;  2PIY A;  2ZPA A;  3R96 A;  2V8H A;  1YME A;  2F5I A;  2PJ9 A;  3QAH A;  4E0A A;  1Y9K A;  1M4L A;  1V0C A;  2BCO A;  2FT0 A;  2IJZ A;  2V8V A;  2YND A;  3KL9 A;  2AFZ A;  4NJQ A;  2VEZ A;  4R57 A;  2GU2 A;  2J8R A;  1Z2L A;  4UFX A;  1Y0Y A;  2ZEP A;  3SJX A;  4BD9 A;  2EUI A;  4Z65 A;  4RS2 A;  3LAC A;  5AG5 A;  4CGN A;  4CGO A;  4CRY B;  4P4D A;  3SHP A;  2ZOF A;  1BAV A;  1BOB A;  4H2K A;  1J4J A;  4YWY A;  4NSQ A;  4RI1 A;  1RXT A;  1S3Z A;  1TKJ A;  2B3U A;  2RFH A;  3FX6 A;  3EY5 A;  2FSR A;  3BLN A;  4JXQ A;  1YLO A;  1BPM A;  1AYE A;  4HKF A;  1F57 A;  1X10 A;  3FRM A;  4C7H A;  3B7I A;  3KHZ A;  1XEB A;  2HQY A;  2EVN A;  4ONU A; 
#chains in the Genus database with same CATH homology
 5AG4 A;  1L0C A;  2FCK A;  4KOT A;  5IV0 A;  3TE4 A;  4KOR A;  4HNW B;  4KUA A;  1IB1 E;  4FD6 A;  3W91 A;  2B4B A;  2K5T A;  2J8N A;  2FIA A;  2BSW A;  4KLV A;  2A4N A;  3W6S A;  1YRE A;  4B5O A;  3B8G A;  1WWZ A;  3FBU A;  4QB9 A;  4Y49 C;  4C2Y A;  2YNC C;  3GKR A;  4R9M A;  4CAX A;  2CNT A;  1Q2D A;  3LD2 A;  1Z9U A;  4OAD A;  1Q2Y A;  3CXP A;  2P6E A;  4KOS A;  3ZZI A;  3CXQ A;  2FE7 A;  5IB0 A;  2H5M A;  2Y0M A;  4B12 A;  5IX3 A;  4MBU A;  3D2P A;  3OWC A;  4PV6 A;  5C88 A;  3DR8 A;  5HMN A;  4R3L A;  1QSN A;  4ZGY B;  3D2M A;  3TCV A;  2Z3P A;  4CAF A;  1Z4R A;  4AG9 A;  4OAE A;  4NEX A;  1YGH A;  5DWM A;  4XNH C;  4CGM A;  3PP9 A;  2IL4 A;  3TTH A;  4PSX A;  4NXY A;  3S6K A;  3TO9 A;  3NE7 A;  1N71 A;  3TO7 A;  2ZW5 A;  3R9F A;  1ZO0 A;  2B5G A;  5ISV A;  4JLY A;  5G22 A;  2AE6 A;  1XE4 A;  4EVY A;  1GHE A;  1KUY A;  5J8C A;  2GE3 A;  4CRZ B;  1CM0 A;  3W6X A;  4UFW A;  2Q04 A;  1M1D A;  2JEV A;  3P2F A;  2ARH A;  2G3A A;  3F5B A;  2PRB A;  3IGR A;  4AVB A;  1YLE A;  3FNC A;  4PK3 A;  4F6A A;  1S7L A;  2R8V A;  3PZJ A;  2B58 A;  4CGP A;  1B6B A;  4B14 A;  3SXN A;  1B87 A;  2QML A;  2WPW A;  1S5K A;  5JQ4 A;  4KOX A;  4R3K A;  1P0H A;  3R1K A;  3JUW A;  4XNH B;  4ZBG A;  2VQY A;  4U9Z A;  2G0B A;  4MFK A;  1QST A;  4B13 A;  5C82 A;  4JWP A;  3IU2 A;  4K30 A;  1RO5 A;  1I12 A;  2PSW A;  5AGE A;  2Q44 A;  4MFQ A;  1IYK A;  4KOY A;  4MY3 A;  4CAE A;  5DWN A;  4I49 A;  1ON0 A;  4YGO A;  3VWE A;  3BJ7 A;  2ZW6 A;  1QSO A;  4KS9 A;  1IIC A;  4NF1 A;  2Z10 A;  4KOV A;  4C2X A;  5BWA B;  4H6Z A;  3CXS A;  2VZY A;  2ATR A;  3FB3 A;  1NE9 A;  3R9G A;  4M85 A;  4J3G A;  4R87 A;  3A9L A;  2REE A;  3GYA A;  4KUB A;  1MJA A;  1TIQ A;  1S7F A;  3EO4 A;  2D4O A;  3JTK A;  2PDO A;  2Z3N A;  2B3V A;  1KUX A;  2B4D B;  2PQ8 A;  2QIR A;  1BO4 A;  3FYN A;  4FD5 A;  4CYN A;  2R98 A;  1YK3 A;  4E2A A;  5G1Z A;  1WK4 A;  2BL1 A;  4BBH A;  4PSW A;  4KVM E;  4QC6 A;  2GAN A;  3S6F A;  4L8A A;  4II9 A;  4C68 A;  4CYP A;  4OLL A;  1QSM A;  2I00 A;  3T9Y A;  2BUE A;  4QUS A;  4GS4 A;  4CYQ A;  4B5P B;  3DSB A;  2OB0 A;  3I9S A;  1NMT A;  4UWJ A;  2B5G B;  3EC4 A;  4KSF A;  5KTA A;  5AG6 A;  2WPX A;  5A27 A;  3FIX A;  3H5Z A;  2OU2 A;  2Z3M A;  3QB8 A;  1VKC A;  2OH1 A;  4JJX A;  4U9Y A;  1M44 A;  2OZG A;  4Q36 A;  4LUA A;  5G21 A;  4AG7 A;  4CAW A;  2YGW A;  4KVX A;  1PU9 A;  4BMH A;  1MK4 A;  2VZZ A;  1VHS A;  5KTD A;  3C26 A;  3S6G A;  4UA3 A;  4LX9 A;  4KZT A;  3SXO A;  1XMT A;  4CGL A;  2Z3K A;  1I21 A;  1Y7R A;  1M4I A;  2HUZ A;  2X7B A;  1MJB A;  4KOU A;  5JPH A;  3PGP A;  4A30 A;  1YX0 A;  1S60 A;  5FVJ A;  4MFL A;  5EBV A;  3E0K A;  3D8P A;  3TT2 A;  4JXR A;  4MFP A;  4Q38 A;  2DXQ A;  4HNX B;  4UCN A;  4A31 A;  4IF5 A;  3F0A A;  5HH1 A;  5H86 A;  4DNC A;  1Y9W A;  3FXT A;  4ORF A;  4A95 A;  4UBR A;  3V8I A;  4YFJ A;  4UCP A;  2GIV A;  5A28 A;  2RC4 A;  4HNY B;  2R7H A;  2YNC A;  3TOB A;  2REF A;  4H6U A;  2Q4V A;  2D4P A;  2PR8 A;  4KLW A;  3EXN A;  2AJ6 A;  1MJ9 A;  2O28 A;  4KOW A;  2I79 A;  4B11 A;  1KZF A;  2QEC A;  3F8K A;  4PK2 A;  2DPT A;  3H4Q A;  5E96 A;  1IYL A;  3TFY A;  1M4G A;  3R95 A;  3GY9 A;  1NSL A;  3DDD A;  4MI4 A;  2JDD A;  4E8O A;  4FD7 A;  1I1D A;  1OZP A;  2DPS A;  2FS5 A;  1CJW A;  4KSA A;  4U5Y A;  2Q0Y A;  2G3T A;  5EC4 A;  2ZXV A;  3ZJ0 A;  1P4N A;  2FIW A;  2Q4Y A;  1KUV A;  3TOA A;  5F49 A;  1S7N A;  2R1I A;  4AB7 A;  3DNS A;  4JD6 A;  4XPL A;  4YRH A;  1YR0 A;  1UFH A;  3WR7 A;  2C27 A;  3IU1 A;  1Q2C A;  2OZU A;  2Z11 A;  4CAV A;  2P6F A;  4QVT A;  2P0W A;  4F0Y A;  4NCZ A;  3KKW A;  5G20 A;  5GCN A;  2YNE A;  3EFA A;  3RYO A;  2CY2 A;  3P2H A;  1XF8 A;  1S7K A;  4XPD C;  1K4J A;  3R9E A;  4AVA A;  3VWD A;  1FY7 A;  3BJ8 A;  2ZW7 A;  4CYO A;  1LRZ A;  4B10 A;  2B4D A;  3IWG A;  5I0C A;  2PC1 A;  1R57 A;  2JDC A;  2VXK A;  4KVO E;  5KTC A;  4F0X A;  3S6H A;  2WUU A;  4MJ8 A;  1IID A;  2CNM A;  1QSR A;  3IWE A;  2NMT A;  2CNS A;  4M3S A;  3MGD A;  5F46 A;  4MHD A;  3K9U A;  4UCM A;  1Z4E A;  3N7Z A;  4X5K A;  4AVC A;  4B5P A;  4H89 A;  2KCW A;  4C7I A;  3UY5 A;  2J8M A;  2PR1 A;  5F48 A;  4Y49 B;  4XPK A;  2WSA A;  2VBQ A;  2Z3O A;  3LOD A;  2CXA A;  4XPD B;  2Z0Z A;  2Z3L A;  4FD4 A;  2Q7B A;  4CS0 B;  1U6M A;  2JLM A;  5H84 A;  1M4D A;  3G3S A;  4C2Z A;  4MY0 A;  5J8F A;  1SQH A;  4A32 A;  2OZH A;  4UFV A;  1XIX A;  1PUA A;  3I3G A;  4MFJ A;  1YVK A;  2FL4 A;  3D3S A;  5AG7 A;  2VI7 A;  4A2Z A;  3G8W A;  2BEI A;  4QBJ A;  3DR6 A;  3T90 A;  2FXF A;  4L89 A;  5CNP A;  5F47 A;  3TO6 A;  4UWI A;  3JVN A;  2P6G A;  1YVO A;  4IUS A;  2HV2 A;  2ZW4 A;  4MFZ A;  4A33 A;  2ZPA A;  3R96 A;  4E0A A;  2F5I A;  3QAH A;  1Y9K A;  1V0C A;  2FT0 A;  2YND A;  2VEZ A;  4R57 A;  4UFX A;  2J8R A;  2EUI A;  4RS2 A;  5AG5 A;  4CGN A;  4CGO A;  4CRY B;  3SHP A;  1BOB A;  1J4J A;  4NSQ A;  4RI1 A;  1RXT A;  1S3Z A;  2B3U A;  3EY5 A;  4JXQ A;  2FSR A;  3BLN A;  4HKF A;  3FRM A;  4C7H A;  1XEB A;  2HQY A;  2EVN A;  4ONU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...