2Q44A

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at1g77540
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At1g77540
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 25
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q44A00
3TTHA 2J8MA 4X5KA 4B5PA 5J8CA 2VQYA 3C26A 4QBJA 1YVKA 5C88A 3TE4A 5GCNA 5ISVA 2BEIA 3FBUA 2GIVA 3GY9A 2BUEA 2QECA 1PU9A 4AVBA 4PK2A 1M4DA 2GE3A 1YGHA 4IF5A 3FIXA 2Q4VA 3FNCA 2B4BA 4FD7A 5F48A 2ZXVA 2VBQA 3EXNA 5DWMA 5IB0A 5HMNA 2Q0YA 4MJ8A 2ZW7A 1R57A 4DNCA 5F46A 2PRBA 2JLMA 3F0AA 1MK4A 1M4IA 1GHEA 1B6BA 3D2PA 3ZJ0A 3R1KA 4MHDA 4CAXA 3BJ7A 3EFAA 1QSMA 1RXTA 2PR8A 1P4NA 1LRZA 5FVJA 2Q4YA 3CXQA 1TIQA 4QVTA 2C27A 4KVXA 3R9EA 5F47A 3TT2A 3VWEA 2FIAA 1SQHA 5HH1A 3FXTA 2CY2A 4NCZA 4F0YA 4FD4A 3JVNA 3SHPA 2D4OA 1S7FA 3W6SA 4NSQA 4XPDB 2ZW6A 4OLLA 1IYKA 1NSLA 1B87A 5IX3A 3OWCA 1P0HA 1KZFA 4NEXA 4GS4A 3E0KA 1I21A 3LODA 4CRZB 3P2FA 4KOWA 3TFYA 2G0BA 1BOBA 3PGPA 4ORFA 4U5YA 4M85A 4KOSA 1Q2DA 4Y49C 2R98A 3JUWA 3S6HA 2QIRA 2J8NA 2B3VA 4CAVA 2Z11A 2Q44A 2QMLA 3G3SA 2VXKA 1XEBA 3TOBA 4AG7A 1IB1E 5H86A 4PV6A 2KCWA 4QB9A 1QSRA 3S6FA 2X7BA 3W6XA 3R9FA 2B58A 2WPXA 3R95A 2RC4A 1Q2CA 4KVME 4RI1A 4U9ZA 3KKWA 2Q04A 2ZW5A 4JD6A 4KOYA 4MBUA 3TO9A 4AVCA 3I3GA 1J4JA 2JEVA 2R8VA 4E2AA 4KORA 1IYLA 4RS2A 2Y0MA 4KOVA 4KUAA 3LD2A 2I79A 1Z4RA 1VKCA 3CXSA 2REEA 4KZTA 1FY7A 1S5KA 4KOTA 4F6AA 3D8PA 3NE7A 2P6EA 2CNMA 1YK3A 2K5TA 2O28A 2WPWA 2GANA 3V8IA 3F5BA 1NMTA 3EY5A 3BLNA 2FIWA 4XPKA 4XNHC 4HKFA 3TO7A 2Q7BA 3R9GA 2VZZA 5CNPA 1MJ9A 5EC4A 5JQ4A 3D2MA 3SXNA 2FT0A 1Z9UA 1CM0A 2R1IA 1Q2YA 2BSWA 2J8RA 4U9YA 3TCVA 1Z4EA 2OH1A 4YFJA 4PK3A 3TOAA 4JWPA 4MY3A 3SXOA 4R9MA 1YREA 3N7ZA 1I1DA 2I00A 4AVAA 1ON0A 4KLVA 1KUYA 2FE7A 1IICA 5I0CA 3K9UA 1Y9WA 2A4NA 1U6MA 3EO4A 3QB8A 1M44A 2JDDA 2AJ6A 3IWGA 1WK4A 1S7LA 4OADA 4KUBA 1OZPA 1M4GA 3PP9A 4HNWB 3GYAA 2JDCA 3G8WA 4NF1A 2FL4A 3GKRA 2H5MA 2ATRA 4R57A 5JPHA 2G3TA 2B5GA 4II9A 1NE9A 3DR6A 1I12A 4FD6A 4E0AA 4KLWA 4JXQA 1UFHA 4UWJA 5EBVA 1YR0A 4FD5A 2B4DA 4ONUA 2HQYA 2CNSA 3W91A 2F5IA 3P2HA 1IIDA 2Z10A 2PQ8A 3TO6A 4R87A 1QSOA 1N71A 3F8KA 4IUSA 2FS5A 2EUIA 4ZBGA 4M3SA 3DNSA 3FRMA 3R96A 4R3LA 2OB0A 4MY0A 5KTDA 1WWZA 2IL4A 2NMTA 3UY5A 4B5PB 4R3KA 4JJXA 4CS0B 1PUAA 1Y9KA 2B3UA 1L0CA 1BO4A 4QC6A 2HUZA 3EC4A 2R7HA 1M1DA 1YVOA 3FYNA 3DR8A 3S6GA 4XPDC 2P6FA 4LUAA 2BL1A 4J3GA 5KTAA 4Y49B 2VEZA 3WR7A 2PSWA 4QUSA 3DSBA 5E96A 2OU2A 1MJAA 1K4JA 1RO5A 3H4QA 4I49A 1XE4A 5H84A 1VHSA 4PSXA 5J8FA 2PC1A 4L89A 4L8AA 4AB7A 3S6KA 2Z0ZA 5F49A 3B8GA 2REFA 3QAHA 1XMTA 4H6ZA 5IV0A 2AE6A 4OAEA 4K30A 2HV2A 1S7KA 3DDDA 4YRHA 4JLYA 4H6UA 3BJ8A 4H89A 1YLEA 2D4PA 2CNTA 4YGOA 1QSTA 2VZYA 4KOXA 4LX9A 4UWIA 4UBRA 3I9SA 4CAWA 3ZZIA 3CXPA 3T90A 2ARHA 1V0CA 2OZGA 4HNXB 2OZHA 2PDOA 4B5OA 4MI4A 2P0WA 3FB3A 1CJWA 3MGDA 4AG9A 4XPLA 1MJBA 2EVNA 4NXYA 1Y7RA 2PR1A 1KUVA 2P6GA 1QSNA 2DXQA 3PZJA 3T9YA 2FXFA 4E8OA 2ZPAA 1YX0A 5DWNA 5KTCA 4BMHA 4JXRA 4PSWA 3VWDA 2ZW4A 2G3AA 4XNHB 2B5GB 3RYOA 1XIXA 1KUXA 4KOUA 1S60A 2FCKA 4CRYB 1XF8A 1S7NA 5C82A 2VI7A 4HNYB 4UA3A 2FSRA 3IGRA 2B4DB 4KVOE 4EVYA 3D3SA 1S3ZA 2OZUA
chains in the Genus database with same CATH superfamily
4MFJA 3KZWA 3TTHA 1AUGA 1TF8A 1ZO0A 1R3NA 3IU1A 2J8MA 4X5KA 2Z3PA 4B5PA 5J8CA 2VQYA 3C26A 4QBJA 1VHEA 1YVKA 3PB9X 4OMEA 1CP6A 5C88A 4CGPA 2EK8A 3TE4A 4UFXA 5GCNA 5ISVA 4G1PA 2BEIA 3HUVA 3FBUA 5K8PA 4OC4A 3B3SA 1XBUA 2GIVA 3DLJA 3FJUA 2BUEA 3GY9A 4P6YA 1ELLP 2QECA 2ZEPA 3IU2A 4BINA 1PU9A 4AVBA 4W9YA 4KSIA 3H8GA 4PK2A 1M4DA 1LAMA 2GE3A 2XEGA 1YGHA 4IF5A 2AFOA 1LANA 4MHZA 4MCQA 2QJ8A 3FIXA 4ZY2A 2Q4VA 3FNCA 4MCRA 2B4BA 4FD7A 5D29A 3TX8A 5J1QA 5F48A 2ZXVA 4MFLA 2VBQA 3EXNA 1CP7A 3SI1A 4CYNA 2Z3MA 5DWMA 5IB0A 3K9TA 4CYPA 1BPMA 2OOTA 3KI9A 4ZX9A 2AFSA 5HMNA 2Q0YA 4FWUA 1VGYA 2F7VA 4MJ8A 1VIXA 4X8IA 5HXDA 2ZW7A 1R57A 4DNCA 5F46A 2PRBA 2JLMA 2V8GA 1MK4A 3F0AA 2EBJA 1M4IA 4UCPA 5DS0A 4CYOA 3PB4X 4A30A 5AG4A 1GHEA 2PJ7A 1XJOA 2GU2A 1B6BA 3GLJA 1ARLA 3D2PA 4MFQA 5HVGA 4A94A 3ZJ0A 4OC2A 2Z3NA 3R1KA 4MHDA 4CAXA 3B3WA 3BJ7A 3FVLA 1H8LA 5JGFA 3EFAA 1QSMA 3ISXA 1Z8LA 3BXMA 1RXTA 5AG6A 3WC6A 2PR8A 1P4NA 1LRZA 1YW4A 1KWMA 2Q4YA 5FVJA 3CXQA 2ZEDA 1TIQA 2Q7SA 2CIJA 1IOFA 2CXAA 3VATA 4QVTA 2C27A 4KVXA 3R9EA 5A27A 1Q7LA 5F47A 3TT2A 3VWEA 4A95A 2FIAA 1ARMA 1XMBA 3D7FA 1YQEA 1SQHA 2PCUA 2IJZA 3KR4A 4NGNA 5HH1A 3FXTA 2Z3OA 1HDQA 1TKFA 2AFZA 1DE4C 2CY2A 4NCZA 4F0YA 2WZNA 4FD4A 3JVNA 5LRJA 3SHPA 2D4OA 1S7FA 2V8HA 4NGTA 3W6SA 4NSQA 4PXDA 4XPDB 2HB6A 3D68A 1EE3P 1YLOA 2ZW6A 4OLLA 1IYKA 2C6PA 3BI1A 1NSLA 3PRTA 5CPAA 1B87A 1Z2LA 5IX3A 3OWCA 1P0HA 1KZFA 4NEXA 5HVFA 4GS4A 2PVVA 1Z8TA 3MN8A 3RBUA 4BD9A 3E0KA 1I21A 3LODA 4CRZB 3B7IA 3P2FA 4PQAA 4KOWA 3SJXA 2CTCA 3TFYA 2NYQA 2IQ6A 2G0BA 4B11A 1BOBA 3LACA 2ZEHA 3PGPA 4ORFA 4U5YA 2G9DA 3FECA 3KASA 3NH4A 4KOSA 4M85A 3V7ZA 4CPAA 1Q2DA 4MHYA 4Y49C 1ELMP 2R98A 2Q4ZA 1AYEA 2PIZA 3MRUA 3JUWA 4RUHA 3S6HA 2QIRA 3PFEA 4P4BA 2J8NA 1M4LA 1ZG7A 2B3VA 4CAVA 2Z11A 1JWQA 2Q44A 4MRIA 2RB7A 5CBMA 5K8OA 5K8NA 4A39A 2O53A 4P4IA 2PJ9A 2QMLA 3G3SA 2VXKA 4B10A 3ISZA 1ZLIA 1XEBA 3TOBA 5LRKA 3NH5A 5G22A 4B12A 5D8NA 4AG7A 3KR5A 1IB1E 5H86A 4PV6A 3SJEA 5BWAB 4Z65A 2BOAA 3NA6A 4PXEA 2KCWA 4QB9A 1QSRA 3S6FA 2X7BA 3W6XA 5LYFA 1BPNA 1IOIA 3R9FA 4R7MA 3KQZA 2HC9A 4NF1A 2PJ2A 3B3CA 4NGRA 4CAFA 2B58A 2WPXA 3R95A 3IO1A 1CPSA 4ZI6A 1LOKA 4C2ZA 2RC4A 4R76A 1Q2CA 4KVME 2BO9A 4RI1A 4U9ZA 5LYLA 3B35A 3KKWA 3PBBA 2Q04A 2DEAA 2ZW5A 4JD6A 4KOYA 4MBUA 4PPZA 3SI2A 3TO9A 4AVCA 3I3GA 1J4JA 2JEVA 1JQGA 2R8VA 4E2AA 4WWVA 3WT4A 4KORA 1IYLA 4EFDA 1QMUA 3HLPA 4RS2A 2Y0MA 2C1CA 2ZENA 3B3TA 4KOVA 4KUAA 4KSAA 4IHMA 3SJGA 4OP4A 3LD2A 2I79A 1Y7EA 4MFPA 4MFZA 1XRYA 2ODFA 2AFWA 3B2YA 1Z4RA 1VKCA 1ZG8A 2POKA 3CPXA 3CXSA 4EMEA 1HEEA 3IWEA 2REEA 3TC8A 3D7GA 4EWTA 4OKOA 3S9LA 1BLLE 4KZTA 1YMEA 3T8WA 1FY7A 1S5KA 2CTBA 4KOTA 5EMIA 4F6AA 2JEWA 4ZYQA 3D8PA 4R6TA 3NE7A 2OR4A 2P6EA 3IFEA 4GXHA 4MCSA 2CNMA 1YK3A 2K5TA 2O28A 2WPWA 1YSJA 2GANA 3V8IA 3F5BA 1NMTA 1X12A 3EY5A 3BLNA 4C68A 3GB0A 1Y0RA 2FIWA 3JTKA 5ELYA 4MHPA 4UIBA 4XPKA 2V77A 3CDXA 2GREA 4P10A 4TNUA 2YGWA 4H2KA 2AFMA 4XNHC 3D67A 4HKFA 5HVHA 3CZXA 3TO7A 2ZOFA 2Q7BA 3R9GA 5JH9A 4F9VA 1BAVA 2ZEGA 2VZZA 3H8FA 2EWBA 1YW6A 2RFHA 3IEHA 5CNPA 1MJ9A 4UCMA 5EC4A 5JQ4A 3D4UA 3D2MA 3IIBA 3SXNA 2FT0A 4FUUA 5AG5A 1Z9UA 1CM0A 1F2PA 2PE3A 3LMSA 2R1IA 1Q2YA 2BSWA 3QNVA 4O23A 2J8RA 4MMOA 4U9YA 1Z4EA 3TCVA 4ZY0A 2PJAA 4NGPA 2OH1A 4YFJA 5AGEA 4PK3A 3TOAA 4UF4A 4JWPA 4MY3A 3SXOA 4UEZA 2WSAA 2GFQA 4R9MA 3LWUA 1YREA 3N7ZA 1I1DA 2I00A 4AVAA 1ON0A 4KLVA 1KUYA 2FE7A 1IICA 3KQXA 3PB7X 4UCNA 3WC5A 3PB6X 3IWWA 4P4EA 3VARA 5I0CA 4UFVA 3K9UA 1Y9WA 2A4NA 1PCAA 2CF4A 4ZX8A 1U6MA 4A33A 3EO4A 3QB8A 1M44A 1FT7A 2JDDA 2AJ6A 3NH8A 3NFZA 3IWGA 1WK4A 3B3VA 1S7LA 3KHZA 4OADA 1Y0YA 3GIUA 4KUBA 4WJBA 1OZPA 2PVWA 4F0XA 2XEIA 1M4GA 2ZEMA 2WUUA 3PP9A 4HNWB 3GYAA 2JBJA 1NSAA 2DPSA 2JDCA 1IY7A 2PJ5A 2FL4A 2J9AA 1VHOA 2H5MA 3G8WA 3GKRA 4M6HA 2ATRA 4NGSA 4R57A 5AG7A 5JPHA 2G3TA 4YU9A 3JRUA 4P44A 3IJ3A 5F09A 2B5GA 4II9A 1NE9A 3DR6A 1I12A 4FD6A 4NGMA 4LQ6A 4E0AA 4UEEA 4KLWA 1IGBA 3PB8X 3RO0A 1FNOA 4JXQA 4BBHA 5IB9A 1UFHA 4UWJA 5EBVA 4CGOA 4CYQA 4GM5A 1YR0A 4A37A 4FD5A 3WABA 6CPAA 4IK2A 2B4DA 4ONUA 2ANPA 2HQYA 2CNSA 3W91A 2F5IA 3FEDA 3FH4A 3FEEA 3P2HA 1XFOA 1IIDA 2Z10A 4KS9A 2PQ8A 2PJ8A 3CT9A 3TO6A 4R87A 1GYTA 4DYOA 1QSOA 1N71A 2PJ4A 3KGQA 3F8KA 4IUSA 2BCOA 2FS5A 2AFXA 2EUIA 4ZBGA 4F9UA 4OC3A 2DF5A 4M3SA 3DNSA 4NJQA 3FRMA 3R96A 4UFWA 4KSFA 3CPAA 2OB0A 4R3LA 4R8FA 1PYTB 1XOVA 1CPXA 4MY0A 1LAPA 3S9NA 3KL9A 4A31A 2JBKA 2F8HA 2Q43A 1Z8WA 5KTDA 4LQGA 1WWZA 2IL4A 2NMTA 4MFKA 3UY5A 4B5PB 1UWYA 4R3KA 4F8ZA 2YNEA 4JJXA 4JYWA 2XEFA 2ABZA 2QVPA 2Z3KA 4C2YA 4CS0B 5A28A 1PUAA 1Y9KA 2B3UA 2WYRA 2YNCC 3KHXA 4K3NA 1L0CA 1BO4A 1RTQA 4AXVA 3FX6A 2ZELA 4NGQA 2Z3LA 4QC6A 4HPSA 4B6ZA 1LCPA 2HUZA 3EC4A 3A9LA 2R7HA 1M1DA 1YVOA 2ZEFA 3FYNA 2DPTA 1LFWA 3DR8A 3S6GA 4NJRA 1CX8A 3PBEA 4XPDC 2P6FA 4LUAA 2BL1A 3QAYA 4B14A 4J3GA 4OC0A 5KTAA 5LRGA 4Y49B 2VEZA 4CAEA 1CG2A 2GLJA 3WR7A 4MHNA 2PSWA 4QUSA 4A2ZA 3DSBA 5E96A 3FMCA 2OU2A 1MJAA 5G20A 1K4JA 1Z5RA 2PJ1A 3H8EA 1RO5A 3H4QA 2QYVA 4I49A 4P4FA 1XE4A 4Q7AA 5H84A 5THWA 4FBEA 1VHSA 1IU8A 2ZEEA 3SI0A 4PSXA 3S9MA 2YNDA 3D7HA 4FAIA 5J8FA 2PC1A 2PJ0A 4L89A 4L8AA 1A2ZA 4AB7A 3S6KA 2Z0ZA 5F49A 3B8GA 2REFA 3QAHA 1TF9A 1XMTA 4H6ZA 2IMOA 2YNCA 1QQ9A 4M6GA 4OC1A 4PXBA 3WC7A 5IV0A 4OIWA 2AE6A 4OAEA 4K30A 2HV2A 1S7KA 3DDDA 4YRHA 4A38A 2EO8A 1AMPA 4JLYA 4H6UA 3BJ8A 5JM6A 1Z8XA 4PXCA 5I4MA 4H89A 4ZGYB 1OBRA 2EK9A 3D66A 3V38A 1YLEA 2D4PA 2CNTA 4YGOA 1QSTA 2PRQA 3VH9A 1TKHA 1R43A 3IC1A 2VZYA 4KOXA 4LX9A 4UWIA 1HDUA 3D7DA 3PFOA 4UBRA 1ZLHA 3I9SA 3BHXA 4CAWA 4P4DA 3RAMA 3ZZIA 2NSMA 2V8VA 3CXPA 3H5ZA 4MXUA 2PIYA 2ARHA 3I1UA 3T90A 4B13A 4C7HA 1V0CA 7CPAA 4P4JA 4OC5A 4RN7A 4TWEA 1F2OA 2I3CA 2OZGA 4HNXB 2OZHA 3DGVA 2PDOA 4B5OA 4MI4A 1F57A 4OIDA 2P0WA 4DUKA 3FB3A 4C7IA 3L2NA 1CJWA 3MGDA 4AG9A 4DJLA 3NE8A 4P45A 5G1ZA 4XPLA 4X3RA 3K2KA 3SJFA 1MJBA 2EVNA 2VL1A 2V8DA 1Y7RA 3PEIA 4NXYA 4Q38A 5LYIA 2GLFA 5G21A 4ZY1A 2PR1A 1KUVA 2O4HA 8CPAA 2P6GA 1QSNA 5LYDA 2DXQA 3PZJA 3RNZA 2FXFA 3T9YA 4E8OA 2FVGA 2ZPAA 1YX0A 5DWNA 5KTCA 4UIAA 2PJ3A 4BMHA 4JXRA 4PSWA 1ZG9A 3BI0A 3VWDA 2ZW4A 4A32A 2C6CA 4CGMA 2PJ6A 4UEFA 2G3AA 2ZEOA 4MCPA 4CGNA 2ZOGA 4XNHB 4M6IA 2B5GB 4Q36A 1XIXA 3RYOA 4C2XA 1KUXA 4KOUA 1CBXA 2Q51A 5K8MA 1S60A 4JZ0A 2AFUA 2FCKA 2PJBA 4CRYB 2PJCA 1TKJA 1XF8A 2XEJA 2C6GA 3FF3A 3RZAA 1S7NA 5C82A 2VI7A 3GUXA 4HNYB 4UA3A 2FSRA 1DTDA 3IGRA 4IAVA 1TXRA 2B4DB 4KVOE 4NFRA 4CGLA 4EVYA 4ONWA 3D3SA 3N5FA 1S3ZA 4YWYA 2OZUA 4X2TA 1X10A
chains in the Genus database with same CATH topology
4MFJA 3TTHA 1ZO0A 3IU1A 2J8MA 4X5KA 2Z3PA 4B5PA 5J8CA 2VQYA 3C26A 4QBJA 1YVKA 5C88A 4CGPA 3TE4A 4UFXA 5GCNA 5ISVA 2BEIA 3FBUA 2GIVA 3GY9A 2BUEA 2QECA 3IU2A 1PU9A 4AVBA 4PK2A 1M4DA 2GE3A 1YGHA 4IF5A 3FIXA 2Q4VA 3FNCA 2B4BA 4FD7A 5F48A 2ZXVA 4MFLA 2VBQA 3EXNA 4CYNA 2Z3MA 5DWMA 5IB0A 4CYPA 5HMNA 2Q0YA 4MJ8A 2ZW7A 1R57A 4DNCA 5F46A 2PRBA 2JLMA 3F0AA 1MK4A 4UCPA 5AG4A 1M4IA 4CYOA 4A30A 1GHEA 1B6BA 3D2PA 4MFQA 3ZJ0A 2Z3NA 3R1KA 4MHDA 4CAXA 3BJ7A 3EFAA 1QSMA 5AG6A 1RXTA 2PR8A 1P4NA 1LRZA 5FVJA 2Q4YA 3CXQA 1TIQA 2CXAA 4QVTA 2C27A 4KVXA 3R9EA 5A27A 5F47A 3TT2A 3VWEA 4A95A 2FIAA 1SQHA 5HH1A 3FXTA 2Z3OA 2CY2A 4NCZA 4F0YA 4FD4A 3JVNA 3SHPA 2D4OA 1S7FA 3W6SA 4NSQA 4XPDB 2ZW6A 4OLLA 1IYKA 1NSLA 1B87A 5IX3A 3OWCA 1P0HA 1KZFA 4NEXA 4GS4A 3E0KA 1I21A 3LODA 4CRZB 3P2FA 4KOWA 3TFYA 2G0BA 4B11A 1BOBA 3PGPA 4ORFA 4U5YA 4M85A 4KOSA 1Q2DA 4Y49C 2R98A 3JUWA 3S6HA 2QIRA 2J8NA 2B3VA 4CAVA 2Z11A 2Q44A 2QMLA 3G3SA 2VXKA 4B10A 1XEBA 3TOBA 5G22A 4B12A 4AG7A 1IB1E 5H86A 4PV6A 5BWAB 2KCWA 4QB9A 1QSRA 3S6FA 2X7BA 3W6XA 3R9FA 4CAFA 2B58A 2WPXA 3R95A 4C2ZA 2RC4A 1Q2CA 4KVME 4RI1A 4U9ZA 3KKWA 2Q04A 2ZW5A 4JD6A 4KOYA 4MBUA 3TO9A 4AVCA 3I3GA 1J4JA 2JEVA 2R8VA 4E2AA 4KORA 1IYLA 4RS2A 2Y0MA 4KSAA 4KOVA 4KUAA 3LD2A 2I79A 4MFPA 4MFZA 1Z4RA 1VKCA 3CXSA 3IWEA 2REEA 4KZTA 1FY7A 1S5KA 4KOTA 4F6AA 3D8PA 3NE7A 2P6EA 2CNMA 1YK3A 2K5TA 2O28A 2WPWA 2GANA 3V8IA 3F5BA 1NMTA 3EY5A 3BLNA 2FIWA 3JTKA 4XPKA 2YGWA 4XNHC 4HKFA 3TO7A 2Q7BA 3R9GA 2VZZA 5CNPA 1MJ9A 4UCMA 5EC4A 5JQ4A 3D2MA 3SXNA 2FT0A 5AG5A 1Z9UA 1CM0A 2R1IA 1Q2YA 2BSWA 2J8RA 4U9YA 3TCVA 1Z4EA 2OH1A 4YFJA 5AGEA 4PK3A 3TOAA 4JWPA 4MY3A 3SXOA 2WSAA 4R9MA 1YREA 3N7ZA 1I1DA 2I00A 4AVAA 1ON0A 4KLVA 1KUYA 2FE7A 1IICA 4UCNA 5I0CA 4UFVA 3K9UA 1Y9WA 2A4NA 1U6MA 4A33A 3EO4A 3QB8A 1M44A 2JDDA 2AJ6A 3IWGA 1WK4A 1S7LA 4OADA 4KUBA 1OZPA 4F0XA 1M4GA 2WUUA 3PP9A 4HNWB 3GYAA 2DPSA 2JDCA 3G8WA 4NF1A 2FL4A 3GKRA 2H5MA 2ATRA 4R57A 5AG7A 5JPHA 2G3TA 2B5GA 4II9A 1NE9A 3DR6A 1I12A 4FD6A 4E0AA 4KLWA 4JXQA 4BBHA 1UFHA 4UWJA 5EBVA 4CGOA 4CYQA 1YR0A 4FD5A 2B4DA 4ONUA 2HQYA 2CNSA 3W91A 2F5IA 3P2HA 1IIDA 2Z10A 4KS9A 2PQ8A 3TO6A 4R87A 1QSOA 1N71A 3F8KA 4IUSA 2FS5A 2EUIA 4ZBGA 4M3SA 3DNSA 3FRMA 3R96A 4UFWA 4KSFA 4R3LA 2OB0A 4MY0A 4A31A 5KTDA 1WWZA 2IL4A 2NMTA 4MFKA 3UY5A 4B5PB 4R3KA 4JJXA 2YNEA 2Z3KA 4C2YA 4CS0B 5A28A 1PUAA 1Y9KA 2B3UA 2YNCC 1L0CA 1BO4A 4QC6A 2Z3LA 2HUZA 3EC4A 3A9LA 2R7HA 1M1DA 1YVOA 3FYNA 2DPTA 3DR8A 3S6GA 4XPDC 2P6FA 4LUAA 2BL1A 4B14A 4J3GA 5KTAA 4Y49B 2VEZA 4CAEA 3WR7A 2PSWA 4QUSA 4A2ZA 3DSBA 5E96A 2OU2A 1MJAA 5G20A 1K4JA 1RO5A 3H4QA 4I49A 1XE4A 5H84A 1VHSA 4PSXA 2YNDA 5J8FA 2PC1A 4L89A 4L8AA 4AB7A 3S6KA 2Z0ZA 5F49A 3B8GA 2REFA 3QAHA 1XMTA 4H6ZA 2YNCA 5IV0A 2AE6A 4OAEA 4K30A 2HV2A 1S7KA 3DDDA 4YRHA 4JLYA 4H6UA 3BJ8A 4H89A 4ZGYB 1YLEA 2D4PA 2CNTA 4YGOA 1QSTA 2VZYA 4KOXA 4LX9A 4UWIA 4UBRA 3I9SA 4CAWA 3ZZIA 3H5ZA 3CXPA 3T90A 2ARHA 4C7HA 4B13A 1V0CA 2OZGA 4HNXB 2OZHA 2PDOA 4B5OA 4MI4A 2P0WA 3FB3A 4C7IA 1CJWA 3MGDA 4AG9A 5G1ZA 4XPLA 1MJBA 2EVNA 4NXYA 4Q38A 1Y7RA 5G21A 2PR1A 1KUVA 2P6GA 1QSNA 2DXQA 3PZJA 3T9YA 2FXFA 4E8OA 2ZPAA 1YX0A 5DWNA 5KTCA 4BMHA 4JXRA 4PSWA 3VWDA 2ZW4A 4A32A 4CGMA 2G3AA 4CGNA 4XNHB 2B5GB 4Q36A 1XIXA 3RYOA 4C2XA 1KUXA 4KOUA 1S60A 2FCKA 4CRYB 1XF8A 1S7NA 5C82A 2VI7A 4HNYB 4UA3A 2FSRA 3IGRA 2B4DB 4KVOE 4CGLA 4EVYA 3D3SA 1S3ZA 2OZUA 4C68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTH A;  2J8M A;  4X5K A;  4B5P A;  5J8C A;  2VQY A;  3C26 A;  4QBJ A;  1YVK A;  5C88 A;  3TE4 A;  5GCN A;  5ISV A;  2BEI A;  3FBU A;  2GIV A;  3GY9 A;  2BUE A;  2QEC A;  1PU9 A;  4AVB A;  4PK2 A;  1M4D A;  2GE3 A;  1YGH A;  4IF5 A;  3FIX A;  2Q4V A;  3FNC A;  2B4B A;  4FD7 A;  5F48 A;  2ZXV A;  2VBQ A;  3EXN A;  5DWM A;  5IB0 A;  5HMN A;  2Q0Y A;  4MJ8 A;  2ZW7 A;  1R57 A;  4DNC A;  5F46 A;  2PRB A;  2JLM A;  3F0A A;  1MK4 A;  1M4I A;  1GHE A;  1B6B A;  3D2P A;  3ZJ0 A;  3R1K A;  4MHD A;  4CAX A;  3BJ7 A;  3EFA A;  1QSM A;  1RXT A;  2PR8 A;  1P4N A;  1LRZ A;  5FVJ A;  2Q4Y A;  3CXQ A;  1TIQ A;  4QVT A;  2C27 A;  4KVX A;  3R9E A;  5F47 A;  3TT2 A;  3VWE A;  2FIA A;  1SQH A;  5HH1 A;  3FXT A;  2CY2 A;  4NCZ A;  4F0Y A;  4FD4 A;  3JVN A;  3SHP A;  2D4O A;  1S7F A;  3W6S A;  4NSQ A;  4XPD B;  2ZW6 A;  4OLL A;  1IYK A;  1NSL A;  1B87 A;  5IX3 A;  3OWC A;  1P0H A;  1KZF A;  4NEX A;  4GS4 A;  3E0K A;  1I21 A;  3LOD A;  4CRZ B;  3P2F A;  4KOW A;  3TFY A;  2G0B A;  1BOB A;  3PGP A;  4ORF A;  4U5Y A;  4M85 A;  4KOS A;  1Q2D A;  4Y49 C;  2R98 A;  3JUW A;  3S6H A;  2QIR A;  2J8N A;  2B3V A;  4CAV A;  2Z11 A;  2Q44 A;  2QML A;  3G3S A;  2VXK A;  1XEB A;  3TOB A;  4AG7 A;  1IB1 E;  5H86 A;  4PV6 A;  2KCW A;  4QB9 A;  1QSR A;  3S6F A;  2X7B A;  3W6X A;  3R9F A;  2B58 A;  2WPX A;  3R95 A;  2RC4 A;  1Q2C A;  4KVM E;  4RI1 A;  4U9Z A;  3KKW A;  2Q04 A;  2ZW5 A;  4JD6 A;  4KOY A;  4MBU A;  3TO9 A;  4AVC A;  3I3G A;  1J4J A;  2JEV A;  2R8V A;  4E2A A;  4KOR A;  1IYL A;  4RS2 A;  2Y0M A;  4KOV A;  4KUA A;  3LD2 A;  2I79 A;  1Z4R A;  1VKC A;  3CXS A;  2REE A;  4KZT A;  1FY7 A;  1S5K A;  4KOT A;  4F6A A;  3D8P A;  3NE7 A;  2P6E A;  2CNM A;  1YK3 A;  2K5T A;  2O28 A;  2WPW A;  2GAN A;  3V8I A;  3F5B A;  1NMT A;  3EY5 A;  3BLN A;  2FIW A;  4XPK A;  4XNH C;  4HKF A;  3TO7 A;  2Q7B A;  3R9G A;  2VZZ A;  5CNP A;  1MJ9 A;  5EC4 A;  5JQ4 A;  3D2M A;  3SXN A;  2FT0 A;  1Z9U A;  1CM0 A;  2R1I A;  1Q2Y A;  2BSW A;  2J8R A;  4U9Y A;  3TCV A;  1Z4E A;  2OH1 A;  4YFJ A;  4PK3 A;  3TOA A;  4JWP A;  4MY3 A;  3SXO A;  4R9M A;  1YRE A;  3N7Z A;  1I1D A;  2I00 A;  4AVA A;  1ON0 A;  4KLV A;  1KUY A;  2FE7 A;  1IIC A;  5I0C A;  3K9U A;  1Y9W A;  2A4N A;  1U6M A;  3EO4 A;  3QB8 A;  1M44 A;  2JDD A;  2AJ6 A;  3IWG A;  1WK4 A;  1S7L A;  4OAD A;  4KUB A;  1OZP A;  1M4G A;  3PP9 A;  4HNW B;  3GYA A;  2JDC A;  3G8W A;  4NF1 A;  2FL4 A;  3GKR A;  2H5M A;  2ATR A;  4R57 A;  5JPH A;  2G3T A;  2B5G A;  4II9 A;  1NE9 A;  3DR6 A;  1I12 A;  4FD6 A;  4E0A A;  4KLW A;  4JXQ A;  1UFH A;  4UWJ A;  5EBV A;  1YR0 A;  4FD5 A;  2B4D A;  4ONU A;  2HQY A;  2CNS A;  3W91 A;  2F5I A;  3P2H A;  1IID A;  2Z10 A;  2PQ8 A;  3TO6 A;  4R87 A;  1QSO A;  1N71 A;  3F8K A;  4IUS A;  2FS5 A;  2EUI A;  4ZBG A;  4M3S A;  3DNS A;  3FRM A;  3R96 A;  4R3L A;  2OB0 A;  4MY0 A;  5KTD A;  1WWZ A;  2IL4 A;  2NMT A;  3UY5 A;  4B5P B;  4R3K A;  4JJX A;  4CS0 B;  1PUA A;  1Y9K A;  2B3U A;  1L0C A;  1BO4 A;  4QC6 A;  2HUZ A;  3EC4 A;  2R7H A;  1M1D A;  1YVO A;  3FYN A;  3DR8 A;  3S6G A;  4XPD C;  2P6F A;  4LUA A;  2BL1 A;  4J3G A;  5KTA A;  4Y49 B;  2VEZ A;  3WR7 A;  2PSW A;  4QUS A;  3DSB A;  5E96 A;  2OU2 A;  1MJA A;  1K4J A;  1RO5 A;  3H4Q A;  4I49 A;  1XE4 A;  5H84 A;  1VHS A;  4PSX A;  5J8F A;  2PC1 A;  4L89 A;  4L8A A;  4AB7 A;  3S6K A;  2Z0Z A;  5F49 A;  3B8G A;  2REF A;  3QAH A;  1XMT A;  4H6Z A;  5IV0 A;  2AE6 A;  4OAE A;  4K30 A;  2HV2 A;  1S7K A;  3DDD A;  4YRH A;  4JLY A;  4H6U A;  3BJ8 A;  4H89 A;  1YLE A;  2D4P A;  2CNT A;  4YGO A;  1QST A;  2VZY A;  4KOX A;  4LX9 A;  4UWI A;  4UBR A;  3I9S A;  4CAW A;  3ZZI A;  3CXP A;  3T90 A;  2ARH A;  1V0C A;  2OZG A;  4HNX B;  2OZH A;  2PDO A;  4B5O A;  4MI4 A;  2P0W A;  3FB3 A;  1CJW A;  3MGD A;  4AG9 A;  4XPL A;  1MJB A;  2EVN A;  4NXY A;  1Y7R A;  2PR1 A;  1KUV A;  2P6G A;  1QSN A;  2DXQ A;  3PZJ A;  3T9Y A;  2FXF A;  4E8O A;  2ZPA A;  1YX0 A;  5DWN A;  5KTC A;  4BMH A;  4JXR A;  4PSW A;  3VWD A;  2ZW4 A;  2G3A A;  4XNH B;  2B5G B;  3RYO A;  1XIX A;  1KUX A;  4KOU A;  1S60 A;  2FCK A;  4CRY B;  1XF8 A;  1S7N A;  5C82 A;  2VI7 A;  4HNY B;  4UA3 A;  2FSR A;  3IGR A;  2B4D B;  4KVO E;  4EVY A;  3D3S A;  1S3Z A;  2OZU A; 
#chains in the Genus database with same CATH topology
 4MFJ A;  3KZW A;  3TTH A;  1AUG A;  1TF8 A;  1ZO0 A;  1R3N A;  3IU1 A;  2J8M A;  4X5K A;  2Z3P A;  4B5P A;  5J8C A;  2VQY A;  3C26 A;  4QBJ A;  1VHE A;  1YVK A;  3PB9 X;  4OME A;  1CP6 A;  5C88 A;  4CGP A;  2EK8 A;  3TE4 A;  4UFX A;  5GCN A;  5ISV A;  4G1P A;  2BEI A;  3HUV A;  3FBU A;  5K8P A;  4OC4 A;  3B3S A;  1XBU A;  2GIV A;  3DLJ A;  3FJU A;  2BUE A;  3GY9 A;  4P6Y A;  1ELL P;  2QEC A;  2ZEP A;  3IU2 A;  4BIN A;  1PU9 A;  4AVB A;  4W9Y A;  4KSI A;  3H8G A;  4PK2 A;  1M4D A;  1LAM A;  2GE3 A;  2XEG A;  1YGH A;  4IF5 A;  2AFO A;  1LAN A;  4MHZ A;  4MCQ A;  2QJ8 A;  3FIX A;  4ZY2 A;  2Q4V A;  3FNC A;  4MCR A;  2B4B A;  4FD7 A;  5D29 A;  3TX8 A;  5J1Q A;  5F48 A;  2ZXV A;  4MFL A;  2VBQ A;  3EXN A;  1CP7 A;  3SI1 A;  4CYN A;  2Z3M A;  5DWM A;  5IB0 A;  3K9T A;  4CYP A;  1BPM A;  2OOT A;  3KI9 A;  4ZX9 A;  2AFS A;  5HMN A;  2Q0Y A;  4FWU A;  1VGY A;  2F7V A;  4MJ8 A;  1VIX A;  4X8I A;  5HXD A;  2ZW7 A;  1R57 A;  4DNC A;  5F46 A;  2PRB A;  2JLM A;  2V8G A;  1MK4 A;  3F0A A;  2EBJ A;  1M4I A;  4UCP A;  5DS0 A;  4CYO A;  3PB4 X;  4A30 A;  5AG4 A;  1GHE A;  2PJ7 A;  1XJO A;  2GU2 A;  1B6B A;  3GLJ A;  1ARL A;  3D2P A;  4MFQ A;  5HVG A;  4A94 A;  3ZJ0 A;  4OC2 A;  2Z3N A;  3R1K A;  4MHD A;  4CAX A;  3B3W A;  3BJ7 A;  3FVL A;  1H8L A;  5JGF A;  3EFA A;  1QSM A;  3ISX A;  1Z8L A;  3BXM A;  1RXT A;  5AG6 A;  3WC6 A;  2PR8 A;  1P4N A;  1LRZ A;  1YW4 A;  1KWM A;  2Q4Y A;  5FVJ A;  3CXQ A;  2ZED A;  1TIQ A;  2Q7S A;  2CIJ A;  1IOF A;  2CXA A;  3VAT A;  4QVT A;  2C27 A;  4KVX A;  3R9E A;  5A27 A;  1Q7L A;  5F47 A;  3TT2 A;  3VWE A;  4A95 A;  2FIA A;  1ARM A;  1XMB A;  3D7F A;  1YQE A;  1SQH A;  2PCU A;  2IJZ A;  3KR4 A;  4NGN A;  5HH1 A;  3FXT A;  2Z3O A;  1HDQ A;  1TKF A;  2AFZ A;  1DE4 C;  2CY2 A;  4NCZ A;  4F0Y A;  2WZN A;  4FD4 A;  3JVN A;  5LRJ A;  3SHP A;  2D4O A;  1S7F A;  2V8H A;  4NGT A;  3W6S A;  4NSQ A;  4PXD A;  4XPD B;  2HB6 A;  3D68 A;  1EE3 P;  1YLO A;  2ZW6 A;  4OLL A;  1IYK A;  2C6P A;  3BI1 A;  1NSL A;  3PRT A;  5CPA A;  1B87 A;  1Z2L A;  5IX3 A;  3OWC A;  1P0H A;  1KZF A;  4NEX A;  5HVF A;  4GS4 A;  2PVV A;  1Z8T A;  3MN8 A;  3RBU A;  4BD9 A;  3E0K A;  1I21 A;  3LOD A;  4CRZ B;  3B7I A;  3P2F A;  4PQA A;  4KOW A;  3SJX A;  2CTC A;  3TFY A;  2NYQ A;  2IQ6 A;  2G0B A;  4B11 A;  1BOB A;  3LAC A;  2ZEH A;  3PGP A;  4ORF A;  4U5Y A;  2G9D A;  3FEC A;  3KAS A;  3NH4 A;  4KOS A;  4M85 A;  3V7Z A;  4CPA A;  1Q2D A;  4MHY A;  4Y49 C;  1ELM P;  2R98 A;  2Q4Z A;  1AYE A;  2PIZ A;  3MRU A;  3JUW A;  4RUH A;  3S6H A;  2QIR A;  3PFE A;  4P4B A;  2J8N A;  1M4L A;  1ZG7 A;  2B3V A;  4CAV A;  2Z11 A;  1JWQ A;  2Q44 A;  4MRI A;  2RB7 A;  5CBM A;  5K8O A;  5K8N A;  4A39 A;  2O53 A;  4P4I A;  2PJ9 A;  2QML A;  3G3S A;  2VXK A;  4B10 A;  3ISZ A;  1ZLI A;  1XEB A;  3TOB A;  5LRK A;  3NH5 A;  5G22 A;  4B12 A;  5D8N A;  4AG7 A;  3KR5 A;  1IB1 E;  5H86 A;  4PV6 A;  3SJE A;  5BWA B;  4Z65 A;  2BOA A;  3NA6 A;  4PXE A;  2KCW A;  4QB9 A;  1QSR A;  3S6F A;  2X7B A;  3W6X A;  5LYF A;  1BPN A;  1IOI A;  3R9F A;  4R7M A;  3KQZ A;  2HC9 A;  4NF1 A;  2PJ2 A;  3B3C A;  4NGR A;  4CAF A;  2B58 A;  2WPX A;  3R95 A;  3IO1 A;  1CPS A;  4ZI6 A;  1LOK A;  4C2Z A;  2RC4 A;  4R76 A;  1Q2C A;  4KVM E;  2BO9 A;  4RI1 A;  4U9Z A;  5LYL A;  3B35 A;  3KKW A;  3PBB A;  2Q04 A;  2DEA A;  2ZW5 A;  4JD6 A;  4KOY A;  4MBU A;  4PPZ A;  3SI2 A;  3TO9 A;  4AVC A;  3I3G A;  1J4J A;  2JEV A;  1JQG A;  2R8V A;  4E2A A;  4WWV A;  3WT4 A;  4KOR A;  1IYL A;  4EFD A;  1QMU A;  3HLP A;  4RS2 A;  2Y0M A;  2C1C A;  2ZEN A;  3B3T A;  4KOV A;  4KUA A;  4KSA A;  4IHM A;  3SJG A;  4OP4 A;  3LD2 A;  2I79 A;  1Y7E A;  4MFP A;  4MFZ A;  1XRY A;  2ODF A;  2AFW A;  3B2Y A;  1Z4R A;  1VKC A;  1ZG8 A;  2POK A;  3CPX A;  3CXS A;  4EME A;  1HEE A;  3IWE A;  2REE A;  3TC8 A;  3D7G A;  4EWT A;  4OKO A;  3S9L A;  1BLL E;  4KZT A;  1YME A;  3T8W A;  1FY7 A;  1S5K A;  2CTB A;  4KOT A;  5EMI A;  4F6A A;  2JEW A;  4ZYQ A;  3D8P A;  4R6T A;  3NE7 A;  2OR4 A;  2P6E A;  3IFE A;  4GXH A;  4MCS A;  2CNM A;  1YK3 A;  2K5T A;  2O28 A;  2WPW A;  1YSJ A;  2GAN A;  3V8I A;  3F5B A;  1NMT A;  1X12 A;  3EY5 A;  3BLN A;  4C68 A;  3GB0 A;  1Y0R A;  2FIW A;  3JTK A;  5ELY A;  4MHP A;  4UIB A;  4XPK A;  2V77 A;  3CDX A;  2GRE A;  4P10 A;  4TNU A;  2YGW A;  4H2K A;  2AFM A;  4XNH C;  3D67 A;  4HKF A;  5HVH A;  3CZX A;  3TO7 A;  2ZOF A;  2Q7B A;  3R9G A;  5JH9 A;  4F9V A;  1BAV A;  2ZEG A;  2VZZ A;  3H8F A;  2EWB A;  1YW6 A;  2RFH A;  3IEH A;  5CNP A;  1MJ9 A;  4UCM A;  5EC4 A;  5JQ4 A;  3D4U A;  3D2M A;  3IIB A;  3SXN A;  2FT0 A;  4FUU A;  5AG5 A;  1Z9U A;  1CM0 A;  1F2P A;  2PE3 A;  3LMS A;  2R1I A;  1Q2Y A;  2BSW A;  3QNV A;  4O23 A;  2J8R A;  4MMO A;  4U9Y A;  1Z4E A;  3TCV A;  4ZY0 A;  2PJA A;  4NGP A;  2OH1 A;  4YFJ A;  5AGE A;  4PK3 A;  3TOA A;  4UF4 A;  4JWP A;  4MY3 A;  3SXO A;  4UEZ A;  2WSA A;  2GFQ A;  4R9M A;  3LWU A;  1YRE A;  3N7Z A;  1I1D A;  2I00 A;  4AVA A;  1ON0 A;  4KLV A;  1KUY A;  2FE7 A;  1IIC A;  3KQX A;  3PB7 X;  4UCN A;  3WC5 A;  3PB6 X;  3IWW A;  4P4E A;  3VAR A;  5I0C A;  4UFV A;  3K9U A;  1Y9W A;  2A4N A;  1PCA A;  2CF4 A;  4ZX8 A;  1U6M A;  4A33 A;  3EO4 A;  3QB8 A;  1M44 A;  1FT7 A;  2JDD A;  2AJ6 A;  3NH8 A;  3NFZ A;  3IWG A;  1WK4 A;  3B3V A;  1S7L A;  3KHZ A;  4OAD A;  1Y0Y A;  3GIU A;  4KUB A;  4WJB A;  1OZP A;  2PVW A;  4F0X A;  2XEI A;  1M4G A;  2ZEM A;  2WUU A;  3PP9 A;  4HNW B;  3GYA A;  2JBJ A;  1NSA A;  2DPS A;  2JDC A;  1IY7 A;  2PJ5 A;  2FL4 A;  2J9A A;  1VHO A;  2H5M A;  3G8W A;  3GKR A;  4M6H A;  2ATR A;  4NGS A;  4R57 A;  5AG7 A;  5JPH A;  2G3T A;  4YU9 A;  3JRU A;  4P44 A;  3IJ3 A;  5F09 A;  2B5G A;  4II9 A;  1NE9 A;  3DR6 A;  1I12 A;  4FD6 A;  4NGM A;  4LQ6 A;  4E0A A;  4UEE A;  4KLW A;  1IGB A;  3PB8 X;  3RO0 A;  1FNO A;  4JXQ A;  4BBH A;  5IB9 A;  1UFH A;  4UWJ A;  5EBV A;  4CGO A;  4CYQ A;  4GM5 A;  1YR0 A;  4A37 A;  4FD5 A;  3WAB A;  6CPA A;  4IK2 A;  2B4D A;  4ONU A;  2ANP A;  2HQY A;  2CNS A;  3W91 A;  2F5I A;  3FED A;  3FH4 A;  3FEE A;  3P2H A;  1XFO A;  1IID A;  2Z10 A;  4KS9 A;  2PQ8 A;  2PJ8 A;  3CT9 A;  3TO6 A;  4R87 A;  1GYT A;  4DYO A;  1QSO A;  1N71 A;  2PJ4 A;  3KGQ A;  3F8K A;  4IUS A;  2BCO A;  2FS5 A;  2AFX A;  2EUI A;  4ZBG A;  4F9U A;  4OC3 A;  2DF5 A;  4M3S A;  3DNS A;  4NJQ A;  3FRM A;  3R96 A;  4UFW A;  4KSF A;  3CPA A;  2OB0 A;  4R3L A;  4R8F A;  1PYT B;  1XOV A;  1CPX A;  4MY0 A;  1LAP A;  3S9N A;  3KL9 A;  4A31 A;  2JBK A;  2F8H A;  2Q43 A;  1Z8W A;  5KTD A;  4LQG A;  1WWZ A;  2IL4 A;  2NMT A;  4MFK A;  3UY5 A;  4B5P B;  1UWY A;  4R3K A;  4F8Z A;  2YNE A;  4JJX A;  4JYW A;  2XEF A;  2ABZ A;  2QVP A;  2Z3K A;  4C2Y A;  4CS0 B;  5A28 A;  1PUA A;  1Y9K A;  2B3U A;  2WYR A;  2YNC C;  3KHX A;  4K3N A;  1L0C A;  1BO4 A;  1RTQ A;  4AXV A;  3FX6 A;  2ZEL A;  4NGQ A;  2Z3L A;  4QC6 A;  4HPS A;  4B6Z A;  1LCP A;  2HUZ A;  3EC4 A;  3A9L A;  2R7H A;  1M1D A;  1YVO A;  2ZEF A;  3FYN A;  2DPT A;  1LFW A;  3DR8 A;  3S6G A;  4NJR A;  1CX8 A;  3PBE A;  4XPD C;  2P6F A;  4LUA A;  2BL1 A;  3QAY A;  4B14 A;  4J3G A;  4OC0 A;  5KTA A;  5LRG A;  4Y49 B;  2VEZ A;  4CAE A;  1CG2 A;  2GLJ A;  3WR7 A;  4MHN A;  2PSW A;  4QUS A;  4A2Z A;  3DSB A;  5E96 A;  3FMC A;  2OU2 A;  1MJA A;  5G20 A;  1K4J A;  1Z5R A;  2PJ1 A;  3H8E A;  1RO5 A;  3H4Q A;  2QYV A;  4I49 A;  4P4F A;  1XE4 A;  4Q7A A;  5H84 A;  5THW A;  4FBE A;  1VHS A;  1IU8 A;  2ZEE A;  3SI0 A;  4PSX A;  3S9M A;  2YND A;  3D7H A;  4FAI A;  5J8F A;  2PC1 A;  2PJ0 A;  4L89 A;  4L8A A;  1A2Z A;  4AB7 A;  3S6K A;  2Z0Z A;  5F49 A;  3B8G A;  2REF A;  3QAH A;  1TF9 A;  1XMT A;  4H6Z A;  2IMO A;  2YNC A;  1QQ9 A;  4M6G A;  4OC1 A;  4PXB A;  3WC7 A;  5IV0 A;  4OIW A;  2AE6 A;  4OAE A;  4K30 A;  2HV2 A;  1S7K A;  3DDD A;  4YRH A;  4A38 A;  2EO8 A;  1AMP A;  4JLY A;  4H6U A;  3BJ8 A;  5JM6 A;  1Z8X A;  4PXC A;  5I4M A;  4H89 A;  4ZGY B;  1OBR A;  2EK9 A;  3D66 A;  3V38 A;  1YLE A;  2D4P A;  2CNT A;  4YGO A;  1QST A;  2PRQ A;  3VH9 A;  1TKH A;  1R43 A;  3IC1 A;  2VZY A;  4KOX A;  4LX9 A;  4UWI A;  1HDU A;  3D7D A;  3PFO A;  4UBR A;  1ZLH A;  3I9S A;  3BHX A;  4CAW A;  4P4D A;  3RAM A;  3ZZI A;  2NSM A;  2V8V A;  3CXP A;  3H5Z A;  4MXU A;  2PIY A;  2ARH A;  3I1U A;  3T90 A;  4B13 A;  4C7H A;  1V0C A;  7CPA A;  4P4J A;  4OC5 A;  4RN7 A;  4TWE A;  1F2O A;  2I3C A;  2OZG A;  4HNX B;  2OZH A;  3DGV A;  2PDO A;  4B5O A;  4MI4 A;  1F57 A;  4OID A;  2P0W A;  4DUK A;  3FB3 A;  4C7I A;  3L2N A;  1CJW A;  3MGD A;  4AG9 A;  4DJL A;  3NE8 A;  4P45 A;  5G1Z A;  4XPL A;  4X3R A;  3K2K A;  3SJF A;  1MJB A;  2EVN A;  2VL1 A;  2V8D A;  1Y7R A;  3PEI A;  4NXY A;  4Q38 A;  5LYI A;  2GLF A;  5G21 A;  4ZY1 A;  2PR1 A;  1KUV A;  2O4H A;  8CPA A;  2P6G A;  1QSN A;  5LYD A;  2DXQ A;  3PZJ A;  3RNZ A;  2FXF A;  3T9Y A;  4E8O A;  2FVG A;  2ZPA A;  1YX0 A;  5DWN A;  5KTC A;  4UIA A;  2PJ3 A;  4BMH A;  4JXR A;  4PSW A;  1ZG9 A;  3BI0 A;  3VWD A;  2ZW4 A;  4A32 A;  2C6C A;  4CGM A;  2PJ6 A;  4UEF A;  2G3A A;  2ZEO A;  4MCP A;  4CGN A;  2ZOG A;  4XNH B;  4M6I A;  2B5G B;  4Q36 A;  1XIX A;  3RYO A;  4C2X A;  1KUX A;  4KOU A;  1CBX A;  2Q51 A;  5K8M A;  1S60 A;  4JZ0 A;  2AFU A;  2FCK A;  2PJB A;  4CRY B;  2PJC A;  1TKJ A;  1XF8 A;  2XEJ A;  2C6G A;  3FF3 A;  3RZA A;  1S7N A;  5C82 A;  2VI7 A;  3GUX A;  4HNY B;  4UA3 A;  2FSR A;  1DTD A;  3IGR A;  4IAV A;  1TXR A;  2B4D B;  4KVO E;  4NFR A;  4CGL A;  4EVY A;  4ONW A;  3D3S A;  3N5F A;  1S3Z A;  4YWY A;  2OZU A;  4X2T A;  1X10 A; 
#chains in the Genus database with same CATH homology
 4MFJ A;  3TTH A;  1ZO0 A;  3IU1 A;  2J8M A;  4X5K A;  2Z3P A;  4B5P A;  5J8C A;  2VQY A;  3C26 A;  4QBJ A;  1YVK A;  5C88 A;  4CGP A;  3TE4 A;  4UFX A;  5GCN A;  5ISV A;  2BEI A;  3FBU A;  2GIV A;  3GY9 A;  2BUE A;  2QEC A;  3IU2 A;  1PU9 A;  4AVB A;  4PK2 A;  1M4D A;  2GE3 A;  1YGH A;  4IF5 A;  3FIX A;  2Q4V A;  3FNC A;  2B4B A;  4FD7 A;  5F48 A;  2ZXV A;  4MFL A;  2VBQ A;  3EXN A;  4CYN A;  2Z3M A;  5DWM A;  5IB0 A;  4CYP A;  5HMN A;  2Q0Y A;  4MJ8 A;  2ZW7 A;  1R57 A;  4DNC A;  5F46 A;  2PRB A;  2JLM A;  3F0A A;  1MK4 A;  4UCP A;  5AG4 A;  1M4I A;  4CYO A;  4A30 A;  1GHE A;  1B6B A;  3D2P A;  4MFQ A;  3ZJ0 A;  2Z3N A;  3R1K A;  4MHD A;  4CAX A;  3BJ7 A;  3EFA A;  1QSM A;  5AG6 A;  1RXT A;  2PR8 A;  1P4N A;  1LRZ A;  5FVJ A;  2Q4Y A;  3CXQ A;  1TIQ A;  2CXA A;  4QVT A;  2C27 A;  4KVX A;  3R9E A;  5A27 A;  5F47 A;  3TT2 A;  3VWE A;  4A95 A;  2FIA A;  1SQH A;  5HH1 A;  3FXT A;  2Z3O A;  2CY2 A;  4NCZ A;  4F0Y A;  4FD4 A;  3JVN A;  3SHP A;  2D4O A;  1S7F A;  3W6S A;  4NSQ A;  4XPD B;  2ZW6 A;  4OLL A;  1IYK A;  1NSL A;  1B87 A;  5IX3 A;  3OWC A;  1P0H A;  1KZF A;  4NEX A;  4GS4 A;  3E0K A;  1I21 A;  3LOD A;  4CRZ B;  3P2F A;  4KOW A;  3TFY A;  2G0B A;  4B11 A;  1BOB A;  3PGP A;  4ORF A;  4U5Y A;  4M85 A;  4KOS A;  1Q2D A;  4Y49 C;  2R98 A;  3JUW A;  3S6H A;  2QIR A;  2J8N A;  2B3V A;  4CAV A;  2Z11 A;  2Q44 A;  2QML A;  3G3S A;  2VXK A;  4B10 A;  1XEB A;  3TOB A;  5G22 A;  4B12 A;  4AG7 A;  1IB1 E;  5H86 A;  4PV6 A;  5BWA B;  2KCW A;  4QB9 A;  1QSR A;  3S6F A;  2X7B A;  3W6X A;  3R9F A;  4CAF A;  2B58 A;  2WPX A;  3R95 A;  4C2Z A;  2RC4 A;  1Q2C A;  4KVM E;  4RI1 A;  4U9Z A;  3KKW A;  2Q04 A;  2ZW5 A;  4JD6 A;  4KOY A;  4MBU A;  3TO9 A;  4AVC A;  3I3G A;  1J4J A;  2JEV A;  2R8V A;  4E2A A;  4KOR A;  1IYL A;  4RS2 A;  2Y0M A;  4KSA A;  4KOV A;  4KUA A;  3LD2 A;  2I79 A;  4MFP A;  4MFZ A;  1Z4R A;  1VKC A;  3CXS A;  3IWE A;  2REE A;  4KZT A;  1FY7 A;  1S5K A;  4KOT A;  4F6A A;  3D8P A;  3NE7 A;  2P6E A;  2CNM A;  1YK3 A;  2K5T A;  2O28 A;  2WPW A;  2GAN A;  3V8I A;  3F5B A;  1NMT A;  3EY5 A;  3BLN A;  2FIW A;  3JTK A;  4XPK A;  2YGW A;  4XNH C;  4HKF A;  3TO7 A;  2Q7B A;  3R9G A;  2VZZ A;  5CNP A;  1MJ9 A;  4UCM A;  5EC4 A;  5JQ4 A;  3D2M A;  3SXN A;  2FT0 A;  5AG5 A;  1Z9U A;  1CM0 A;  2R1I A;  1Q2Y A;  2BSW A;  2J8R A;  4U9Y A;  3TCV A;  1Z4E A;  2OH1 A;  4YFJ A;  5AGE A;  4PK3 A;  3TOA A;  4JWP A;  4MY3 A;  3SXO A;  2WSA A;  4R9M A;  1YRE A;  3N7Z A;  1I1D A;  2I00 A;  4AVA A;  1ON0 A;  4KLV A;  1KUY A;  2FE7 A;  1IIC A;  4UCN A;  5I0C A;  4UFV A;  3K9U A;  1Y9W A;  2A4N A;  1U6M A;  4A33 A;  3EO4 A;  3QB8 A;  1M44 A;  2JDD A;  2AJ6 A;  3IWG A;  1WK4 A;  1S7L A;  4OAD A;  4KUB A;  1OZP A;  4F0X A;  1M4G A;  2WUU A;  3PP9 A;  4HNW B;  3GYA A;  2DPS A;  2JDC A;  3G8W A;  4NF1 A;  2FL4 A;  3GKR A;  2H5M A;  2ATR A;  4R57 A;  5AG7 A;  5JPH A;  2G3T A;  2B5G A;  4II9 A;  1NE9 A;  3DR6 A;  1I12 A;  4FD6 A;  4E0A A;  4KLW A;  4JXQ A;  4BBH A;  1UFH A;  4UWJ A;  5EBV A;  4CGO A;  4CYQ A;  1YR0 A;  4FD5 A;  2B4D A;  4ONU A;  2HQY A;  2CNS A;  3W91 A;  2F5I A;  3P2H A;  1IID A;  2Z10 A;  4KS9 A;  2PQ8 A;  3TO6 A;  4R87 A;  1QSO A;  1N71 A;  3F8K A;  4IUS A;  2FS5 A;  2EUI A;  4ZBG A;  4M3S A;  3DNS A;  3FRM A;  3R96 A;  4UFW A;  4KSF A;  4R3L A;  2OB0 A;  4MY0 A;  4A31 A;  5KTD A;  1WWZ A;  2IL4 A;  2NMT A;  4MFK A;  3UY5 A;  4B5P B;  4R3K A;  4JJX A;  2YNE A;  2Z3K A;  4C2Y A;  4CS0 B;  5A28 A;  1PUA A;  1Y9K A;  2B3U A;  2YNC C;  1L0C A;  1BO4 A;  4QC6 A;  2Z3L A;  2HUZ A;  3EC4 A;  3A9L A;  2R7H A;  1M1D A;  1YVO A;  3FYN A;  2DPT A;  3DR8 A;  3S6G A;  4XPD C;  2P6F A;  4LUA A;  2BL1 A;  4B14 A;  4J3G A;  5KTA A;  4Y49 B;  2VEZ A;  4CAE A;  3WR7 A;  2PSW A;  4QUS A;  4A2Z A;  3DSB A;  5E96 A;  2OU2 A;  1MJA A;  5G20 A;  1K4J A;  1RO5 A;  3H4Q A;  4I49 A;  1XE4 A;  5H84 A;  1VHS A;  4PSX A;  2YND A;  5J8F A;  2PC1 A;  4L89 A;  4L8A A;  4AB7 A;  3S6K A;  2Z0Z A;  5F49 A;  3B8G A;  2REF A;  3QAH A;  1XMT A;  4H6Z A;  2YNC A;  5IV0 A;  2AE6 A;  4OAE A;  4K30 A;  2HV2 A;  1S7K A;  3DDD A;  4YRH A;  4JLY A;  4H6U A;  3BJ8 A;  4H89 A;  4ZGY B;  1YLE A;  2D4P A;  2CNT A;  4YGO A;  1QST A;  2VZY A;  4KOX A;  4LX9 A;  4UWI A;  4UBR A;  3I9S A;  4CAW A;  3ZZI A;  3H5Z A;  3CXP A;  3T90 A;  2ARH A;  4C7H A;  4B13 A;  1V0C A;  2OZG A;  4HNX B;  2OZH A;  2PDO A;  4B5O A;  4MI4 A;  2P0W A;  3FB3 A;  4C7I A;  1CJW A;  3MGD A;  4AG9 A;  5G1Z A;  4XPL A;  1MJB A;  2EVN A;  4NXY A;  4Q38 A;  1Y7R A;  5G21 A;  2PR1 A;  1KUV A;  2P6G A;  1QSN A;  2DXQ A;  3PZJ A;  3T9Y A;  2FXF A;  4E8O A;  2ZPA A;  1YX0 A;  5DWN A;  5KTC A;  4BMH A;  4JXR A;  4PSW A;  3VWD A;  2ZW4 A;  4A32 A;  4CGM A;  2G3A A;  4CGN A;  4XNH B;  2B5G B;  4Q36 A;  1XIX A;  3RYO A;  4C2X A;  1KUX A;  4KOU A;  1S60 A;  2FCK A;  4CRY B;  1XF8 A;  1S7N A;  5C82 A;  2VI7 A;  4HNY B;  4UA3 A;  2FSR A;  3IGR A;  2B4D B;  4KVO E;  4CGL A;  4EVY A;  3D3S A;  1S3Z A;  2OZU A;  4C68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...