1BO4A

Crystal structure of a gcn5-related n-acetyltransferase: serratia marescens aminoglycoside 3-n-acetyltransferase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
137
Chain Sequence
GIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-ACETYLTRANSF
publication title Crystal structure of a GCN5-related N-acetyltransferase: Serratia marcescens aminoglycoside 3-N-acetyltransferase.
pubmed doi rcsb
source organism Serratia marcescens
total genus 34
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bo4A00
1MJ9A 1QSNA 2D4PA 2PRBA 4CS0B 2I79A 1CJWA 4RI1A 1MJAA 2DXQA 2B58A 3N7ZA 3D8PA 1S7FA 3NE7A 1I1DA 5ISVA 1GHEA 4KOSA 2Q4VA 5DWMA 4Y49C 2Z10A 4RS2A 1QSTA 3S6FA 2Q4YA 2RC4A 4R3KA 5C82A 2AJ6A 2ZW6A 2B4DB 4FD6A 1Y7RA 3PGPA 3W91A 3W6XA 3DR8A 3GY9A 2B3UA 4HKFA 1Q2CA 3DNSA 4B5PA 4R9MA 4FD5A 5IB0A 1IYKA 2K5TA 3MGDA 4B5OA 4R3LA 3BJ7A 3SXOA 2OZGA 3TFYA 2FE7A 1XE4A 2PR1A 4H6ZA 2BL1A 5F46A 2ZXVA 2P6EA 3TCVA 4KLVA 1YGHA 3JVNA 1I21A 4MI4A 1R57A 3LD2A 1QSRA 3TE4A 3VWDA 2CNTA 3S6HA 2ARHA 3FNCA 2GE3A 5GCNA 4CAWA 4M85A 4XNHC 4CRZB 2HV2A 2Q44A 1FY7A 2Q0YA 1BO4A 2FXFA 4XPLA 2F5IA 2OZHA 4UBRA 3R9GA 3QB8A 2ZW5A 2B4DA 3OWCA 5KTAA 2A4NA 2R7HA 2VZYA 2J8RA 2CNSA 4KOTA 3T9YA 1PU9A 3FB3A 2VXKA 4EVYA 1B6BA 2VQYA 4UWJA 4Y49B 3FBUA 4KORA 2Z0ZA 2B3VA 1U6MA 2CNMA 2HQYA 3G8WA 4KOXA 1XEBA 3QAHA 2GIVA 3I3GA 4PV6A 2I00A 3KKWA 2OZUA 4AG7A 2QIRA 3DSBA 3TOAA 4JLYA 4YRHA 2VEZA 1YK3A 1I12A 4JJXA 4JXRA 1J4JA 3TO6A 4JWPA 4U9ZA 2FL4A 5F47A 5F49A 1NE9A 3G3SA 4PK3A 3TT2A 3BJ8A 3S6GA 2CY2A 4HNXB 4NF1A 4KUBA 4L8AA 2VBQA 3EC4A 3E0KA 1M4DA 2FT0A 5J8CA 3CXSA 1L0CA 2B4BA 4YGOA 1KUYA 2C27A 1P0HA 1M4GA 2JEVA 3CXPA 4PSXA 4KLWA 3EFAA 4K30A 3F5BA 4KOYA 4XNHB 4KZTA 3D2PA 3H4QA 5J8FA 4LX9A 1S5KA 2WPWA 1S7KA 3WR7A 1M4IA 4NXYA 1Y9WA 2QECA 2GANA 2PQ8A 1KZFA 1VKCA 4FD7A 1IICA 4U5YA 4AVBA 2X7BA 5KTCA 2IL4A 1KUVA 1IIDA 5CNPA 1XIXA 4OAEA 4IUSA 1RO5A 3PP9A 4E0AA 2EUIA 1YVKA 4FD4A 5JPHA 3V8IA 4IF5A 5C88A 2O28A 4J3GA 1M44A 3FYNA 4YFJA 1S3ZA 2P6GA 4E8OA 2HUZA 4XPDB 3ZJ0A 3B8GA 3S6KA 3TO7A 4JXQA 2BUEA 1YR0A 4ORFA 5E96A 1P4NA 4H89A 1S7LA 4NEXA 2PR8A 4UWIA 4II9A 3R95A 4QBJA 2H5MA 1QSOA 4PK2A 1M1DA 3VWEA 3TO9A 4QC6A 4OLLA 4F0YA 3IWGA 2FCKA 5I0CA 4HNYB 1QSMA 4XPDC 3GYAA 4I49A 3EXNA 2BEIA 1IYLA 1Z4EA 3DDDA 2NMTA 3I9SA 4LUAA 2REFA 2R8VA 5FVJA 2P6FA 1PUAA 5HMNA 2KCWA 2ZW7A 1N71A 5F48A 4AVAA 1NSLA 2Y0MA 3PZJA 2QMLA 5H86A 2REEA 1SQHA 4R87A 2FSRA 3BLNA 4NSQA 2B5GB 2PC1A 1K4JA 1WK4A 2R1IA 1MJBA 3SXNA 2OH1A 4ONUA 1S7NA 4QUSA 5H84A 4U9YA 5EC4A 1BOBA 4KOVA 2VZZA 2D4OA 1YLEA 3P2HA 2FIWA 1RXTA 2PSWA 4XPKA 1YX0A 3FXTA 3R1KA 1IB1E 4OADA 1ON0A 1MK4A 2FS5A 4E2AA 2Z11A 1UFHA 3JUWA 5KTDA 3FRMA 1KUXA 3T90A 3F0AA 4CAXA 4MY0A 3D2MA 2JLMA 2Q7BA 1YREA 4MJ8A 4UA3A 2PDOA 4BMHA 2J8NA 2AE6A 1XF8A 2ZPAA 1Z9UA 4H6UA 3RYOA 2OB0A 4AG9A 3TTHA 2WPXA 2FIAA 2G3TA 3F8KA 2BSWA 4KVOE 3LODA 3R9EA 2G0BA 1NMTA 5HH1A 2B5GA 4MHDA 2JDDA 1Z4RA 4X5KA 2ZW4A 3R96A 2G3AA 5EBVA 1LRZA 3ZZIA 1YVOA 2JDCA 4HNWB 4KVXA 4L89A 1V0CA 4MY3A 1VHSA 3CXQA 1B87A 3K9UA 1CM0A 4R57A 4AB7A 4KOUA 1WWZA 3EO4A 2R98A 3W6SA 4KOWA 1S60A 1OZPA 1TIQA 4AVCA 4NCZA 2VI7A 3P2FA 3D3SA 3UY5A 1Q2DA 2P0WA 3FIXA 5JQ4A 3IGRA 2OU2A 1Y9KA 4CRYB 2J8MA 5IX3A 4MBUA 3C26A 4B5PB 2Q04A 3DR6A 3EY5A 4CAVA 4F6AA 3SHPA 4PSWA 3R9FA 4QVTA 4DNCA 4QB9A 5DWNA 4M3SA 4JD6A 2EVNA 4GS4A 1Q2YA 2ATRA 4KUAA 3TOBA 5IV0A 3GKRA 4KVME 1XMTA 4ZBGA
chains in the Genus database with same CATH superfamily
1MJ9A 1QSNA 4ZY0A 5AG6A 2V8DA 3L2NA 4B14A 4YWYA 2D4PA 4LQ6A 1XBUA 2PRBA 4P4FA 4CS0B 3DGVA 2PIYA 2G9DA 2I79A 4MXUA 4TWEA 1VHOA 4EMEA 1CJWA 4RI1A 1MJAA 2DXQA 2PJ8A 2B58A 2JBKA 4MFLA 3N7ZA 1CP7A 3IIBA 2PJ9A 2ZEDA 3VH9A 2WZNA 4BINA 2AFMA 1S7FA 3D8PA 3NE7A 2C6PA 3MRUA 2Z3PA 3SI1A 4CYOA 1IGBA 1I1DA 5ISVA 1TKJA 4C2ZA 1GHEA 3FF3A 5K8MA 4KOSA 3NFZA 2Q4VA 3RAMA 5DWMA 3KQXA 2BCOA 4Y49C 2O53A 2Z10A 4PXBA 3NA6A 4RS2A 3CPAA 4Q36A 2V8HA 1QSTA 4MFZA 1ZLIA 3D7DA 5G20A 3B3CA 3S6FA 2Q4YA 4Q7AA 2C6GA 2RC4A 4UIAA 1VHEA 4R3KA 4OC5A 5C82A 2AJ6A 3PB7X 2ZW6A 1HDQA 2B4DB 3QAYA 4FD6A 3D68A 2OR4A 3FMCA 1TKHA 1Y7RA 3IEHA 3PGPA 4X3RA 3DR8A 4MCPA 2GU2A 3GY9A 3W6XA 4B11A 4R76A 2B3UA 4HKFA 1Q2CA 2AFOA 2XEJA 4B10A 3DNSA 4B5PA 4R9MA 2O4HA 2HB6A 4NGQA 5LRGA 1UWYA 2GLJA 1YW6A 1IOIA 5A27A 1TF8A 2QVPA 4FD5A 5IB0A 3KL9A 1IYKA 2K5TA 5LYIA 3MGDA 1JWQA 5JH9A 3SI0A 4R3LA 4B5OA 3BJ7A 1XRYA 2Z3MA 3ISZA 3SXOA 2Q7SA 1BAVA 2OZGA 2RB7A 4A94A 1R43A 3TFYA 1CX8A 1Z8LA 3GB0A 2ZEFA 3BXMA 4X8IA 4OKOA 2EK8A 2ZEEA 4CGOA 3H8GA 3NE8A 4B13A 4OIDA 2PIZA 4UEEA 2FE7A 4B6ZA 1XE4A 2PR1A 3B3WA 4H6ZA 2BL1A 1X12A 5F46A 2ZXVA 2P6EA 3TCVA 2Z3NA 4LQGA 3FEEA 3KR4A 1YGHA 3JVNA 1I21A 4KLVA 1YMEA 1R57A 3LD2A 4MI4A 3IU1A 1QSRA 3GUXA 2QYVA 4X2TA 1F57A 2CNTA 3JTKA 3VWDA 3TE4A 5BWAB 3S6HA 2ARHA 1XOVA 3FNCA 2GE3A 5DS0A 5GCNA 4CAWA 4M85A 2I3CA 1LANA 4XNHC 4FUUA 4KSIA 3PB4X 4BBHA 3IWEA 4CRZB 2IQ6A 2HV2A 2Q44A 2Z3OA 4P10A 4F8ZA 5CPAA 4Q38A 1AUGA 1FY7A 2Q0YA 3JRUA 1BO4A 2FXFA 2WSAA 4XPLA 3PBBA 1ZG9A 3H8FA 4MFQA 4ONWA 5AG7A 3SJEA 3IJ3A 4MHPA 2F5IA 2OZHA 4UBRA 3R9GA 5HXDA 3QB8A 2ZW5A 2PJ3A 4MRIA 3IC1A 4ZX8A 5F09A 2B4DA 4OC3A 2CTCA 3OWCA 1HDUA 1X10A 5KTAA 2A4NA 4NJRA 2R7HA 2VZYA 2EBJA 2J8RA 2CNSA 3WABA 4KOTA 4P45A 3N5FA 3T9YA 3VATA 4B12A 1LFWA 1PU9A 4Z65A 3FB3A 1PCAA 3ISXA 1IOFA 2VXKA 3SJFA 4EVYA 1B6BA 2AFUA 2VQYA 4UWJA 1GYTA 4Y49B 3FBUA 5D8NA 4KORA 2WUUA 2B3VA 1U6MA 2CNMA 2HQYA 2Z0ZA 3G8WA 1YLOA 4KOXA 1XEBA 4PXCA 2VL1A 3QAHA 1JQGA 4ZI6A 2GIVA 3I3GA 4A37A 5K8OA 3SJGA 4PV6A 2I00A 2PJ7A 4MFPA 3KKWA 2OZUA 4AG7A 2QIRA 3DSBA 4NGTA 3TOAA 4JLYA 4OC2A 3FECA 5IB9A 4YRHA 2VEZA 3H5ZA 5D29A 4JZ0A 1YK3A 1I12A 3CZXA 4JJXA 5A28A 4JXRA 1J4JA 3TO6A 3S9MA 4JWPA 4U9ZA 2FL4A 5F47A 4DYOA 3D7GA 5F49A 1NE9A 1Z2LA 4CAEA 3G3SA 3HLPA 4PK3A 3TT2A 4R7MA 3BJ8A 2XEIA 3S6GA 3WC7A 2CY2A 4HNXB 2Q4ZA 1NSAA 4NF1A 4KUBA 4L8AA 2VBQA 4NJQA 3B2YA 3EC4A 5HVGA 2PJ6A 3D4UA 3E0KA 1M4DA 2FT0A 2ZEMA 3CXSA 4FBEA 5J8CA 1L0CA 3TX8A 2B4BA 4YGOA 4NFRA 4A38A 1KUYA 2C27A 1P0HA 3FH4A 3CDXA 1R3NA 3GLJA 4OIWA 4O23A 1M4GA 2EO8A 2JEVA 2EK9A 3CXPA 4PSXA 4KLWA 3V38A 3EFAA 2ODFA 2Z3KA 4K30A 2PJ5A 3F5BA 4KOYA 2PVWA 4XNHB 4AXVA 4KZTA 5ELYA 4NGSA 3D2PA 2ZENA 4OC0A 4MFKA 1CPSA 3H4QA 2YNDA 1CG2A 5LYDA 4A39A 2QJ8A 2WYRA 4LX9A 5J8FA 5AG4A 1S5KA 4MCRA 2WPWA 1S7KA 4F0XA 3WR7A 1M4IA 2V8VA 4NXYA 1Y9WA 2RFHA 2QECA 2GANA 2PQ8A 4C68A 1FT7A 1KZFA 1VKCA 4FD7A 2BOAA 1IICA 4U5YA 1M4LA 2X7BA 4AVBA 5KTCA 2NSMA 5THWA 4EFDA 2IL4A 1AYEA 2GLFA 4P4EA 1KUVA 3WC5A 1IIDA 4HPSA 5CNPA 1XIXA 4P6YA 4KS9A 4IUSA 4M6IA 4OAEA 3D66A 1RO5A 4MHNA 4CGLA 4UCNA 2DPSA 3PP9A 4E0AA 2EUIA 1YVKA 4CGMA 4OC4A 2YNCC 4FD4A 5JPHA 3FVLA 2ZEOA 3V8IA 2DF5A 4UCPA 4A30A 2Q43A 4IF5A 1DE4C 1XMBA 1ARMA 5C88A 3LWUA 4ZX9A 2O28A 4J3GA 1M44A 2ZOFA 1TKFA 3FYNA 4IHMA 4YFJA 1S3ZA 3QNVA 1YSJA 2P6GA 2YGWA 2HUZA 4MMOA 4PPZA 4XPDB 2V8GA 1H8LA 2OOTA 3ZJ0A 3A9LA 3B7IA 3B8GA 4PXDA 3PBEA 3S6KA 3WT4A 3TC8A 4M6HA 3TO7A 5JGFA 1ELMP 4JXQA 3IU2A 1FNOA 2BUEA 2DEAA 1YR0A 3LACA 1BLLE 1PYTB 3PB6X 3KZWA 4R8FA 4WJBA 4ORFA 5E96A 1P4NA 1IY7A 4RN7A 4H89A 1S7LA 1OBRA 4IK2A 4NEXA 1ZO0A 2PR8A 4A32A 4E8OA 5K8PA 4UWIA 3KASA 1DTDA 4II9A 1CPXA 4OP4A 1Y0YA 4MCQA 4UFWA 3R95A 4UFVA 4OMEA 2YNCA 4QBJA 2H5MA 1QSOA 4ZGYB 4PK2A 1M1DA 3CPXA 3VWEA 2BO9A 3TO9A 4QC6A 1YW4A 4CGPA 3D7HA 3KQZA 1ZG7A 2ABZA 2FVGA 2PJ2A 4OLLA 2PE3A 3KI9A 5G1ZA 3IWGA 5AGEA 4F0YA 2FCKA 4CYPA 2AFSA 5I0CA 4HNYB 1QSMA 4XPDC 3GYAA 4I49A 3FJUA 3EXNA 4P4JA 2BEIA 2PCUA 2XEGA 3FEDA 4G1PA 2V77A 2AFWA 1IYLA 1Z4EA 1XJOA 3DDDA 5LYFA 2NMTA 3I9SA 4LUAA 2REFA 2R8VA 5FVJA 2P6FA 1PUAA 4C2XA 4UEFA 5HMNA 4C7IA 2KCWA 2ZW7A 1N71A 3B3VA 5F48A 3IWWA 2GFQA 1Z5RA 3K9TA 4AVAA 4UF4A 1NSLA 3BI0A 2Y0MA 3PZJA 2PJ1A 5LYLA 4W9YA 2IMOA 2QMLA 6CPAA 5H86A 2REEA 1EE3P 1SQHA 2POKA 4R87A 2FSRA 3BLNA 3SI2A 3PEIA 4NSQA 3NH5A 3D67A 5AG5A 3PB8X 1LAMA 4OC1A 2B5GB 2PC1A 3IFEA 3BHXA 1K4JA 1WK4A 2R1IA 1VGYA 1AMPA 3IO1A 4R6TA 1MJBA 4ZY2A 3SXNA 2OH1A 4ONUA 2JEWA 4NGMA 1S7NA 1TXRA 3I1UA 4QUSA 3B3SA 3K2KA 4U9YA 5EC4A 1BOBA 5H84A 3V7ZA 4KOVA 2ANPA 2VZZA 4CYQA 2ZEGA 4GM5A 2D4OA 1YLEA 3P2HA 2FIWA 2JBJA 1RXTA 2PSWA 1ZLHA 1LCPA 3MN8A 4P4BA 3D7FA 4XPKA 1YX0A 3FXTA 3R1KA 3RNZA 1LAPA 1HEEA 1IB1E 2CIJA 5JM6A 4A33A 4OADA 5LRJA 1ON0A 1MK4A 4FWUA 1IU8A 2PJ4A 2FS5A 2CF4A 4E2AA 1BPNA 4CAFA 4PQAA 2ZELA 2Z11A 3PB9X 3FX6A 1UFHA 3JUWA 5KTDA 3FRMA 1F2PA 3BI1A 1KUXA 3KHXA 5HVFA 3T90A 3F0AA 1KWMA 2CXAA 4CAXA 4MY0A 4C2YA 3D2MA 2JLMA 3NH8A 2Q7BA 4DUKA 5K8NA 1YREA 4MJ8A 4UA3A 2PDOA 5G22A 1Q7LA 3W91A 4BMHA 1VIXA 2GREA 4F9VA 2CTBA 2J8NA 4MHYA 2AE6A 4ZYQA 4DJLA 4MFJA 2ZEPA 1XF8A 4RUHA 8CPAA 2ZPAA 4MHZA 4P4DA 1Z9UA 2DPTA 2J9AA 4H6UA 3PFOA 2PJBA 3RYOA 2OB0A 1ELLP 4AG9A 1TF9A 3TTHA 4M6GA 4A95A 4A31A 2Q51A 2WPXA 5LRKA 3NH4A 1Y0RA 2FIAA 2G3TA 4KSAA 1YQEA 3F8KA 3KGQA 1LOKA 4NGNA 4P44A 4BD9A 3PRTA 2BSWA 4KVOE 3SJXA 3LODA 2C1CA 3R9EA 2G0BA 1NMTA 1QQ9A 4UEZA 5HH1A 2B5GA 4MHDA 3WC6A 2JDDA 4UCMA 2IJZA 4GXHA 5I4MA 1F2OA 1Z4RA 2ZOGA 2ZW4A 3CT9A 4X5KA 1RTQA 3R96A 2G3AA 2C6CA 3KR5A 5EBVA 1LRZA 3ZZIA 1YVOA 2JDCA 4HNWB 4CPAA 4NGRA 4KVXA 4L89A 4FAIA 1V0CA 4MY3A 2PJ0A 1ZG8A 1VHSA 2XEFA 3CXQA 4TNUA 4F9UA 5J1QA 1B87A 3K9UA 1ARLA 1CM0A 1Z8WA 3B3TA 4KSFA 4R57A 4AB7A 4C7HA 4NGPA 2YNEA 4KOUA 1WWZA 1Z8TA 3EO4A 2R98A 2AFZA 2HC9A 3W6SA 4KOWA 1S60A 5G21A 1OZPA 1TIQA 4UIBA 4P4IA 4AVCA 4NCZA 3S9NA 3H8EA 3KHZA 2VI7A 3P2FA 3D3SA 3UY5A 2AFXA 2F8HA 3T8WA 5IV0A 1Q2DA 1XFOA 2P0WA 2F7VA 3RBUA 3FIXA 5JQ4A 3LMSA 4CGNA 2PJAA 2Z3LA 3IGRA 2EWBA 2OU2A 1CP6A 1Y9KA 3GIUA 2PRQA 4H2KA 4A2ZA 4CRYB 3DLJA 4MCSA 3RO0A 1CBXA 2J8MA 4ZY1A 5IX3A 4MBUA 1A2ZA 3C26A 4B5PB 2Q04A 4EWTA 3DR6A 5CBMA 7CPAA 3EY5A 4CAVA 4F6AA 4WWVA 2PJCA 3SHPA 3PFEA 4PSWA 2PVVA 5HVHA 4K3NA 3R9FA 3HUVA 3S9LA 4QVTA 4IAVA 4JYWA 4DNCA 4QB9A 4UFXA 5DWNA 4M3SA 3VARA 3RZAA 1Z8XA 3B35A 2ZEHA 3GKRA 5EMIA 4JD6A 2EVNA 4CYNA 4GS4A 1Q2YA 2ATRA 1QMUA 4YU9A 1BPMA 4KUAA 3TOBA 1Y7EA 2NYQA 4PXEA 4KVME 1XMTA 4ZBGA
chains in the Genus database with same CATH topology
1MJ9A 1QSNA 5AG6A 4B14A 2D4PA 2PRBA 4CS0B 2I79A 1CJWA 4RI1A 1MJAA 2DXQA 2B58A 4MFLA 3N7ZA 3D8PA 1S7FA 3NE7A 2Z3PA 4CYOA 1I1DA 5ISVA 4C2ZA 1GHEA 4KOSA 2Q4VA 5DWMA 4Y49C 2Z10A 4RS2A 4Q36A 1QSTA 4MFZA 5G20A 3S6FA 2Q4YA 2RC4A 4R3KA 5C82A 2AJ6A 2ZW6A 2B4DB 4FD6A 1Y7RA 3PGPA 3W91A 3W6XA 4B11A 3DR8A 3GY9A 4B10A 2B3UA 4HKFA 1Q2CA 3DNSA 4B5PA 4R9MA 5A27A 4FD5A 5IB0A 1IYKA 2K5TA 3MGDA 4B5OA 4R3LA 3BJ7A 2Z3MA 3SXOA 2OZGA 3TFYA 4CGOA 4B13A 2FE7A 1XE4A 2PR1A 4H6ZA 2BL1A 5F46A 2ZXVA 2P6EA 3TCVA 2Z3NA 4KLVA 1YGHA 3JVNA 1I21A 4MI4A 1R57A 3LD2A 3IU1A 1QSRA 3TE4A 3VWDA 3JTKA 2CNTA 5BWAB 3S6HA 2ARHA 3FNCA 2GE3A 5GCNA 4CAWA 4M85A 4XNHC 4BBHA 3IWEA 4CRZB 2HV2A 2Q44A 2Z3OA 4Q38A 1FY7A 2Q0YA 1BO4A 2FXFA 2WSAA 4XPLA 4MFQA 5AG7A 2F5IA 2OZHA 4UBRA 3R9GA 3QB8A 2ZW5A 2B4DA 3OWCA 5KTAA 2A4NA 2R7HA 2VZYA 2J8RA 2CNSA 4KOTA 3T9YA 4B12A 1PU9A 3FB3A 2VXKA 4EVYA 1B6BA 2VQYA 4UWJA 4Y49B 3FBUA 4KORA 2WUUA 2B3VA 1U6MA 2CNMA 2HQYA 2Z0ZA 3G8WA 4KOXA 1XEBA 3QAHA 2GIVA 3I3GA 4PV6A 2I00A 4MFPA 3KKWA 2OZUA 4AG7A 2QIRA 3DSBA 3TOAA 4JLYA 4YRHA 2VEZA 3H5ZA 1YK3A 1I12A 4JJXA 5A28A 4JXRA 1J4JA 3TO6A 4JWPA 4U9ZA 2FL4A 5F47A 5F49A 1NE9A 4CAEA 3G3SA 4PK3A 3TT2A 3BJ8A 3S6GA 2CY2A 4HNXB 4NF1A 4KUBA 4L8AA 2VBQA 3EC4A 3E0KA 1M4DA 2FT0A 5J8CA 3CXSA 1L0CA 2B4BA 4YGOA 1KUYA 2C27A 1P0HA 1M4GA 2JEVA 3CXPA 4PSXA 4KLWA 3EFAA 2Z3KA 4K30A 3F5BA 4KOYA 4XNHB 4KZTA 3D2PA 4MFKA 3H4QA 2YNDA 5J8FA 4LX9A 5AG4A 1S5KA 2WPWA 1S7KA 4F0XA 3WR7A 1M4IA 4NXYA 1Y9WA 2QECA 2GANA 2PQ8A 4C68A 1KZFA 1VKCA 4FD7A 1IICA 4U5YA 4AVBA 2X7BA 5KTCA 2IL4A 1KUVA 1IIDA 5CNPA 1XIXA 4KS9A 4IUSA 4OAEA 1RO5A 4CGLA 4UCNA 2DPSA 3PP9A 4E0AA 2EUIA 1YVKA 4CGMA 2YNCC 4FD4A 5JPHA 3V8IA 4UCPA 4A30A 4IF5A 5C88A 2O28A 4J3GA 1M44A 3FYNA 4YFJA 1S3ZA 2P6GA 2YGWA 2HUZA 4XPDB 4E8OA 3ZJ0A 3A9LA 3B8GA 3S6KA 3TO7A 4JXQA 3IU2A 2BUEA 1YR0A 4ORFA 5E96A 1P4NA 4H89A 1S7LA 4NEXA 1ZO0A 2PR8A 4A32A 4UWIA 4II9A 4UFWA 3R95A 4UFVA 2YNCA 4QBJA 2H5MA 1QSOA 4ZGYB 4PK2A 1M1DA 3VWEA 3TO9A 4QC6A 4CGPA 4OLLA 4F0YA 5G1ZA 3IWGA 5AGEA 2FCKA 4CYPA 5I0CA 4HNYB 1QSMA 4XPDC 3GYAA 4I49A 3EXNA 2BEIA 1IYLA 1Z4EA 3DDDA 2NMTA 3I9SA 4LUAA 2REFA 2R8VA 5FVJA 2P6FA 1PUAA 4C2XA 5HMNA 4C7IA 2KCWA 2ZW7A 1N71A 5F48A 4AVAA 1NSLA 2Y0MA 3PZJA 2QMLA 5H86A 2REEA 1SQHA 4R87A 2FSRA 3BLNA 4NSQA 5AG5A 2B5GB 2PC1A 1K4JA 1WK4A 2R1IA 1MJBA 3SXNA 2OH1A 4ONUA 1S7NA 4QUSA 5H84A 4U9YA 5EC4A 1BOBA 4KOVA 2VZZA 4CYQA 2D4OA 1YLEA 3P2HA 2FIWA 1RXTA 2PSWA 4XPKA 1YX0A 3FXTA 3R1KA 1IB1E 4A33A 4OADA 1ON0A 1MK4A 2FS5A 4E2AA 4CAFA 2Z11A 1UFHA 3JUWA 5KTDA 3FRMA 1KUXA 3T90A 3F0AA 2CXAA 4CAXA 4MY0A 4C2YA 3D2MA 2JLMA 2Q7BA 1YREA 4MJ8A 4UA3A 2PDOA 5G22A 4BMHA 2J8NA 2AE6A 4MFJA 1XF8A 2ZPAA 1Z9UA 2DPTA 4H6UA 3RYOA 2OB0A 4AG9A 3TTHA 4A95A 4A31A 2WPXA 2FIAA 2G3TA 4KSAA 3F8KA 2BSWA 4KVOE 3LODA 3R9EA 2G0BA 1NMTA 5HH1A 2B5GA 4MHDA 2JDDA 4UCMA 1Z4RA 4X5KA 2ZW4A 3R96A 2G3AA 5EBVA 1LRZA 3ZZIA 1YVOA 2JDCA 4HNWB 4KVXA 4L89A 1V0CA 4MY3A 1VHSA 3CXQA 1B87A 3K9UA 1CM0A 4R57A 4C7HA 4KSFA 4AB7A 2YNEA 4KOUA 1WWZA 3EO4A 2R98A 3W6SA 4KOWA 1S60A 5G21A 1OZPA 1TIQA 4AVCA 4NCZA 2VI7A 3P2FA 3D3SA 3UY5A 1Q2DA 2P0WA 3FIXA 5JQ4A 4CGNA 3IGRA 2Z3LA 2OU2A 1Y9KA 4A2ZA 4CRYB 2J8MA 5IX3A 4MBUA 3C26A 4B5PB 2Q04A 3DR6A 3EY5A 4CAVA 4F6AA 3SHPA 4PSWA 3R9FA 4QVTA 4DNCA 4QB9A 4UFXA 5DWNA 4M3SA 4JD6A 2EVNA 4CYNA 4GS4A 1Q2YA 2ATRA 4KUAA 3TOBA 5IV0A 3GKRA 4KVME 1XMTA 4ZBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ9 A;  1QSN A;  2D4P A;  2PRB A;  4CS0 B;  2I79 A;  1CJW A;  4RI1 A;  1MJA A;  2DXQ A;  2B58 A;  3N7Z A;  3D8P A;  1S7F A;  3NE7 A;  1I1D A;  5ISV A;  1GHE A;  4KOS A;  2Q4V A;  5DWM A;  4Y49 C;  2Z10 A;  4RS2 A;  1QST A;  3S6F A;  2Q4Y A;  2RC4 A;  4R3K A;  5C82 A;  2AJ6 A;  2ZW6 A;  2B4D B;  4FD6 A;  1Y7R A;  3PGP A;  3W91 A;  3W6X A;  3DR8 A;  3GY9 A;  2B3U A;  4HKF A;  1Q2C A;  3DNS A;  4B5P A;  4R9M A;  4FD5 A;  5IB0 A;  1IYK A;  2K5T A;  3MGD A;  4B5O A;  4R3L A;  3BJ7 A;  3SXO A;  2OZG A;  3TFY A;  2FE7 A;  1XE4 A;  2PR1 A;  4H6Z A;  2BL1 A;  5F46 A;  2ZXV A;  2P6E A;  3TCV A;  4KLV A;  1YGH A;  3JVN A;  1I21 A;  4MI4 A;  1R57 A;  3LD2 A;  1QSR A;  3TE4 A;  3VWD A;  2CNT A;  3S6H A;  2ARH A;  3FNC A;  2GE3 A;  5GCN A;  4CAW A;  4M85 A;  4XNH C;  4CRZ B;  2HV2 A;  2Q44 A;  1FY7 A;  2Q0Y A;  1BO4 A;  2FXF A;  4XPL A;  2F5I A;  2OZH A;  4UBR A;  3R9G A;  3QB8 A;  2ZW5 A;  2B4D A;  3OWC A;  5KTA A;  2A4N A;  2R7H A;  2VZY A;  2J8R A;  2CNS A;  4KOT A;  3T9Y A;  1PU9 A;  3FB3 A;  2VXK A;  4EVY A;  1B6B A;  2VQY A;  4UWJ A;  4Y49 B;  3FBU A;  4KOR A;  2Z0Z A;  2B3V A;  1U6M A;  2CNM A;  2HQY A;  3G8W A;  4KOX A;  1XEB A;  3QAH A;  2GIV A;  3I3G A;  4PV6 A;  2I00 A;  3KKW A;  2OZU A;  4AG7 A;  2QIR A;  3DSB A;  3TOA A;  4JLY A;  4YRH A;  2VEZ A;  1YK3 A;  1I12 A;  4JJX A;  4JXR A;  1J4J A;  3TO6 A;  4JWP A;  4U9Z A;  2FL4 A;  5F47 A;  5F49 A;  1NE9 A;  3G3S A;  4PK3 A;  3TT2 A;  3BJ8 A;  3S6G A;  2CY2 A;  4HNX B;  4NF1 A;  4KUB A;  4L8A A;  2VBQ A;  3EC4 A;  3E0K A;  1M4D A;  2FT0 A;  5J8C A;  3CXS A;  1L0C A;  2B4B A;  4YGO A;  1KUY A;  2C27 A;  1P0H A;  1M4G A;  2JEV A;  3CXP A;  4PSX A;  4KLW A;  3EFA A;  4K30 A;  3F5B A;  4KOY A;  4XNH B;  4KZT A;  3D2P A;  3H4Q A;  5J8F A;  4LX9 A;  1S5K A;  2WPW A;  1S7K A;  3WR7 A;  1M4I A;  4NXY A;  1Y9W A;  2QEC A;  2GAN A;  2PQ8 A;  1KZF A;  1VKC A;  4FD7 A;  1IIC A;  4U5Y A;  4AVB A;  2X7B A;  5KTC A;  2IL4 A;  1KUV A;  1IID A;  5CNP A;  1XIX A;  4OAE A;  4IUS A;  1RO5 A;  3PP9 A;  4E0A A;  2EUI A;  1YVK A;  4FD4 A;  5JPH A;  3V8I A;  4IF5 A;  5C88 A;  2O28 A;  4J3G A;  1M44 A;  3FYN A;  4YFJ A;  1S3Z A;  2P6G A;  4E8O A;  2HUZ A;  4XPD B;  3ZJ0 A;  3B8G A;  3S6K A;  3TO7 A;  4JXQ A;  2BUE A;  1YR0 A;  4ORF A;  5E96 A;  1P4N A;  4H89 A;  1S7L A;  4NEX A;  2PR8 A;  4UWI A;  4II9 A;  3R95 A;  4QBJ A;  2H5M A;  1QSO A;  4PK2 A;  1M1D A;  3VWE A;  3TO9 A;  4QC6 A;  4OLL A;  4F0Y A;  3IWG A;  2FCK A;  5I0C A;  4HNY B;  1QSM A;  4XPD C;  3GYA A;  4I49 A;  3EXN A;  2BEI A;  1IYL A;  1Z4E A;  3DDD A;  2NMT A;  3I9S A;  4LUA A;  2REF A;  2R8V A;  5FVJ A;  2P6F A;  1PUA A;  5HMN A;  2KCW A;  2ZW7 A;  1N71 A;  5F48 A;  4AVA A;  1NSL A;  2Y0M A;  3PZJ A;  2QML A;  5H86 A;  2REE A;  1SQH A;  4R87 A;  2FSR A;  3BLN A;  4NSQ A;  2B5G B;  2PC1 A;  1K4J A;  1WK4 A;  2R1I A;  1MJB A;  3SXN A;  2OH1 A;  4ONU A;  1S7N A;  4QUS A;  5H84 A;  4U9Y A;  5EC4 A;  1BOB A;  4KOV A;  2VZZ A;  2D4O A;  1YLE A;  3P2H A;  2FIW A;  1RXT A;  2PSW A;  4XPK A;  1YX0 A;  3FXT A;  3R1K A;  1IB1 E;  4OAD A;  1ON0 A;  1MK4 A;  2FS5 A;  4E2A A;  2Z11 A;  1UFH A;  3JUW A;  5KTD A;  3FRM A;  1KUX A;  3T90 A;  3F0A A;  4CAX A;  4MY0 A;  3D2M A;  2JLM A;  2Q7B A;  1YRE A;  4MJ8 A;  4UA3 A;  2PDO A;  4BMH A;  2J8N A;  2AE6 A;  1XF8 A;  2ZPA A;  1Z9U A;  4H6U A;  3RYO A;  2OB0 A;  4AG9 A;  3TTH A;  2WPX A;  2FIA A;  2G3T A;  3F8K A;  2BSW A;  4KVO E;  3LOD A;  3R9E A;  2G0B A;  1NMT A;  5HH1 A;  2B5G A;  4MHD A;  2JDD A;  1Z4R A;  4X5K A;  2ZW4 A;  3R96 A;  2G3A A;  5EBV A;  1LRZ A;  3ZZI A;  1YVO A;  2JDC A;  4HNW B;  4KVX A;  4L89 A;  1V0C A;  4MY3 A;  1VHS A;  3CXQ A;  1B87 A;  3K9U A;  1CM0 A;  4R57 A;  4AB7 A;  4KOU A;  1WWZ A;  3EO4 A;  2R98 A;  3W6S A;  4KOW A;  1S60 A;  1OZP A;  1TIQ A;  4AVC A;  4NCZ A;  2VI7 A;  3P2F A;  3D3S A;  3UY5 A;  1Q2D A;  2P0W A;  3FIX A;  5JQ4 A;  3IGR A;  2OU2 A;  1Y9K A;  4CRY B;  2J8M A;  5IX3 A;  4MBU A;  3C26 A;  4B5P B;  2Q04 A;  3DR6 A;  3EY5 A;  4CAV A;  4F6A A;  3SHP A;  4PSW A;  3R9F A;  4QVT A;  4DNC A;  4QB9 A;  5DWN A;  4M3S A;  4JD6 A;  2EVN A;  4GS4 A;  1Q2Y A;  2ATR A;  4KUA A;  3TOB A;  5IV0 A;  3GKR A;  4KVM E;  1XMT A;  4ZBG A; 
#chains in the Genus database with same CATH topology
 1MJ9 A;  1QSN A;  4ZY0 A;  5AG6 A;  2V8D A;  3L2N A;  4B14 A;  4YWY A;  2D4P A;  4LQ6 A;  1XBU A;  2PRB A;  4P4F A;  4CS0 B;  3DGV A;  2PIY A;  2G9D A;  2I79 A;  4MXU A;  4TWE A;  1VHO A;  4EME A;  1CJW A;  4RI1 A;  1MJA A;  2DXQ A;  2PJ8 A;  2B58 A;  2JBK A;  4MFL A;  3N7Z A;  1CP7 A;  3IIB A;  2PJ9 A;  2ZED A;  3VH9 A;  2WZN A;  4BIN A;  2AFM A;  1S7F A;  3D8P A;  3NE7 A;  2C6P A;  3MRU A;  2Z3P A;  3SI1 A;  4CYO A;  1IGB A;  1I1D A;  5ISV A;  1TKJ A;  4C2Z A;  1GHE A;  3FF3 A;  5K8M A;  4KOS A;  3NFZ A;  2Q4V A;  3RAM A;  5DWM A;  3KQX A;  2BCO A;  4Y49 C;  2O53 A;  2Z10 A;  4PXB A;  3NA6 A;  4RS2 A;  3CPA A;  4Q36 A;  2V8H A;  1QST A;  4MFZ A;  1ZLI A;  3D7D A;  5G20 A;  3B3C A;  3S6F A;  2Q4Y A;  4Q7A A;  2C6G A;  2RC4 A;  4UIA A;  1VHE A;  4R3K A;  4OC5 A;  5C82 A;  2AJ6 A;  3PB7 X;  2ZW6 A;  1HDQ A;  2B4D B;  3QAY A;  4FD6 A;  3D68 A;  2OR4 A;  3FMC A;  1TKH A;  1Y7R A;  3IEH A;  3PGP A;  4X3R A;  3DR8 A;  4MCP A;  2GU2 A;  3GY9 A;  3W6X A;  4B11 A;  4R76 A;  2B3U A;  4HKF A;  1Q2C A;  2AFO A;  2XEJ A;  4B10 A;  3DNS A;  4B5P A;  4R9M A;  2O4H A;  2HB6 A;  4NGQ A;  5LRG A;  1UWY A;  2GLJ A;  1YW6 A;  1IOI A;  5A27 A;  1TF8 A;  2QVP A;  4FD5 A;  5IB0 A;  3KL9 A;  1IYK A;  2K5T A;  5LYI A;  3MGD A;  1JWQ A;  5JH9 A;  3SI0 A;  4R3L A;  4B5O A;  3BJ7 A;  1XRY A;  2Z3M A;  3ISZ A;  3SXO A;  2Q7S A;  1BAV A;  2OZG A;  2RB7 A;  4A94 A;  1R43 A;  3TFY A;  1CX8 A;  1Z8L A;  3GB0 A;  2ZEF A;  3BXM A;  4X8I A;  4OKO A;  2EK8 A;  2ZEE A;  4CGO A;  3H8G A;  3NE8 A;  4B13 A;  4OID A;  2PIZ A;  4UEE A;  2FE7 A;  4B6Z A;  1XE4 A;  2PR1 A;  3B3W A;  4H6Z A;  2BL1 A;  1X12 A;  5F46 A;  2ZXV A;  2P6E A;  3TCV A;  2Z3N A;  4LQG A;  3FEE A;  3KR4 A;  1YGH A;  3JVN A;  1I21 A;  4KLV A;  1YME A;  1R57 A;  3LD2 A;  4MI4 A;  3IU1 A;  1QSR A;  3GUX A;  2QYV A;  4X2T A;  1F57 A;  2CNT A;  3JTK A;  3VWD A;  3TE4 A;  5BWA B;  3S6H A;  2ARH A;  1XOV A;  3FNC A;  2GE3 A;  5DS0 A;  5GCN A;  4CAW A;  4M85 A;  2I3C A;  1LAN A;  4XNH C;  4FUU A;  4KSI A;  3PB4 X;  4BBH A;  3IWE A;  4CRZ B;  2IQ6 A;  2HV2 A;  2Q44 A;  2Z3O A;  4P10 A;  4F8Z A;  5CPA A;  4Q38 A;  1AUG A;  1FY7 A;  2Q0Y A;  3JRU A;  1BO4 A;  2FXF A;  2WSA A;  4XPL A;  3PBB A;  1ZG9 A;  3H8F A;  4MFQ A;  4ONW A;  5AG7 A;  3SJE A;  3IJ3 A;  4MHP A;  2F5I A;  2OZH A;  4UBR A;  3R9G A;  5HXD A;  3QB8 A;  2ZW5 A;  2PJ3 A;  4MRI A;  3IC1 A;  4ZX8 A;  5F09 A;  2B4D A;  4OC3 A;  2CTC A;  3OWC A;  1HDU A;  1X10 A;  5KTA A;  2A4N A;  4NJR A;  2R7H A;  2VZY A;  2EBJ A;  2J8R A;  2CNS A;  3WAB A;  4KOT A;  4P45 A;  3N5F A;  3T9Y A;  3VAT A;  4B12 A;  1LFW A;  1PU9 A;  4Z65 A;  3FB3 A;  1PCA A;  3ISX A;  1IOF A;  2VXK A;  3SJF A;  4EVY A;  1B6B A;  2AFU A;  2VQY A;  4UWJ A;  1GYT A;  4Y49 B;  3FBU A;  5D8N A;  4KOR A;  2WUU A;  2B3V A;  1U6M A;  2CNM A;  2HQY A;  2Z0Z A;  3G8W A;  1YLO A;  4KOX A;  1XEB A;  4PXC A;  2VL1 A;  3QAH A;  1JQG A;  4ZI6 A;  2GIV A;  3I3G A;  4A37 A;  5K8O A;  3SJG A;  4PV6 A;  2I00 A;  2PJ7 A;  4MFP A;  3KKW A;  2OZU A;  4AG7 A;  2QIR A;  3DSB A;  4NGT A;  3TOA A;  4JLY A;  4OC2 A;  3FEC A;  5IB9 A;  4YRH A;  2VEZ A;  3H5Z A;  5D29 A;  4JZ0 A;  1YK3 A;  1I12 A;  3CZX A;  4JJX A;  5A28 A;  4JXR A;  1J4J A;  3TO6 A;  3S9M A;  4JWP A;  4U9Z A;  2FL4 A;  5F47 A;  4DYO A;  3D7G A;  5F49 A;  1NE9 A;  1Z2L A;  4CAE A;  3G3S A;  3HLP A;  4PK3 A;  3TT2 A;  4R7M A;  3BJ8 A;  2XEI A;  3S6G A;  3WC7 A;  2CY2 A;  4HNX B;  2Q4Z A;  1NSA A;  4NF1 A;  4KUB A;  4L8A A;  2VBQ A;  4NJQ A;  3B2Y A;  3EC4 A;  5HVG A;  2PJ6 A;  3D4U A;  3E0K A;  1M4D A;  2FT0 A;  2ZEM A;  3CXS A;  4FBE A;  5J8C A;  1L0C A;  3TX8 A;  2B4B A;  4YGO A;  4NFR A;  4A38 A;  1KUY A;  2C27 A;  1P0H A;  3FH4 A;  3CDX A;  1R3N A;  3GLJ A;  4OIW A;  4O23 A;  1M4G A;  2EO8 A;  2JEV A;  2EK9 A;  3CXP A;  4PSX A;  4KLW A;  3V38 A;  3EFA A;  2ODF A;  2Z3K A;  4K30 A;  2PJ5 A;  3F5B A;  4KOY A;  2PVW A;  4XNH B;  4AXV A;  4KZT A;  5ELY A;  4NGS A;  3D2P A;  2ZEN A;  4OC0 A;  4MFK A;  1CPS A;  3H4Q A;  2YND A;  1CG2 A;  5LYD A;  4A39 A;  2QJ8 A;  2WYR A;  4LX9 A;  5J8F A;  5AG4 A;  1S5K A;  4MCR A;  2WPW A;  1S7K A;  4F0X A;  3WR7 A;  1M4I A;  2V8V A;  4NXY A;  1Y9W A;  2RFH A;  2QEC A;  2GAN A;  2PQ8 A;  4C68 A;  1FT7 A;  1KZF A;  1VKC A;  4FD7 A;  2BOA A;  1IIC A;  4U5Y A;  1M4L A;  2X7B A;  4AVB A;  5KTC A;  2NSM A;  5THW A;  4EFD A;  2IL4 A;  1AYE A;  2GLF A;  4P4E A;  1KUV A;  3WC5 A;  1IID A;  4HPS A;  5CNP A;  1XIX A;  4P6Y A;  4KS9 A;  4IUS A;  4M6I A;  4OAE A;  3D66 A;  1RO5 A;  4MHN A;  4CGL A;  4UCN A;  2DPS A;  3PP9 A;  4E0A A;  2EUI A;  1YVK A;  4CGM A;  4OC4 A;  2YNC C;  4FD4 A;  5JPH A;  3FVL A;  2ZEO A;  3V8I A;  2DF5 A;  4UCP A;  4A30 A;  2Q43 A;  4IF5 A;  1DE4 C;  1XMB A;  1ARM A;  5C88 A;  3LWU A;  4ZX9 A;  2O28 A;  4J3G A;  1M44 A;  2ZOF A;  1TKF A;  3FYN A;  4IHM A;  4YFJ A;  1S3Z A;  3QNV A;  1YSJ A;  2P6G A;  2YGW A;  2HUZ A;  4MMO A;  4PPZ A;  4XPD B;  2V8G A;  1H8L A;  2OOT A;  3ZJ0 A;  3A9L A;  3B7I A;  3B8G A;  4PXD A;  3PBE A;  3S6K A;  3WT4 A;  3TC8 A;  4M6H A;  3TO7 A;  5JGF A;  1ELM P;  4JXQ A;  3IU2 A;  1FNO A;  2BUE A;  2DEA A;  1YR0 A;  3LAC A;  1BLL E;  1PYT B;  3PB6 X;  3KZW A;  4R8F A;  4WJB A;  4ORF A;  5E96 A;  1P4N A;  1IY7 A;  4RN7 A;  4H89 A;  1S7L A;  1OBR A;  4IK2 A;  4NEX A;  1ZO0 A;  2PR8 A;  4A32 A;  4E8O A;  5K8P A;  4UWI A;  3KAS A;  1DTD A;  4II9 A;  1CPX A;  4OP4 A;  1Y0Y A;  4MCQ A;  4UFW A;  3R95 A;  4UFV A;  4OME A;  2YNC A;  4QBJ A;  2H5M A;  1QSO A;  4ZGY B;  4PK2 A;  1M1D A;  3CPX A;  3VWE A;  2BO9 A;  3TO9 A;  4QC6 A;  1YW4 A;  4CGP A;  3D7H A;  3KQZ A;  1ZG7 A;  2ABZ A;  2FVG A;  2PJ2 A;  4OLL A;  2PE3 A;  3KI9 A;  5G1Z A;  3IWG A;  5AGE A;  4F0Y A;  2FCK A;  4CYP A;  2AFS A;  5I0C A;  4HNY B;  1QSM A;  4XPD C;  3GYA A;  4I49 A;  3FJU A;  3EXN A;  4P4J A;  2BEI A;  2PCU A;  2XEG A;  3FED A;  4G1P A;  2V77 A;  2AFW A;  1IYL A;  1Z4E A;  1XJO A;  3DDD A;  5LYF A;  2NMT A;  3I9S A;  4LUA A;  2REF A;  2R8V A;  5FVJ A;  2P6F A;  1PUA A;  4C2X A;  4UEF A;  5HMN A;  4C7I A;  2KCW A;  2ZW7 A;  1N71 A;  3B3V A;  5F48 A;  3IWW A;  2GFQ A;  1Z5R A;  3K9T A;  4AVA A;  4UF4 A;  1NSL A;  3BI0 A;  2Y0M A;  3PZJ A;  2PJ1 A;  5LYL A;  4W9Y A;  2IMO A;  2QML A;  6CPA A;  5H86 A;  2REE A;  1EE3 P;  1SQH A;  2POK A;  4R87 A;  2FSR A;  3BLN A;  3SI2 A;  3PEI A;  4NSQ A;  3NH5 A;  3D67 A;  5AG5 A;  3PB8 X;  1LAM A;  4OC1 A;  2B5G B;  2PC1 A;  3IFE A;  3BHX A;  1K4J A;  1WK4 A;  2R1I A;  1VGY A;  1AMP A;  3IO1 A;  4R6T A;  1MJB A;  4ZY2 A;  3SXN A;  2OH1 A;  4ONU A;  2JEW A;  4NGM A;  1S7N A;  1TXR A;  3I1U A;  4QUS A;  3B3S A;  3K2K A;  4U9Y A;  5EC4 A;  1BOB A;  5H84 A;  3V7Z A;  4KOV A;  2ANP A;  2VZZ A;  4CYQ A;  2ZEG A;  4GM5 A;  2D4O A;  1YLE A;  3P2H A;  2FIW A;  2JBJ A;  1RXT A;  2PSW A;  1ZLH A;  1LCP A;  3MN8 A;  4P4B A;  3D7F A;  4XPK A;  1YX0 A;  3FXT A;  3R1K A;  3RNZ A;  1LAP A;  1HEE A;  1IB1 E;  2CIJ A;  5JM6 A;  4A33 A;  4OAD A;  5LRJ A;  1ON0 A;  1MK4 A;  4FWU A;  1IU8 A;  2PJ4 A;  2FS5 A;  2CF4 A;  4E2A A;  1BPN A;  4CAF A;  4PQA A;  2ZEL A;  2Z11 A;  3PB9 X;  3FX6 A;  1UFH A;  3JUW A;  5KTD A;  3FRM A;  1F2P A;  3BI1 A;  1KUX A;  3KHX A;  5HVF A;  3T90 A;  3F0A A;  1KWM A;  2CXA A;  4CAX A;  4MY0 A;  4C2Y A;  3D2M A;  2JLM A;  3NH8 A;  2Q7B A;  4DUK A;  5K8N A;  1YRE A;  4MJ8 A;  4UA3 A;  2PDO A;  5G22 A;  1Q7L A;  3W91 A;  4BMH A;  1VIX A;  2GRE A;  4F9V A;  2CTB A;  2J8N A;  4MHY A;  2AE6 A;  4ZYQ A;  4DJL A;  4MFJ A;  2ZEP A;  1XF8 A;  4RUH A;  8CPA A;  2ZPA A;  4MHZ A;  4P4D A;  1Z9U A;  2DPT A;  2J9A A;  4H6U A;  3PFO A;  2PJB A;  3RYO A;  2OB0 A;  1ELL P;  4AG9 A;  1TF9 A;  3TTH A;  4M6G A;  4A95 A;  4A31 A;  2Q51 A;  2WPX A;  5LRK A;  3NH4 A;  1Y0R A;  2FIA A;  2G3T A;  4KSA A;  1YQE A;  3F8K A;  3KGQ A;  1LOK A;  4NGN A;  4P44 A;  4BD9 A;  3PRT A;  2BSW A;  4KVO E;  3SJX A;  3LOD A;  2C1C A;  3R9E A;  2G0B A;  1NMT A;  1QQ9 A;  4UEZ A;  5HH1 A;  2B5G A;  4MHD A;  3WC6 A;  2JDD A;  4UCM A;  2IJZ A;  4GXH A;  5I4M A;  1F2O A;  1Z4R A;  2ZOG A;  2ZW4 A;  3CT9 A;  4X5K A;  1RTQ A;  3R96 A;  2G3A A;  2C6C A;  3KR5 A;  5EBV A;  1LRZ A;  3ZZI A;  1YVO A;  2JDC A;  4HNW B;  4CPA A;  4NGR A;  4KVX A;  4L89 A;  4FAI A;  1V0C A;  4MY3 A;  2PJ0 A;  1ZG8 A;  1VHS A;  2XEF A;  3CXQ A;  4TNU A;  4F9U A;  5J1Q A;  1B87 A;  3K9U A;  1ARL A;  1CM0 A;  1Z8W A;  3B3T A;  4KSF A;  4R57 A;  4AB7 A;  4C7H A;  4NGP A;  2YNE A;  4KOU A;  1WWZ A;  1Z8T A;  3EO4 A;  2R98 A;  2AFZ A;  2HC9 A;  3W6S A;  4KOW A;  1S60 A;  5G21 A;  1OZP A;  1TIQ A;  4UIB A;  4P4I A;  4AVC A;  4NCZ A;  3S9N A;  3H8E A;  3KHZ A;  2VI7 A;  3P2F A;  3D3S A;  3UY5 A;  2AFX A;  2F8H A;  3T8W A;  5IV0 A;  1Q2D A;  1XFO A;  2P0W A;  2F7V A;  3RBU A;  3FIX A;  5JQ4 A;  3LMS A;  4CGN A;  2PJA A;  2Z3L A;  3IGR A;  2EWB A;  2OU2 A;  1CP6 A;  1Y9K A;  3GIU A;  2PRQ A;  4H2K A;  4A2Z A;  4CRY B;  3DLJ A;  4MCS A;  3RO0 A;  1CBX A;  2J8M A;  4ZY1 A;  5IX3 A;  4MBU A;  1A2Z A;  3C26 A;  4B5P B;  2Q04 A;  4EWT A;  3DR6 A;  5CBM A;  7CPA A;  3EY5 A;  4CAV A;  4F6A A;  4WWV A;  2PJC A;  3SHP A;  3PFE A;  4PSW A;  2PVV A;  5HVH A;  4K3N A;  3R9F A;  3HUV A;  3S9L A;  4QVT A;  4IAV A;  4JYW A;  4DNC A;  4QB9 A;  4UFX A;  5DWN A;  4M3S A;  3VAR A;  3RZA A;  1Z8X A;  3B35 A;  2ZEH A;  3GKR A;  5EMI A;  4JD6 A;  2EVN A;  4CYN A;  4GS4 A;  1Q2Y A;  2ATR A;  1QMU A;  4YU9 A;  1BPM A;  4KUA A;  3TOB A;  1Y7E A;  2NYQ A;  4PXE A;  4KVM E;  1XMT A;  4ZBG A; 
#chains in the Genus database with same CATH homology
 1MJ9 A;  1QSN A;  5AG6 A;  4B14 A;  2D4P A;  2PRB A;  4CS0 B;  2I79 A;  1CJW A;  4RI1 A;  1MJA A;  2DXQ A;  2B58 A;  4MFL A;  3N7Z A;  3D8P A;  1S7F A;  3NE7 A;  2Z3P A;  4CYO A;  1I1D A;  5ISV A;  4C2Z A;  1GHE A;  4KOS A;  2Q4V A;  5DWM A;  4Y49 C;  2Z10 A;  4RS2 A;  4Q36 A;  1QST A;  4MFZ A;  5G20 A;  3S6F A;  2Q4Y A;  2RC4 A;  4R3K A;  5C82 A;  2AJ6 A;  2ZW6 A;  2B4D B;  4FD6 A;  1Y7R A;  3PGP A;  3W91 A;  3W6X A;  4B11 A;  3DR8 A;  3GY9 A;  4B10 A;  2B3U A;  4HKF A;  1Q2C A;  3DNS A;  4B5P A;  4R9M A;  5A27 A;  4FD5 A;  5IB0 A;  1IYK A;  2K5T A;  3MGD A;  4B5O A;  4R3L A;  3BJ7 A;  2Z3M A;  3SXO A;  2OZG A;  3TFY A;  4CGO A;  4B13 A;  2FE7 A;  1XE4 A;  2PR1 A;  4H6Z A;  2BL1 A;  5F46 A;  2ZXV A;  2P6E A;  3TCV A;  2Z3N A;  4KLV A;  1YGH A;  3JVN A;  1I21 A;  4MI4 A;  1R57 A;  3LD2 A;  3IU1 A;  1QSR A;  3TE4 A;  3VWD A;  3JTK A;  2CNT A;  5BWA B;  3S6H A;  2ARH A;  3FNC A;  2GE3 A;  5GCN A;  4CAW A;  4M85 A;  4XNH C;  4BBH A;  3IWE A;  4CRZ B;  2HV2 A;  2Q44 A;  2Z3O A;  4Q38 A;  1FY7 A;  2Q0Y A;  1BO4 A;  2FXF A;  2WSA A;  4XPL A;  4MFQ A;  5AG7 A;  2F5I A;  2OZH A;  4UBR A;  3R9G A;  3QB8 A;  2ZW5 A;  2B4D A;  3OWC A;  5KTA A;  2A4N A;  2R7H A;  2VZY A;  2J8R A;  2CNS A;  4KOT A;  3T9Y A;  4B12 A;  1PU9 A;  3FB3 A;  2VXK A;  4EVY A;  1B6B A;  2VQY A;  4UWJ A;  4Y49 B;  3FBU A;  4KOR A;  2WUU A;  2B3V A;  1U6M A;  2CNM A;  2HQY A;  2Z0Z A;  3G8W A;  4KOX A;  1XEB A;  3QAH A;  2GIV A;  3I3G A;  4PV6 A;  2I00 A;  4MFP A;  3KKW A;  2OZU A;  4AG7 A;  2QIR A;  3DSB A;  3TOA A;  4JLY A;  4YRH A;  2VEZ A;  3H5Z A;  1YK3 A;  1I12 A;  4JJX A;  5A28 A;  4JXR A;  1J4J A;  3TO6 A;  4JWP A;  4U9Z A;  2FL4 A;  5F47 A;  5F49 A;  1NE9 A;  4CAE A;  3G3S A;  4PK3 A;  3TT2 A;  3BJ8 A;  3S6G A;  2CY2 A;  4HNX B;  4NF1 A;  4KUB A;  4L8A A;  2VBQ A;  3EC4 A;  3E0K A;  1M4D A;  2FT0 A;  5J8C A;  3CXS A;  1L0C A;  2B4B A;  4YGO A;  1KUY A;  2C27 A;  1P0H A;  1M4G A;  2JEV A;  3CXP A;  4PSX A;  4KLW A;  3EFA A;  2Z3K A;  4K30 A;  3F5B A;  4KOY A;  4XNH B;  4KZT A;  3D2P A;  4MFK A;  3H4Q A;  2YND A;  5J8F A;  4LX9 A;  5AG4 A;  1S5K A;  2WPW A;  1S7K A;  4F0X A;  3WR7 A;  1M4I A;  4NXY A;  1Y9W A;  2QEC A;  2GAN A;  2PQ8 A;  4C68 A;  1KZF A;  1VKC A;  4FD7 A;  1IIC A;  4U5Y A;  4AVB A;  2X7B A;  5KTC A;  2IL4 A;  1KUV A;  1IID A;  5CNP A;  1XIX A;  4KS9 A;  4IUS A;  4OAE A;  1RO5 A;  4CGL A;  4UCN A;  2DPS A;  3PP9 A;  4E0A A;  2EUI A;  1YVK A;  4CGM A;  2YNC C;  4FD4 A;  5JPH A;  3V8I A;  4UCP A;  4A30 A;  4IF5 A;  5C88 A;  2O28 A;  4J3G A;  1M44 A;  3FYN A;  4YFJ A;  1S3Z A;  2P6G A;  2YGW A;  2HUZ A;  4XPD B;  4E8O A;  3ZJ0 A;  3A9L A;  3B8G A;  3S6K A;  3TO7 A;  4JXQ A;  3IU2 A;  2BUE A;  1YR0 A;  4ORF A;  5E96 A;  1P4N A;  4H89 A;  1S7L A;  4NEX A;  1ZO0 A;  2PR8 A;  4A32 A;  4UWI A;  4II9 A;  4UFW A;  3R95 A;  4UFV A;  2YNC A;  4QBJ A;  2H5M A;  1QSO A;  4ZGY B;  4PK2 A;  1M1D A;  3VWE A;  3TO9 A;  4QC6 A;  4CGP A;  4OLL A;  4F0Y A;  5G1Z A;  3IWG A;  5AGE A;  2FCK A;  4CYP A;  5I0C A;  4HNY B;  1QSM A;  4XPD C;  3GYA A;  4I49 A;  3EXN A;  2BEI A;  1IYL A;  1Z4E A;  3DDD A;  2NMT A;  3I9S A;  4LUA A;  2REF A;  2R8V A;  5FVJ A;  2P6F A;  1PUA A;  4C2X A;  5HMN A;  4C7I A;  2KCW A;  2ZW7 A;  1N71 A;  5F48 A;  4AVA A;  1NSL A;  2Y0M A;  3PZJ A;  2QML A;  5H86 A;  2REE A;  1SQH A;  4R87 A;  2FSR A;  3BLN A;  4NSQ A;  5AG5 A;  2B5G B;  2PC1 A;  1K4J A;  1WK4 A;  2R1I A;  1MJB A;  3SXN A;  2OH1 A;  4ONU A;  1S7N A;  4QUS A;  5H84 A;  4U9Y A;  5EC4 A;  1BOB A;  4KOV A;  2VZZ A;  4CYQ A;  2D4O A;  1YLE A;  3P2H A;  2FIW A;  1RXT A;  2PSW A;  4XPK A;  1YX0 A;  3FXT A;  3R1K A;  1IB1 E;  4A33 A;  4OAD A;  1ON0 A;  1MK4 A;  2FS5 A;  4E2A A;  4CAF A;  2Z11 A;  1UFH A;  3JUW A;  5KTD A;  3FRM A;  1KUX A;  3T90 A;  3F0A A;  2CXA A;  4CAX A;  4MY0 A;  4C2Y A;  3D2M A;  2JLM A;  2Q7B A;  1YRE A;  4MJ8 A;  4UA3 A;  2PDO A;  5G22 A;  4BMH A;  2J8N A;  2AE6 A;  4MFJ A;  1XF8 A;  2ZPA A;  1Z9U A;  2DPT A;  4H6U A;  3RYO A;  2OB0 A;  4AG9 A;  3TTH A;  4A95 A;  4A31 A;  2WPX A;  2FIA A;  2G3T A;  4KSA A;  3F8K A;  2BSW A;  4KVO E;  3LOD A;  3R9E A;  2G0B A;  1NMT A;  5HH1 A;  2B5G A;  4MHD A;  2JDD A;  4UCM A;  1Z4R A;  4X5K A;  2ZW4 A;  3R96 A;  2G3A A;  5EBV A;  1LRZ A;  3ZZI A;  1YVO A;  2JDC A;  4HNW B;  4KVX A;  4L89 A;  1V0C A;  4MY3 A;  1VHS A;  3CXQ A;  1B87 A;  3K9U A;  1CM0 A;  4R57 A;  4C7H A;  4KSF A;  4AB7 A;  2YNE A;  4KOU A;  1WWZ A;  3EO4 A;  2R98 A;  3W6S A;  4KOW A;  1S60 A;  5G21 A;  1OZP A;  1TIQ A;  4AVC A;  4NCZ A;  2VI7 A;  3P2F A;  3D3S A;  3UY5 A;  1Q2D A;  2P0W A;  3FIX A;  5JQ4 A;  4CGN A;  3IGR A;  2Z3L A;  2OU2 A;  1Y9K A;  4A2Z A;  4CRY B;  2J8M A;  5IX3 A;  4MBU A;  3C26 A;  4B5P B;  2Q04 A;  3DR6 A;  3EY5 A;  4CAV A;  4F6A A;  3SHP A;  4PSW A;  3R9F A;  4QVT A;  4DNC A;  4QB9 A;  4UFX A;  5DWN A;  4M3S A;  4JD6 A;  2EVN A;  4CYN A;  4GS4 A;  1Q2Y A;  2ATR A;  4KUA A;  3TOB A;  5IV0 A;  3GKR A;  4KVM E;  1XMT A;  4ZBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...