1BO4A

Crystal structure of a gcn5-related n-acetyltransferase: serratia marescens aminoglycoside 3-n-acetyltransferase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
137
Chain Sequence
GIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-ACETYLTRANSF
publication title Crystal structure of a GCN5-related N-acetyltransferase: Serratia marcescens aminoglycoside 3-N-acetyltransferase.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Transferase
total genus 34
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bo4A00
5IV0A 4CRYB 2PRBA 2Q0YA 2R7HA 2IL4A 2REFA 4FD7A 4GS4A 4YRHA 2A4NA 3FNCA 3H4QA 4XPKA 4KUBA 2ZXVA 4KOXA 4ZBGA 2D4PA 4CRZB 3BJ8A 2P6EA 2GANA 1GHEA 2P6FA 3PGPA 5DWMA 4FD5A 5EBVA 3LODA 1I21A 4AVCA 4KOYA 1M4IA 3EC4A 3CXPA 4U9ZA 1Q2DA 2PC1A 3IGRA 3QAHA 2PDOA 4FD6A 4KVME 3R9GA 1VHSA 4IF5A 3TTHA 4KZTA 2VI7A 2CNTA 2VZZA 2J8RA 2Q7BA 2CNSA 2G3AA 2P0WA 3TO6A 4NXYA 4AG7A 1FY7A 1RXTA 2AE6A 4JLYA 3G3SA 5J8CA 3DR6A 2PR8A 1M1DA 1Y9KA 2B5GB 3TT2A 2PQ8A 5GCNA 3D2PA 3CXQA 1WK4A 2OZHA 2Z10A 4RS2A 2B58A 3F5BA 3W91A 4KOTA 1Q2YA 2FIWA 2FXFA 3R1KA 1KZFA 4HNXB 1WWZA 1QSOA 4PSWA 3D8PA 4Y49C 3ZJ0A 1TIQA 1Z4RA 1MK4A 2JEVA 4U9YA 1YVKA 2FIAA 5C82A 5HMNA 4M3SA 2JDCA 2H5MA 4AG9A 4KLWA 1XIXA 4BMHA 4KUAA 2Q4YA 3FXTA 4PK2A 3DSBA 3EFAA 2J8NA 1YGHA 3S6FA 4KOVA 2FL4A 3S6GA 2HQYA 1IYKA 1B6BA 2F5IA 2K5TA 4FD4A 4B5PA 4XNHB 3F0AA 1MJAA 3NE7A 2G3TA 4OADA 1Y9WA 4E8OA 5KTCA 1PUAA 4H89A 4HNYB 2ZW4A 1PU9A 3GY9A 5HH1A 1XEBA 2R98A 1U6MA 5IX3A 3G8WA 1J4JA 1P0HA 3UY5A 3PP9A 1RO5A 3EO4A 3SXNA 3OWCA 2BSWA 2B4BA 1M4DA 3K9UA 3SXOA 4MBUA 2ARHA 3R95A 4UWIA 2I00A 4E2AA 3GYAA 5H84A 1YR0A 3TO7A 1Z4EA 3I9SA 1CM0A 1IB1E 2GE3A 3C26A 5E96A 1YVOA 2R1IA 2OZGA 3DNSA 1P4NA 2BUEA 1MJ9A 4ONUA 1N71A 2QECA 2B3UA 2Q44A 1M44A 4XPDC 1QSRA 2ZW5A 2B4DA 1S5KA 4Y49B 4JD6A 1XMTA 1YLEA 3EXNA 4MI4A 4PSXA 4CS0B 3D2MA 5ISVA 5F46A 1QSMA 1S7LA 3T9YA 5KTAA 2ZW7A 5F47A 3ZZIA 1BOBA 2NMTA 2I79A 4R87A 3FRMA 1IYLA 2KCWA 2C27A 1BO4A 1YK3A 1NSLA 3W6SA 3P2FA 4B5OA 4MJ8A 2EUIA 4KVOE 4NSQA 2B5GA 4KORA 5J8FA 4KOWA 4HKFA 3JVNA 2PR1A 3FBUA 2BEIA 2FT0A 2OZUA 1S60A 1XE4A 2AJ6A 2Q4VA 4QB9A 1L0CA 3N7ZA 4AB7A 3TOAA 4QBJA 2Z0ZA 3TFYA 2G0BA 5JQ4A 3T90A 5FVJA 4JJXA 3V8IA 4RI1A 5F49A 2RC4A 4II9A 1UFHA 4IUSA 5JPHA 1Z9UA 1ON0A 3FIXA 3RYOA 4KLVA 4KVXA 3TOBA 2VXKA 3F8KA 4PK3A 1NMTA 4MHDA 2X7BA 5F48A 3E0KA 4XPLA 2FCKA 1SQHA 4QUSA 4EVYA 1R57A 4F6AA 4K30A 3S6HA 4XPDB 2Q04A 1IICA 3TE4A 1Q2CA 3R9EA 4I49A 2OB0A 4H6ZA 4OLLA 3PZJA 4UBRA 2QMLA 4NF1A 1B87A 4AVAA 3S6KA 3LD2A 4YFJA 2FE7A 2GIVA 4ORFA 4KOSA 3CXSA 4F0YA 4XNHC 2B4DB 1Y7RA 3MGDA 4CAWA 4X5KA 4QVTA 2J8MA 3R9FA 2QIRA 4HNWB 3QB8A 2D4OA 5IB0A 4U5YA 5KTDA 1S7NA 2HV2A 4L8AA 3W6XA 5I0CA 4KOUA 4JXQA 2VBQA 4JXRA 2Y0MA 1I12A 4JWPA 2R8VA 1QSTA 4LUAA 3TCVA 4E0AA 1V0CA 1NE9A 1K4JA 4UA3A 2EVNA 3R96A 2Z11A 2JDDA 2CNMA 4J3GA 2OH1A 1S7FA 5C88A 1I1DA 4YGOA 3FB3A 3WR7A 4MY3A 3EY5A 2CY2A 3D3SA 3B8GA 3KKWA 1KUXA 2ZW6A 4R57A 1S7KA 3SHPA 2BL1A 1M4GA 1YX0A 4OAEA 3DDDA 1OZPA 2JLMA 2PSWA 3BJ7A 4LX9A 4L89A 1QSNA 2REEA 2ZPAA 4R9MA 4PV6A 2VEZA 3DR8A 4NCZA 4DNCA 2OU2A 2VZYA 4B5PB 4R3LA 1CJWA 1KUYA 2FS5A 2FSRA 2O28A 5H86A 4R3KA 2P6GA 4UWJA 2ATRA 1LRZA 3VWDA 2WPXA 3FYNA 4H6UA 1IIDA 5CNPA 3VWEA 4QC6A 1S3ZA 5EC4A 3GKRA 1MJBA 1KUVA 3JUWA 5DWNA 4MY0A 2HUZA 2VQYA 4CAVA 1VKCA 3TO9A 2WPWA 3P2HA 2DXQA 2B3VA 4CAXA 1XF8A 3IWGA 1YREA 3BLNA 4AVBA 3I3GA 4M85A 4NEXA
chains in the Genus database with same CATH superfamily
5IV0A 3B3TA 4CRYB 2PRBA 3FMCA 2Q0YA 4UFWA 2R7HA 2IL4A 1FT7A 5G21A 2F7VA 2YNEA 2REFA 2ZOFA 4FD7A 4MHZA 2V8HA 2WSAA 4A32A 2ZEGA 4GS4A 5LYFA 4YRHA 2A4NA 3FNCA 3H4QA 3KQZA 4XPKA 4PXBA 1Z5RA 4KUBA 2ZXVA 3D7DA 4KOXA 4ZBGA 1BLLE 4Z65A 2D4PA 4CRZB 3BJ8A 3IWWA 2P6EA 2PJ0A 4OMEA 2PE3A 3KR4A 4NGRA 2GANA 3HUVA 3TC8A 2IJZA 2RB7A 1XFOA 2PIZA 4A33A 1GHEA 2QJ8A 2IMOA 1YLOA 2P6FA 2ZEPA 2BO9A 3PGPA 5DWMA 4FD5A 5EBVA 3LODA 2V8GA 2BCOA 4C7IA 1I21A 2XEIA 4AVCA 3CT9A 4KOYA 4NGQA 1M4IA 3EC4A 3CXPA 3BI0A 4U9ZA 3WC5A 1Q2DA 2PC1A 3IGRA 3QAHA 4KSIA 4UCMA 2PDOA 4FD6A 3PB4X 4KVME 4PXCA 3R9GA 1VHSA 2JBKA 3KL9A 4IF5A 2ZENA 4G1PA 4KZTA 2VI7A 3TTHA 2CNTA 2VZZA 2J8RA 4OC5A 1YMEA 2RFHA 2Q7BA 4A31A 4F9VA 2CNSA 3IFEA 1ZLIA 2G3AA 2P0WA 3CZXA 4NXYA 3TO6A 4AG7A 1FY7A 3PBEA 1RXTA 2AE6A 2YNCA 4WWVA 4JLYA 1YSJA 2AFXA 4A39A 1IGBA 4CYNA 2PCUA 1TKHA 3G3SA 3ISXA 5J8CA 3DR6A 2EBJA 2PR8A 3BXMA 1M1DA 1Q7LA 1Y9KA 1XMBA 3B7IA 4PPZA 4CYOA 2B5GB 3H8FA 3PEIA 1ZO0A 3TT2A 3QAYA 2J9AA 2PQ8A 1YW4A 4F0XA 5AG6A 4OC3A 5GCNA 3T8WA 3D2PA 2CIJA 4Q7AA 2YNDA 3CXQA 2OOTA 2CTBA 5A28A 1WK4A 2OZHA 2POKA 2Z10A 4RS2A 5F09A 2B58A 3F5BA 3I1UA 3LMSA 3W91A 4KOTA 1Q2YA 1ZG7A 2FIWA 3D4UA 2FXFA 3R1KA 1KZFA 4BINA 1IOFA 1CG2A 4HNXB 1WWZA 2PJ6A 3VH9A 1QSOA 4C2ZA 3K9TA 3D8PA 4PSWA 4Y49C 4W9YA 1TIQA 3ZJ0A 1Z4RA 1F2OA 1MK4A 2JEVA 3BHXA 4MFJA 2Z3PA 1EE3P 2V77A 4U9YA 2NSMA 3S9MA 4CYQA 1YVKA 3KZWA 1Z8TA 2FIAA 4CGPA 4NGNA 5C82A 3RNZA 4C2YA 4ZGYB 1JWQA 1CP6A 5HMNA 5CBMA 1HDQA 1Z8XA 5THWA 2DEAA 1LOKA 4M3SA 4OC4A 2OR4A 2JDCA 2H5MA 4AG9A 4A37A 4KLWA 1XIXA 4P6YA 4C68A 4B13A 4BMHA 4A95A 4KUAA 2Q4YA 4FBEA 2C1CA 3FXTA 4PK2A 3DSBA 3MRUA 4A30A 3EFAA 1FNOA 2ANPA 2J8NA 4B10A 5ELYA 1YGHA 2CXAA 3S6FA 8CPAA 4KOVA 4IK2A 4BBHA 3PB8X 4OIDA 3FH4A 2FL4A 5K8MA 3S6GA 3GLJA 2HQYA 1IYKA 1CX8A 2FVGA 1B6BA 3SJEA 2F5IA 2K5TA 4R76A 4CGLA 4FD4A 4B5PA 4XNHB 5HXDA 3F0AA 4WJBA 4DUKA 4MCSA 1MJAA 4OP4A 1PYTB 3NE7A 5EMIA 4M6HA 2G3TA 4OADA 4UFXA 4DYOA 4MFKA 1Y9WA 4E8OA 1R43A 4IAVA 2Z3KA 3H8GA 1TF8A 1Z2LA 2PJ5A 5KTCA 4K3NA 1PUAA 4P10A 3DLJA 1Y7EA 2ZEOA 1VHEA 4H89A 4HNYB 2ZW4A 2Z3OA 2Q43A 1PU9A 3GY9A 5HH1A 4NJQA 1XEBA 2R98A 1U6MA 5IX3A 4OC2A 3G8WA 1J4JA 3IIBA 1P0HA 3UY5A 3D66A 2Z3NA 4UEEA 3PP9A 1RO5A 3EO4A 5BWAB 2PJAA 1Y0YA 3SXNA 3OWCA 3FEDA 2BSWA 4B12A 3PRTA 3NA6A 5HVFA 4AXVA 1TKFA 2B4BA 1M4DA 2JEWA 3KI9A 3K9UA 3A9LA 1CPXA 3SXOA 3H8EA 4X3RA 4MBUA 3FVLA 2ARHA 3R95A 3D7HA 4UWIA 2I00A 4E2AA 3LACA 2I3CA 2PJ8A 3GYAA 4LQGA 5H84A 1YR0A 3FECA 3TO7A 1Z4EA 2AFWA 3I9SA 1CM0A 4MCRA 1LCPA 1IB1E 2GE3A 3RBUA 3C26A 5E96A 1YVOA 2R1IA 1NSAA 2OZGA 3DNSA 1XOVA 1BAVA 4MHYA 1P4NA 2BUEA 2Z3LA 1MJ9A 2XEFA 1VIXA 2EK8A 4P4EA 4EMEA 3MN8A 4ONUA 1N71A 2QECA 5D8NA 1VGYA 4OIWA 2EWBA 3FJUA 4KS9A 4A94A 1ELMP 2B3UA 3CPAA 2Q44A 3D7FA 1M44A 3WC7A 2DPSA 4NGMA 2ODFA 4XPDC 5K8PA 2AFMA 1QSRA 1LAMA 4YU9A 3RO0A 2ZW5A 3TX8A 2B4DA 2ZEDA 1S5KA 1ELLP 4GM5A 4TWEA 4R7MA 4JD6A 1XMTA 4TNUA 4Y49B 4X2TA 4F9UA 3GB0A 1TF9A 3PFOA 1YLEA 3CPXA 3EXNA 4O23A 4FAIA 4MI4A 4PSXA 4EFDA 3IWEA 3S9LA 4CS0B 3D2MA 5ISVA 5F46A 5LYIA 1QSMA 1S7LA 2PJ2A 5J1QA 4MHPA 3T9YA 2PRQA 1HEEA 2ZW7A 5F47A 3ZZIA 5KTAA 1ARLA 1BOBA 2NMTA 2GFQA 2QYVA 2I79A 3PFEA 4R87A 3FRMA 3GIUA 2YNCC 1IYLA 2KCWA 2C27A 4C7HA 1BO4A 4P4FA 1YK3A 2ZOGA 1NSLA 3W6SA 2PVWA 3P2FA 4B5OA 4MJ8A 2EUIA 5AG4A 4KVOE 1X10A 2PJ1A 4X8IA 4NSQA 1TKJA 2B5GA 2EK9A 3FF3A 4KORA 4KOWA 4HKFA 5J8FA 3JVNA 2PR1A 3FBUA 1LAPA 2BEIA 2FT0A 1YW6A 3L2NA 1Y0RA 1DTDA 2C6CA 4MFLA 3FX6A 2OZUA 1S60A 4CYPA 1A2ZA 2DF5A 5IB9A 4H2KA 3N5FA 1XE4A 2AJ6A 2Q4VA 3B3CA 4QB9A 1L0CA 3N7ZA 4CGMA 4HPSA 2ABZA 2PJ7A 4MHNA 3TOAA 4AB7A 4QBJA 5A27A 2Z0ZA 3DGVA 2ZEMA 4Q38A 3TFYA 2G0BA 3KGQA 2GU2A 5JQ4A 3FEEA 3T90A 3S9NA 5I4MA 5FVJA 4JJXA 2ZEHA 3V8IA 4CAFA 4ONWA 4MFPA 3NH5A 4MXUA 4RI1A 4UFVA 5F49A 3V38A 2RC4A 4DJLA 4II9A 1UFHA 3SI2A 4RUHA 1BPMA 4IUSA 5JPHA 1CPSA 1Z9UA 3D7GA 4B6ZA 1ON0A 1F57A 3FIXA 3RYOA 4KLVA 1VHOA 4KVXA 2QVPA 2VXKA 3F8KA 3KHXA 3TOBA 4C2XA 1Z8WA 2YGWA 1Z8LA 4NFRA 1NMTA 4PK3A 3SI1A 4MHDA 2VL1A 2C6PA 2X7BA 3NH4A 5F48A 5DS0A 3E0KA 1ARMA 1R3NA 4GXHA 2PJCA 4XPLA 4NGTA 3JTKA 4ZY0A 2FCKA 2EO8A 3PB6X 1CP7A 1SQHA 3CDXA 3ISZA 4NGSA 4QUSA 5AG7A 4EVYA 4KSFA 4MFQA 4ZI6A 5LYDA 1R57A 5G22A 1ZG8A 4F6AA 4K30A 3S6HA 4XPDB 4P4IA 2WUUA 2Q04A 1IICA 4IHMA 3BI1A 3B3VA 3D67A 2PVVA 2PIYA 1YQEA 4NJRA 3TE4A 1Q2CA 1QMUA 3R9EA 4I49A 1X12A 5LYLA 3GUXA 2OB0A 4CPAA 4H6ZA 2CF4A 1HDUA 5JM6A 4OLLA 3PZJA 4UBRA 4JZ0A 4F8ZA 2AFSA 5K8OA 2QMLA 3PB9X 3IC1A 4NF1A 4P4BA 1B87A 5AG5A 3SI0A 4AVAA 2NYQA 3S6KA 3LD2A 2JBJA 4YFJA 2FE7A 2GIVA 4ORFA 4KOSA 2GREA 3CXSA 4F0YA 4XNHC 2PJ4A 2B4DB 1Y7RA 1IY7A 4FWUA 4A2ZA 4ZYQA 1M4LA 3MGDA 2XEJA 4NGPA 1TXRA 4CAWA 4X5KA 4QVTA 2J8MA 3R9FA 4ZY1A 2QIRA 2V8VA 1F2PA 3QB8A 4HNWB 4R6TA 2D4OA 5IB0A 4U5YA 5KTDA 3PBBA 1AMPA 3LWUA 1LFWA 1KWMA 1S7NA 3IU2A 4ZY2A 2HV2A 3KQXA 4L8AA 3B35A 3W6XA 3WC6A 5I0CA 3K2KA 4LQ6A 4MMOA 4KOUA 3WABA 4JXQA 2VBQA 3V7ZA 2HC9A 3NFZA 4JXRA 2Y0MA 1AUGA 1I12A 2AFUA 5LRJA 4JWPA 3KASA 4B14A 2Q4ZA 2R8VA 4PQAA 1QSTA 4R8FA 4LUAA 2V8DA 4UIBA 3TCVA 4UCPA 4E0AA 1V0CA 2Q51A 2WYRA 2Z3MA 4FUUA 5HVHA 2GLFA 2PJ9A 4P45A 1JQGA 1K4JA 1NE9A 2EVNA 4Q36A 2Z11A 4UA3A 4KSAA 4ZX9A 1LANA 3R96A 2JDDA 2CNMA 4J3GA 1ZLHA 3SJGA 4OC0A 3NH8A 2OH1A 3RAMA 1S7FA 4PXEA 2XEGA 5C88A 5JH9A 1I1DA 4EWTA 4YGOA 3FB3A 5D29A 4MY3A 3WR7A 6CPAA 4M6IA 3RZAA 3EY5A 2CY2A 4P4JA 5LRGA 3D3SA 3B8GA 4CGOA 5LRKA 3IJ3A 1RTQA 3KKWA 3PB7X 2ZELA 1KUXA 4UEFA 2ZEFA 2ZW6A 3D68A 4R57A 4BD9A 4A38A 1S7KA 3SHPA 2GLJA 2BL1A 3B2YA 5JGFA 1M4GA 2CTCA 1DE4C 2PJ3A 3IU1A 5K8NA 3JRUA 4UIAA 1YX0A 4MCPA 4OAEA 3DDDA 2Q7SA 1OZPA 4ZX8A 2JLMA 2IQ6A 5CPAA 2PSWA 3BJ7A 4L89A 4LX9A 1QSNA 2REEA 2ZPAA 4OKOA 3QNVA 2VEZA 3DR8A 3H5ZA 3B3WA 4PV6A 4R9MA 2BOAA 4NCZA 4DNCA 2OU2A 2VZYA 4OC1A 3VARA 2O4HA 4B5PB 5G1ZA 4R3LA 3B3SA 3WT4A 3IO1A 1CJWA 1KUYA 4CGNA 2FS5A 2FSRA 1H8LA 1GYTA 2O28A 5H86A 4R3KA 4UEZA 2P6GA 4UWJA 3NE8A 2ATRA 2AFZA 4CAEA 1LRZA 3SJXA 3VWDA 2WPXA 3FYNA 1AYEA 4H6UA 1CBXA 4UF4A 1IIDA 1XJOA 4RN7A 1IOIA 3IEHA 5CNPA 3HLPA 4UCNA 2G9DA 5AGEA 3KR5A 3VWEA 2WZNA 4MFZA 5G20A 4QC6A 4MCQA 1S3ZA 3KHZA 2C6GA 4P4DA 5HVGA 2F8HA 3SJFA 5EC4A 2PJBA 3GKRA 1MJBA 1KUVA 3JUWA 1IU8A 5DWNA 1UWYA 4MY0A 1OBRA 2HUZA 2VQYA 4CAVA 1VKCA 2O53A 1PCAA 1ZG9A 2WPWA 1XBUA 3P2HA 3TO9A 2DXQA 2ZEEA 2B3VA 1XRYA 3VATA 4JYWA 4M6GA 4MRIA 4CAXA 1BPNA 2AFOA 7CPAA 1XF8A 3IWGA 1YREA 3BLNA 4B11A 4AVBA 2DPTA 1QQ9A 4YWYA 4PXDA 4P44A 3I3GA 4M85A 4NEXA 2HB6A
chains in the Genus database with same CATH topology
5IV0A 4CRYB 2PRBA 2Q0YA 4UFWA 2R7HA 2IL4A 5G21A 2YNEA 2REFA 4FD7A 4A32A 2WSAA 4GS4A 4YRHA 2A4NA 3FNCA 3H4QA 4XPKA 4KUBA 2ZXVA 4KOXA 4ZBGA 2D4PA 4CRZB 3BJ8A 2P6EA 2GANA 4A33A 1GHEA 2P6FA 3PGPA 5DWMA 4FD5A 5EBVA 3LODA 4C7IA 1I21A 4AVCA 4KOYA 1M4IA 3EC4A 3CXPA 4U9ZA 1Q2DA 2PC1A 3IGRA 3QAHA 4UCMA 2PDOA 4FD6A 4KVME 3R9GA 1VHSA 4IF5A 3TTHA 4KZTA 2VI7A 2CNTA 2VZZA 2J8RA 2Q7BA 4A31A 2CNSA 2G3AA 2P0WA 3TO6A 4NXYA 4AG7A 1FY7A 1RXTA 2AE6A 2YNCA 4JLYA 4CYNA 3G3SA 5J8CA 3DR6A 2PR8A 1M1DA 1Y9KA 4CYOA 2B5GB 1ZO0A 3TT2A 2PQ8A 4F0XA 5AG6A 5GCNA 3D2PA 2YNDA 3CXQA 5A28A 1WK4A 2OZHA 2Z10A 4RS2A 2B58A 3F5BA 3W91A 4KOTA 1Q2YA 2FIWA 2FXFA 3R1KA 1KZFA 4HNXB 1WWZA 1QSOA 4C2ZA 4PSWA 3D8PA 4Y49C 3ZJ0A 1TIQA 1Z4RA 1MK4A 2JEVA 4MFJA 2Z3PA 4U9YA 4CYQA 1YVKA 2FIAA 4CGPA 5C82A 4C2YA 4ZGYB 5HMNA 4M3SA 2JDCA 2H5MA 4AG9A 4KLWA 1XIXA 4C68A 4B13A 4BMHA 4A95A 4KUAA 2Q4YA 3FXTA 4PK2A 3DSBA 4A30A 3EFAA 2J8NA 4B10A 1YGHA 2CXAA 3S6FA 4KOVA 4BBHA 2FL4A 3S6GA 2HQYA 1IYKA 1B6BA 2F5IA 2K5TA 4CGLA 4FD4A 4B5PA 4XNHB 3F0AA 1MJAA 3NE7A 2G3TA 4OADA 4UFXA 4MFKA 1Y9WA 4E8OA 2Z3KA 5KTCA 1PUAA 4H89A 4HNYB 2ZW4A 2Z3OA 1PU9A 3GY9A 5HH1A 1XEBA 2R98A 1U6MA 5IX3A 3G8WA 1J4JA 1P0HA 3UY5A 2Z3NA 3PP9A 1RO5A 3EO4A 5BWAB 3SXNA 3OWCA 2BSWA 4B12A 2B4BA 1M4DA 3K9UA 3A9LA 3SXOA 4MBUA 2ARHA 3R95A 4UWIA 2I00A 4E2AA 3GYAA 5H84A 1YR0A 3TO7A 1Z4EA 3I9SA 1CM0A 1IB1E 2GE3A 3C26A 5E96A 1YVOA 2R1IA 2OZGA 3DNSA 1P4NA 2BUEA 2Z3LA 1MJ9A 4ONUA 1N71A 2QECA 4KS9A 2B3UA 2Q44A 1M44A 2DPSA 4XPDC 1QSRA 2ZW5A 2B4DA 1S5KA 4Y49B 4JD6A 1XMTA 1YLEA 3EXNA 4MI4A 4PSXA 3IWEA 4CS0B 3D2MA 5ISVA 5F46A 1QSMA 1S7LA 3T9YA 5KTAA 2ZW7A 5F47A 3ZZIA 1BOBA 2NMTA 2I79A 4R87A 3FRMA 2YNCC 1IYLA 2KCWA 2C27A 4C7HA 1BO4A 1YK3A 1NSLA 3W6SA 3P2FA 4B5OA 4MJ8A 2EUIA 5AG4A 4KVOE 4NSQA 2B5GA 4KORA 5J8FA 4KOWA 4HKFA 3JVNA 2PR1A 3FBUA 2BEIA 2FT0A 4MFLA 2OZUA 1S60A 4CYPA 1XE4A 2AJ6A 2Q4VA 4QB9A 1L0CA 3N7ZA 4CGMA 4AB7A 3TOAA 4QBJA 5A27A 2Z0ZA 4Q38A 3TFYA 2G0BA 5JQ4A 3T90A 5FVJA 4JJXA 3V8IA 4CAFA 4MFPA 4RI1A 4UFVA 5F49A 2RC4A 4II9A 1UFHA 4IUSA 5JPHA 1Z9UA 1ON0A 3FIXA 3RYOA 4KLVA 4KVXA 3TOBA 2VXKA 3F8KA 4C2XA 2YGWA 4PK3A 1NMTA 4MHDA 2X7BA 5F48A 3E0KA 4XPLA 3JTKA 2FCKA 1SQHA 4QUSA 5AG7A 4EVYA 4KSFA 4MFQA 1R57A 5G22A 4F6AA 4K30A 3S6HA 4XPDB 2WUUA 2Q04A 1IICA 3TE4A 1Q2CA 3R9EA 4I49A 2OB0A 4H6ZA 4OLLA 3PZJA 4UBRA 2QMLA 4NF1A 1B87A 5AG5A 4AVAA 3S6KA 3LD2A 4YFJA 2FE7A 2GIVA 4ORFA 4KOSA 3CXSA 4F0YA 4XNHC 2B4DB 1Y7RA 4A2ZA 3MGDA 4CAWA 4X5KA 4QVTA 2J8MA 3R9FA 2QIRA 4HNWB 3QB8A 2D4OA 5IB0A 4U5YA 5KTDA 1S7NA 3IU2A 2HV2A 4L8AA 3W6XA 5I0CA 4KOUA 4JXQA 2VBQA 4JXRA 2Y0MA 1I12A 4JWPA 4B14A 2R8VA 1QSTA 4LUAA 3TCVA 4UCPA 4E0AA 1V0CA 2Z3MA 1NE9A 1K4JA 4Q36A 2EVNA 4UA3A 2Z11A 3R96A 4KSAA 2JDDA 2CNMA 4J3GA 2OH1A 1S7FA 5C88A 1I1DA 4YGOA 3FB3A 3WR7A 4MY3A 3EY5A 2CY2A 3D3SA 3B8GA 4CGOA 3KKWA 1KUXA 2ZW6A 4R57A 1S7KA 3SHPA 2BL1A 1M4GA 3IU1A 1YX0A 4OAEA 3DDDA 1OZPA 2JLMA 2PSWA 3BJ7A 4L89A 4LX9A 1QSNA 2REEA 2ZPAA 4R9MA 4PV6A 2VEZA 3DR8A 3H5ZA 4NCZA 4DNCA 2OU2A 2VZYA 4B5PB 5G1ZA 4R3LA 1CJWA 1KUYA 4CGNA 2FS5A 2FSRA 2O28A 5H86A 4R3KA 2P6GA 4UWJA 2ATRA 4CAEA 1LRZA 3VWDA 2WPXA 3FYNA 4H6UA 1IIDA 5CNPA 4UCNA 5AGEA 3VWEA 4MFZA 5G20A 4QC6A 1S3ZA 5EC4A 3GKRA 1MJBA 1KUVA 3JUWA 5DWNA 4MY0A 2HUZA 2VQYA 4CAVA 1VKCA 3TO9A 2WPWA 3P2HA 2DXQA 2B3VA 4CAXA 1XF8A 3IWGA 1YREA 3BLNA 4B11A 4AVBA 2DPTA 3I3GA 4M85A 4NEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV0 A;  4CRY B;  2PRB A;  2Q0Y A;  2R7H A;  2IL4 A;  2REF A;  4FD7 A;  4GS4 A;  4YRH A;  2A4N A;  3FNC A;  3H4Q A;  4XPK A;  4KUB A;  2ZXV A;  4KOX A;  4ZBG A;  2D4P A;  4CRZ B;  3BJ8 A;  2P6E A;  2GAN A;  1GHE A;  2P6F A;  3PGP A;  5DWM A;  4FD5 A;  5EBV A;  3LOD A;  1I21 A;  4AVC A;  4KOY A;  1M4I A;  3EC4 A;  3CXP A;  4U9Z A;  1Q2D A;  2PC1 A;  3IGR A;  3QAH A;  2PDO A;  4FD6 A;  4KVM E;  3R9G A;  1VHS A;  4IF5 A;  3TTH A;  4KZT A;  2VI7 A;  2CNT A;  2VZZ A;  2J8R A;  2Q7B A;  2CNS A;  2G3A A;  2P0W A;  3TO6 A;  4NXY A;  4AG7 A;  1FY7 A;  1RXT A;  2AE6 A;  4JLY A;  3G3S A;  5J8C A;  3DR6 A;  2PR8 A;  1M1D A;  1Y9K A;  2B5G B;  3TT2 A;  2PQ8 A;  5GCN A;  3D2P A;  3CXQ A;  1WK4 A;  2OZH A;  2Z10 A;  4RS2 A;  2B58 A;  3F5B A;  3W91 A;  4KOT A;  1Q2Y A;  2FIW A;  2FXF A;  3R1K A;  1KZF A;  4HNX B;  1WWZ A;  1QSO A;  4PSW A;  3D8P A;  4Y49 C;  3ZJ0 A;  1TIQ A;  1Z4R A;  1MK4 A;  2JEV A;  4U9Y A;  1YVK A;  2FIA A;  5C82 A;  5HMN A;  4M3S A;  2JDC A;  2H5M A;  4AG9 A;  4KLW A;  1XIX A;  4BMH A;  4KUA A;  2Q4Y A;  3FXT A;  4PK2 A;  3DSB A;  3EFA A;  2J8N A;  1YGH A;  3S6F A;  4KOV A;  2FL4 A;  3S6G A;  2HQY A;  1IYK A;  1B6B A;  2F5I A;  2K5T A;  4FD4 A;  4B5P A;  4XNH B;  3F0A A;  1MJA A;  3NE7 A;  2G3T A;  4OAD A;  1Y9W A;  4E8O A;  5KTC A;  1PUA A;  4H89 A;  4HNY B;  2ZW4 A;  1PU9 A;  3GY9 A;  5HH1 A;  1XEB A;  2R98 A;  1U6M A;  5IX3 A;  3G8W A;  1J4J A;  1P0H A;  3UY5 A;  3PP9 A;  1RO5 A;  3EO4 A;  3SXN A;  3OWC A;  2BSW A;  2B4B A;  1M4D A;  3K9U A;  3SXO A;  4MBU A;  2ARH A;  3R95 A;  4UWI A;  2I00 A;  4E2A A;  3GYA A;  5H84 A;  1YR0 A;  3TO7 A;  1Z4E A;  3I9S A;  1CM0 A;  1IB1 E;  2GE3 A;  3C26 A;  5E96 A;  1YVO A;  2R1I A;  2OZG A;  3DNS A;  1P4N A;  2BUE A;  1MJ9 A;  4ONU A;  1N71 A;  2QEC A;  2B3U A;  2Q44 A;  1M44 A;  4XPD C;  1QSR A;  2ZW5 A;  2B4D A;  1S5K A;  4Y49 B;  4JD6 A;  1XMT A;  1YLE A;  3EXN A;  4MI4 A;  4PSX A;  4CS0 B;  3D2M A;  5ISV A;  5F46 A;  1QSM A;  1S7L A;  3T9Y A;  5KTA A;  2ZW7 A;  5F47 A;  3ZZI A;  1BOB A;  2NMT A;  2I79 A;  4R87 A;  3FRM A;  1IYL A;  2KCW A;  2C27 A;  1BO4 A;  1YK3 A;  1NSL A;  3W6S A;  3P2F A;  4B5O A;  4MJ8 A;  2EUI A;  4KVO E;  4NSQ A;  2B5G A;  4KOR A;  5J8F A;  4KOW A;  4HKF A;  3JVN A;  2PR1 A;  3FBU A;  2BEI A;  2FT0 A;  2OZU A;  1S60 A;  1XE4 A;  2AJ6 A;  2Q4V A;  4QB9 A;  1L0C A;  3N7Z A;  4AB7 A;  3TOA A;  4QBJ A;  2Z0Z A;  3TFY A;  2G0B A;  5JQ4 A;  3T90 A;  5FVJ A;  4JJX A;  3V8I A;  4RI1 A;  5F49 A;  2RC4 A;  4II9 A;  1UFH A;  4IUS A;  5JPH A;  1Z9U A;  1ON0 A;  3FIX A;  3RYO A;  4KLV A;  4KVX A;  3TOB A;  2VXK A;  3F8K A;  4PK3 A;  1NMT A;  4MHD A;  2X7B A;  5F48 A;  3E0K A;  4XPL A;  2FCK A;  1SQH A;  4QUS A;  4EVY A;  1R57 A;  4F6A A;  4K30 A;  3S6H A;  4XPD B;  2Q04 A;  1IIC A;  3TE4 A;  1Q2C A;  3R9E A;  4I49 A;  2OB0 A;  4H6Z A;  4OLL A;  3PZJ A;  4UBR A;  2QML A;  4NF1 A;  1B87 A;  4AVA A;  3S6K A;  3LD2 A;  4YFJ A;  2FE7 A;  2GIV A;  4ORF A;  4KOS A;  3CXS A;  4F0Y A;  4XNH C;  2B4D B;  1Y7R A;  3MGD A;  4CAW A;  4X5K A;  4QVT A;  2J8M A;  3R9F A;  2QIR A;  4HNW B;  3QB8 A;  2D4O A;  5IB0 A;  4U5Y A;  5KTD A;  1S7N A;  2HV2 A;  4L8A A;  3W6X A;  5I0C A;  4KOU A;  4JXQ A;  2VBQ A;  4JXR A;  2Y0M A;  1I12 A;  4JWP A;  2R8V A;  1QST A;  4LUA A;  3TCV A;  4E0A A;  1V0C A;  1NE9 A;  1K4J A;  4UA3 A;  2EVN A;  3R96 A;  2Z11 A;  2JDD A;  2CNM A;  4J3G A;  2OH1 A;  1S7F A;  5C88 A;  1I1D A;  4YGO A;  3FB3 A;  3WR7 A;  4MY3 A;  3EY5 A;  2CY2 A;  3D3S A;  3B8G A;  3KKW A;  1KUX A;  2ZW6 A;  4R57 A;  1S7K A;  3SHP A;  2BL1 A;  1M4G A;  1YX0 A;  4OAE A;  3DDD A;  1OZP A;  2JLM A;  2PSW A;  3BJ7 A;  4LX9 A;  4L89 A;  1QSN A;  2REE A;  2ZPA A;  4R9M A;  4PV6 A;  2VEZ A;  3DR8 A;  4NCZ A;  4DNC A;  2OU2 A;  2VZY A;  4B5P B;  4R3L A;  1CJW A;  1KUY A;  2FS5 A;  2FSR A;  2O28 A;  5H86 A;  4R3K A;  2P6G A;  4UWJ A;  2ATR A;  1LRZ A;  3VWD A;  2WPX A;  3FYN A;  4H6U A;  1IID A;  5CNP A;  3VWE A;  4QC6 A;  1S3Z A;  5EC4 A;  3GKR A;  1MJB A;  1KUV A;  3JUW A;  5DWN A;  4MY0 A;  2HUZ A;  2VQY A;  4CAV A;  1VKC A;  3TO9 A;  2WPW A;  3P2H A;  2DXQ A;  2B3V A;  4CAX A;  1XF8 A;  3IWG A;  1YRE A;  3BLN A;  4AVB A;  3I3G A;  4M85 A;  4NEX A; 
#chains in the Genus database with same CATH topology
 5IV0 A;  3B3T A;  4CRY B;  2PRB A;  3FMC A;  2Q0Y A;  4UFW A;  2R7H A;  2IL4 A;  1FT7 A;  5G21 A;  2F7V A;  2YNE A;  2REF A;  2ZOF A;  4FD7 A;  4MHZ A;  2V8H A;  2WSA A;  4A32 A;  2ZEG A;  4GS4 A;  5LYF A;  4YRH A;  2A4N A;  3FNC A;  3H4Q A;  3KQZ A;  4XPK A;  4PXB A;  1Z5R A;  4KUB A;  2ZXV A;  3D7D A;  4KOX A;  4ZBG A;  1BLL E;  4Z65 A;  2D4P A;  4CRZ B;  3BJ8 A;  3IWW A;  2P6E A;  2PJ0 A;  4OME A;  2PE3 A;  3KR4 A;  4NGR A;  2GAN A;  3HUV A;  3TC8 A;  2IJZ A;  2RB7 A;  1XFO A;  2PIZ A;  4A33 A;  1GHE A;  2QJ8 A;  2IMO A;  1YLO A;  2P6F A;  2ZEP A;  2BO9 A;  3PGP A;  5DWM A;  4FD5 A;  5EBV A;  3LOD A;  2V8G A;  2BCO A;  4C7I A;  1I21 A;  2XEI A;  4AVC A;  3CT9 A;  4KOY A;  4NGQ A;  1M4I A;  3EC4 A;  3CXP A;  3BI0 A;  4U9Z A;  3WC5 A;  1Q2D A;  2PC1 A;  3IGR A;  3QAH A;  4KSI A;  4UCM A;  2PDO A;  4FD6 A;  3PB4 X;  4KVM E;  4PXC A;  3R9G A;  1VHS A;  2JBK A;  3KL9 A;  4IF5 A;  2ZEN A;  4G1P A;  4KZT A;  2VI7 A;  3TTH A;  2CNT A;  2VZZ A;  2J8R A;  4OC5 A;  1YME A;  2RFH A;  2Q7B A;  4A31 A;  4F9V A;  2CNS A;  3IFE A;  1ZLI A;  2G3A A;  2P0W A;  3CZX A;  4NXY A;  3TO6 A;  4AG7 A;  1FY7 A;  3PBE A;  1RXT A;  2AE6 A;  2YNC A;  4WWV A;  4JLY A;  1YSJ A;  2AFX A;  4A39 A;  1IGB A;  4CYN A;  2PCU A;  1TKH A;  3G3S A;  3ISX A;  5J8C A;  3DR6 A;  2EBJ A;  2PR8 A;  3BXM A;  1M1D A;  1Q7L A;  1Y9K A;  1XMB A;  3B7I A;  4PPZ A;  4CYO A;  2B5G B;  3H8F A;  3PEI A;  1ZO0 A;  3TT2 A;  3QAY A;  2J9A A;  2PQ8 A;  1YW4 A;  4F0X A;  5AG6 A;  4OC3 A;  5GCN A;  3T8W A;  3D2P A;  2CIJ A;  4Q7A A;  2YND A;  3CXQ A;  2OOT A;  2CTB A;  5A28 A;  1WK4 A;  2OZH A;  2POK A;  2Z10 A;  4RS2 A;  5F09 A;  2B58 A;  3F5B A;  3I1U A;  3LMS A;  3W91 A;  4KOT A;  1Q2Y A;  1ZG7 A;  2FIW A;  3D4U A;  2FXF A;  3R1K A;  1KZF A;  4BIN A;  1IOF A;  1CG2 A;  4HNX B;  1WWZ A;  2PJ6 A;  3VH9 A;  1QSO A;  4C2Z A;  3K9T A;  3D8P A;  4PSW A;  4Y49 C;  4W9Y A;  1TIQ A;  3ZJ0 A;  1Z4R A;  1F2O A;  1MK4 A;  2JEV A;  3BHX A;  4MFJ A;  2Z3P A;  1EE3 P;  2V77 A;  4U9Y A;  2NSM A;  3S9M A;  4CYQ A;  1YVK A;  3KZW A;  1Z8T A;  2FIA A;  4CGP A;  4NGN A;  5C82 A;  3RNZ A;  4C2Y A;  4ZGY B;  1JWQ A;  1CP6 A;  5HMN A;  5CBM A;  1HDQ A;  1Z8X A;  5THW A;  2DEA A;  1LOK A;  4M3S A;  4OC4 A;  2OR4 A;  2JDC A;  2H5M A;  4AG9 A;  4A37 A;  4KLW A;  1XIX A;  4P6Y A;  4C68 A;  4B13 A;  4BMH A;  4A95 A;  4KUA A;  2Q4Y A;  4FBE A;  2C1C A;  3FXT A;  4PK2 A;  3DSB A;  3MRU A;  4A30 A;  3EFA A;  1FNO A;  2ANP A;  2J8N A;  4B10 A;  5ELY A;  1YGH A;  2CXA A;  3S6F A;  8CPA A;  4KOV A;  4IK2 A;  4BBH A;  3PB8 X;  4OID A;  3FH4 A;  2FL4 A;  5K8M A;  3S6G A;  3GLJ A;  2HQY A;  1IYK A;  1CX8 A;  2FVG A;  1B6B A;  3SJE A;  2F5I A;  2K5T A;  4R76 A;  4CGL A;  4FD4 A;  4B5P A;  4XNH B;  5HXD A;  3F0A A;  4WJB A;  4DUK A;  4MCS A;  1MJA A;  4OP4 A;  1PYT B;  3NE7 A;  5EMI A;  4M6H A;  2G3T A;  4OAD A;  4UFX A;  4DYO A;  4MFK A;  1Y9W A;  4E8O A;  1R43 A;  4IAV A;  2Z3K A;  3H8G A;  1TF8 A;  1Z2L A;  2PJ5 A;  5KTC A;  4K3N A;  1PUA A;  4P10 A;  3DLJ A;  1Y7E A;  2ZEO A;  1VHE A;  4H89 A;  4HNY B;  2ZW4 A;  2Z3O A;  2Q43 A;  1PU9 A;  3GY9 A;  5HH1 A;  4NJQ A;  1XEB A;  2R98 A;  1U6M A;  5IX3 A;  4OC2 A;  3G8W A;  1J4J A;  3IIB A;  1P0H A;  3UY5 A;  3D66 A;  2Z3N A;  4UEE A;  3PP9 A;  1RO5 A;  3EO4 A;  5BWA B;  2PJA A;  1Y0Y A;  3SXN A;  3OWC A;  3FED A;  2BSW A;  4B12 A;  3PRT A;  3NA6 A;  5HVF A;  4AXV A;  1TKF A;  2B4B A;  1M4D A;  2JEW A;  3KI9 A;  3K9U A;  3A9L A;  1CPX A;  3SXO A;  3H8E A;  4X3R A;  4MBU A;  3FVL A;  2ARH A;  3R95 A;  3D7H A;  4UWI A;  2I00 A;  4E2A A;  3LAC A;  2I3C A;  2PJ8 A;  3GYA A;  4LQG A;  5H84 A;  1YR0 A;  3FEC A;  3TO7 A;  1Z4E A;  2AFW A;  3I9S A;  1CM0 A;  4MCR A;  1LCP A;  1IB1 E;  2GE3 A;  3RBU A;  3C26 A;  5E96 A;  1YVO A;  2R1I A;  1NSA A;  2OZG A;  3DNS A;  1XOV A;  1BAV A;  4MHY A;  1P4N A;  2BUE A;  2Z3L A;  1MJ9 A;  2XEF A;  1VIX A;  2EK8 A;  4P4E A;  4EME A;  3MN8 A;  4ONU A;  1N71 A;  2QEC A;  5D8N A;  1VGY A;  4OIW A;  2EWB A;  3FJU A;  4KS9 A;  4A94 A;  1ELM P;  2B3U A;  3CPA A;  2Q44 A;  3D7F A;  1M44 A;  3WC7 A;  2DPS A;  4NGM A;  2ODF A;  4XPD C;  5K8P A;  2AFM A;  1QSR A;  1LAM A;  4YU9 A;  3RO0 A;  2ZW5 A;  3TX8 A;  2B4D A;  2ZED A;  1S5K A;  1ELL P;  4GM5 A;  4TWE A;  4R7M A;  4JD6 A;  1XMT A;  4TNU A;  4Y49 B;  4X2T A;  4F9U A;  3GB0 A;  1TF9 A;  3PFO A;  1YLE A;  3CPX A;  3EXN A;  4O23 A;  4FAI A;  4MI4 A;  4PSX A;  4EFD A;  3IWE A;  3S9L A;  4CS0 B;  3D2M A;  5ISV A;  5F46 A;  5LYI A;  1QSM A;  1S7L A;  2PJ2 A;  5J1Q A;  4MHP A;  3T9Y A;  2PRQ A;  1HEE A;  2ZW7 A;  5F47 A;  3ZZI A;  5KTA A;  1ARL A;  1BOB A;  2NMT A;  2GFQ A;  2QYV A;  2I79 A;  3PFE A;  4R87 A;  3FRM A;  3GIU A;  2YNC C;  1IYL A;  2KCW A;  2C27 A;  4C7H A;  1BO4 A;  4P4F A;  1YK3 A;  2ZOG A;  1NSL A;  3W6S A;  2PVW A;  3P2F A;  4B5O A;  4MJ8 A;  2EUI A;  5AG4 A;  4KVO E;  1X10 A;  2PJ1 A;  4X8I A;  4NSQ A;  1TKJ A;  2B5G A;  2EK9 A;  3FF3 A;  4KOR A;  4KOW A;  4HKF A;  5J8F A;  3JVN A;  2PR1 A;  3FBU A;  1LAP A;  2BEI A;  2FT0 A;  1YW6 A;  3L2N A;  1Y0R A;  1DTD A;  2C6C A;  4MFL A;  3FX6 A;  2OZU A;  1S60 A;  4CYP A;  1A2Z A;  2DF5 A;  5IB9 A;  4H2K A;  3N5F A;  1XE4 A;  2AJ6 A;  2Q4V A;  3B3C A;  4QB9 A;  1L0C A;  3N7Z A;  4CGM A;  4HPS A;  2ABZ A;  2PJ7 A;  4MHN A;  3TOA A;  4AB7 A;  4QBJ A;  5A27 A;  2Z0Z A;  3DGV A;  2ZEM A;  4Q38 A;  3TFY A;  2G0B A;  3KGQ A;  2GU2 A;  5JQ4 A;  3FEE A;  3T90 A;  3S9N A;  5I4M A;  5FVJ A;  4JJX A;  2ZEH A;  3V8I A;  4CAF A;  4ONW A;  4MFP A;  3NH5 A;  4MXU A;  4RI1 A;  4UFV A;  5F49 A;  3V38 A;  2RC4 A;  4DJL A;  4II9 A;  1UFH A;  3SI2 A;  4RUH A;  1BPM A;  4IUS A;  5JPH A;  1CPS A;  1Z9U A;  3D7G A;  4B6Z A;  1ON0 A;  1F57 A;  3FIX A;  3RYO A;  4KLV A;  1VHO A;  4KVX A;  2QVP A;  2VXK A;  3F8K A;  3KHX A;  3TOB A;  4C2X A;  1Z8W A;  2YGW A;  1Z8L A;  4NFR A;  1NMT A;  4PK3 A;  3SI1 A;  4MHD A;  2VL1 A;  2C6P A;  2X7B A;  3NH4 A;  5F48 A;  5DS0 A;  3E0K A;  1ARM A;  1R3N A;  4GXH A;  2PJC A;  4XPL A;  4NGT A;  3JTK A;  4ZY0 A;  2FCK A;  2EO8 A;  3PB6 X;  1CP7 A;  1SQH A;  3CDX A;  3ISZ A;  4NGS A;  4QUS A;  5AG7 A;  4EVY A;  4KSF A;  4MFQ A;  4ZI6 A;  5LYD A;  1R57 A;  5G22 A;  1ZG8 A;  4F6A A;  4K30 A;  3S6H A;  4XPD B;  4P4I A;  2WUU A;  2Q04 A;  1IIC A;  4IHM A;  3BI1 A;  3B3V A;  3D67 A;  2PVV A;  2PIY A;  1YQE A;  4NJR A;  3TE4 A;  1Q2C A;  1QMU A;  3R9E A;  4I49 A;  1X12 A;  5LYL A;  3GUX A;  2OB0 A;  4CPA A;  4H6Z A;  2CF4 A;  1HDU A;  5JM6 A;  4OLL A;  3PZJ A;  4UBR A;  4JZ0 A;  4F8Z A;  2AFS A;  5K8O A;  2QML A;  3PB9 X;  3IC1 A;  4NF1 A;  4P4B A;  1B87 A;  5AG5 A;  3SI0 A;  4AVA A;  2NYQ A;  3S6K A;  3LD2 A;  2JBJ A;  4YFJ A;  2FE7 A;  2GIV A;  4ORF A;  4KOS A;  2GRE A;  3CXS A;  4F0Y A;  4XNH C;  2PJ4 A;  2B4D B;  1Y7R A;  1IY7 A;  4FWU A;  4A2Z A;  4ZYQ A;  1M4L A;  3MGD A;  2XEJ A;  4NGP A;  1TXR A;  4CAW A;  4X5K A;  4QVT A;  2J8M A;  3R9F A;  4ZY1 A;  2QIR A;  2V8V A;  1F2P A;  3QB8 A;  4HNW B;  4R6T A;  2D4O A;  5IB0 A;  4U5Y A;  5KTD A;  3PBB A;  1AMP A;  3LWU A;  1LFW A;  1KWM A;  1S7N A;  3IU2 A;  4ZY2 A;  2HV2 A;  3KQX A;  4L8A A;  3B35 A;  3W6X A;  3WC6 A;  5I0C A;  3K2K A;  4LQ6 A;  4MMO A;  4KOU A;  3WAB A;  4JXQ A;  2VBQ A;  3V7Z A;  2HC9 A;  3NFZ A;  4JXR A;  2Y0M A;  1AUG A;  1I12 A;  2AFU A;  5LRJ A;  4JWP A;  3KAS A;  4B14 A;  2Q4Z A;  2R8V A;  4PQA A;  1QST A;  4R8F A;  4LUA A;  2V8D A;  4UIB A;  3TCV A;  4UCP A;  4E0A A;  1V0C A;  2Q51 A;  2WYR A;  2Z3M A;  4FUU A;  5HVH A;  2GLF A;  2PJ9 A;  4P45 A;  1JQG A;  1K4J A;  1NE9 A;  2EVN A;  4Q36 A;  2Z11 A;  4UA3 A;  4KSA A;  4ZX9 A;  1LAN A;  3R96 A;  2JDD A;  2CNM A;  4J3G A;  1ZLH A;  3SJG A;  4OC0 A;  3NH8 A;  2OH1 A;  3RAM A;  1S7F A;  4PXE A;  2XEG A;  5C88 A;  5JH9 A;  1I1D A;  4EWT A;  4YGO A;  3FB3 A;  5D29 A;  4MY3 A;  3WR7 A;  6CPA A;  4M6I A;  3RZA A;  3EY5 A;  2CY2 A;  4P4J A;  5LRG A;  3D3S A;  3B8G A;  4CGO A;  5LRK A;  3IJ3 A;  1RTQ A;  3KKW A;  3PB7 X;  2ZEL A;  1KUX A;  4UEF A;  2ZEF A;  2ZW6 A;  3D68 A;  4R57 A;  4BD9 A;  4A38 A;  1S7K A;  3SHP A;  2GLJ A;  2BL1 A;  3B2Y A;  5JGF A;  1M4G A;  2CTC A;  1DE4 C;  2PJ3 A;  3IU1 A;  5K8N A;  3JRU A;  4UIA A;  1YX0 A;  4MCP A;  4OAE A;  3DDD A;  2Q7S A;  1OZP A;  4ZX8 A;  2JLM A;  2IQ6 A;  5CPA A;  2PSW A;  3BJ7 A;  4L89 A;  4LX9 A;  1QSN A;  2REE A;  2ZPA A;  4OKO A;  3QNV A;  2VEZ A;  3DR8 A;  3H5Z A;  3B3W A;  4PV6 A;  4R9M A;  2BOA A;  4NCZ A;  4DNC A;  2OU2 A;  2VZY A;  4OC1 A;  3VAR A;  2O4H A;  4B5P B;  5G1Z A;  4R3L A;  3B3S A;  3WT4 A;  3IO1 A;  1CJW A;  1KUY A;  4CGN A;  2FS5 A;  2FSR A;  1H8L A;  1GYT A;  2O28 A;  5H86 A;  4R3K A;  4UEZ A;  2P6G A;  4UWJ A;  3NE8 A;  2ATR A;  2AFZ A;  4CAE A;  1LRZ A;  3SJX A;  3VWD A;  2WPX A;  3FYN A;  1AYE A;  4H6U A;  1CBX A;  4UF4 A;  1IID A;  1XJO A;  4RN7 A;  1IOI A;  3IEH A;  5CNP A;  3HLP A;  4UCN A;  2G9D A;  5AGE A;  3KR5 A;  3VWE A;  2WZN A;  4MFZ A;  5G20 A;  4QC6 A;  4MCQ A;  1S3Z A;  3KHZ A;  2C6G A;  4P4D A;  5HVG A;  2F8H A;  3SJF A;  5EC4 A;  2PJB A;  3GKR A;  1MJB A;  1KUV A;  3JUW A;  1IU8 A;  5DWN A;  1UWY A;  4MY0 A;  1OBR A;  2HUZ A;  2VQY A;  4CAV A;  1VKC A;  2O53 A;  1PCA A;  1ZG9 A;  2WPW A;  1XBU A;  3P2H A;  3TO9 A;  2DXQ A;  2ZEE A;  2B3V A;  1XRY A;  3VAT A;  4JYW A;  4M6G A;  4MRI A;  4CAX A;  1BPN A;  2AFO A;  7CPA A;  1XF8 A;  3IWG A;  1YRE A;  3BLN A;  4B11 A;  4AVB A;  2DPT A;  1QQ9 A;  4YWY A;  4PXD A;  4P44 A;  3I3G A;  4M85 A;  4NEX A;  2HB6 A; 
#chains in the Genus database with same CATH homology
 5IV0 A;  4CRY B;  2PRB A;  2Q0Y A;  4UFW A;  2R7H A;  2IL4 A;  5G21 A;  2YNE A;  2REF A;  4FD7 A;  4A32 A;  2WSA A;  4GS4 A;  4YRH A;  2A4N A;  3FNC A;  3H4Q A;  4XPK A;  4KUB A;  2ZXV A;  4KOX A;  4ZBG A;  2D4P A;  4CRZ B;  3BJ8 A;  2P6E A;  2GAN A;  4A33 A;  1GHE A;  2P6F A;  3PGP A;  5DWM A;  4FD5 A;  5EBV A;  3LOD A;  4C7I A;  1I21 A;  4AVC A;  4KOY A;  1M4I A;  3EC4 A;  3CXP A;  4U9Z A;  1Q2D A;  2PC1 A;  3IGR A;  3QAH A;  4UCM A;  2PDO A;  4FD6 A;  4KVM E;  3R9G A;  1VHS A;  4IF5 A;  3TTH A;  4KZT A;  2VI7 A;  2CNT A;  2VZZ A;  2J8R A;  2Q7B A;  4A31 A;  2CNS A;  2G3A A;  2P0W A;  3TO6 A;  4NXY A;  4AG7 A;  1FY7 A;  1RXT A;  2AE6 A;  2YNC A;  4JLY A;  4CYN A;  3G3S A;  5J8C A;  3DR6 A;  2PR8 A;  1M1D A;  1Y9K A;  4CYO A;  2B5G B;  1ZO0 A;  3TT2 A;  2PQ8 A;  4F0X A;  5AG6 A;  5GCN A;  3D2P A;  2YND A;  3CXQ A;  5A28 A;  1WK4 A;  2OZH A;  2Z10 A;  4RS2 A;  2B58 A;  3F5B A;  3W91 A;  4KOT A;  1Q2Y A;  2FIW A;  2FXF A;  3R1K A;  1KZF A;  4HNX B;  1WWZ A;  1QSO A;  4C2Z A;  4PSW A;  3D8P A;  4Y49 C;  3ZJ0 A;  1TIQ A;  1Z4R A;  1MK4 A;  2JEV A;  4MFJ A;  2Z3P A;  4U9Y A;  4CYQ A;  1YVK A;  2FIA A;  4CGP A;  5C82 A;  4C2Y A;  4ZGY B;  5HMN A;  4M3S A;  2JDC A;  2H5M A;  4AG9 A;  4KLW A;  1XIX A;  4C68 A;  4B13 A;  4BMH A;  4A95 A;  4KUA A;  2Q4Y A;  3FXT A;  4PK2 A;  3DSB A;  4A30 A;  3EFA A;  2J8N A;  4B10 A;  1YGH A;  2CXA A;  3S6F A;  4KOV A;  4BBH A;  2FL4 A;  3S6G A;  2HQY A;  1IYK A;  1B6B A;  2F5I A;  2K5T A;  4CGL A;  4FD4 A;  4B5P A;  4XNH B;  3F0A A;  1MJA A;  3NE7 A;  2G3T A;  4OAD A;  4UFX A;  4MFK A;  1Y9W A;  4E8O A;  2Z3K A;  5KTC A;  1PUA A;  4H89 A;  4HNY B;  2ZW4 A;  2Z3O A;  1PU9 A;  3GY9 A;  5HH1 A;  1XEB A;  2R98 A;  1U6M A;  5IX3 A;  3G8W A;  1J4J A;  1P0H A;  3UY5 A;  2Z3N A;  3PP9 A;  1RO5 A;  3EO4 A;  5BWA B;  3SXN A;  3OWC A;  2BSW A;  4B12 A;  2B4B A;  1M4D A;  3K9U A;  3A9L A;  3SXO A;  4MBU A;  2ARH A;  3R95 A;  4UWI A;  2I00 A;  4E2A A;  3GYA A;  5H84 A;  1YR0 A;  3TO7 A;  1Z4E A;  3I9S A;  1CM0 A;  1IB1 E;  2GE3 A;  3C26 A;  5E96 A;  1YVO A;  2R1I A;  2OZG A;  3DNS A;  1P4N A;  2BUE A;  2Z3L A;  1MJ9 A;  4ONU A;  1N71 A;  2QEC A;  4KS9 A;  2B3U A;  2Q44 A;  1M44 A;  2DPS A;  4XPD C;  1QSR A;  2ZW5 A;  2B4D A;  1S5K A;  4Y49 B;  4JD6 A;  1XMT A;  1YLE A;  3EXN A;  4MI4 A;  4PSX A;  3IWE A;  4CS0 B;  3D2M A;  5ISV A;  5F46 A;  1QSM A;  1S7L A;  3T9Y A;  5KTA A;  2ZW7 A;  5F47 A;  3ZZI A;  1BOB A;  2NMT A;  2I79 A;  4R87 A;  3FRM A;  2YNC C;  1IYL A;  2KCW A;  2C27 A;  4C7H A;  1BO4 A;  1YK3 A;  1NSL A;  3W6S A;  3P2F A;  4B5O A;  4MJ8 A;  2EUI A;  5AG4 A;  4KVO E;  4NSQ A;  2B5G A;  4KOR A;  5J8F A;  4KOW A;  4HKF A;  3JVN A;  2PR1 A;  3FBU A;  2BEI A;  2FT0 A;  4MFL A;  2OZU A;  1S60 A;  4CYP A;  1XE4 A;  2AJ6 A;  2Q4V A;  4QB9 A;  1L0C A;  3N7Z A;  4CGM A;  4AB7 A;  3TOA A;  4QBJ A;  5A27 A;  2Z0Z A;  4Q38 A;  3TFY A;  2G0B A;  5JQ4 A;  3T90 A;  5FVJ A;  4JJX A;  3V8I A;  4CAF A;  4MFP A;  4RI1 A;  4UFV A;  5F49 A;  2RC4 A;  4II9 A;  1UFH A;  4IUS A;  5JPH A;  1Z9U A;  1ON0 A;  3FIX A;  3RYO A;  4KLV A;  4KVX A;  3TOB A;  2VXK A;  3F8K A;  4C2X A;  2YGW A;  4PK3 A;  1NMT A;  4MHD A;  2X7B A;  5F48 A;  3E0K A;  4XPL A;  3JTK A;  2FCK A;  1SQH A;  4QUS A;  5AG7 A;  4EVY A;  4KSF A;  4MFQ A;  1R57 A;  5G22 A;  4F6A A;  4K30 A;  3S6H A;  4XPD B;  2WUU A;  2Q04 A;  1IIC A;  3TE4 A;  1Q2C A;  3R9E A;  4I49 A;  2OB0 A;  4H6Z A;  4OLL A;  3PZJ A;  4UBR A;  2QML A;  4NF1 A;  1B87 A;  5AG5 A;  4AVA A;  3S6K A;  3LD2 A;  4YFJ A;  2FE7 A;  2GIV A;  4ORF A;  4KOS A;  3CXS A;  4F0Y A;  4XNH C;  2B4D B;  1Y7R A;  4A2Z A;  3MGD A;  4CAW A;  4X5K A;  4QVT A;  2J8M A;  3R9F A;  2QIR A;  4HNW B;  3QB8 A;  2D4O A;  5IB0 A;  4U5Y A;  5KTD A;  1S7N A;  3IU2 A;  2HV2 A;  4L8A A;  3W6X A;  5I0C A;  4KOU A;  4JXQ A;  2VBQ A;  4JXR A;  2Y0M A;  1I12 A;  4JWP A;  4B14 A;  2R8V A;  1QST A;  4LUA A;  3TCV A;  4UCP A;  4E0A A;  1V0C A;  2Z3M A;  1NE9 A;  1K4J A;  4Q36 A;  2EVN A;  4UA3 A;  2Z11 A;  3R96 A;  4KSA A;  2JDD A;  2CNM A;  4J3G A;  2OH1 A;  1S7F A;  5C88 A;  1I1D A;  4YGO A;  3FB3 A;  3WR7 A;  4MY3 A;  3EY5 A;  2CY2 A;  3D3S A;  3B8G A;  4CGO A;  3KKW A;  1KUX A;  2ZW6 A;  4R57 A;  1S7K A;  3SHP A;  2BL1 A;  1M4G A;  3IU1 A;  1YX0 A;  4OAE A;  3DDD A;  1OZP A;  2JLM A;  2PSW A;  3BJ7 A;  4L89 A;  4LX9 A;  1QSN A;  2REE A;  2ZPA A;  4R9M A;  4PV6 A;  2VEZ A;  3DR8 A;  3H5Z A;  4NCZ A;  4DNC A;  2OU2 A;  2VZY A;  4B5P B;  5G1Z A;  4R3L A;  1CJW A;  1KUY A;  4CGN A;  2FS5 A;  2FSR A;  2O28 A;  5H86 A;  4R3K A;  2P6G A;  4UWJ A;  2ATR A;  4CAE A;  1LRZ A;  3VWD A;  2WPX A;  3FYN A;  4H6U A;  1IID A;  5CNP A;  4UCN A;  5AGE A;  3VWE A;  4MFZ A;  5G20 A;  4QC6 A;  1S3Z A;  5EC4 A;  3GKR A;  1MJB A;  1KUV A;  3JUW A;  5DWN A;  4MY0 A;  2HUZ A;  2VQY A;  4CAV A;  1VKC A;  3TO9 A;  2WPW A;  3P2H A;  2DXQ A;  2B3V A;  4CAX A;  1XF8 A;  3IWG A;  1YRE A;  3BLN A;  4B11 A;  4AVB A;  2DPT A;  3I3G A;  4M85 A;  4NEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...