1BO4A

Crystal structure of a gcn5-related n-acetyltransferase: serratia marescens aminoglycoside 3-n-acetyltransferase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
137
Chain Sequence
GIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-ACETYLTRANSF
publication title Crystal structure of a GCN5-related N-acetyltransferase: Serratia marcescens aminoglycoside 3-N-acetyltransferase.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Transferase
total genus 34
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bo4A00
5H86A 4PK2A 4CAXA 1GHEA 4OLLA 1Z9UA 2FCKA 1PUAA 2KCWA 2G3AA 5F46A 4II9A 3RYOA 4JXQA 4JXRA 1IIDA 1PU9A 3GY9A 1Y9KA 1QSOA 2B58A 4KOUA 2D4OA 3S6FA 2K5TA 2PDOA 2I00A 3W6XA 2OH1A 4L89A 2AJ6A 4KLWA 1WK4A 3N7ZA 5C82A 2EVNA 4QVTA 2Q44A 2ZW6A 3GYAA 4R57A 1S60A 2I79A 2RC4A 2ZXVA 3FIXA 4FD6A 3TT2A 2CNSA 5JPHA 2P0WA 4XPDC 1Y7RA 1YVOA 4U9ZA 1V0CA 3LODA 1QSNA 4JD6A 1YGHA 2R7HA 2P6FA 4B5PB 4BMHA 4HNYB 1QSRA 2REFA 4EVYA 1LRZA 3C26A 5H84A 4QUSA 3FB3A 1MJ9A 3DDDA 4I49A 5IV0A 5FVJA 4B5OA 2Z0ZA 4KOVA 1I21A 1S7NA 4E2AA 2PRBA 2FE7A 4Y49B 3S6HA 4UWIA 2OB0A 2P6GA 2PQ8A 2J8RA 2WPWA 4KOTA 5CNPA 4HNWB 5E96A 4NF1A 3E0KA 2P6EA 1TIQA 1UFHA 1CJWA 1Z4EA 4KUAA 2NMTA 3TFYA 4DNCA 1YVKA 2B4DB 1YREA 3FBUA 4JLYA 1RXTA 3TTHA 4RS2A 3D8PA 3K9UA 3R95A 4AVAA 5HMNA 3IGRA 3BLNA 2J8MA 4YGOA 2VXKA 3SHPA 4HNXB 1SQHA 3F8KA 1NE9A 2FIAA 1P0HA 3R96A 1YX0A 3QAHA 2VQYA 4PSWA 4UBRA 4K30A 3GKRA 2JEVA 1MK4A 2C27A 3IWGA 3TO9A 2Z11A 3JUWA 1J4JA 1R57A 4OAEA 2G3TA 4XNHB 2AE6A 4H89A 2CY2A 2HUZA 3EXNA 4NCZA 4B5PA 2WPXA 3G3SA 2CNTA 4CAVA 1BOBA 4AG9A 4F0YA 2PSWA 4U9YA 1M1DA 3R9EA 4MJ8A 3KKWA 4PSXA 3JVNA 3VWDA 2PR8A 1NMTA 4KVME 3B8GA 5GCNA 1QSMA 2PR1A 4ONUA 4AG7A 2OZHA 2IL4A 1XE4A 1XF8A 2F5IA 3I3GA 3DSBA 4KZTA 3EO4A 1XMTA 4UWJA 3R1KA 1N71A 5ISVA 1U6MA 2Q7BA 5J8FA 2JDDA 4YRHA 2B4DA 3H4QA 2GANA 1IB1E 3D3SA 2A4NA 1OZPA 5F47A 2EUIA 2HV2A 4IF5A 5DWMA 2REEA 2B4BA 4XPKA 3G8WA 2VBQA 4MHDA 3P2FA 1WWZA 2Z10A 4AVCA 4JJXA 3ZJ0A 2B3VA 4M3SA 5C88A 3MGDA 3BJ7A 3PP9A 4UA3A 4HKFA 3SXNA 2R1IA 4IUSA 4MI4A 1Y9WA 3CXQA 2HQYA 3TOBA 1M4IA 3R9FA 4LUAA 3EC4A 3EFAA 5DWNA 1RO5A 5HH1A 2OZGA 1YLEA 1M4GA 1CM0A 4E8OA 3T90A 1IICA 2VZZA 5EBVA 2CNMA 4R3KA 2BUEA 4JWPA 4NEXA 4QBJA 3D2MA 1L0CA 2ZPAA 3W91A 1M44A 4KOXA 1I1DA 3TO7A 5IB0A 1VHSA 1KUVA 3SXOA 2BL1A 4RI1A 2FT0A 4MY3A 4KOSA 2FL4A 2OZUA 2O28A 4AVBA 3CXPA 5IX3A 2G0BA 4Y49C 5I0CA 4KOWA 2BSWA 3F0AA 3VWEA 1KUXA 4FD7A 1KUYA 1QSTA 3DNSA 4FD5A 4CRYB 3W6SA 3I9SA 2X7BA 4U5YA 4XPDB 2PC1A 3FXTA 4KOYA 1S3ZA 3D2PA 1KZFA 2R8VA 4KVOE 2Q4YA 4J3GA 1XEBA 1Z4RA 2BEIA 3S6KA 1XIXA 3FYNA 3QB8A 3TOAA 3F5BA 4M85A 4XPLA 2Q0YA 2B3UA 3OWCA 4R87A 2B5GB 4GS4A 3ZZIA 4KUBA 3R9GA 1MJBA 3DR6A 1ON0A 3WR7A 1S7FA 2Q04A 4H6UA 3NE7A 2VI7A 3PZJA 3S6GA 5F49A 1IYKA 3BJ8A 4XNHC 5KTAA 4NSQA 3UY5A 2Y0MA 2GIVA 5F48A 4CRZB 4KORA 2D4PA 2R98A 4NXYA 2QIRA 1B6BA 2Q4VA 4MBUA 4QB9A 3DR8A 1VKCA 1I12A 4KVXA 2FSRA 1S7KA 1Q2CA 4PK3A 4LX9A 4MY0A 1FY7A 4R3LA 2JDCA 3V8IA 1M4DA 4QC6A 3LD2A 4ZBGA 3PGPA 4CS0B 5J8CA 1K4JA 4FD4A 1S7LA 4F6AA 2VEZA 3FRMA 2ARHA 2J8NA 1Q2YA 4R9MA 2FS5A 5EC4A 2ZW7A 3TE4A 1B87A 1MJAA 5JQ4A 1S5KA 2GE3A 2ATRA 3T9YA 2QMLA 3TO6A 4ORFA 4X5KA 2B5GA 2JLMA 1NSLA 1YR0A 2H5MA 2OU2A 2FIWA 4OADA 1P4NA 3FNCA 4CAWA 5KTDA 2QECA 2DXQA 4YFJA 1BO4A 2ZW5A 4L8AA 3P2HA 1IYLA 3TCVA 3EY5A 3CXSA 2VZYA 4PV6A 4KLVA 2FXFA 5KTCA 1Q2DA 1YK3A 4AB7A 4E0AA 4H6ZA 2ZW4A
chains in the Genus database with same CATH superfamily
5H86A 4PK2A 2IQ6A 4CAXA 2AFWA 3PBEA 1GHEA 4OLLA 4OC5A 1Z8WA 1Z9UA 2FCKA 1PUAA 2KCWA 1Z8TA 4ZGYB 2G3AA 3NH4A 5F46A 3PRTA 4II9A 2GLFA 4O23A 3RYOA 4R76A 4JXQA 1IIDA 4JXRA 1PU9A 3GY9A 2PJ8A 2YGWA 6CPAA 1Y9KA 1QSOA 2NYQA 2OR4A 4KSFA 4OC4A 4EMEA 2B58A 4KOUA 2ZENA 2D4OA 3S6FA 3FEDA 2K5TA 2PDOA 2ABZA 2I00A 3W6XA 2OH1A 4L89A 2AJ6A 4KLWA 5LRGA 1WK4A 3WC5A 4A94A 2ZW4A 3N7ZA 5JM6A 5C82A 2EVNA 3LMSA 3MRUA 4QVTA 4ZY2A 5JGFA 2AFUA 3BXMA 2Q44A 4CGNA 2ZW6A 3GYAA 2EBJA 4C2XA 3SJXA 4R57A 4CYPA 3SJFA 1ELLP 1ZO0A 1S60A 2I79A 2RC4A 2ZXVA 3FIXA 4FD6A 3TT2A 2CNSA 1FT7A 5AG7A 2P0WA 4DJLA 5JPHA 4XPDC 1Y7RA 1YVOA 4R7MA 2F8HA 3FEEA 4U9ZA 1V0CA 3LODA 1Q7LA 1QSNA 2DPSA 1YGHA 2R7HA 2P6FA 2RB7A 4JD6A 4OC3A 2YNCC 4P10A 4B5PB 4BMHA 4HNYB 2C6PA 1QSRA 2REFA 4EVYA 3GUXA 1LRZA 3C26A 2PRQA 5H84A 4QUSA 5K8NA 3FB3A 3NH8A 1NSAA 4MHZA 1XOVA 1MJ9A 2PJBA 3DDDA 3FH4A 4PXDA 4UFVA 3PB9X 3CPXA 4GXHA 2PJ3A 3B35A 4I49A 2C6CA 4F9VA 5DS0A 5IV0A 2Q4ZA 5FVJA 4B5OA 2Z0ZA 2Z3PA 1VGYA 4KOVA 1I21A 2DF5A 1S7NA 4E2AA 2PRBA 4UIAA 2HC9A 3KGQA 1VHOA 4ONWA 2FE7A 4Y49B 4ZI6A 4YWYA 4C7HA 3S6HA 3IFEA 4KSIA 2G9DA 4UWIA 2OB0A 2P6GA 2PQ8A 2J8RA 2WPWA 4IHMA 3WC7A 4KOTA 5CNPA 2VL1A 4HNWB 1YW6A 5E96A 4NF1A 3E0KA 1EE3P 1Y0RA 3D4UA 3V38A 1ARMA 4WWVA 2EWBA 4A95A 2GLJA 7CPAA 2P6EA 5HXDA 1IU8A 1TIQA 1UFHA 1CJWA 1Z4EA 2EO8A 2WZNA 5LYIA 4KUAA 4PXCA 2NMTA 4UIBA 2PJ1A 3GIUA 4DNCA 3TFYA 2F7VA 1YVKA 1H8LA 2B4DB 4P4BA 4IAVA 1YREA 3FBUA 4JLYA 2DPTA 2PJ9A 1RXTA 3TTHA 4RS2A 3D8PA 3K9UA 4X3RA 3QAYA 1FNOA 3R95A 4AVAA 5HMNA 3IGRA 1IOFA 3BLNA 2J8MA 1BAVA 3A9LA 4A30A 3KI9A 5THWA 3NH5A 2VXKA 4YGOA 5K8OA 4MHPA 1LCPA 5CPAA 1CX8A 3SHPA 4HNXB 1BPMA 1SQHA 3F8KA 3LACA 1NE9A 4W9YA 2ZEOA 2FIAA 1P0HA 3B3TA 5K8MA 3R96A 1YX0A 4LQ6A 2PJ4A 3QAHA 2VQYA 4PSWA 2GU2A 4UBRA 4CGLA 2ZELA 4K30A 3GKRA 1BLLE 4MCRA 2JEVA 1MK4A 2C27A 3BHXA 3IU1A 3IWGA 3KR4A 4Q38A 3KASA 2O4HA 2Z11A 3TO9A 3JUWA 1J4JA 4CAEA 1R57A 3S9NA 5HVFA 4OAEA 2G3TA 1ARLA 4MFLA 4TWEA 4XNHB 5LYLA 4UCMA 1DTDA 3RNZA 5G21A 2AE6A 4H89A 1QQ9A 2PE3A 4FAIA 3KR5A 2CY2A 2HUZA 2WSAA 3CZXA 3EXNA 3N5FA 4NCZA 4P6YA 5D8NA 4B5PA 2WPXA 2AFOA 3WC6A 2IJZA 3G3SA 5J1QA 2CNTA 2V8HA 1BOBA 3SJGA 4AG9A 2ZEPA 4CAVA 1YQEA 2QJ8A 5CBMA 2NSMA 4F0YA 1PCAA 1VIXA 2PSWA 4U9YA 4X2TA 1M1DA 3R9EA 4KSAA 4MJ8A 4UFXA 3V7ZA 3TC8A 3KKWA 1KWMA 1XBUA 4MFPA 3JVNA 4PSXA 3VWDA 4GM5A 2PR8A 1IY7A 1NMTA 4KVME 3B8GA 4MXUA 1QMUA 5GCNA 4Z65A 1QSMA 2PIYA 1IGBA 4FWUA 2Z3OA 3PFOA 3GLJA 4OP4A 3HLPA 2PR1A 4ONUA 2PJ2A 4MFQA 4AG7A 4CYOA 2OZHA 4YU9A 2IL4A 1XE4A 1XF8A 2F5IA 5D29A 3I3GA 2J9AA 3DSBA 3S9LA 3IIBA 4FBEA 3KL9A 4KZTA 3EO4A 1XMTA 3D7FA 4UWJA 2AFSA 3LWUA 3R1KA 4PPZA 4BINA 2EK9A 1N71A 2PJ6A 2V77A 4ZX9A 2FVGA 2PVWA 4M6HA 3NFZA 5ISVA 1U6MA 2DEAA 4OMEA 2Q7BA 5J8FA 4MCSA 2JDDA 4YRHA 2B4DA 4UEFA 3H4QA 4LQGA 1JQGA 2GANA 1IB1E 3CT9A 3D3SA 1ZG8A 3IEHA 4C7IA 3KHXA 3PBBA 2A4NA 4MFJA 1OZPA 5F47A 2EUIA 2PJ7A 1XRYA 2HV2A 3JRUA 4JZ0A 4IF5A 4MCPA 5DWMA 2REEA 2B4BA 1AUGA 3G8WA 4XPKA 2Q7SA 2VBQA 3D7DA 3D66A 4MHDA 5A27A 3P2FA 1WWZA 2Z10A 4PXBA 4AVCA 4CGMA 4UEZA 4JJXA 4B10A 3ZJ0A 5K8PA 2B3VA 2ZEGA 1X12A 3PB8X 4M3SA 3SI2A 1GYTA 3B7IA 4A2ZA 5C88A 2PIZA 2PJCA 5I4MA 2XEJA 4MHNA 2QYVA 3MGDA 3VH9A 1JWQA 1R3NA 3BJ7A 3PP9A 1TF8A 4UA3A 1ZLIA 4HKFA 4DYOA 1Y0YA 4B11A 3RAMA 4CYQA 4F0XA 3FECA 5AG4A 2Q51A 4WJBA 2R1IA 3SXNA 2V8GA 4IUSA 3B3CA 3PFEA 5AGEA 4MI4A 1Y9WA 3CXQA 2HQYA 3TOBA 1M4IA 5LRJA 3R9FA 3CPAA 4R8FA 2PJ5A 4LUAA 3EC4A 3EFAA 4OC0A 5DWNA 1RO5A 3PB6X 1TKFA 5HH1A 2OZGA 3FX6A 1XFOA 1YLOA 1YLEA 1M4GA 1CM0A 4E8OA 3T90A 1IICA 2VZZA 4JYWA 5EBVA 2CNMA 5BWAB 2V8VA 4R3KA 4MFZA 2YNDA 2XEIA 2BUEA 4JWPA 4NEXA 4QBJA 1F2PA 1L0CA 3D2MA 4MMOA 2ZPAA 5ELYA 4UCNA 3W91A 1M44A 4ZYQA 2JBKA 2GFQA 3HUVA 4OKOA 4KOXA 4P4DA 1I1DA 3TO7A 4P44A 5IB0A 1VHSA 1KUVA 3SXOA 2BL1A 4RI1A 5LYDA 2JEWA 3B3SA 4NJRA 2FT0A 1ELMP 4MY3A 4KOSA 2FL4A 3L2NA 4NGNA 4EFDA 4M6IA 1YMEA 1Z8XA 1RTQA 2OZUA 1LANA 2O28A 1LOKA 3JTKA 4AVBA 4P4JA 3CXPA 5IX3A 1XMBA 3SI0A 2G0BA 3KQXA 4Y49C 5I0CA 4KOWA 3VATA 3KZWA 3K9TA 3IWWA 2BSWA 3F0AA 3ISZA 3VWEA 1KUXA 2AFMA 4B14A 4FD7A 5HVGA 2IMOA 1KUYA 2JBJA 4NGMA 3SJEA 1QSTA 3DNSA 4FD5A 4A32A 4CRYB 1LAMA 2OOTA 3W6SA 3I9SA 4A39A 5EMIA 2X7BA 4CGPA 3IWEA 4U5YA 4P4FA 1AMPA 2CF4A 2I3CA 3PB4X 3BI1A 4XPDB 3RBUA 3D7HA 2CXAA 1LAPA 2PC1A 3FXTA 4OC1A 3IC1A 4KOYA 5AG6A 1S3ZA 1UWYA 3D2PA 1KZFA 4UEEA 1VHEA 2ANPA 2PVVA 2R8VA 1ZG7A 4KVOE 2Q4YA 3TX8A 4J3GA 3ISXA 5AG5A 1XEBA 1Z4RA 1CP6A 2BEIA 3S6KA 5A28A 4M6GA 4MCQA 3H8FA 5JH9A 3KHZA 1XIXA 3FYNA 4A33A 3PEIA 3QB8A 3TOAA 3F5BA 4K3NA 4RN7A 2AFZA 4M85A 4XPLA 2HB6A 3PB7X 2Q0YA 3D67A 1TKJA 2B3UA 4CAFA 1CG2A 3OWCA 4R87A 1ZLHA 2B5GB 4GS4A 3DLJA 4UF4A 1Z5RA 5G1ZA 2ODFA 4ZX8A 3ZZIA 4NGQA 2C1CA 4KUBA 5LRKA 2BOAA 3R9GA 1CPSA 1MJBA 3DR6A 1ON0A 2ZEMA 4BBHA 3WR7A 1S7FA 2Q04A 4H6UA 2WYRA 3D68A 4PQAA 4G1PA 3NE7A 2VI7A 1Z2LA 4DUKA 3IJ3A 1CP7A 3PZJA 3S6GA 5F49A 4EWTA 3RO0A 5HVHA 4NGTA 4UCPA 5LYFA 1IYKA 3BJ8A 2PJ0A 3I1UA 4XNHC 2ZEFA 5KTAA 2Z3NA 4NSQA 3UY5A 2Y0MA 4A37A 2GIVA 5F48A 2Z3KA 4Q7AA 1HDUA 4CRZB 2CIJA 4KORA 2D4PA 2R98A 2XEGA 4NXYA 2ZEEA 1R43A 3IO1A 3SI1A 2QIRA 3B3VA 3WABA 1B6BA 2Q4VA 4MBUA 4QB9A 3DR8A 1VKCA 4X8IA 1I12A 4KVXA 1CBXA 2FSRA 3FF3A 5G20A 2RFHA 1S7KA 1Q2CA 3VARA 4KS9A 3D7GA 4NFRA 4R6TA 3S9MA 4PK3A 4LX9A 4MFKA 4MY0A 3BI0A 3RZAA 1FY7A 2ZOFA 2CTCA 1DE4C 4C2YA 2AFXA 1HEEA 4R3LA 2JDCA 2CTBA 3H8GA 3V8IA 2PCUA 3MN8A 2O53A 4ZY1A 1M4DA 4QC6A 3LD2A 4TNUA 1YW4A 3FMCA 4ZBGA 4NGSA 3PGPA 4CS0B 1TXRA 5J8CA 1K4JA 2Z3LA 4OC2A 1PYTB 3GB0A 3FJUA 4CGOA 4FD4A 1S7LA 4F6AA 2VEZA 4MRIA 2XEFA 3WT4A 3FRMA 2J8NA 2ARHA 1Q2YA 4NGPA 4R9MA 1YSJA 2FS5A 2POKA 4B6ZA 8CPAA 5EC4A 1BPNA 2ZW7A 3FVLA 2YNCA 2EK8A 2BCOA 4MHYA 5F09A 3TE4A 4CPAA 1B87A 1A2ZA 2Z3MA 1MJAA 3H8EA 3KQZA 5JQ4A 1S5KA 2GE3A 2ATRA 5G22A 2QMLA 3T9YA 4F9UA 1F2OA 4A38A 1F57A 3T8WA 3TO6A 1Y7EA 4ORFA 4X5KA 1CPXA 2B5GA 4BD9A 2GREA 4HPSA 4B13A 2ZEDA 2JLMA 3CDXA 1NSLA 4AXVA 1YR0A 2WUUA 2H5MA 1OBRA 4B12A 2QVPA 4A31A 1XJOA 2OU2A 4F8ZA 4OIDA 1M4LA 2FIWA 4OADA 1P4NA 3FNCA 2ZOGA 4P45A 4CAWA 4PXEA 3B3WA 1IOIA 2BO9A 3K2KA 4IK2A 2YNEA 5KTDA 3NA6A 3IU2A 4H2KA 2QECA 5IB9A 1TKHA 4C2ZA 2DXQA 1Z8LA 2Q43A 4YFJA 1LFWA 1BO4A 2ZW5A 4ZY0A 4L8AA 3P2HA 1AYEA 2ZEHA 1IYLA 4P4EA 4P4IA 3TCVA 3EY5A 3CXSA 2PJAA 2VZYA 4OIWA 1ZG9A 4PV6A 4C68A 4KLVA 2FXFA 1TF9A 3B2YA 1HDQA 4CYNA 2V8DA 5KTCA 3QNVA 4NGRA 1Q2DA 4FUUA 2C6GA 3H5ZA 4RUHA 4Q36A 1YK3A 4AB7A 4E0AA 3DGVA 3NE8A 4H6ZA 4NJQA 1X10A 4UFWA
chains in the Genus database with same CATH topology
5H86A 4PK2A 4CAXA 1GHEA 4OLLA 1Z9UA 2FCKA 1PUAA 2KCWA 4ZGYB 2G3AA 5F46A 4II9A 3RYOA 4JXQA 4JXRA 1IIDA 1PU9A 3GY9A 2YGWA 1Y9KA 1QSOA 4KSFA 2B58A 4KOUA 2D4OA 3S6FA 2K5TA 2PDOA 2I00A 3W6XA 2OH1A 4L89A 2AJ6A 4KLWA 1WK4A 3N7ZA 5C82A 2EVNA 4QVTA 2Q44A 2ZW6A 3GYAA 4C2XA 4R57A 4CYPA 1ZO0A 1S60A 2I79A 2RC4A 2ZXVA 3FIXA 4FD6A 3TT2A 2CNSA 5AG7A 5JPHA 2P0WA 4XPDC 1Y7RA 1YVOA 4U9ZA 1V0CA 3LODA 1QSNA 2DPSA 4JD6A 1YGHA 2R7HA 2P6FA 4B5PB 4B14A 4BMHA 2YNCC 4HNYB 1QSRA 2REFA 4EVYA 1LRZA 3C26A 5H84A 4QUSA 3FB3A 1MJ9A 3DDDA 4UFVA 4I49A 5IV0A 5FVJA 4B5OA 2Z0ZA 2Z3PA 4KOVA 1I21A 1S7NA 4E2AA 2PRBA 2FE7A 4Y49B 4C7HA 3S6HA 4UWIA 2OB0A 2P6GA 2PQ8A 2J8RA 2WPWA 4KOTA 5CNPA 4HNWB 5E96A 4NF1A 3E0KA 4A95A 2P6EA 1TIQA 1UFHA 1CJWA 1Z4EA 4KUAA 2NMTA 3TFYA 4DNCA 1YVKA 2B4DB 1YREA 3FBUA 4JLYA 2DPTA 1RXTA 3TTHA 4RS2A 3D8PA 3K9UA 3R95A 4AVAA 5HMNA 3IGRA 3BLNA 3A9LA 2J8MA 4A30A 4YGOA 2VXKA 3SHPA 4HNXB 1SQHA 3F8KA 1NE9A 2FIAA 1P0HA 3R96A 1YX0A 3QAHA 2VQYA 4PSWA 4UBRA 4CGLA 4K30A 3GKRA 2JEVA 1MK4A 2C27A 3IWGA 3IU1A 4Q38A 3TO9A 4CAEA 2Z11A 3JUWA 1J4JA 1R57A 4OAEA 2G3TA 4MFLA 4XNHB 4UCMA 5G21A 2AE6A 4H89A 2CY2A 2HUZA 2WSAA 3EXNA 4NCZA 4B5PA 2WPXA 3G3SA 2CNTA 4CAVA 1BOBA 4AG9A 4F0YA 2PSWA 4U9YA 1M1DA 3R9EA 4KSAA 4MJ8A 4UFXA 3KKWA 4MFPA 3JVNA 4PSXA 3VWDA 2PR8A 1NMTA 4KVME 3B8GA 5GCNA 1QSMA 2Z3OA 2PR1A 4ONUA 4MFQA 4AG7A 4CYOA 2OZHA 2IL4A 1XE4A 1XF8A 2F5IA 3I3GA 3DSBA 4KZTA 3EO4A 1XMTA 4UWJA 3R1KA 1N71A 5ISVA 1U6MA 2Q7BA 5J8FA 2JDDA 4YRHA 2B4DA 4CGNA 3H4QA 4C7IA 2GANA 1IB1E 3D3SA 4MFJA 2A4NA 1OZPA 5F47A 2EUIA 2HV2A 4IF5A 5DWMA 2REEA 2B4BA 4XPKA 3G8WA 2VBQA 4MHDA 5A27A 3P2FA 1WWZA 2Z10A 4AVCA 4CGMA 4JJXA 4B10A 3ZJ0A 2B3VA 4M3SA 4A2ZA 5C88A 3MGDA 3BJ7A 3PP9A 4UA3A 4HKFA 4B11A 4F0XA 4CYQA 5AG4A 3SXNA 2R1IA 4IUSA 5AGEA 4MI4A 1Y9WA 3CXQA 2HQYA 3TOBA 1M4IA 3R9FA 4LUAA 3EC4A 3EFAA 5DWNA 1RO5A 5HH1A 2OZGA 1YLEA 1M4GA 1CM0A 4E8OA 3T90A 1IICA 2VZZA 5EBVA 2CNMA 5BWAB 4R3KA 4MFZA 2YNDA 2BUEA 4JWPA 4NEXA 4QBJA 3D2MA 1L0CA 2ZPAA 3W91A 4UCNA 1M44A 4KOXA 1I1DA 3TO7A 5IB0A 1VHSA 1KUVA 3SXOA 2BL1A 4RI1A 2FT0A 4MY3A 4KOSA 2FL4A 2OZUA 2O28A 3JTKA 4AVBA 3CXPA 5IX3A 2G0BA 4Y49C 5I0CA 4KOWA 2BSWA 3F0AA 3VWEA 1KUXA 4FD7A 1KUYA 1QSTA 3DNSA 4FD5A 4A32A 4CRYB 3W6SA 3I9SA 2X7BA 4CGPA 3IWEA 4U5YA 4XPDB 2CXAA 5AG6A 2PC1A 3FXTA 4KOYA 1S3ZA 3D2PA 1KZFA 2R8VA 4KVOE 2Q4YA 4J3GA 5AG5A 1XEBA 1Z4RA 2BEIA 3S6KA 5A28A 1XIXA 3FYNA 4A33A 3QB8A 3TOAA 3F5BA 4M85A 4XPLA 2Q0YA 2B3UA 4CAFA 3OWCA 4R87A 2B5GB 4GS4A 5G1ZA 3ZZIA 4KUBA 3R9GA 1MJBA 3DR6A 1ON0A 4BBHA 3WR7A 1S7FA 2Q04A 4H6UA 3NE7A 2VI7A 3PZJA 3S6GA 5F49A 4UCPA 1IYKA 3BJ8A 4XNHC 5KTAA 2Z3NA 4NSQA 3UY5A 2Y0MA 2GIVA 5F48A 2Z3KA 4CRZB 4KORA 2D4PA 2R98A 4NXYA 2QIRA 1B6BA 2Q4VA 4MBUA 4QB9A 3DR8A 1VKCA 1I12A 4KVXA 5G20A 2FSRA 1S7KA 1Q2CA 4KS9A 4PK3A 4LX9A 4MFKA 4MY0A 1FY7A 4C2YA 4R3LA 2JDCA 3V8IA 1M4DA 4QC6A 3LD2A 4ZBGA 3PGPA 4CS0B 5J8CA 1K4JA 2Z3LA 4CGOA 4FD4A 1S7LA 4F6AA 2VEZA 3FRMA 2ARHA 2J8NA 1Q2YA 4R9MA 2FS5A 5EC4A 2ZW7A 2YNCA 3TE4A 1B87A 2Z3MA 1MJAA 5JQ4A 1S5KA 2GE3A 2ATRA 5G22A 2QMLA 3T9YA 3TO6A 4ORFA 4X5KA 2B5GA 4B13A 2JLMA 1NSLA 1YR0A 2WUUA 2H5MA 4B12A 4A31A 2OU2A 2FIWA 4OADA 1P4NA 3FNCA 4CAWA 2YNEA 5KTDA 3IU2A 2QECA 4C2ZA 2DXQA 4YFJA 1BO4A 2ZW5A 4L8AA 3P2HA 1IYLA 3TCVA 3EY5A 3CXSA 2VZYA 4C68A 4PV6A 4KLVA 2FXFA 4CYNA 5KTCA 1Q2DA 3H5ZA 4Q36A 1YK3A 4AB7A 4E0AA 4H6ZA 2ZW4A 4UFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H86 A;  4PK2 A;  4CAX A;  1GHE A;  4OLL A;  1Z9U A;  2FCK A;  1PUA A;  2KCW A;  2G3A A;  5F46 A;  4II9 A;  3RYO A;  4JXQ A;  4JXR A;  1IID A;  1PU9 A;  3GY9 A;  1Y9K A;  1QSO A;  2B58 A;  4KOU A;  2D4O A;  3S6F A;  2K5T A;  2PDO A;  2I00 A;  3W6X A;  2OH1 A;  4L89 A;  2AJ6 A;  4KLW A;  1WK4 A;  3N7Z A;  5C82 A;  2EVN A;  4QVT A;  2Q44 A;  2ZW6 A;  3GYA A;  4R57 A;  1S60 A;  2I79 A;  2RC4 A;  2ZXV A;  3FIX A;  4FD6 A;  3TT2 A;  2CNS A;  5JPH A;  2P0W A;  4XPD C;  1Y7R A;  1YVO A;  4U9Z A;  1V0C A;  3LOD A;  1QSN A;  4JD6 A;  1YGH A;  2R7H A;  2P6F A;  4B5P B;  4BMH A;  4HNY B;  1QSR A;  2REF A;  4EVY A;  1LRZ A;  3C26 A;  5H84 A;  4QUS A;  3FB3 A;  1MJ9 A;  3DDD A;  4I49 A;  5IV0 A;  5FVJ A;  4B5O A;  2Z0Z A;  4KOV A;  1I21 A;  1S7N A;  4E2A A;  2PRB A;  2FE7 A;  4Y49 B;  3S6H A;  4UWI A;  2OB0 A;  2P6G A;  2PQ8 A;  2J8R A;  2WPW A;  4KOT A;  5CNP A;  4HNW B;  5E96 A;  4NF1 A;  3E0K A;  2P6E A;  1TIQ A;  1UFH A;  1CJW A;  1Z4E A;  4KUA A;  2NMT A;  3TFY A;  4DNC A;  1YVK A;  2B4D B;  1YRE A;  3FBU A;  4JLY A;  1RXT A;  3TTH A;  4RS2 A;  3D8P A;  3K9U A;  3R95 A;  4AVA A;  5HMN A;  3IGR A;  3BLN A;  2J8M A;  4YGO A;  2VXK A;  3SHP A;  4HNX B;  1SQH A;  3F8K A;  1NE9 A;  2FIA A;  1P0H A;  3R96 A;  1YX0 A;  3QAH A;  2VQY A;  4PSW A;  4UBR A;  4K30 A;  3GKR A;  2JEV A;  1MK4 A;  2C27 A;  3IWG A;  3TO9 A;  2Z11 A;  3JUW A;  1J4J A;  1R57 A;  4OAE A;  2G3T A;  4XNH B;  2AE6 A;  4H89 A;  2CY2 A;  2HUZ A;  3EXN A;  4NCZ A;  4B5P A;  2WPX A;  3G3S A;  2CNT A;  4CAV A;  1BOB A;  4AG9 A;  4F0Y A;  2PSW A;  4U9Y A;  1M1D A;  3R9E A;  4MJ8 A;  3KKW A;  4PSX A;  3JVN A;  3VWD A;  2PR8 A;  1NMT A;  4KVM E;  3B8G A;  5GCN A;  1QSM A;  2PR1 A;  4ONU A;  4AG7 A;  2OZH A;  2IL4 A;  1XE4 A;  1XF8 A;  2F5I A;  3I3G A;  3DSB A;  4KZT A;  3EO4 A;  1XMT A;  4UWJ A;  3R1K A;  1N71 A;  5ISV A;  1U6M A;  2Q7B A;  5J8F A;  2JDD A;  4YRH A;  2B4D A;  3H4Q A;  2GAN A;  1IB1 E;  3D3S A;  2A4N A;  1OZP A;  5F47 A;  2EUI A;  2HV2 A;  4IF5 A;  5DWM A;  2REE A;  2B4B A;  4XPK A;  3G8W A;  2VBQ A;  4MHD A;  3P2F A;  1WWZ A;  2Z10 A;  4AVC A;  4JJX A;  3ZJ0 A;  2B3V A;  4M3S A;  5C88 A;  3MGD A;  3BJ7 A;  3PP9 A;  4UA3 A;  4HKF A;  3SXN A;  2R1I A;  4IUS A;  4MI4 A;  1Y9W A;  3CXQ A;  2HQY A;  3TOB A;  1M4I A;  3R9F A;  4LUA A;  3EC4 A;  3EFA A;  5DWN A;  1RO5 A;  5HH1 A;  2OZG A;  1YLE A;  1M4G A;  1CM0 A;  4E8O A;  3T90 A;  1IIC A;  2VZZ A;  5EBV A;  2CNM A;  4R3K A;  2BUE A;  4JWP A;  4NEX A;  4QBJ A;  3D2M A;  1L0C A;  2ZPA A;  3W91 A;  1M44 A;  4KOX A;  1I1D A;  3TO7 A;  5IB0 A;  1VHS A;  1KUV A;  3SXO A;  2BL1 A;  4RI1 A;  2FT0 A;  4MY3 A;  4KOS A;  2FL4 A;  2OZU A;  2O28 A;  4AVB A;  3CXP A;  5IX3 A;  2G0B A;  4Y49 C;  5I0C A;  4KOW A;  2BSW A;  3F0A A;  3VWE A;  1KUX A;  4FD7 A;  1KUY A;  1QST A;  3DNS A;  4FD5 A;  4CRY B;  3W6S A;  3I9S A;  2X7B A;  4U5Y A;  4XPD B;  2PC1 A;  3FXT A;  4KOY A;  1S3Z A;  3D2P A;  1KZF A;  2R8V A;  4KVO E;  2Q4Y A;  4J3G A;  1XEB A;  1Z4R A;  2BEI A;  3S6K A;  1XIX A;  3FYN A;  3QB8 A;  3TOA A;  3F5B A;  4M85 A;  4XPL A;  2Q0Y A;  2B3U A;  3OWC A;  4R87 A;  2B5G B;  4GS4 A;  3ZZI A;  4KUB A;  3R9G A;  1MJB A;  3DR6 A;  1ON0 A;  3WR7 A;  1S7F A;  2Q04 A;  4H6U A;  3NE7 A;  2VI7 A;  3PZJ A;  3S6G A;  5F49 A;  1IYK A;  3BJ8 A;  4XNH C;  5KTA A;  4NSQ A;  3UY5 A;  2Y0M A;  2GIV A;  5F48 A;  4CRZ B;  4KOR A;  2D4P A;  2R98 A;  4NXY A;  2QIR A;  1B6B A;  2Q4V A;  4MBU A;  4QB9 A;  3DR8 A;  1VKC A;  1I12 A;  4KVX A;  2FSR A;  1S7K A;  1Q2C A;  4PK3 A;  4LX9 A;  4MY0 A;  1FY7 A;  4R3L A;  2JDC A;  3V8I A;  1M4D A;  4QC6 A;  3LD2 A;  4ZBG A;  3PGP A;  4CS0 B;  5J8C A;  1K4J A;  4FD4 A;  1S7L A;  4F6A A;  2VEZ A;  3FRM A;  2ARH A;  2J8N A;  1Q2Y A;  4R9M A;  2FS5 A;  5EC4 A;  2ZW7 A;  3TE4 A;  1B87 A;  1MJA A;  5JQ4 A;  1S5K A;  2GE3 A;  2ATR A;  3T9Y A;  2QML A;  3TO6 A;  4ORF A;  4X5K A;  2B5G A;  2JLM A;  1NSL A;  1YR0 A;  2H5M A;  2OU2 A;  2FIW A;  4OAD A;  1P4N A;  3FNC A;  4CAW A;  5KTD A;  2QEC A;  2DXQ A;  4YFJ A;  1BO4 A;  2ZW5 A;  4L8A A;  3P2H A;  1IYL A;  3TCV A;  3EY5 A;  3CXS A;  2VZY A;  4PV6 A;  4KLV A;  2FXF A;  5KTC A;  1Q2D A;  1YK3 A;  4AB7 A;  4E0A A;  4H6Z A;  2ZW4 A; 
#chains in the Genus database with same CATH topology
 5H86 A;  4PK2 A;  2IQ6 A;  4CAX A;  2AFW A;  3PBE A;  1GHE A;  4OLL A;  4OC5 A;  1Z8W A;  1Z9U A;  2FCK A;  1PUA A;  2KCW A;  1Z8T A;  4ZGY B;  2G3A A;  3NH4 A;  5F46 A;  3PRT A;  4II9 A;  2GLF A;  4O23 A;  3RYO A;  4R76 A;  4JXQ A;  1IID A;  4JXR A;  1PU9 A;  3GY9 A;  2PJ8 A;  2YGW A;  6CPA A;  1Y9K A;  1QSO A;  2NYQ A;  2OR4 A;  4KSF A;  4OC4 A;  4EME A;  2B58 A;  4KOU A;  2ZEN A;  2D4O A;  3S6F A;  3FED A;  2K5T A;  2PDO A;  2ABZ A;  2I00 A;  3W6X A;  2OH1 A;  4L89 A;  2AJ6 A;  4KLW A;  5LRG A;  1WK4 A;  3WC5 A;  4A94 A;  2ZW4 A;  3N7Z A;  5JM6 A;  5C82 A;  2EVN A;  3LMS A;  3MRU A;  4QVT A;  4ZY2 A;  5JGF A;  2AFU A;  3BXM A;  2Q44 A;  4CGN A;  2ZW6 A;  3GYA A;  2EBJ A;  4C2X A;  3SJX A;  4R57 A;  4CYP A;  3SJF A;  1ELL P;  1ZO0 A;  1S60 A;  2I79 A;  2RC4 A;  2ZXV A;  3FIX A;  4FD6 A;  3TT2 A;  2CNS A;  1FT7 A;  5AG7 A;  2P0W A;  4DJL A;  5JPH A;  4XPD C;  1Y7R A;  1YVO A;  4R7M A;  2F8H A;  3FEE A;  4U9Z A;  1V0C A;  3LOD A;  1Q7L A;  1QSN A;  2DPS A;  1YGH A;  2R7H A;  2P6F A;  2RB7 A;  4JD6 A;  4OC3 A;  2YNC C;  4P10 A;  4B5P B;  4BMH A;  4HNY B;  2C6P A;  1QSR A;  2REF A;  4EVY A;  3GUX A;  1LRZ A;  3C26 A;  2PRQ A;  5H84 A;  4QUS A;  5K8N A;  3FB3 A;  3NH8 A;  1NSA A;  4MHZ A;  1XOV A;  1MJ9 A;  2PJB A;  3DDD A;  3FH4 A;  4PXD A;  4UFV A;  3PB9 X;  3CPX A;  4GXH A;  2PJ3 A;  3B35 A;  4I49 A;  2C6C A;  4F9V A;  5DS0 A;  5IV0 A;  2Q4Z A;  5FVJ A;  4B5O A;  2Z0Z A;  2Z3P A;  1VGY A;  4KOV A;  1I21 A;  2DF5 A;  1S7N A;  4E2A A;  2PRB A;  4UIA A;  2HC9 A;  3KGQ A;  1VHO A;  4ONW A;  2FE7 A;  4Y49 B;  4ZI6 A;  4YWY A;  4C7H A;  3S6H A;  3IFE A;  4KSI A;  2G9D A;  4UWI A;  2OB0 A;  2P6G A;  2PQ8 A;  2J8R A;  2WPW A;  4IHM A;  3WC7 A;  4KOT A;  5CNP A;  2VL1 A;  4HNW B;  1YW6 A;  5E96 A;  4NF1 A;  3E0K A;  1EE3 P;  1Y0R A;  3D4U A;  3V38 A;  1ARM A;  4WWV A;  2EWB A;  4A95 A;  2GLJ A;  7CPA A;  2P6E A;  5HXD A;  1IU8 A;  1TIQ A;  1UFH A;  1CJW A;  1Z4E A;  2EO8 A;  2WZN A;  5LYI A;  4KUA A;  4PXC A;  2NMT A;  4UIB A;  2PJ1 A;  3GIU A;  4DNC A;  3TFY A;  2F7V A;  1YVK A;  1H8L A;  2B4D B;  4P4B A;  4IAV A;  1YRE A;  3FBU A;  4JLY A;  2DPT A;  2PJ9 A;  1RXT A;  3TTH A;  4RS2 A;  3D8P A;  3K9U A;  4X3R A;  3QAY A;  1FNO A;  3R95 A;  4AVA A;  5HMN A;  3IGR A;  1IOF A;  3BLN A;  2J8M A;  1BAV A;  3A9L A;  4A30 A;  3KI9 A;  5THW A;  3NH5 A;  2VXK A;  4YGO A;  5K8O A;  4MHP A;  1LCP A;  5CPA A;  1CX8 A;  3SHP A;  4HNX B;  1BPM A;  1SQH A;  3F8K A;  3LAC A;  1NE9 A;  4W9Y A;  2ZEO A;  2FIA A;  1P0H A;  3B3T A;  5K8M A;  3R96 A;  1YX0 A;  4LQ6 A;  2PJ4 A;  3QAH A;  2VQY A;  4PSW A;  2GU2 A;  4UBR A;  4CGL A;  2ZEL A;  4K30 A;  3GKR A;  1BLL E;  4MCR A;  2JEV A;  1MK4 A;  2C27 A;  3BHX A;  3IU1 A;  3IWG A;  3KR4 A;  4Q38 A;  3KAS A;  2O4H A;  2Z11 A;  3TO9 A;  3JUW A;  1J4J A;  4CAE A;  1R57 A;  3S9N A;  5HVF A;  4OAE A;  2G3T A;  1ARL A;  4MFL A;  4TWE A;  4XNH B;  5LYL A;  4UCM A;  1DTD A;  3RNZ A;  5G21 A;  2AE6 A;  4H89 A;  1QQ9 A;  2PE3 A;  4FAI A;  3KR5 A;  2CY2 A;  2HUZ A;  2WSA A;  3CZX A;  3EXN A;  3N5F A;  4NCZ A;  4P6Y A;  5D8N A;  4B5P A;  2WPX A;  2AFO A;  3WC6 A;  2IJZ A;  3G3S A;  5J1Q A;  2CNT A;  2V8H A;  1BOB A;  3SJG A;  4AG9 A;  2ZEP A;  4CAV A;  1YQE A;  2QJ8 A;  5CBM A;  2NSM A;  4F0Y A;  1PCA A;  1VIX A;  2PSW A;  4U9Y A;  4X2T A;  1M1D A;  3R9E A;  4KSA A;  4MJ8 A;  4UFX A;  3V7Z A;  3TC8 A;  3KKW A;  1KWM A;  1XBU A;  4MFP A;  3JVN A;  4PSX A;  3VWD A;  4GM5 A;  2PR8 A;  1IY7 A;  1NMT A;  4KVM E;  3B8G A;  4MXU A;  1QMU A;  5GCN A;  4Z65 A;  1QSM A;  2PIY A;  1IGB A;  4FWU A;  2Z3O A;  3PFO A;  3GLJ A;  4OP4 A;  3HLP A;  2PR1 A;  4ONU A;  2PJ2 A;  4MFQ A;  4AG7 A;  4CYO A;  2OZH A;  4YU9 A;  2IL4 A;  1XE4 A;  1XF8 A;  2F5I A;  5D29 A;  3I3G A;  2J9A A;  3DSB A;  3S9L A;  3IIB A;  4FBE A;  3KL9 A;  4KZT A;  3EO4 A;  1XMT A;  3D7F A;  4UWJ A;  2AFS A;  3LWU A;  3R1K A;  4PPZ A;  4BIN A;  2EK9 A;  1N71 A;  2PJ6 A;  2V77 A;  4ZX9 A;  2FVG A;  2PVW A;  4M6H A;  3NFZ A;  5ISV A;  1U6M A;  2DEA A;  4OME A;  2Q7B A;  5J8F A;  4MCS A;  2JDD A;  4YRH A;  2B4D A;  4UEF A;  3H4Q A;  4LQG A;  1JQG A;  2GAN A;  1IB1 E;  3CT9 A;  3D3S A;  1ZG8 A;  3IEH A;  4C7I A;  3KHX A;  3PBB A;  2A4N A;  4MFJ A;  1OZP A;  5F47 A;  2EUI A;  2PJ7 A;  1XRY A;  2HV2 A;  3JRU A;  4JZ0 A;  4IF5 A;  4MCP A;  5DWM A;  2REE A;  2B4B A;  1AUG A;  3G8W A;  4XPK A;  2Q7S A;  2VBQ A;  3D7D A;  3D66 A;  4MHD A;  5A27 A;  3P2F A;  1WWZ A;  2Z10 A;  4PXB A;  4AVC A;  4CGM A;  4UEZ A;  4JJX A;  4B10 A;  3ZJ0 A;  5K8P A;  2B3V A;  2ZEG A;  1X12 A;  3PB8 X;  4M3S A;  3SI2 A;  1GYT A;  3B7I A;  4A2Z A;  5C88 A;  2PIZ A;  2PJC A;  5I4M A;  2XEJ A;  4MHN A;  2QYV A;  3MGD A;  3VH9 A;  1JWQ A;  1R3N A;  3BJ7 A;  3PP9 A;  1TF8 A;  4UA3 A;  1ZLI A;  4HKF A;  4DYO A;  1Y0Y A;  4B11 A;  3RAM A;  4CYQ A;  4F0X A;  3FEC A;  5AG4 A;  2Q51 A;  4WJB A;  2R1I A;  3SXN A;  2V8G A;  4IUS A;  3B3C A;  3PFE A;  5AGE A;  4MI4 A;  1Y9W A;  3CXQ A;  2HQY A;  3TOB A;  1M4I A;  5LRJ A;  3R9F A;  3CPA A;  4R8F A;  2PJ5 A;  4LUA A;  3EC4 A;  3EFA A;  4OC0 A;  5DWN A;  1RO5 A;  3PB6 X;  1TKF A;  5HH1 A;  2OZG A;  3FX6 A;  1XFO A;  1YLO A;  1YLE A;  1M4G A;  1CM0 A;  4E8O A;  3T90 A;  1IIC A;  2VZZ A;  4JYW A;  5EBV A;  2CNM A;  5BWA B;  2V8V A;  4R3K A;  4MFZ A;  2YND A;  2XEI A;  2BUE A;  4JWP A;  4NEX A;  4QBJ A;  1F2P A;  1L0C A;  3D2M A;  4MMO A;  2ZPA A;  5ELY A;  4UCN A;  3W91 A;  1M44 A;  4ZYQ A;  2JBK A;  2GFQ A;  3HUV A;  4OKO A;  4KOX A;  4P4D A;  1I1D A;  3TO7 A;  4P44 A;  5IB0 A;  1VHS A;  1KUV A;  3SXO A;  2BL1 A;  4RI1 A;  5LYD A;  2JEW A;  3B3S A;  4NJR A;  2FT0 A;  1ELM P;  4MY3 A;  4KOS A;  2FL4 A;  3L2N A;  4NGN A;  4EFD A;  4M6I A;  1YME A;  1Z8X A;  1RTQ A;  2OZU A;  1LAN A;  2O28 A;  1LOK A;  3JTK A;  4AVB A;  4P4J A;  3CXP A;  5IX3 A;  1XMB A;  3SI0 A;  2G0B A;  3KQX A;  4Y49 C;  5I0C A;  4KOW A;  3VAT A;  3KZW A;  3K9T A;  3IWW A;  2BSW A;  3F0A A;  3ISZ A;  3VWE A;  1KUX A;  2AFM A;  4B14 A;  4FD7 A;  5HVG A;  2IMO A;  1KUY A;  2JBJ A;  4NGM A;  3SJE A;  1QST A;  3DNS A;  4FD5 A;  4A32 A;  4CRY B;  1LAM A;  2OOT A;  3W6S A;  3I9S A;  4A39 A;  5EMI A;  2X7B A;  4CGP A;  3IWE A;  4U5Y A;  4P4F A;  1AMP A;  2CF4 A;  2I3C A;  3PB4 X;  3BI1 A;  4XPD B;  3RBU A;  3D7H A;  2CXA A;  1LAP A;  2PC1 A;  3FXT A;  4OC1 A;  3IC1 A;  4KOY A;  5AG6 A;  1S3Z A;  1UWY A;  3D2P A;  1KZF A;  4UEE A;  1VHE A;  2ANP A;  2PVV A;  2R8V A;  1ZG7 A;  4KVO E;  2Q4Y A;  3TX8 A;  4J3G A;  3ISX A;  5AG5 A;  1XEB A;  1Z4R A;  1CP6 A;  2BEI A;  3S6K A;  5A28 A;  4M6G A;  4MCQ A;  3H8F A;  5JH9 A;  3KHZ A;  1XIX A;  3FYN A;  4A33 A;  3PEI A;  3QB8 A;  3TOA A;  3F5B A;  4K3N A;  4RN7 A;  2AFZ A;  4M85 A;  4XPL A;  2HB6 A;  3PB7 X;  2Q0Y A;  3D67 A;  1TKJ A;  2B3U A;  4CAF A;  1CG2 A;  3OWC A;  4R87 A;  1ZLH A;  2B5G B;  4GS4 A;  3DLJ A;  4UF4 A;  1Z5R A;  5G1Z A;  2ODF A;  4ZX8 A;  3ZZI A;  4NGQ A;  2C1C A;  4KUB A;  5LRK A;  2BOA A;  3R9G A;  1CPS A;  1MJB A;  3DR6 A;  1ON0 A;  2ZEM A;  4BBH A;  3WR7 A;  1S7F A;  2Q04 A;  4H6U A;  2WYR A;  3D68 A;  4PQA A;  4G1P A;  3NE7 A;  2VI7 A;  1Z2L A;  4DUK A;  3IJ3 A;  1CP7 A;  3PZJ A;  3S6G A;  5F49 A;  4EWT A;  3RO0 A;  5HVH A;  4NGT A;  4UCP A;  5LYF A;  1IYK A;  3BJ8 A;  2PJ0 A;  3I1U A;  4XNH C;  2ZEF A;  5KTA A;  2Z3N A;  4NSQ A;  3UY5 A;  2Y0M A;  4A37 A;  2GIV A;  5F48 A;  2Z3K A;  4Q7A A;  1HDU A;  4CRZ B;  2CIJ A;  4KOR A;  2D4P A;  2R98 A;  2XEG A;  4NXY A;  2ZEE A;  1R43 A;  3IO1 A;  3SI1 A;  2QIR A;  3B3V A;  3WAB A;  1B6B A;  2Q4V A;  4MBU A;  4QB9 A;  3DR8 A;  1VKC A;  4X8I A;  1I12 A;  4KVX A;  1CBX A;  2FSR A;  3FF3 A;  5G20 A;  2RFH A;  1S7K A;  1Q2C A;  3VAR A;  4KS9 A;  3D7G A;  4NFR A;  4R6T A;  3S9M A;  4PK3 A;  4LX9 A;  4MFK A;  4MY0 A;  3BI0 A;  3RZA A;  1FY7 A;  2ZOF A;  2CTC A;  1DE4 C;  4C2Y A;  2AFX A;  1HEE A;  4R3L A;  2JDC A;  2CTB A;  3H8G A;  3V8I A;  2PCU A;  3MN8 A;  2O53 A;  4ZY1 A;  1M4D A;  4QC6 A;  3LD2 A;  4TNU A;  1YW4 A;  3FMC A;  4ZBG A;  4NGS A;  3PGP A;  4CS0 B;  1TXR A;  5J8C A;  1K4J A;  2Z3L A;  4OC2 A;  1PYT B;  3GB0 A;  3FJU A;  4CGO A;  4FD4 A;  1S7L A;  4F6A A;  2VEZ A;  4MRI A;  2XEF A;  3WT4 A;  3FRM A;  2J8N A;  2ARH A;  1Q2Y A;  4NGP A;  4R9M A;  1YSJ A;  2FS5 A;  2POK A;  4B6Z A;  8CPA A;  5EC4 A;  1BPN A;  2ZW7 A;  3FVL A;  2YNC A;  2EK8 A;  2BCO A;  4MHY A;  5F09 A;  3TE4 A;  4CPA A;  1B87 A;  1A2Z A;  2Z3M A;  1MJA A;  3H8E A;  3KQZ A;  5JQ4 A;  1S5K A;  2GE3 A;  2ATR A;  5G22 A;  2QML A;  3T9Y A;  4F9U A;  1F2O A;  4A38 A;  1F57 A;  3T8W A;  3TO6 A;  1Y7E A;  4ORF A;  4X5K A;  1CPX A;  2B5G A;  4BD9 A;  2GRE A;  4HPS A;  4B13 A;  2ZED A;  2JLM A;  3CDX A;  1NSL A;  4AXV A;  1YR0 A;  2WUU A;  2H5M A;  1OBR A;  4B12 A;  2QVP A;  4A31 A;  1XJO A;  2OU2 A;  4F8Z A;  4OID A;  1M4L A;  2FIW A;  4OAD A;  1P4N A;  3FNC A;  2ZOG A;  4P45 A;  4CAW A;  4PXE A;  3B3W A;  1IOI A;  2BO9 A;  3K2K A;  4IK2 A;  2YNE A;  5KTD A;  3NA6 A;  3IU2 A;  4H2K A;  2QEC A;  5IB9 A;  1TKH A;  4C2Z A;  2DXQ A;  1Z8L A;  2Q43 A;  4YFJ A;  1LFW A;  1BO4 A;  2ZW5 A;  4ZY0 A;  4L8A A;  3P2H A;  1AYE A;  2ZEH A;  1IYL A;  4P4E A;  4P4I A;  3TCV A;  3EY5 A;  3CXS A;  2PJA A;  2VZY A;  4OIW A;  1ZG9 A;  4PV6 A;  4C68 A;  4KLV A;  2FXF A;  1TF9 A;  3B2Y A;  1HDQ A;  4CYN A;  2V8D A;  5KTC A;  3QNV A;  4NGR A;  1Q2D A;  4FUU A;  2C6G A;  3H5Z A;  4RUH A;  4Q36 A;  1YK3 A;  4AB7 A;  4E0A A;  3DGV A;  3NE8 A;  4H6Z A;  4NJQ A;  1X10 A;  4UFW A; 
#chains in the Genus database with same CATH homology
 5H86 A;  4PK2 A;  4CAX A;  1GHE A;  4OLL A;  1Z9U A;  2FCK A;  1PUA A;  2KCW A;  4ZGY B;  2G3A A;  5F46 A;  4II9 A;  3RYO A;  4JXQ A;  4JXR A;  1IID A;  1PU9 A;  3GY9 A;  2YGW A;  1Y9K A;  1QSO A;  4KSF A;  2B58 A;  4KOU A;  2D4O A;  3S6F A;  2K5T A;  2PDO A;  2I00 A;  3W6X A;  2OH1 A;  4L89 A;  2AJ6 A;  4KLW A;  1WK4 A;  3N7Z A;  5C82 A;  2EVN A;  4QVT A;  2Q44 A;  2ZW6 A;  3GYA A;  4C2X A;  4R57 A;  4CYP A;  1ZO0 A;  1S60 A;  2I79 A;  2RC4 A;  2ZXV A;  3FIX A;  4FD6 A;  3TT2 A;  2CNS A;  5AG7 A;  5JPH A;  2P0W A;  4XPD C;  1Y7R A;  1YVO A;  4U9Z A;  1V0C A;  3LOD A;  1QSN A;  2DPS A;  4JD6 A;  1YGH A;  2R7H A;  2P6F A;  4B5P B;  4B14 A;  4BMH A;  2YNC C;  4HNY B;  1QSR A;  2REF A;  4EVY A;  1LRZ A;  3C26 A;  5H84 A;  4QUS A;  3FB3 A;  1MJ9 A;  3DDD A;  4UFV A;  4I49 A;  5IV0 A;  5FVJ A;  4B5O A;  2Z0Z A;  2Z3P A;  4KOV A;  1I21 A;  1S7N A;  4E2A A;  2PRB A;  2FE7 A;  4Y49 B;  4C7H A;  3S6H A;  4UWI A;  2OB0 A;  2P6G A;  2PQ8 A;  2J8R A;  2WPW A;  4KOT A;  5CNP A;  4HNW B;  5E96 A;  4NF1 A;  3E0K A;  4A95 A;  2P6E A;  1TIQ A;  1UFH A;  1CJW A;  1Z4E A;  4KUA A;  2NMT A;  3TFY A;  4DNC A;  1YVK A;  2B4D B;  1YRE A;  3FBU A;  4JLY A;  2DPT A;  1RXT A;  3TTH A;  4RS2 A;  3D8P A;  3K9U A;  3R95 A;  4AVA A;  5HMN A;  3IGR A;  3BLN A;  3A9L A;  2J8M A;  4A30 A;  4YGO A;  2VXK A;  3SHP A;  4HNX B;  1SQH A;  3F8K A;  1NE9 A;  2FIA A;  1P0H A;  3R96 A;  1YX0 A;  3QAH A;  2VQY A;  4PSW A;  4UBR A;  4CGL A;  4K30 A;  3GKR A;  2JEV A;  1MK4 A;  2C27 A;  3IWG A;  3IU1 A;  4Q38 A;  3TO9 A;  4CAE A;  2Z11 A;  3JUW A;  1J4J A;  1R57 A;  4OAE A;  2G3T A;  4MFL A;  4XNH B;  4UCM A;  5G21 A;  2AE6 A;  4H89 A;  2CY2 A;  2HUZ A;  2WSA A;  3EXN A;  4NCZ A;  4B5P A;  2WPX A;  3G3S A;  2CNT A;  4CAV A;  1BOB A;  4AG9 A;  4F0Y A;  2PSW A;  4U9Y A;  1M1D A;  3R9E A;  4KSA A;  4MJ8 A;  4UFX A;  3KKW A;  4MFP A;  3JVN A;  4PSX A;  3VWD A;  2PR8 A;  1NMT A;  4KVM E;  3B8G A;  5GCN A;  1QSM A;  2Z3O A;  2PR1 A;  4ONU A;  4MFQ A;  4AG7 A;  4CYO A;  2OZH A;  2IL4 A;  1XE4 A;  1XF8 A;  2F5I A;  3I3G A;  3DSB A;  4KZT A;  3EO4 A;  1XMT A;  4UWJ A;  3R1K A;  1N71 A;  5ISV A;  1U6M A;  2Q7B A;  5J8F A;  2JDD A;  4YRH A;  2B4D A;  4CGN A;  3H4Q A;  4C7I A;  2GAN A;  1IB1 E;  3D3S A;  4MFJ A;  2A4N A;  1OZP A;  5F47 A;  2EUI A;  2HV2 A;  4IF5 A;  5DWM A;  2REE A;  2B4B A;  4XPK A;  3G8W A;  2VBQ A;  4MHD A;  5A27 A;  3P2F A;  1WWZ A;  2Z10 A;  4AVC A;  4CGM A;  4JJX A;  4B10 A;  3ZJ0 A;  2B3V A;  4M3S A;  4A2Z A;  5C88 A;  3MGD A;  3BJ7 A;  3PP9 A;  4UA3 A;  4HKF A;  4B11 A;  4F0X A;  4CYQ A;  5AG4 A;  3SXN A;  2R1I A;  4IUS A;  5AGE A;  4MI4 A;  1Y9W A;  3CXQ A;  2HQY A;  3TOB A;  1M4I A;  3R9F A;  4LUA A;  3EC4 A;  3EFA A;  5DWN A;  1RO5 A;  5HH1 A;  2OZG A;  1YLE A;  1M4G A;  1CM0 A;  4E8O A;  3T90 A;  1IIC A;  2VZZ A;  5EBV A;  2CNM A;  5BWA B;  4R3K A;  4MFZ A;  2YND A;  2BUE A;  4JWP A;  4NEX A;  4QBJ A;  3D2M A;  1L0C A;  2ZPA A;  3W91 A;  4UCN A;  1M44 A;  4KOX A;  1I1D A;  3TO7 A;  5IB0 A;  1VHS A;  1KUV A;  3SXO A;  2BL1 A;  4RI1 A;  2FT0 A;  4MY3 A;  4KOS A;  2FL4 A;  2OZU A;  2O28 A;  3JTK A;  4AVB A;  3CXP A;  5IX3 A;  2G0B A;  4Y49 C;  5I0C A;  4KOW A;  2BSW A;  3F0A A;  3VWE A;  1KUX A;  4FD7 A;  1KUY A;  1QST A;  3DNS A;  4FD5 A;  4A32 A;  4CRY B;  3W6S A;  3I9S A;  2X7B A;  4CGP A;  3IWE A;  4U5Y A;  4XPD B;  2CXA A;  5AG6 A;  2PC1 A;  3FXT A;  4KOY A;  1S3Z A;  3D2P A;  1KZF A;  2R8V A;  4KVO E;  2Q4Y A;  4J3G A;  5AG5 A;  1XEB A;  1Z4R A;  2BEI A;  3S6K A;  5A28 A;  1XIX A;  3FYN A;  4A33 A;  3QB8 A;  3TOA A;  3F5B A;  4M85 A;  4XPL A;  2Q0Y A;  2B3U A;  4CAF A;  3OWC A;  4R87 A;  2B5G B;  4GS4 A;  5G1Z A;  3ZZI A;  4KUB A;  3R9G A;  1MJB A;  3DR6 A;  1ON0 A;  4BBH A;  3WR7 A;  1S7F A;  2Q04 A;  4H6U A;  3NE7 A;  2VI7 A;  3PZJ A;  3S6G A;  5F49 A;  4UCP A;  1IYK A;  3BJ8 A;  4XNH C;  5KTA A;  2Z3N A;  4NSQ A;  3UY5 A;  2Y0M A;  2GIV A;  5F48 A;  2Z3K A;  4CRZ B;  4KOR A;  2D4P A;  2R98 A;  4NXY A;  2QIR A;  1B6B A;  2Q4V A;  4MBU A;  4QB9 A;  3DR8 A;  1VKC A;  1I12 A;  4KVX A;  5G20 A;  2FSR A;  1S7K A;  1Q2C A;  4KS9 A;  4PK3 A;  4LX9 A;  4MFK A;  4MY0 A;  1FY7 A;  4C2Y A;  4R3L A;  2JDC A;  3V8I A;  1M4D A;  4QC6 A;  3LD2 A;  4ZBG A;  3PGP A;  4CS0 B;  5J8C A;  1K4J A;  2Z3L A;  4CGO A;  4FD4 A;  1S7L A;  4F6A A;  2VEZ A;  3FRM A;  2ARH A;  2J8N A;  1Q2Y A;  4R9M A;  2FS5 A;  5EC4 A;  2ZW7 A;  2YNC A;  3TE4 A;  1B87 A;  2Z3M A;  1MJA A;  5JQ4 A;  1S5K A;  2GE3 A;  2ATR A;  5G22 A;  2QML A;  3T9Y A;  3TO6 A;  4ORF A;  4X5K A;  2B5G A;  4B13 A;  2JLM A;  1NSL A;  1YR0 A;  2WUU A;  2H5M A;  4B12 A;  4A31 A;  2OU2 A;  2FIW A;  4OAD A;  1P4N A;  3FNC A;  4CAW A;  2YNE A;  5KTD A;  3IU2 A;  2QEC A;  4C2Z A;  2DXQ A;  4YFJ A;  1BO4 A;  2ZW5 A;  4L8A A;  3P2H A;  1IYL A;  3TCV A;  3EY5 A;  3CXS A;  2VZY A;  4C68 A;  4PV6 A;  4KLV A;  2FXF A;  4CYN A;  5KTC A;  1Q2D A;  3H5Z A;  4Q36 A;  1YK3 A;  4AB7 A;  4E0A A;  4H6Z A;  2ZW4 A;  4UFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...