4E0AA

Crystal structure of the mutant f44r bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MIIREATVQDYEEVARLHTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQRKTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNDRAKAFYHSLGMRCQKQTMELPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BH1408 protein
publication title Northeast Structural Genomics Consortium Target BhR182
rcsb
source organism Bacillus halodurans
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e0aA00
4PSWA 3CXQA 1YX0A 3K9UA 2CY2A 4KVXA 3W6SA 2REEA 1L0CA 2F5IA 1VHSA 2BUEA 2Z11A 1CJWA 2K5TA 4CAVA 4R9MA 5ISVA 4LX9A 2FIWA 3QAHA 1S7FA 1Z9UA 2VI7A 1S7LA 4CS0B 3R9FA 2NMTA 5H84A 4AG9A 2I79A 2ZPAA 3GYAA 4L8AA 1Y9KA 1I12A 3TOBA 3EC4A 4PSXA 3EO4A 3GY9A 2OU2A 1Q2CA 4ONUA 4E2AA 1YR0A 2BEIA 3BJ7A 3DSBA 4R57A 1S60A 1BO4A 4BMHA 4X5KA 2ZXVA 2B58A 2G0BA 2PQ8A 1Z4EA 1YVOA 3TE4A 3BJ8A 4PK3A 5J8FA 5C82A 5E96A 4B5PA 1MK4A 4ORFA 2B4BA 4HNYB 3C26A 4JLYA 2WPXA 4H89A 1QSTA 2DXQA 4H6UA 2OB0A 1TIQA 1XIXA 4DNCA 4QBJA 2G3AA 1IYLA 2Q4VA 1CM0A 2GE3A 1RXTA 1Q2DA 4FD7A 3W6XA 1B87A 4AVBA 3FXTA 3I3GA 1NE9A 3P2FA 2HQYA 4OADA 1UFHA 4I49A 5H86A 3W91A 4AVAA 4KOYA 2Q7BA 4NCZA 4MY3A 2OH1A 1M4IA 3PP9A 4JJXA 2Q04A 2ZW6A 1XEBA 1LRZA 5DWNA 2WPWA 5F46A 3SXOA 4FD5A 4LUAA 2KCWA 3OWCA 4H6ZA 4AVCA 3FIXA 3LODA 1M1DA 2J8MA 4M85A 1S5KA 4Y49C 4YRHA 2Q0YA 4MHDA 2B3VA 3TO9A 1Y7RA 1M4GA 1I1DA 2JLMA 2I00A 5KTCA 3VWEA 2EUIA 2H5MA 3FB3A 3S6FA 1KZFA 2G3TA 5IX3A 1XF8A 3FYNA 1MJAA 2P0WA 2CNMA 4CRZB 1IICA 1M44A 3FNCA 4XPKA 3DR8A 3R9EA 4PK2A 1J4JA 4AB7A 1Y9WA 4JXRA 5F47A 4KVME 1IIDA 1N71A 5J8CA 2PC1A 2HUZA 5EC4A 2R7HA 3EY5A 3EXNA 3RYOA 2P6EA 2VZYA 1K4JA 5IB0A 4KOXA 1YVKA 3LD2A 4EVYA 1MJBA 3G8WA 1YK3A 2ATRA 4QUSA 2B5GA 4R3KA 1S7KA 2FL4A 2JDDA 2JDCA 1NSLA 3I9SA 4KORA 4M3SA 4XPDC 4YFJA 4XPLA 3D8PA 4UWJA 1QSOA 2P6FA 2R1IA 3DDDA 4UA3A 4E8OA 1XE4A 1KUYA 2VEZA 2B4DA 4NF1A 3TFYA 4F0YA 1Q2YA 4NSQA 2IL4A 4R3LA 4QB9A 4R87A 2HV2A 2R98A 2FS5A 5JPHA 3D2MA 2D4OA 2FIAA 3CXPA 4IUSA 5C88A 3P2HA 4HKFA 4ZBGA 4XNHC 3TO7A 1MJ9A 2JEVA 4KLWA 1GHEA 4JXQA 2PR8A 2Z0ZA 2CNTA 3PGPA 3QB8A 4CAWA 5CNPA 4PV6A 3R1KA 4KOSA 3TOAA 2C27A 4JD6A 3V8IA 4UBRA 1KUXA 2B3UA 1WK4A 2Q4YA 2BSWA 5JQ4A 4MJ8A 1S7NA 4F6AA 3B8GA 1R57A 2R8VA 3TCVA 4CRYB 2PR1A 4MY0A 3VWDA 1WWZA 4Y49B 2AE6A 3IWGA 1P0HA 3JUWA 5HMNA 4IF5A 2GANA 3UY5A 5I0CA 3S6HA 3SXNA 5KTAA 3CXSA 3S6KA 2VBQA 2OZHA 1YLEA 2Y0MA 3NE7A 4OLLA 4OAEA 1M4DA 1QSNA 3FBUA 3FRMA 3F5BA 3PZJA 3R95A 4KLVA 4QC6A 2ZW7A 4RS2A 1IYKA 4II9A 1P4NA 2RC4A 4U5YA 2OZUA 2J8RA 4HNXB 2ZW5A 4L89A 4J3GA 3T9YA 2QMLA 3WR7A 1VKCA 1KUVA 3GKRA 2VXKA 4U9ZA 4XPDB 2O28A 4KOUA 3EFAA 4NXYA 2FCKA 2J8NA 1I21A 2FSRA 1PU9A 2FT0A 2OZGA 4MBUA 3IGRA 5FVJA 3F0AA 3F8KA 5F49A 3ZJ0A 2VQYA 3S6GA 1ON0A 2EVNA 2VZZA 3N7ZA 2FE7A 3TO6A 1OZPA 3JVNA 1S3ZA 4RI1A 3E0KA 4KUAA 5DWMA 4KOWA 5GCNA 2X7BA 1QSMA 2BL1A 4CAXA 4K30A 4XNHB 5EBVA 1BOBA 2D4PA 2B5GB 3DNSA 4KZTA 4GS4A 3R96A 4FD6A 1IB1E 1YREA 1XMTA 1YGHA 5HH1A 3R9GA 3MGDA 4JWPA 2REFA 2PSWA 3G3SA 4FD4A 1PUAA 3TTHA 3BLNA 2Q44A 5F48A 4NEXA 2QIRA 4UWIA 4QVTA 4B5PB 4E0AA 1SQHA 2B4DB 1U6MA 1V0CA 4U9YA 2QECA 3DR6A 2GIVA 3KKWA 2P6GA 1FY7A 1RO5A 3TT2A 3H4QA 1Z4RA 2FXFA 2ZW4A 2CNSA 2PRBA 4B5OA 4YGOA 3D2PA 2A4NA 4MI4A 3D3SA 4KOTA 3T90A 4KOVA 1NMTA 2AJ6A 5KTDA 4AG7A 2Z10A 5IV0A 1QSRA 4KVOE 2PDOA 3SHPA 1B6BA 4HNWB 3ZZIA 2ARHA 4KUBA
chains in the Genus database with same CATH superfamily
5G20A 3CZXA 3VATA 3B3WA 4PSWA 3CXQA 3PB4X 4CGMA 1YX0A 3K9UA 2CY2A 4KVXA 4MHNA 3W6SA 2BO9A 2VL1A 2REEA 1L0CA 2F5IA 1KWMA 1VHSA 3D7HA 4ONWA 2BUEA 2JBJA 4P4IA 2Z11A 1CJWA 4MFZA 2K5TA 2ANPA 4CAVA 4H2KA 4R9MA 3K9TA 3GB0A 1TF9A 5ISVA 2WZNA 4LX9A 3CT9A 3KR5A 2FIWA 2ZELA 1LAMA 3QAHA 3RAMA 1S7FA 1Z9UA 1ZLHA 2VI7A 1S7LA 5LRJA 4CS0B 3R9FA 2NMTA 3KHXA 5H84A 4AG9A 3VARA 2I79A 1YMEA 2ZPAA 3GYAA 4L8AA 1Y9KA 1I12A 3TOBA 3FVLA 3EC4A 4PSXA 3EO4A 3GY9A 3H5ZA 2ABZA 3RO0A 3H8FA 5DS0A 7CPAA 1QQ9A 1XMBA 2AFMA 2OU2A 1Q2CA 4NGTA 5G1ZA 4ONUA 4E2AA 1YR0A 4C7IA 2QJ8A 5ELYA 5AG4A 3HLPA 1LFWA 4NGMA 2CXAA 2BEIA 4M6GA 3BJ7A 3DSBA 4R57A 1F2OA 2AFSA 3B3CA 2F7VA 3PFEA 2GLJA 1S60A 2PJ6A 3H8GA 1BO4A 4MFJA 4BMHA 4MCPA 4X5KA 4CYOA 4P4EA 2ZXVA 2ZOFA 3CDXA 2PJ8A 5I4MA 2B58A 2G0BA 2ZEGA 3SI1A 2PQ8A 1Z4EA 1YVOA 3NH8A 1OBRA 4IHMA 5HVFA 3BJ8A 4PK3A 3TE4A 5J8FA 5THWA 5E96A 1AUGA 5C82A 4B5PA 2PJ7A 1MK4A 4ORFA 2V8VA 3QNVA 2B4BA 4UF4A 4HNYB 3C26A 4WWVA 3PBEA 4JLYA 2WPXA 4DYOA 2PJ3A 2Q43A 4H89A 3D66A 3WC5A 4EFDA 1QSTA 2DXQA 4H6UA 2OB0A 1TIQA 2Z3KA 1XIXA 4P45A 4B11A 2GLFA 4DNCA 4TWEA 4QBJA 4X2TA 2G3AA 2OR4A 3B3TA 1IYLA 3PFOA 4P4DA 3NH5A 4OC1A 2QYVA 2Q4VA 1CM0A 3WC7A 4KS9A 1HEEA 2GE3A 1RXTA 2Z3LA 1F57A 2BOAA 1Q2DA 2V8DA 2Z3MA 3KZWA 4UFVA 2ZEHA 4FD7A 4YWYA 3W6XA 1B87A 1VIXA 2CF4A 4AVBA 1HDQA 3FXTA 3I3GA 1NE9A 3FF3A 3P2FA 2PJ2A 1NSAA 2HQYA 4OADA 4P10A 1UFHA 4I49A 3D7GA 5H86A 3W91A 3S9LA 4AVAA 4KOYA 2Q7BA 1CBXA 4UFXA 4NCZA 1Y7EA 2PJ5A 4MY3A 3IU1A 2V77A 2OH1A 4PQAA 1M4IA 2GFQA 2C6PA 2QVPA 1R43A 2Q04A 2ZW6A 3L2NA 1XEBA 1LRZA 3PP9A 2C6GA 5DWNA 3SJEA 4A39A 1AMPA 2WPWA 2RB7A 5F46A 3SXOA 4UCNA 1EE3P 4FD5A 4MMOA 4LUAA 2KCWA 3OWCA 4H6ZA 4AVCA 5HXDA 1TKHA 4P44A 4ZY1A 3FIXA 2EK9A 3LODA 1M1DA 2J8MA 4MXUA 4M85A 4RUHA 1S5KA 2ZEEA 4Y49C 4YRHA 2Q0YA 3WABA 2CTCA 2XEJA 2B3VA 4MHDA 3RZAA 4MFKA 5JH9A 4NGRA 3TO9A 1Y7RA 1I1DA 1M4GA 2JLMA 2I00A 5K8NA 2PCUA 3VWEA 1CPXA 5KTCA 5G21A 3KHZA 4CYPA 2EUIA 4BINA 4CGLA 1ZG8A 1Y0RA 2WYRA 5BWAB 2H5MA 3FB3A 2GU2A 2FVGA 3FH4A 2G9DA 4R7MA 3S6FA 1KZFA 2PJ0A 1PCAA 2G3TA 2HB6A 3FEDA 5IX3A 1XF8A 4C2ZA 2CIJA 3FYNA 4B14A 1MJAA 2P0WA 2CNMA 1TF8A 4CRZB 1IICA 5AGEA 1M44A 4CGPA 3FNCA 1XFOA 1TXRA 4XPKA 3DR8A 3R9EA 1Z8TA 1J4JA 2Q51A 4PK2A 1Y9WA 4A31A 4AB7A 4EWTA 1GYTA 1IOFA 4K3NA 4JXRA 1DE4C 2F8HA 1RTQA 5F47A 4KVME 2EO8A 4OC0A 4A37A 1IIDA 2ZEMA 1CG2A 3SI2A 1N71A 1XJOA 5J8CA 4G1PA 2PC1A 2HUZA 3IC1A 2R7HA 3EY5A 3EXNA 5EC4A 3RYOA 3I1UA 2P6EA 3SJXA 2VZYA 1Y0YA 5LYLA 2V8HA 1K4JA 4MCRA 4CAEA 5IB0A 4C68A 4KOXA 5LRKA 1YVKA 4P6YA 2IMOA 3LD2A 3IO1A 3JTKA 4EVYA 4ZI6A 2XEFA 5CPAA 5F09A 1MJBA 3G8WA 1YK3A 2ATRA 4QUSA 2DEAA 2B5GA 4R3KA 5J1QA 1S7KA 3BHXA 2FL4A 2PJ9A 4R8FA 2JDDA 4GXHA 4OC3A 2JDCA 1JWQA 5AG7A 1NSLA 3GUXA 3I9SA 4KORA 4M3SA 4XPDC 4YFJA 2PJAA 4XPLA 3IIBA 1TKFA 4NJQA 3D8PA 4UFWA 4ZY2A 4UWJA 1ELMP 1QSOA 4OMEA 2Q7SA 4ZX8A 4A95A 2NSMA 2PIYA 3KGQA 2P6FA 2R1IA 3DDDA 4UA3A 4E8OA 3RBUA 4B6ZA 4WJBA 2RFHA 4OC2A 4M6HA 1XE4A 1CX8A 2IQ6A 3KI9A 4CYNA 1KUYA 2VEZA 4JJXA 4Z65A 2B4DA 3FEEA 2C1CA 3KQZA 4NF1A 1LCPA 4NGPA 2POKA 5LYFA 3TFYA 4F0YA 1Q2YA 4UEZA 4Q7AA 3FJUA 4NSQA 2IL4A 4R3LA 4QB9A 4R87A 2HV2A 2R98A 1A2ZA 2FS5A 4CPAA 3KR4A 5JPHA 2HC9A 3D2MA 1CP7A 3BI1A 2D4OA 1Z8XA 2FIAA 3CXPA 4P4FA 2J9AA 5LYIA 3SJFA 4IUSA 3HUVA 5JGFA 5C88A 3V7ZA 3K2KA 4C7HA 3P2HA 4HKFA 4B10A 3PB8X 2PVVA 3ISXA 3TC8A 4ZBGA 4LQGA 4NJRA 4XNHC 1Z5RA 4PXEA 4MHYA 2ZOGA 3TO7A 3IJ3A 2PVWA 1MJ9A 4C2YA 2JEVA 4KLWA 1GHEA 1VHEA 4JXQA 2PIZA 2PR8A 3TX8A 4JYWA 4MCQA 2Q4ZA 2Z0ZA 2CNTA 3PGPA 2ODFA 2JBKA 3QB8A 1VHOA 1ELLP 4CAWA 5CNPA 1YSJA 4PV6A 5AG5A 1BAVA 4UEEA 4UIAA 4A32A 4AXVA 3R1KA 3S9NA 4KOSA 3TOAA 4F9UA 4ZYQA 2C27A 4JD6A 2OOTA 2YGWA 3V8IA 4MRIA 4M6IA 4UBRA 1KUXA 3DLJA 4B13A 3ISZA 4OC4A 2B3UA 1WK4A 2Q4YA 1HDUA 2BSWA 1FNOA 3FMCA 5JQ4A 5G22A 4BD9A 4MJ8A 1S7NA 4F6AA 4FBEA 3D67A 4A2ZA 8CPAA 5HVHA 3B8GA 3DGVA 1R57A 2R8VA 3TCVA 4X3RA 2AFUA 4O23A 4TNUA 4CRYB 2PR1A 5EMIA 4MY0A 2PJBA 4A38A 3VWDA 1WWZA 4Y49B 1IGBA 4P4BA 4A33A 2GREA 4F8ZA 2AE6A 4KUBA 1XRYA 3IWGA 4NGNA 3B3SA 4CGOA 3LACA 5IB9A 4MHPA 1P0HA 3JUWA 5HMNA 3GLJA 5K8MA 1IOIA 1CP6A 3B35A 1JQGA 4A94A 4KSAA 3VH9A 4IF5A 2GANA 3UY5A 5I0CA 2C6CA 4IAVA 3S6HA 4CGNA 1LOKA 1ZO0A 3SXNA 4A30A 1LAPA 5KTAA 2EBJA 2AFXA 3CXSA 3S6KA 2VBQA 2OZHA 4DUKA 3SJGA 1YLEA 2Y0MA 5K8PA 3NE7A 3LMSA 2XEGA 4NFRA 4OLLA 5D8NA 4Q36A 4F0XA 4JZ0A 3BI0A 4OAEA 2DPSA 1H8LA 1M4DA 3NE8A 4MCSA 4OC5A 1QSNA 3B2YA 2YNCA 3FBUA 4FAIA 3FRMA 4DJLA 3SI0A 2ZEDA 3F5BA 2YNEA 3PZJA 3R95A 2WSAA 4CAFA 3PB7X 2ZEOA 3IEHA 3MN8A 4KLVA 4QC6A 1DTDA 1M4LA 2ZW7A 4MHZA 4RS2A 1IYKA 1ARLA 4ZX9A 1X12A 4EMEA 4II9A 1UWYA 1P4NA 2RC4A 1ZLIA 1TKJA 4MFPA 4U5YA 2EWBA 2OZUA 2IJZA 3LWUA 2J8RA 4HNXB 2ZW5A 4L89A 1BPNA 4B12A 5D29A 4R76A 4J3GA 4KSIA 3T9YA 2QMLA 3WR7A 1VKCA 1KUVA 3GKRA 3IWEA 2AFZA 2VXKA 4U9ZA 3CPAA 4XPDB 1CPSA 2O28A 2NYQA 4KOUA 3EFAA 4FUUA 4NXYA 2XEIA 3PEIA 2FCKA 2J8NA 1I21A 2JEWA 3PBBA 4UEFA 4PPZA 2FSRA 1PU9A 4OIWA 2FT0A 2O4HA 2OZGA 4MBUA 3IGRA 5FVJA 3N5FA 1YW4A 2I3CA 2Z3PA 3F0AA 3F8KA 3NH4A 2PJ4A 2ZEFA 3NA6A 4HPSA 4UIBA 2EK8A 2ZENA 3IFEA 2WUUA 5F49A 4W9YA 3S9MA 3ZJ0A 4OKOA 1ARMA 2VQYA 1ZG9A 2Z3NA 3D7DA 1Z2LA 2YNCC 3S6GA 1ON0A 2EVNA 3PB6X 4KSFA 3BXMA 2VZZA 3N7ZA 1XOVA 2FE7A 3KQXA 4IK2A 3TO6A 5A28A 2CTBA 1OZPA 3T8WA 1X10A 1S3ZA 3B3VA 3JVNA 3PRTA 4RI1A 3E0KA 4KUAA 5DWMA 4KOWA 5GCNA 2X7BA 4C2XA 4LQ6A 4MFQA 4PXDA 4RN7A 4ZY0A 1QSMA 2BL1A 4OP4A 4CAXA 1ZG7A 3B7IA 3MRUA 1Q7LA 5HVGA 4PXCA 4K30A 4BBHA 4XNHB 5EBVA 1YW6A 2PJCA 3A9LA 1BOBA 2D4PA 1VGYA 2B5GB 3DNSA 4GS4A 4KZTA 4X8IA 1Z8LA 3R96A 6CPAA 1BPMA 3H8EA 2DPTA 4FD6A 1IB1E 1YREA 1XMTA 4MFLA 4NGQA 4P4JA 1YGHA 2PE3A 5HH1A 1IU8A 4GM5A 3R9GA 3WT4A 3MGDA 4JWPA 2REFA 2PSWA 3G3SA 4FD4A 5A27A 1PUAA 3D68A 3TTHA 2PJ1A 3BLNA 2Q44A 1QMUA 5JM6A 3QAYA 5F48A 4NEXA 3FECA 2QIRA 4CYQA 1BLLE 4UWIA 4F9VA 4QVTA 5LRGA 4B5PB 4E0AA 5CBMA 1F2PA 3FX6A 1SQHA 2B4DB 1U6MA 1V0CA 4U9YA 2QECA 3D4UA 3DR6A 5K8OA 2GIVA 3KKWA 3JRUA 2P6GA 1FY7A 1RO5A 2BCOA 1Z8WA 4UCPA 3TT2A 3H4QA 1Z4RA 1IY7A 2ZEPA 4OIDA 3PB9X 2FXFA 3IWWA 4YU9A 2ZW4A 4ZGYB 4UCMA 2CNSA 2PRBA 4B5OA 5LYDA 3CPXA 4YGOA 3KASA 3D2PA 3GIUA 2A4NA 3WC6A 1R3NA 4MI4A 3KL9A 4PXBA 3D3SA 4KOTA 3T90A 3V38A 4KOVA 2YNDA 2DF5A 1NMTA 2AJ6A 1AYEA 1LANA 4Q38A 5KTDA 1XBUA 2V8GA 4AG7A 2Z10A 5IV0A 2PRQA 3IU2A 1QSRA 4NGSA 4KVOE 2PDOA 3SHPA 1YQEA 1B6BA 2AFWA 2Z3OA 4FWUA 1YLOA 3RNZA 4HNWB 2O53A 1PYTB 5AG6A 2AFOA 3D7FA 4R6TA 3ZZIA 2ARHA 3NFZA 1FT7A
chains in the Genus database with same CATH topology
5G20A 4PSWA 3CXQA 4CGMA 1YX0A 3K9UA 2CY2A 4KVXA 3W6SA 2REEA 1L0CA 2F5IA 1VHSA 2BUEA 2Z11A 1CJWA 4MFZA 2K5TA 4CAVA 4R9MA 5ISVA 4LX9A 2FIWA 3QAHA 1S7FA 1Z9UA 2VI7A 1S7LA 4CS0B 3R9FA 2NMTA 5H84A 4AG9A 2I79A 2ZPAA 3GYAA 4L8AA 1Y9KA 1I12A 3TOBA 3EC4A 4PSXA 3EO4A 3GY9A 3H5ZA 2OU2A 1Q2CA 5G1ZA 4ONUA 4E2AA 1YR0A 4C7IA 5AG4A 2CXAA 2BEIA 3BJ7A 3DSBA 4R57A 1S60A 4MFJA 1BO4A 4BMHA 4X5KA 4CYOA 2ZXVA 2B58A 2G0BA 2PQ8A 1Z4EA 1YVOA 3TE4A 3BJ8A 4PK3A 5J8FA 5C82A 5E96A 4B5PA 1MK4A 4ORFA 2B4BA 4HNYB 3C26A 4JLYA 2WPXA 4H89A 1QSTA 2DXQA 4H6UA 2OB0A 1TIQA 2Z3KA 1XIXA 4B11A 4DNCA 4QBJA 2G3AA 1IYLA 2Q4VA 1CM0A 4KS9A 2GE3A 1RXTA 2Z3LA 1Q2DA 2Z3MA 4UFVA 4FD7A 3W6XA 1B87A 4AVBA 3FXTA 3I3GA 1NE9A 3P2FA 2HQYA 4OADA 1UFHA 4I49A 5H86A 3W91A 4AVAA 4KOYA 2Q7BA 4UFXA 4NCZA 4MY3A 3IU1A 2OH1A 1M4IA 3PP9A 4JJXA 2Q04A 2ZW6A 1XEBA 1LRZA 5DWNA 2WPWA 5F46A 3SXOA 4UCNA 4FD5A 4LUAA 2KCWA 3OWCA 4H6ZA 4AVCA 3FIXA 3LODA 1M1DA 2J8MA 4M85A 1S5KA 4Y49C 4YRHA 2Q0YA 4MHDA 2B3VA 4MFKA 3TO9A 1Y7RA 1M4GA 1I1DA 2JLMA 2I00A 5KTCA 3VWEA 5G21A 4CYPA 2EUIA 4CGLA 5BWAB 2H5MA 3FB3A 3S6FA 1KZFA 2G3TA 5IX3A 1XF8A 4C2ZA 3FYNA 4B14A 1MJAA 2P0WA 2CNMA 4CRZB 1IICA 5AGEA 1M44A 4CGPA 3FNCA 4XPKA 3DR8A 3R9EA 4PK2A 1J4JA 4A31A 4AB7A 1Y9WA 4JXRA 5F47A 4KVME 1IIDA 1N71A 5J8CA 2PC1A 2HUZA 5EC4A 2R7HA 3EY5A 3EXNA 3RYOA 2P6EA 2VZYA 1K4JA 4CAEA 5IB0A 4C68A 4KOXA 1YVKA 3LD2A 4EVYA 3JTKA 1MJBA 3G8WA 1YK3A 2ATRA 4QUSA 2B5GA 4R3KA 1S7KA 2FL4A 2JDDA 2JDCA 5AG7A 1NSLA 3I9SA 4KORA 4M3SA 4XPDC 4YFJA 4XPLA 3D8PA 4UFWA 4UWJA 1QSOA 4A95A 2P6FA 2R1IA 3DDDA 4UA3A 4E8OA 4CYNA 1XE4A 1KUYA 2VEZA 2B4DA 4NF1A 3TFYA 4F0YA 1Q2YA 4NSQA 2IL4A 4R3LA 4QB9A 4R87A 2HV2A 2R98A 2FS5A 5JPHA 3D2MA 2D4OA 2FIAA 3CXPA 4IUSA 5C88A 4C7HA 3P2HA 4HKFA 4B10A 4ZBGA 4XNHC 3TO7A 1MJ9A 4C2YA 2JEVA 4KLWA 1GHEA 4JXQA 2PR8A 2Z0ZA 2CNTA 3PGPA 3QB8A 4CAWA 5CNPA 4PV6A 5AG5A 4A32A 3R1KA 4KOSA 3TOAA 2C27A 4JD6A 2YGWA 3V8IA 4UBRA 1KUXA 4B13A 2B3UA 1WK4A 2Q4YA 2BSWA 5JQ4A 5G22A 4MJ8A 1S7NA 4F6AA 4A2ZA 3B8GA 1R57A 2R8VA 3TCVA 4CRYB 2PR1A 4MY0A 3VWDA 1WWZA 4Y49B 4A33A 2AE6A 3IWGA 4CGOA 1P0HA 3JUWA 5HMNA 4KSAA 4IF5A 2GANA 3UY5A 5I0CA 3S6HA 4CGNA 1ZO0A 3SXNA 4A30A 5KTAA 3CXSA 3S6KA 2VBQA 2OZHA 1YLEA 2Y0MA 3NE7A 4F0XA 4OLLA 4Q36A 4OAEA 2DPSA 1M4DA 1QSNA 3FBUA 2YNCA 3FRMA 3F5BA 2YNEA 3PZJA 3R95A 2WSAA 4CAFA 4KLVA 4QC6A 2ZW7A 4RS2A 1IYKA 4II9A 1P4NA 2RC4A 4MFPA 4U5YA 2OZUA 2J8RA 4HNXB 2ZW5A 4L89A 4B12A 4J3GA 3T9YA 2QMLA 3WR7A 1VKCA 1KUVA 3GKRA 3IWEA 2VXKA 4U9ZA 4XPDB 2O28A 4KOUA 3EFAA 4NXYA 2FCKA 2J8NA 1I21A 2FSRA 1PU9A 2FT0A 2OZGA 4MBUA 3IGRA 5FVJA 2Z3PA 3F0AA 3F8KA 2WUUA 5F49A 3ZJ0A 2VQYA 2Z3NA 2YNCC 3S6GA 1ON0A 2EVNA 4KSFA 2VZZA 3N7ZA 2FE7A 3TO6A 5A28A 1OZPA 3JVNA 1S3ZA 4RI1A 3E0KA 4KUAA 5DWMA 4KOWA 5GCNA 2X7BA 4C2XA 4MFQA 1QSMA 2BL1A 4CAXA 4K30A 4BBHA 4XNHB 5EBVA 3A9LA 1BOBA 2D4PA 2B5GB 3DNSA 4KZTA 4GS4A 3R96A 2DPTA 4FD6A 1IB1E 1YREA 1XMTA 4MFLA 1YGHA 5HH1A 3R9GA 3MGDA 4JWPA 2REFA 2PSWA 3G3SA 4FD4A 5A27A 1PUAA 3TTHA 3BLNA 2Q44A 5F48A 4NEXA 2QIRA 4CYQA 4UWIA 4QVTA 4B5PB 4E0AA 1SQHA 2B4DB 1U6MA 1V0CA 4U9YA 2QECA 3DR6A 2GIVA 3KKWA 2P6GA 1FY7A 1RO5A 4UCPA 3TT2A 3H4QA 1Z4RA 2FXFA 2ZW4A 4ZGYB 4UCMA 2CNSA 2PRBA 4B5OA 4YGOA 3D2PA 2A4NA 4MI4A 3D3SA 4KOTA 3T90A 4KOVA 2YNDA 1NMTA 2AJ6A 5KTDA 4Q38A 4AG7A 2Z10A 5IV0A 3IU2A 1QSRA 4KVOE 2PDOA 3SHPA 1B6BA 2Z3OA 4HNWB 5AG6A 3ZZIA 2ARHA 4KUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSW A;  3CXQ A;  1YX0 A;  3K9U A;  2CY2 A;  4KVX A;  3W6S A;  2REE A;  1L0C A;  2F5I A;  1VHS A;  2BUE A;  2Z11 A;  1CJW A;  2K5T A;  4CAV A;  4R9M A;  5ISV A;  4LX9 A;  2FIW A;  3QAH A;  1S7F A;  1Z9U A;  2VI7 A;  1S7L A;  4CS0 B;  3R9F A;  2NMT A;  5H84 A;  4AG9 A;  2I79 A;  2ZPA A;  3GYA A;  4L8A A;  1Y9K A;  1I12 A;  3TOB A;  3EC4 A;  4PSX A;  3EO4 A;  3GY9 A;  2OU2 A;  1Q2C A;  4ONU A;  4E2A A;  1YR0 A;  2BEI A;  3BJ7 A;  3DSB A;  4R57 A;  1S60 A;  1BO4 A;  4BMH A;  4X5K A;  2ZXV A;  2B58 A;  2G0B A;  2PQ8 A;  1Z4E A;  1YVO A;  3TE4 A;  3BJ8 A;  4PK3 A;  5J8F A;  5C82 A;  5E96 A;  4B5P A;  1MK4 A;  4ORF A;  2B4B A;  4HNY B;  3C26 A;  4JLY A;  2WPX A;  4H89 A;  1QST A;  2DXQ A;  4H6U A;  2OB0 A;  1TIQ A;  1XIX A;  4DNC A;  4QBJ A;  2G3A A;  1IYL A;  2Q4V A;  1CM0 A;  2GE3 A;  1RXT A;  1Q2D A;  4FD7 A;  3W6X A;  1B87 A;  4AVB A;  3FXT A;  3I3G A;  1NE9 A;  3P2F A;  2HQY A;  4OAD A;  1UFH A;  4I49 A;  5H86 A;  3W91 A;  4AVA A;  4KOY A;  2Q7B A;  4NCZ A;  4MY3 A;  2OH1 A;  1M4I A;  3PP9 A;  4JJX A;  2Q04 A;  2ZW6 A;  1XEB A;  1LRZ A;  5DWN A;  2WPW A;  5F46 A;  3SXO A;  4FD5 A;  4LUA A;  2KCW A;  3OWC A;  4H6Z A;  4AVC A;  3FIX A;  3LOD A;  1M1D A;  2J8M A;  4M85 A;  1S5K A;  4Y49 C;  4YRH A;  2Q0Y A;  4MHD A;  2B3V A;  3TO9 A;  1Y7R A;  1M4G A;  1I1D A;  2JLM A;  2I00 A;  5KTC A;  3VWE A;  2EUI A;  2H5M A;  3FB3 A;  3S6F A;  1KZF A;  2G3T A;  5IX3 A;  1XF8 A;  3FYN A;  1MJA A;  2P0W A;  2CNM A;  4CRZ B;  1IIC A;  1M44 A;  3FNC A;  4XPK A;  3DR8 A;  3R9E A;  4PK2 A;  1J4J A;  4AB7 A;  1Y9W A;  4JXR A;  5F47 A;  4KVM E;  1IID A;  1N71 A;  5J8C A;  2PC1 A;  2HUZ A;  5EC4 A;  2R7H A;  3EY5 A;  3EXN A;  3RYO A;  2P6E A;  2VZY A;  1K4J A;  5IB0 A;  4KOX A;  1YVK A;  3LD2 A;  4EVY A;  1MJB A;  3G8W A;  1YK3 A;  2ATR A;  4QUS A;  2B5G A;  4R3K A;  1S7K A;  2FL4 A;  2JDD A;  2JDC A;  1NSL A;  3I9S A;  4KOR A;  4M3S A;  4XPD C;  4YFJ A;  4XPL A;  3D8P A;  4UWJ A;  1QSO A;  2P6F A;  2R1I A;  3DDD A;  4UA3 A;  4E8O A;  1XE4 A;  1KUY A;  2VEZ A;  2B4D A;  4NF1 A;  3TFY A;  4F0Y A;  1Q2Y A;  4NSQ A;  2IL4 A;  4R3L A;  4QB9 A;  4R87 A;  2HV2 A;  2R98 A;  2FS5 A;  5JPH A;  3D2M A;  2D4O A;  2FIA A;  3CXP A;  4IUS A;  5C88 A;  3P2H A;  4HKF A;  4ZBG A;  4XNH C;  3TO7 A;  1MJ9 A;  2JEV A;  4KLW A;  1GHE A;  4JXQ A;  2PR8 A;  2Z0Z A;  2CNT A;  3PGP A;  3QB8 A;  4CAW A;  5CNP A;  4PV6 A;  3R1K A;  4KOS A;  3TOA A;  2C27 A;  4JD6 A;  3V8I A;  4UBR A;  1KUX A;  2B3U A;  1WK4 A;  2Q4Y A;  2BSW A;  5JQ4 A;  4MJ8 A;  1S7N A;  4F6A A;  3B8G A;  1R57 A;  2R8V A;  3TCV A;  4CRY B;  2PR1 A;  4MY0 A;  3VWD A;  1WWZ A;  4Y49 B;  2AE6 A;  3IWG A;  1P0H A;  3JUW A;  5HMN A;  4IF5 A;  2GAN A;  3UY5 A;  5I0C A;  3S6H A;  3SXN A;  5KTA A;  3CXS A;  3S6K A;  2VBQ A;  2OZH A;  1YLE A;  2Y0M A;  3NE7 A;  4OLL A;  4OAE A;  1M4D A;  1QSN A;  3FBU A;  3FRM A;  3F5B A;  3PZJ A;  3R95 A;  4KLV A;  4QC6 A;  2ZW7 A;  4RS2 A;  1IYK A;  4II9 A;  1P4N A;  2RC4 A;  4U5Y A;  2OZU A;  2J8R A;  4HNX B;  2ZW5 A;  4L89 A;  4J3G A;  3T9Y A;  2QML A;  3WR7 A;  1VKC A;  1KUV A;  3GKR A;  2VXK A;  4U9Z A;  4XPD B;  2O28 A;  4KOU A;  3EFA A;  4NXY A;  2FCK A;  2J8N A;  1I21 A;  2FSR A;  1PU9 A;  2FT0 A;  2OZG A;  4MBU A;  3IGR A;  5FVJ A;  3F0A A;  3F8K A;  5F49 A;  3ZJ0 A;  2VQY A;  3S6G A;  1ON0 A;  2EVN A;  2VZZ A;  3N7Z A;  2FE7 A;  3TO6 A;  1OZP A;  3JVN A;  1S3Z A;  4RI1 A;  3E0K A;  4KUA A;  5DWM A;  4KOW A;  5GCN A;  2X7B A;  1QSM A;  2BL1 A;  4CAX A;  4K30 A;  4XNH B;  5EBV A;  1BOB A;  2D4P A;  2B5G B;  3DNS A;  4KZT A;  4GS4 A;  3R96 A;  4FD6 A;  1IB1 E;  1YRE A;  1XMT A;  1YGH A;  5HH1 A;  3R9G A;  3MGD A;  4JWP A;  2REF A;  2PSW A;  3G3S A;  4FD4 A;  1PUA A;  3TTH A;  3BLN A;  2Q44 A;  5F48 A;  4NEX A;  2QIR A;  4UWI A;  4QVT A;  4B5P B;  4E0A A;  1SQH A;  2B4D B;  1U6M A;  1V0C A;  4U9Y A;  2QEC A;  3DR6 A;  2GIV A;  3KKW A;  2P6G A;  1FY7 A;  1RO5 A;  3TT2 A;  3H4Q A;  1Z4R A;  2FXF A;  2ZW4 A;  2CNS A;  2PRB A;  4B5O A;  4YGO A;  3D2P A;  2A4N A;  4MI4 A;  3D3S A;  4KOT A;  3T90 A;  4KOV A;  1NMT A;  2AJ6 A;  5KTD A;  4AG7 A;  2Z10 A;  5IV0 A;  1QSR A;  4KVO E;  2PDO A;  3SHP A;  1B6B A;  4HNW B;  3ZZI A;  2ARH A;  4KUB A; 
#chains in the Genus database with same CATH topology
 5G20 A;  3CZX A;  3VAT A;  3B3W A;  4PSW A;  3CXQ A;  3PB4 X;  4CGM A;  1YX0 A;  3K9U A;  2CY2 A;  4KVX A;  4MHN A;  3W6S A;  2BO9 A;  2VL1 A;  2REE A;  1L0C A;  2F5I A;  1KWM A;  1VHS A;  3D7H A;  4ONW A;  2BUE A;  2JBJ A;  4P4I A;  2Z11 A;  1CJW A;  4MFZ A;  2K5T A;  2ANP A;  4CAV A;  4H2K A;  4R9M A;  3K9T A;  3GB0 A;  1TF9 A;  5ISV A;  2WZN A;  4LX9 A;  3CT9 A;  3KR5 A;  2FIW A;  2ZEL A;  1LAM A;  3QAH A;  3RAM A;  1S7F A;  1Z9U A;  1ZLH A;  2VI7 A;  1S7L A;  5LRJ A;  4CS0 B;  3R9F A;  2NMT A;  3KHX A;  5H84 A;  4AG9 A;  3VAR A;  2I79 A;  1YME A;  2ZPA A;  3GYA A;  4L8A A;  1Y9K A;  1I12 A;  3TOB A;  3FVL A;  3EC4 A;  4PSX A;  3EO4 A;  3GY9 A;  3H5Z A;  2ABZ A;  3RO0 A;  3H8F A;  5DS0 A;  7CPA A;  1QQ9 A;  1XMB A;  2AFM A;  2OU2 A;  1Q2C A;  4NGT A;  5G1Z A;  4ONU A;  4E2A A;  1YR0 A;  4C7I A;  2QJ8 A;  5ELY A;  5AG4 A;  3HLP A;  1LFW A;  4NGM A;  2CXA A;  2BEI A;  4M6G A;  3BJ7 A;  3DSB A;  4R57 A;  1F2O A;  2AFS A;  3B3C A;  2F7V A;  3PFE A;  2GLJ A;  1S60 A;  2PJ6 A;  3H8G A;  1BO4 A;  4MFJ A;  4BMH A;  4MCP A;  4X5K A;  4CYO A;  4P4E A;  2ZXV A;  2ZOF A;  3CDX A;  2PJ8 A;  5I4M A;  2B58 A;  2G0B A;  2ZEG A;  3SI1 A;  2PQ8 A;  1Z4E A;  1YVO A;  3NH8 A;  1OBR A;  4IHM A;  5HVF A;  3BJ8 A;  4PK3 A;  3TE4 A;  5J8F A;  5THW A;  5E96 A;  1AUG A;  5C82 A;  4B5P A;  2PJ7 A;  1MK4 A;  4ORF A;  2V8V A;  3QNV A;  2B4B A;  4UF4 A;  4HNY B;  3C26 A;  4WWV A;  3PBE A;  4JLY A;  2WPX A;  4DYO A;  2PJ3 A;  2Q43 A;  4H89 A;  3D66 A;  3WC5 A;  4EFD A;  1QST A;  2DXQ A;  4H6U A;  2OB0 A;  1TIQ A;  2Z3K A;  1XIX A;  4P45 A;  4B11 A;  2GLF A;  4DNC A;  4TWE A;  4QBJ A;  4X2T A;  2G3A A;  2OR4 A;  3B3T A;  1IYL A;  3PFO A;  4P4D A;  3NH5 A;  4OC1 A;  2QYV A;  2Q4V A;  1CM0 A;  3WC7 A;  4KS9 A;  1HEE A;  2GE3 A;  1RXT A;  2Z3L A;  1F57 A;  2BOA A;  1Q2D A;  2V8D A;  2Z3M A;  3KZW A;  4UFV A;  2ZEH A;  4FD7 A;  4YWY A;  3W6X A;  1B87 A;  1VIX A;  2CF4 A;  4AVB A;  1HDQ A;  3FXT A;  3I3G A;  1NE9 A;  3FF3 A;  3P2F A;  2PJ2 A;  1NSA A;  2HQY A;  4OAD A;  4P10 A;  1UFH A;  4I49 A;  3D7G A;  5H86 A;  3W91 A;  3S9L A;  4AVA A;  4KOY A;  2Q7B A;  1CBX A;  4UFX A;  4NCZ A;  1Y7E A;  2PJ5 A;  4MY3 A;  3IU1 A;  2V77 A;  2OH1 A;  4PQA A;  1M4I A;  2GFQ A;  2C6P A;  2QVP A;  1R43 A;  2Q04 A;  2ZW6 A;  3L2N A;  1XEB A;  1LRZ A;  3PP9 A;  2C6G A;  5DWN A;  3SJE A;  4A39 A;  1AMP A;  2WPW A;  2RB7 A;  5F46 A;  3SXO A;  4UCN A;  1EE3 P;  4FD5 A;  4MMO A;  4LUA A;  2KCW A;  3OWC A;  4H6Z A;  4AVC A;  5HXD A;  1TKH A;  4P44 A;  4ZY1 A;  3FIX A;  2EK9 A;  3LOD A;  1M1D A;  2J8M A;  4MXU A;  4M85 A;  4RUH A;  1S5K A;  2ZEE A;  4Y49 C;  4YRH A;  2Q0Y A;  3WAB A;  2CTC A;  2XEJ A;  2B3V A;  4MHD A;  3RZA A;  4MFK A;  5JH9 A;  4NGR A;  3TO9 A;  1Y7R A;  1I1D A;  1M4G A;  2JLM A;  2I00 A;  5K8N A;  2PCU A;  3VWE A;  1CPX A;  5KTC A;  5G21 A;  3KHZ A;  4CYP A;  2EUI A;  4BIN A;  4CGL A;  1ZG8 A;  1Y0R A;  2WYR A;  5BWA B;  2H5M A;  3FB3 A;  2GU2 A;  2FVG A;  3FH4 A;  2G9D A;  4R7M A;  3S6F A;  1KZF A;  2PJ0 A;  1PCA A;  2G3T A;  2HB6 A;  3FED A;  5IX3 A;  1XF8 A;  4C2Z A;  2CIJ A;  3FYN A;  4B14 A;  1MJA A;  2P0W A;  2CNM A;  1TF8 A;  4CRZ B;  1IIC A;  5AGE A;  1M44 A;  4CGP A;  3FNC A;  1XFO A;  1TXR A;  4XPK A;  3DR8 A;  3R9E A;  1Z8T A;  1J4J A;  2Q51 A;  4PK2 A;  1Y9W A;  4A31 A;  4AB7 A;  4EWT A;  1GYT A;  1IOF A;  4K3N A;  4JXR A;  1DE4 C;  2F8H A;  1RTQ A;  5F47 A;  4KVM E;  2EO8 A;  4OC0 A;  4A37 A;  1IID A;  2ZEM A;  1CG2 A;  3SI2 A;  1N71 A;  1XJO A;  5J8C A;  4G1P A;  2PC1 A;  2HUZ A;  3IC1 A;  2R7H A;  3EY5 A;  3EXN A;  5EC4 A;  3RYO A;  3I1U A;  2P6E A;  3SJX A;  2VZY A;  1Y0Y A;  5LYL A;  2V8H A;  1K4J A;  4MCR A;  4CAE A;  5IB0 A;  4C68 A;  4KOX A;  5LRK A;  1YVK A;  4P6Y A;  2IMO A;  3LD2 A;  3IO1 A;  3JTK A;  4EVY A;  4ZI6 A;  2XEF A;  5CPA A;  5F09 A;  1MJB A;  3G8W A;  1YK3 A;  2ATR A;  4QUS A;  2DEA A;  2B5G A;  4R3K A;  5J1Q A;  1S7K A;  3BHX A;  2FL4 A;  2PJ9 A;  4R8F A;  2JDD A;  4GXH A;  4OC3 A;  2JDC A;  1JWQ A;  5AG7 A;  1NSL A;  3GUX A;  3I9S A;  4KOR A;  4M3S A;  4XPD C;  4YFJ A;  2PJA A;  4XPL A;  3IIB A;  1TKF A;  4NJQ A;  3D8P A;  4UFW A;  4ZY2 A;  4UWJ A;  1ELM P;  1QSO A;  4OME A;  2Q7S A;  4ZX8 A;  4A95 A;  2NSM A;  2PIY A;  3KGQ A;  2P6F A;  2R1I A;  3DDD A;  4UA3 A;  4E8O A;  3RBU A;  4B6Z A;  4WJB A;  2RFH A;  4OC2 A;  4M6H A;  1XE4 A;  1CX8 A;  2IQ6 A;  3KI9 A;  4CYN A;  1KUY A;  2VEZ A;  4JJX A;  4Z65 A;  2B4D A;  3FEE A;  2C1C A;  3KQZ A;  4NF1 A;  1LCP A;  4NGP A;  2POK A;  5LYF A;  3TFY A;  4F0Y A;  1Q2Y A;  4UEZ A;  4Q7A A;  3FJU A;  4NSQ A;  2IL4 A;  4R3L A;  4QB9 A;  4R87 A;  2HV2 A;  2R98 A;  1A2Z A;  2FS5 A;  4CPA A;  3KR4 A;  5JPH A;  2HC9 A;  3D2M A;  1CP7 A;  3BI1 A;  2D4O A;  1Z8X A;  2FIA A;  3CXP A;  4P4F A;  2J9A A;  5LYI A;  3SJF A;  4IUS A;  3HUV A;  5JGF A;  5C88 A;  3V7Z A;  3K2K A;  4C7H A;  3P2H A;  4HKF A;  4B10 A;  3PB8 X;  2PVV A;  3ISX A;  3TC8 A;  4ZBG A;  4LQG A;  4NJR A;  4XNH C;  1Z5R A;  4PXE A;  4MHY A;  2ZOG A;  3TO7 A;  3IJ3 A;  2PVW A;  1MJ9 A;  4C2Y A;  2JEV A;  4KLW A;  1GHE A;  1VHE A;  4JXQ A;  2PIZ A;  2PR8 A;  3TX8 A;  4JYW A;  4MCQ A;  2Q4Z A;  2Z0Z A;  2CNT A;  3PGP A;  2ODF A;  2JBK A;  3QB8 A;  1VHO A;  1ELL P;  4CAW A;  5CNP A;  1YSJ A;  4PV6 A;  5AG5 A;  1BAV A;  4UEE A;  4UIA A;  4A32 A;  4AXV A;  3R1K A;  3S9N A;  4KOS A;  3TOA A;  4F9U A;  4ZYQ A;  2C27 A;  4JD6 A;  2OOT A;  2YGW A;  3V8I A;  4MRI A;  4M6I A;  4UBR A;  1KUX A;  3DLJ A;  4B13 A;  3ISZ A;  4OC4 A;  2B3U A;  1WK4 A;  2Q4Y A;  1HDU A;  2BSW A;  1FNO A;  3FMC A;  5JQ4 A;  5G22 A;  4BD9 A;  4MJ8 A;  1S7N A;  4F6A A;  4FBE A;  3D67 A;  4A2Z A;  8CPA A;  5HVH A;  3B8G A;  3DGV A;  1R57 A;  2R8V A;  3TCV A;  4X3R A;  2AFU A;  4O23 A;  4TNU A;  4CRY B;  2PR1 A;  5EMI A;  4MY0 A;  2PJB A;  4A38 A;  3VWD A;  1WWZ A;  4Y49 B;  1IGB A;  4P4B A;  4A33 A;  2GRE A;  4F8Z A;  2AE6 A;  4KUB A;  1XRY A;  3IWG A;  4NGN A;  3B3S A;  4CGO A;  3LAC A;  5IB9 A;  4MHP A;  1P0H A;  3JUW A;  5HMN A;  3GLJ A;  5K8M A;  1IOI A;  1CP6 A;  3B35 A;  1JQG A;  4A94 A;  4KSA A;  3VH9 A;  4IF5 A;  2GAN A;  3UY5 A;  5I0C A;  2C6C A;  4IAV A;  3S6H A;  4CGN A;  1LOK A;  1ZO0 A;  3SXN A;  4A30 A;  1LAP A;  5KTA A;  2EBJ A;  2AFX A;  3CXS A;  3S6K A;  2VBQ A;  2OZH A;  4DUK A;  3SJG A;  1YLE A;  2Y0M A;  5K8P A;  3NE7 A;  3LMS A;  2XEG A;  4NFR A;  4OLL A;  5D8N A;  4Q36 A;  4F0X A;  4JZ0 A;  3BI0 A;  4OAE A;  2DPS A;  1H8L A;  1M4D A;  3NE8 A;  4MCS A;  4OC5 A;  1QSN A;  3B2Y A;  2YNC A;  3FBU A;  4FAI A;  3FRM A;  4DJL A;  3SI0 A;  2ZED A;  3F5B A;  2YNE A;  3PZJ A;  3R95 A;  2WSA A;  4CAF A;  3PB7 X;  2ZEO A;  3IEH A;  3MN8 A;  4KLV A;  4QC6 A;  1DTD A;  1M4L A;  2ZW7 A;  4MHZ A;  4RS2 A;  1IYK A;  1ARL A;  4ZX9 A;  1X12 A;  4EME A;  4II9 A;  1UWY A;  1P4N A;  2RC4 A;  1ZLI A;  1TKJ A;  4MFP A;  4U5Y A;  2EWB A;  2OZU A;  2IJZ A;  3LWU A;  2J8R A;  4HNX B;  2ZW5 A;  4L89 A;  1BPN A;  4B12 A;  5D29 A;  4R76 A;  4J3G A;  4KSI A;  3T9Y A;  2QML A;  3WR7 A;  1VKC A;  1KUV A;  3GKR A;  3IWE A;  2AFZ A;  2VXK A;  4U9Z A;  3CPA A;  4XPD B;  1CPS A;  2O28 A;  2NYQ A;  4KOU A;  3EFA A;  4FUU A;  4NXY A;  2XEI A;  3PEI A;  2FCK A;  2J8N A;  1I21 A;  2JEW A;  3PBB A;  4UEF A;  4PPZ A;  2FSR A;  1PU9 A;  4OIW A;  2FT0 A;  2O4H A;  2OZG A;  4MBU A;  3IGR A;  5FVJ A;  3N5F A;  1YW4 A;  2I3C A;  2Z3P A;  3F0A A;  3F8K A;  3NH4 A;  2PJ4 A;  2ZEF A;  3NA6 A;  4HPS A;  4UIB A;  2EK8 A;  2ZEN A;  3IFE A;  2WUU A;  5F49 A;  4W9Y A;  3S9M A;  3ZJ0 A;  4OKO A;  1ARM A;  2VQY A;  1ZG9 A;  2Z3N A;  3D7D A;  1Z2L A;  2YNC C;  3S6G A;  1ON0 A;  2EVN A;  3PB6 X;  4KSF A;  3BXM A;  2VZZ A;  3N7Z A;  1XOV A;  2FE7 A;  3KQX A;  4IK2 A;  3TO6 A;  5A28 A;  2CTB A;  1OZP A;  3T8W A;  1X10 A;  1S3Z A;  3B3V A;  3JVN A;  3PRT A;  4RI1 A;  3E0K A;  4KUA A;  5DWM A;  4KOW A;  5GCN A;  2X7B A;  4C2X A;  4LQ6 A;  4MFQ A;  4PXD A;  4RN7 A;  4ZY0 A;  1QSM A;  2BL1 A;  4OP4 A;  4CAX A;  1ZG7 A;  3B7I A;  3MRU A;  1Q7L A;  5HVG A;  4PXC A;  4K30 A;  4BBH A;  4XNH B;  5EBV A;  1YW6 A;  2PJC A;  3A9L A;  1BOB A;  2D4P A;  1VGY A;  2B5G B;  3DNS A;  4GS4 A;  4KZT A;  4X8I A;  1Z8L A;  3R96 A;  6CPA A;  1BPM A;  3H8E A;  2DPT A;  4FD6 A;  1IB1 E;  1YRE A;  1XMT A;  4MFL A;  4NGQ A;  4P4J A;  1YGH A;  2PE3 A;  5HH1 A;  1IU8 A;  4GM5 A;  3R9G A;  3WT4 A;  3MGD A;  4JWP A;  2REF A;  2PSW A;  3G3S A;  4FD4 A;  5A27 A;  1PUA A;  3D68 A;  3TTH A;  2PJ1 A;  3BLN A;  2Q44 A;  1QMU A;  5JM6 A;  3QAY A;  5F48 A;  4NEX A;  3FEC A;  2QIR A;  4CYQ A;  1BLL E;  4UWI A;  4F9V A;  4QVT A;  5LRG A;  4B5P B;  4E0A A;  5CBM A;  1F2P A;  3FX6 A;  1SQH A;  2B4D B;  1U6M A;  1V0C A;  4U9Y A;  2QEC A;  3D4U A;  3DR6 A;  5K8O A;  2GIV A;  3KKW A;  3JRU A;  2P6G A;  1FY7 A;  1RO5 A;  2BCO A;  1Z8W A;  4UCP A;  3TT2 A;  3H4Q A;  1Z4R A;  1IY7 A;  2ZEP A;  4OID A;  3PB9 X;  2FXF A;  3IWW A;  4YU9 A;  2ZW4 A;  4ZGY B;  4UCM A;  2CNS A;  2PRB A;  4B5O A;  5LYD A;  3CPX A;  4YGO A;  3KAS A;  3D2P A;  3GIU A;  2A4N A;  3WC6 A;  1R3N A;  4MI4 A;  3KL9 A;  4PXB A;  3D3S A;  4KOT A;  3T90 A;  3V38 A;  4KOV A;  2YND A;  2DF5 A;  1NMT A;  2AJ6 A;  1AYE A;  1LAN A;  4Q38 A;  5KTD A;  1XBU A;  2V8G A;  4AG7 A;  2Z10 A;  5IV0 A;  2PRQ A;  3IU2 A;  1QSR A;  4NGS A;  4KVO E;  2PDO A;  3SHP A;  1YQE A;  1B6B A;  2AFW A;  2Z3O A;  4FWU A;  1YLO A;  3RNZ A;  4HNW B;  2O53 A;  1PYT B;  5AG6 A;  2AFO A;  3D7F A;  4R6T A;  3ZZI A;  2ARH A;  3NFZ A;  1FT7 A; 
#chains in the Genus database with same CATH homology
 5G20 A;  4PSW A;  3CXQ A;  4CGM A;  1YX0 A;  3K9U A;  2CY2 A;  4KVX A;  3W6S A;  2REE A;  1L0C A;  2F5I A;  1VHS A;  2BUE A;  2Z11 A;  1CJW A;  4MFZ A;  2K5T A;  4CAV A;  4R9M A;  5ISV A;  4LX9 A;  2FIW A;  3QAH A;  1S7F A;  1Z9U A;  2VI7 A;  1S7L A;  4CS0 B;  3R9F A;  2NMT A;  5H84 A;  4AG9 A;  2I79 A;  2ZPA A;  3GYA A;  4L8A A;  1Y9K A;  1I12 A;  3TOB A;  3EC4 A;  4PSX A;  3EO4 A;  3GY9 A;  3H5Z A;  2OU2 A;  1Q2C A;  5G1Z A;  4ONU A;  4E2A A;  1YR0 A;  4C7I A;  5AG4 A;  2CXA A;  2BEI A;  3BJ7 A;  3DSB A;  4R57 A;  1S60 A;  4MFJ A;  1BO4 A;  4BMH A;  4X5K A;  4CYO A;  2ZXV A;  2B58 A;  2G0B A;  2PQ8 A;  1Z4E A;  1YVO A;  3TE4 A;  3BJ8 A;  4PK3 A;  5J8F A;  5C82 A;  5E96 A;  4B5P A;  1MK4 A;  4ORF A;  2B4B A;  4HNY B;  3C26 A;  4JLY A;  2WPX A;  4H89 A;  1QST A;  2DXQ A;  4H6U A;  2OB0 A;  1TIQ A;  2Z3K A;  1XIX A;  4B11 A;  4DNC A;  4QBJ A;  2G3A A;  1IYL A;  2Q4V A;  1CM0 A;  4KS9 A;  2GE3 A;  1RXT A;  2Z3L A;  1Q2D A;  2Z3M A;  4UFV A;  4FD7 A;  3W6X A;  1B87 A;  4AVB A;  3FXT A;  3I3G A;  1NE9 A;  3P2F A;  2HQY A;  4OAD A;  1UFH A;  4I49 A;  5H86 A;  3W91 A;  4AVA A;  4KOY A;  2Q7B A;  4UFX A;  4NCZ A;  4MY3 A;  3IU1 A;  2OH1 A;  1M4I A;  3PP9 A;  4JJX A;  2Q04 A;  2ZW6 A;  1XEB A;  1LRZ A;  5DWN A;  2WPW A;  5F46 A;  3SXO A;  4UCN A;  4FD5 A;  4LUA A;  2KCW A;  3OWC A;  4H6Z A;  4AVC A;  3FIX A;  3LOD A;  1M1D A;  2J8M A;  4M85 A;  1S5K A;  4Y49 C;  4YRH A;  2Q0Y A;  4MHD A;  2B3V A;  4MFK A;  3TO9 A;  1Y7R A;  1M4G A;  1I1D A;  2JLM A;  2I00 A;  5KTC A;  3VWE A;  5G21 A;  4CYP A;  2EUI A;  4CGL A;  5BWA B;  2H5M A;  3FB3 A;  3S6F A;  1KZF A;  2G3T A;  5IX3 A;  1XF8 A;  4C2Z A;  3FYN A;  4B14 A;  1MJA A;  2P0W A;  2CNM A;  4CRZ B;  1IIC A;  5AGE A;  1M44 A;  4CGP A;  3FNC A;  4XPK A;  3DR8 A;  3R9E A;  4PK2 A;  1J4J A;  4A31 A;  4AB7 A;  1Y9W A;  4JXR A;  5F47 A;  4KVM E;  1IID A;  1N71 A;  5J8C A;  2PC1 A;  2HUZ A;  5EC4 A;  2R7H A;  3EY5 A;  3EXN A;  3RYO A;  2P6E A;  2VZY A;  1K4J A;  4CAE A;  5IB0 A;  4C68 A;  4KOX A;  1YVK A;  3LD2 A;  4EVY A;  3JTK A;  1MJB A;  3G8W A;  1YK3 A;  2ATR A;  4QUS A;  2B5G A;  4R3K A;  1S7K A;  2FL4 A;  2JDD A;  2JDC A;  5AG7 A;  1NSL A;  3I9S A;  4KOR A;  4M3S A;  4XPD C;  4YFJ A;  4XPL A;  3D8P A;  4UFW A;  4UWJ A;  1QSO A;  4A95 A;  2P6F A;  2R1I A;  3DDD A;  4UA3 A;  4E8O A;  4CYN A;  1XE4 A;  1KUY A;  2VEZ A;  2B4D A;  4NF1 A;  3TFY A;  4F0Y A;  1Q2Y A;  4NSQ A;  2IL4 A;  4R3L A;  4QB9 A;  4R87 A;  2HV2 A;  2R98 A;  2FS5 A;  5JPH A;  3D2M A;  2D4O A;  2FIA A;  3CXP A;  4IUS A;  5C88 A;  4C7H A;  3P2H A;  4HKF A;  4B10 A;  4ZBG A;  4XNH C;  3TO7 A;  1MJ9 A;  4C2Y A;  2JEV A;  4KLW A;  1GHE A;  4JXQ A;  2PR8 A;  2Z0Z A;  2CNT A;  3PGP A;  3QB8 A;  4CAW A;  5CNP A;  4PV6 A;  5AG5 A;  4A32 A;  3R1K A;  4KOS A;  3TOA A;  2C27 A;  4JD6 A;  2YGW A;  3V8I A;  4UBR A;  1KUX A;  4B13 A;  2B3U A;  1WK4 A;  2Q4Y A;  2BSW A;  5JQ4 A;  5G22 A;  4MJ8 A;  1S7N A;  4F6A A;  4A2Z A;  3B8G A;  1R57 A;  2R8V A;  3TCV A;  4CRY B;  2PR1 A;  4MY0 A;  3VWD A;  1WWZ A;  4Y49 B;  4A33 A;  2AE6 A;  3IWG A;  4CGO A;  1P0H A;  3JUW A;  5HMN A;  4KSA A;  4IF5 A;  2GAN A;  3UY5 A;  5I0C A;  3S6H A;  4CGN A;  1ZO0 A;  3SXN A;  4A30 A;  5KTA A;  3CXS A;  3S6K A;  2VBQ A;  2OZH A;  1YLE A;  2Y0M A;  3NE7 A;  4F0X A;  4OLL A;  4Q36 A;  4OAE A;  2DPS A;  1M4D A;  1QSN A;  3FBU A;  2YNC A;  3FRM A;  3F5B A;  2YNE A;  3PZJ A;  3R95 A;  2WSA A;  4CAF A;  4KLV A;  4QC6 A;  2ZW7 A;  4RS2 A;  1IYK A;  4II9 A;  1P4N A;  2RC4 A;  4MFP A;  4U5Y A;  2OZU A;  2J8R A;  4HNX B;  2ZW5 A;  4L89 A;  4B12 A;  4J3G A;  3T9Y A;  2QML A;  3WR7 A;  1VKC A;  1KUV A;  3GKR A;  3IWE A;  2VXK A;  4U9Z A;  4XPD B;  2O28 A;  4KOU A;  3EFA A;  4NXY A;  2FCK A;  2J8N A;  1I21 A;  2FSR A;  1PU9 A;  2FT0 A;  2OZG A;  4MBU A;  3IGR A;  5FVJ A;  2Z3P A;  3F0A A;  3F8K A;  2WUU A;  5F49 A;  3ZJ0 A;  2VQY A;  2Z3N A;  2YNC C;  3S6G A;  1ON0 A;  2EVN A;  4KSF A;  2VZZ A;  3N7Z A;  2FE7 A;  3TO6 A;  5A28 A;  1OZP A;  3JVN A;  1S3Z A;  4RI1 A;  3E0K A;  4KUA A;  5DWM A;  4KOW A;  5GCN A;  2X7B A;  4C2X A;  4MFQ A;  1QSM A;  2BL1 A;  4CAX A;  4K30 A;  4BBH A;  4XNH B;  5EBV A;  3A9L A;  1BOB A;  2D4P A;  2B5G B;  3DNS A;  4KZT A;  4GS4 A;  3R96 A;  2DPT A;  4FD6 A;  1IB1 E;  1YRE A;  1XMT A;  4MFL A;  1YGH A;  5HH1 A;  3R9G A;  3MGD A;  4JWP A;  2REF A;  2PSW A;  3G3S A;  4FD4 A;  5A27 A;  1PUA A;  3TTH A;  3BLN A;  2Q44 A;  5F48 A;  4NEX A;  2QIR A;  4CYQ A;  4UWI A;  4QVT A;  4B5P B;  4E0A A;  1SQH A;  2B4D B;  1U6M A;  1V0C A;  4U9Y A;  2QEC A;  3DR6 A;  2GIV A;  3KKW A;  2P6G A;  1FY7 A;  1RO5 A;  4UCP A;  3TT2 A;  3H4Q A;  1Z4R A;  2FXF A;  2ZW4 A;  4ZGY B;  4UCM A;  2CNS A;  2PRB A;  4B5O A;  4YGO A;  3D2P A;  2A4N A;  4MI4 A;  3D3S A;  4KOT A;  3T90 A;  4KOV A;  2YND A;  1NMT A;  2AJ6 A;  5KTD A;  4Q38 A;  4AG7 A;  2Z10 A;  5IV0 A;  3IU2 A;  1QSR A;  4KVO E;  2PDO A;  3SHP A;  1B6B A;  2Z3O A;  4HNW B;  5AG6 A;  3ZZI A;  2ARH A;  4KUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...