4E0AA

Crystal structure of the mutant f44r bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MIIREATVQDYEEVARLHTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQRKTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNDRAKAFYHSLGMRCQKQTMELPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1408 protein
publication title Northeast Structural Genomics Consortium Target BhR182
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e0aA00
1WWZA 2CY2A 3S6KA 4X5KA 4KOUA 2P6EA 1FY7A 3TFYA 4KOVA 2ZW7A 4JWPA 5F49A 3GKRA 3DDDA 2VXKA 1Y7RA 2JEVA 4UA3A 5JPHA 1BO4A 2Q44A 2B4DA 2Z0ZA 3EXNA 3LD2A 3G8WA 1K4JA 1XIXA 2ZPAA 3K9UA 2B5GB 3TT2A 1IB1E 2QIRA 4KUBA 5C88A 4AG7A 2I00A 1RXTA 2R1IA 4HKFA 3SXOA 4U5YA 2Q7BA 2FSRA 2PC1A 3DSBA 4NSQA 3VWDA 1U6MA 4F6AA 4AVAA 4AVBA 2B3UA 3FIXA 4FD7A 3ZJ0A 1I1DA 4ORFA 1S7LA 4JD6A 2GIVA 4PSXA 2OU2A 3F8KA 4YRHA 4QUSA 1L0CA 4H6UA 2J8NA 5GCNA 2B3VA 4NEXA 1YVOA 4H6ZA 4GS4A 4Y49B 4AB7A 2REFA 4MI4A 2Q0YA 1B6BA 2AJ6A 1YVKA 1Z4RA 5DWNA 4ZBGA 3S6FA 1KZFA 4QBJA 1S60A 4JXRA 3W91A 1B87A 2JDCA 2VQYA 2CNTA 5F46A 2R7HA 4U9YA 2FE7A 3P2FA 1MJ9A 4KZTA 4MY0A 3T9YA 3N7ZA 4I49A 4XPDC 1M4DA 4PK3A 1VKCA 3DNSA 2C27A 4PSWA 1S7KA 4KUAA 2B5GA 2FCKA 1PU9A 4KOSA 4XPDB 3UY5A 2DXQA 1S5KA 2OZUA 2PQ8A 3BJ7A 1QSNA 3EC4A 2ZXVA 2G0BA 3D2MA 2RC4A 1MJAA 1QSRA 3QB8A 1IYLA 4OADA 2WPWA 5EBVA 5FVJA 4HNWB 4KOYA 4ONUA 1IIDA 2FT0A 2G3AA 3SHPA 1IICA 5H84A 5IB0A 4CAXA 3FBUA 4M3SA 2P6GA 3EY5A 2FXFA 4KOTA 3R9FA 4JXQA 3W6SA 4CS0B 1KUYA 2I79A 3FRMA 4NXYA 4H89A 2R98A 2ZW5A 2X7BA 2EVNA 5CNPA 4BMHA 1Y9WA 3LODA 4K30A 2OB0A 4M85A 3BLNA 2HV2A 2HQYA 1WK4A 4KLVA 2VZYA 3KKWA 2JDDA 3FB3A 3B8GA 4B5PB 4MY3A 3FXTA 4CAVA 4DNCA 1UFHA 1YGHA 4QC6A 1S7FA 3R9GA 4CRZB 4R9MA 1ON0A 3R95A 3EO4A 5H86A 4RS2A 1N71A 1QSTA 2O28A 1OZPA 1I21A 5IV0A 4KOXA 1MJBA 3R9EA 3NE7A 1P4NA 1VHSA 3WR7A 2FIAA 5KTDA 5E96A 1XMTA 4R87A 2G3TA 2B58A 4FD4A 1PUAA 4Y49C 3TO7A 3P2HA 2ZW6A 3GY9A 1GHEA 4F0YA 1NE9A 1M44A 1SQHA 5JQ4A 3CXSA 3GYAA 3R1KA 5C82A 4HNXB 4PK2A 4OAEA 4R57A 1CJWA 2Z10A 4QB9A 2BUEA 2REEA 3E0KA 1Q2YA 4U9ZA 2VI7A 4IF5A 4MJ8A 1RO5A 3BJ8A 5KTAA 3TCVA 3PZJA 1Z9UA 2GANA 4MBUA 2KCWA 5HMNA 4B5OA 5I0CA 5J8FA 1M1DA 2PDOA 4B5PA 5EC4A 4YFJA 3FNCA 5J8CA 2F5IA 4IUSA 4RI1A 1YLEA 3PP9A 2IL4A 2CNMA 1CM0A 4AG9A 3PGPA 4J3GA 2VBQA 1NSLA 3FYNA 4II9A 2CNSA 1I12A 4QVTA 2ATRA 1XE4A 4CRYB 3S6HA 4NCZA 1M4IA 2ZW4A 3TO9A 4KVME 1S3ZA 2K5TA 4UBRA 3TTHA 4OLLA 4HNYB 5KTCA 2JLMA 2P6FA 4KVOE 3I9SA 2WPXA 2FS5A 3IGRA 1QSOA 3JVNA 1V0CA 3F5BA 4MHDA 3CXQA 1KUVA 1Y9KA 2Y0MA 2OZHA 2QMLA 2BEIA 3JUWA 1YR0A 1YK3A 4JJXA 2Q04A 4EVYA 2VEZA 3D8PA 3OWCA 3T90A 2P0WA 1XF8A 4KOWA 3DR8A 2R8VA 5HH1A 4L8AA 5ISVA 1KUXA 1LRZA 3D2PA 3IWGA 1Q2CA 4JLYA 2OZGA 2BSWA 2Q4YA 2ARHA 1P0HA 2FL4A 1R57A 3EFAA 1YX0A 2D4OA 2HUZA 2FIWA 1S7NA 3TO6A 3R96A 4PV6A 3D3SA 3QAHA 2PR8A 1XEBA 1NMTA 2Z11A 3SXNA 2J8RA 4R3LA 2J8MA 4XPKA 1MK4A 3RYOA 2B4DB 3H4QA 3I3GA 3MGDA 4CAWA 1TIQA 3ZZIA 4UWIA 4FD6A 5DWMA 3TOBA 2OH1A 2QECA 1J4JA 1QSMA 2BL1A 4XNHC 2Q4VA 4LUAA 2PSWA 4XNHB 4YGOA 1BOBA 5IX3A 5F47A 4KVXA 1IYKA 2A4NA 1Q2DA 4AVCA 2B4BA 2H5MA 4KLWA 5F48A 4E2AA 3F0AA 3VWEA 3V8IA 2VZZA 2NMTA 2EUIA 4XPLA 4L89A 4NF1A 2GE3A 4E8OA 3DR6A 3W6XA 2AE6A 3TOAA 1M4GA 4R3KA 4LX9A 3TE4A 3G3SA 2PRBA 4UWJA 4KORA 1YREA 3C26A 1Z4EA 2PR1A 3S6GA 4FD5A 4E0AA 3CXPA 2D4PA
chains in the Genus database with same CATH superfamily
1WWZA 2CY2A 3S6KA 4X5KA 4A38A 4KOUA 2PVVA 2P6EA 2PJ7A 1FY7A 3TFYA 4KOVA 4UEZA 2ZW7A 4P4BA 1Y0RA 4JWPA 1PYTB 3IC1A 2O53A 1FNOA 3KL9A 3GKRA 5F49A 3DDDA 2VXKA 1X12A 1Y7RA 2AFOA 2JEVA 4UA3A 5JPHA 5K8NA 1F57A 1BO4A 2Q44A 3GLJA 2B4DA 3PFEA 3WC6A 3PRTA 2Z0ZA 3EXNA 3LD2A 4ZYQA 4C7HA 3G8WA 1JWQA 3GIUA 4R6TA 1K4JA 5LYFA 5JM6A 1XIXA 5G1ZA 4C2ZA 4IAVA 2ODFA 5AG6A 2ZPAA 3K9UA 2B5GB 3TT2A 2V8GA 3D4UA 1IB1E 2GLFA 3D66A 2F7VA 4UFVA 4OKOA 2QIRA 4KUBA 5C88A 2AFXA 2I00A 3D7GA 4AG7A 4MFPA 1RXTA 2C6CA 2R1IA 4HKFA 4NGMA 3SXOA 4PPZA 2Q43A 2FSRA 2OR4A 1QMUA 4U5YA 2Q7BA 2PC1A 3DSBA 1Z5RA 4NSQA 3VWDA 1VHOA 5J1QA 3CZXA 1U6MA 1ZLHA 2EK9A 4AVAA 4AVBA 2B3UA 4F6AA 3FIXA 5HVGA 4FD7A 1TF8A 1XMBA 3V38A 3D68A 3ZJ0A 4EVYA 1I1DA 4ORFA 1S7LA 4P4IA 4JD6A 1CX8A 2GIVA 2YNEA 2HB6A 4PSXA 2OU2A 2YNCA 3F8KA 3N5FA 4F9VA 4YRHA 5LYIA 2CTCA 4QUSA 1L0CA 4H6UA 4A31A 4YWYA 3D7HA 4NFRA 2J8NA 4GM5A 2PE3A 3PFOA 4OC3A 1OBRA 3IU1A 5GCNA 1BPNA 2B3VA 4MRIA 4NEXA 1YVOA 5LRKA 4X2TA 4H6ZA 4GS4A 5LYDA 2NYQA 2JBKA 4Y49B 4AB7A 4EWTA 3I1UA 4CGLA 1JQGA 5CBMA 1Z8TA 2REFA 4FAIA 1TF9A 4MI4A 2Q0YA 1B6BA 3WC5A 2AJ6A 4ZI6A 1YVKA 4MCRA 1Z4RA 4R8FA 5DWNA 3WABA 4X3RA 3B35A 3B3VA 4ZBGA 1NSAA 4NGRA 2ZEOA 3S6FA 2FVGA 1KZFA 4QBJA 1S60A 3IJ3A 1Q7LA 2ZOFA 4JXRA 3SJGA 3W91A 1B87A 2JDCA 2V77A 2IQ6A 1YMEA 2VQYA 2CNTA 3LWUA 1ARLA 4CGNA 5F46A 2R7HA 3TC8A 4U9YA 1Y7EA 2FE7A 7CPAA 3P2FA 4A39A 1MJ9A 4DUKA 2CF4A 2Q4ZA 4KZTA 3H8EA 3BXMA 5G20A 4MY0A 1ZG7A 3T9YA 3HLPA 3N7ZA 3MN8A 4I49A 4UCPA 4XPDC 1M4DA 3L2NA 4PK3A 4A33A 3B7IA 3ISXA 2YGWA 1VKCA 2Z3NA 3DNSA 2C27A 4PSWA 1CP6A 1S7KA 1XFOA 4KUAA 4MHPA 4OIWA 2B5GA 5AG7A 4EMEA 2FCKA 1PU9A 4KOSA 4XPDB 3UY5A 5K8MA 4G1PA 3KHZA 4KSFA 1LFWA 2DXQA 1S5KA 2OZUA 2PQ8A 1M4LA 2ZEDA 3V7ZA 1IOFA 3VH9A 4IHMA 3BJ7A 1QSNA 2PRQA 3EC4A 4OC1A 2ZXVA 5I4MA 2G0BA 4B14A 3D2MA 2RC4A 1MJAA 1QSRA 1Z8WA 3QB8A 1IYLA 1A2ZA 2NSMA 2WPWA 4OADA 5EBVA 5FVJA 1UWYA 4HNWB 2AFUA 4KOYA 4UFWA 3B3SA 2PJCA 5D29A 5G21A 3KI9A 5K8OA 4ONUA 1ARMA 1IIDA 2Z3PA 2FT0A 1LAPA 2G3AA 4M6IA 1IICA 3SHPA 5H84A 4DJLA 5IB0A 4CAXA 3KQXA 3FBUA 4M3SA 2P6GA 3D7FA 2FXFA 3EY5A 4KOTA 3CDXA 1BAVA 4JXQA 2PJ4A 3R9FA 3W6SA 4CS0B 2PVWA 1KUYA 2I79A 2EWBA 3FRMA 3NH5A 4CYPA 2PJ0A 4NXYA 3QAYA 4H89A 2R98A 4HPSA 3PBBA 2ZW5A 4P4JA 1BPMA 2X7BA 4UIAA 1YLOA 2EVNA 2IMOA 4GXHA 5CNPA 4M6HA 3IFEA 4BMHA 1Y9WA 4MHYA 3LODA 4K30A 2OB0A 2ZENA 4MMOA 3TX8A 5K8PA 4M85A 2BOAA 2I3CA 3BLNA 2HV2A 4UCMA 2HQYA 1WK4A 3CPXA 2VZYA 2AFWA 3FF3A 3KKWA 4KLVA 2JDDA 1ZG8A 2DPSA 4NGPA 1IGBA 3FB3A 3B8GA 1F2OA 3BI0A 4O23A 2OOTA 4A2ZA 4A94A 1CG2A 4B5PB 1PCAA 3JTKA 4MY3A 4UEEA 4A32A 4C2YA 3FXTA 4PQAA 4CAVA 1LOKA 1UFHA 4DNCA 1YGHA 5CPAA 4W9YA 4F0XA 4QC6A 2PJ3A 2Z3LA 1S7FA 3R9GA 4CRZB 2ZEMA 3NE8A 4R9MA 1ON0A 3R95A 1CP7A 2PJ2A 3EO4A 1IY7A 4FUUA 1XRYA 4OC0A 5H86A 3IIBA 3S9MA 4RS2A 4B11A 4CPAA 1N71A 1QSTA 4A37A 2O28A 1OZPA 5G22A 2WZNA 4KSIA 4UEFA 5JH9A 1ZLIA 1I21A 2WSAA 3LACA 2PIYA 4KOXA 5IV0A 1MJBA 3R9EA 3NE7A 1P4NA 3JRUA 4R7MA 1VHSA 5HVFA 3WR7A 2DPTA 2FIAA 4TNUA 3PB7X 5KTDA 5E96A 1XMTA 4R87A 1R3NA 2B58A 2G3TA 5F09A 4FD4A 4C2XA 1VGYA 1PUAA 4Y49C 3TO7A 4RUHA 3P2HA 4KSAA 2ZW6A 4MCSA 5LYLA 4MXUA 3GY9A 1GHEA 5LRJA 4P6YA 1IOIA 1NE9A 1M44A 4P4DA 4F0YA 1SQHA 3IU2A 2RFHA 4B13A 1X10A 5JQ4A 3CXSA 3RBUA 3GYAA 3R1KA 5C82A 3KGQA 1QQ9A 3DLJA 4OIDA 4IK2A 3FMCA 4HNXB 1LCPA 2Z3KA 4PK2A 1XJOA 4OAEA 4R57A 1HEEA 4X8IA 1CJWA 2Z10A 3PBEA 2C1CA 3H5ZA 4CGOA 3LMSA 1YW4A 3RNZA 4QB9A 2BUEA 4P44A 2REEA 2Q7SA 3E0KA 1Q2YA 2PJ8A 5A27A 5ELYA 2XEJA 3S9LA 4U9ZA 1RTQA 2VI7A 4CYOA 3DGVA 1CPXA 6CPAA 3D67A 4IF5A 1LANA 1DE4C 4MJ8A 1RO5A 3BJ8A 5IB9A 5KTAA 3TCVA 3PZJA 2WYRA 1Z9UA 2GANA 4MBUA 2KCWA 2O4HA 5HMNA 2PIZA 4Q7AA 4NGNA 4B5OA 1DTDA 2ZEEA 3KZWA 5I0CA 5J8FA 3A9LA 4NGQA 2GLJA 4YU9A 1M1DA 2PDOA 4B5PA 4F8ZA 5EC4A 4YFJA 3FNCA 5J8CA 2F5IA 4NJRA 4LQGA 4Z65A 4IUSA 2V8DA 4RI1A 2AFSA 1HDUA 1ELMP 1YLEA 2HC9A 3SJFA 4BBHA 3PP9A 5HVHA 2IL4A 3WC7A 4ZY0A 2CNMA 1CM0A 3KR5A 2IJZA 2EBJA 4H2KA 4OC5A 4ZY1A 4AG9A 4C7IA 3PGPA 4J3GA 4NJQA 2VBQA 4LQ6A 1IU8A 2XEIA 1NSLA 3FYNA 4II9A 2CNSA 1I12A 2QJ8A 4QVTA 5AG4A 2ATRA 4CAFA 2F8HA 3NH4A 1XE4A 3D7DA 4CRYB 3GB0A 1TKJA 3S6HA 1F2PA 4BINA 2XEFA 1TXRA 2PJ5A 4NCZA 4ZGYB 1M4IA 2ZW4A 3HUVA 3ISZA 4KVME 1S3ZA 2K5TA 4MFKA 3TO9A 4UBRA 3TTHA 4EFDA 4OLLA 2V8VA 1AYEA 3NH8A 1YQEA 2CXAA 2Z3OA 2GREA 4HNYB 3KASA 5KTCA 2JLMA 4WWVA 3B3CA 2P6FA 3KQZA 2QVPA 2BCOA 2POKA 1YSJA 3B3TA 4KVOE 4MFJA 5LRGA 3T8WA 3I9SA 3SI1A 2WPXA 2FS5A 2AFZA 1CBXA 1QSOA 1Y0YA 2J9AA 3IGRA 4A30A 3JVNA 4OC2A 1V0CA 3CPAA 3F5BA 3FEEA 4AXVA 4MHDA 4C68A 3KR4A 2DF5A 1GYTA 3CXQA 3SJXA 1KUVA 1Y9KA 3FH4A 4OP4A 4A95A 2Y0MA 4M6GA 2OZHA 2QMLA 3FVLA 2BEIA 3JUWA 1YR0A 1YK3A 4JJXA 1KWMA 2Q04A 2EK8A 3PEIA 3IO1A 4ZX9A 2BO9A 2VEZA 3D8PA 1FT7A 3OWCA 1TKFA 5AG5A 3T90A 4MHNA 4BD9A 2P0WA 2ZEFA 1XF8A 1Z8LA 3FEDA 4KOWA 3PB4X 3DR8A 1BLLE 8CPAA 2R8VA 3PB9X 5HH1A 4L8AA 2Z3MA 3NA6A 1KUXA 4ONWA 5ISVA 3RZAA 1LRZA 3K2KA 2Q51A 4CYQA 3H8GA 2PJAA 3D2PA 3IWGA 1Q2CA 4JLYA 3MRUA 1ZO0A 4MFZA 2C6GA 4MCQA 4R76A 2OZGA 1AUGA 4CGPA 4P4EA 3IWEA 3K9TA 2BSWA 2Q4YA 4OC4A 2ARHA 1VIXA 1P0HA 2EO8A 4PXDA 4PXBA 2FL4A 1R57A 3EFAA 3BHXA 1YX0A 3SI0A 2D4OA 3VATA 2HUZA 2FIWA 4WJBA 1S7NA 3TO6A 4F9UA 2WUUA 1R43A 3R96A 4JYWA 3RAMA 4ZY2A 2C6PA 5A28A 4PXCA 2ZEHA 2GU2A 4PV6A 3QNVA 3D3SA 3NFZA 1AMPA 4UIBA 4DYOA 3QAHA 4NGSA 2PR8A 1XEBA 1NMTA 2Z11A 3SXNA 5DS0A 2J8RA 3IWWA 4R3LA 2PJBA 2DEAA 2J8MA 4XPKA 1EE3P 1MK4A 3RYOA 2B4DB 3H4QA 3I3GA 3MGDA 5HXDA 4CAWA 1Z8XA 1TIQA 4CAEA 1Z2LA 3ZZIA 3B2YA 4UWIA 2ZOGA 1H8LA 4FD6A 5DWMA 4P45A 4B6ZA 3TOBA 2OH1A 2QECA 4UCNA 5AGEA 5JGFA 1J4JA 3VARA 4MHZA 2JBJA 1QSMA 3S9NA 4PXEA 1YW6A 5BWAB 2CIJA 2BL1A 2PJ9A 4TWEA 4MFLA 3RO0A 4XNHC 2Q4VA 4LUAA 1HDQA 1LAMA 2XEGA 4K3NA 2PSWA 4XNHB 2PJ6A 4YGOA 1BOBA 3GUXA 4B12A 2AFMA 5IX3A 5F47A 3IEHA 3FX6A 1CPSA 4KVXA 1IYKA 2A4NA 3FECA 4FBEA 4CGMA 1Q2DA 4P4FA 3PB6X 2ZELA 2ABZA 3FJUA 1ELLP 2V8HA 4AVCA 4B10A 2B4BA 2YNCC 4NGTA 5EMIA 1VHEA 5THWA 2H5MA 4KLWA 4Q36A 2VL1A 5F48A 4P10A 3KHXA 4E2AA 3F0AA 3SI2A 4RN7A 3VWEA 4MCPA 3V8IA 3H8FA 2PJ1A 3WT4A 4Q38A 2ZEGA 2ANPA 2VZZA 2JEWA 2NMTA 2EUIA 3CT9A 4L89A 4KS9A 4XPLA 5D8NA 4NF1A 2GE3A 4E8OA 3DR6A 2RB7A 4JZ0A 3W6XA 3PB8X 1XBUA 2AE6A 3TOAA 1M4GA 4R3KA 4LX9A 3SJEA 2YNDA 3TE4A 3G3SA 2PCUA 3B3WA 2ZEPA 2GFQA 4FWUA 2PRBA 2CTBA 4CYNA 4UWJA 2QYVA 4KORA 1YREA 4MFQA 1XOVA 3BI1A 3C26A 1Z4EA 1ZG9A 2PR1A 3S6GA 1TKHA 4ZX8A 4FD5A 4E0AA 2G9DA 3CXPA 4OMEA 2D4PA 4UF4A 4UFXA
chains in the Genus database with same CATH topology
1WWZA 2CY2A 3S6KA 4X5KA 4KOUA 2P6EA 1FY7A 3TFYA 4KOVA 2ZW7A 4JWPA 5F49A 3GKRA 3DDDA 2VXKA 1Y7RA 2JEVA 4UA3A 5JPHA 1BO4A 2Q44A 2B4DA 2Z0ZA 3EXNA 3LD2A 4C7HA 3G8WA 1K4JA 1XIXA 5G1ZA 4C2ZA 5AG6A 3K9UA 2ZPAA 2B5GB 3TT2A 1IB1E 4UFVA 2QIRA 4KUBA 5C88A 4AG7A 2I00A 4MFPA 1RXTA 2R1IA 4HKFA 3SXOA 4U5YA 2Q7BA 2FSRA 2PC1A 3DSBA 4NSQA 3VWDA 1U6MA 4F6AA 4AVAA 4AVBA 2B3UA 3FIXA 4FD7A 3ZJ0A 1I1DA 4ORFA 1S7LA 4JD6A 2GIVA 2YNEA 4PSXA 2OU2A 2YNCA 3F8KA 4YRHA 4QUSA 1L0CA 4H6UA 4A31A 2J8NA 3IU1A 5GCNA 2B3VA 4NEXA 1YVOA 4H6ZA 4GS4A 4Y49B 4AB7A 4CGLA 2REFA 4MI4A 2Q0YA 1B6BA 2AJ6A 1YVKA 1Z4RA 5DWNA 4ZBGA 3S6FA 1KZFA 4QBJA 1S60A 4JXRA 3W91A 1B87A 2JDCA 2VQYA 2CNTA 4CGNA 5F46A 2R7HA 4U9YA 2FE7A 3P2FA 1MJ9A 4KZTA 5G20A 4MY0A 3T9YA 3N7ZA 4I49A 4UCPA 4XPDC 1M4DA 4PK3A 4A33A 2YGWA 1VKCA 2Z3NA 3DNSA 2C27A 4PSWA 1S7KA 4KUAA 5AG7A 2B5GA 2FCKA 1PU9A 4KOSA 4XPDB 3UY5A 4KSFA 2DXQA 1S5KA 2OZUA 2PQ8A 3BJ7A 1QSNA 3EC4A 2ZXVA 2G0BA 4B14A 3D2MA 2RC4A 1MJAA 1QSRA 3QB8A 1IYLA 4OADA 2WPWA 5EBVA 5FVJA 4HNWB 4KOYA 4UFWA 5G21A 4ONUA 1IIDA 2Z3PA 2FT0A 2G3AA 3SHPA 1IICA 5H84A 5IB0A 4CAXA 3FBUA 4M3SA 2P6GA 3EY5A 2FXFA 4KOTA 3R9FA 4JXQA 3W6SA 4CS0B 4CYPA 1KUYA 2I79A 3FRMA 4NXYA 4H89A 2R98A 2ZW5A 2X7BA 2EVNA 5CNPA 4BMHA 1Y9WA 3LODA 4K30A 2OB0A 4M85A 3BLNA 2HV2A 4UCMA 2HQYA 1WK4A 4KLVA 2VZYA 3KKWA 2JDDA 2DPSA 3FB3A 3B8GA 4A2ZA 4B5PB 3JTKA 4A32A 4MY3A 4C2YA 3FXTA 4CAVA 4DNCA 1UFHA 1YGHA 4F0XA 4QC6A 2Z3LA 1S7FA 3R9GA 4CRZB 4R9MA 1ON0A 3R95A 3EO4A 5H86A 4B11A 4RS2A 1N71A 1QSTA 2O28A 1OZPA 5G22A 1I21A 2WSAA 5IV0A 4KOXA 1MJBA 3R9EA 3NE7A 1P4NA 1VHSA 3WR7A 2DPTA 2FIAA 5KTDA 5E96A 1XMTA 4R87A 2G3TA 2B58A 4FD4A 4C2XA 1PUAA 4Y49C 3TO7A 3P2HA 4KSAA 2ZW6A 3GY9A 1GHEA 4F0YA 1NE9A 1M44A 1SQHA 3IU2A 4B13A 5JQ4A 3CXSA 3GYAA 3R1KA 5C82A 4HNXB 2Z3KA 4PK2A 4OAEA 4R57A 1CJWA 2Z10A 3H5ZA 4CGOA 4QB9A 2BUEA 2REEA 3E0KA 1Q2YA 5A27A 4U9ZA 2VI7A 4CYOA 4IF5A 4MJ8A 1RO5A 3BJ8A 5KTAA 3TCVA 3PZJA 1Z9UA 2GANA 4MBUA 2KCWA 5HMNA 4B5OA 5I0CA 5J8FA 3A9LA 1M1DA 2PDOA 4B5PA 5EC4A 4YFJA 3FNCA 5J8CA 2F5IA 4IUSA 4RI1A 1YLEA 4BBHA 3PP9A 2IL4A 2CNMA 1CM0A 4AG9A 4C7IA 3PGPA 4J3GA 2VBQA 1NSLA 3FYNA 4II9A 2CNSA 1I12A 4QVTA 5AG4A 2ATRA 4CAFA 1XE4A 4CRYB 3S6HA 4ZGYB 4NCZA 1M4IA 2ZW4A 4MFKA 3TO9A 4KVME 1S3ZA 2K5TA 4UBRA 3TTHA 4OLLA 2CXAA 2Z3OA 4HNYB 5KTCA 2JLMA 2P6FA 4KVOE 4MFJA 3I9SA 2WPXA 2FS5A 3IGRA 1QSOA 4A30A 3JVNA 1V0CA 3F5BA 4MHDA 4C68A 3CXQA 1KUVA 1Y9KA 4A95A 2Y0MA 2OZHA 2QMLA 2BEIA 3JUWA 1YR0A 1YK3A 4JJXA 2Q04A 4EVYA 2VEZA 3D8PA 5AG5A 3OWCA 3T90A 2P0WA 1XF8A 4KOWA 3DR8A 2R8VA 5HH1A 4L8AA 2Z3MA 5ISVA 1KUXA 1LRZA 4CYQA 3D2PA 3IWGA 1Q2CA 4JLYA 1ZO0A 4MFZA 2OZGA 4CGPA 3IWEA 2BSWA 2Q4YA 2ARHA 1P0HA 2FL4A 1R57A 3EFAA 1YX0A 2D4OA 2HUZA 2FIWA 1S7NA 3TO6A 2WUUA 3R96A 5A28A 4PV6A 3D3SA 3QAHA 2PR8A 1XEBA 1NMTA 2Z11A 3SXNA 2J8RA 4R3LA 2J8MA 4XPKA 1MK4A 3RYOA 2B4DB 3H4QA 3I3GA 3MGDA 4CAWA 1TIQA 4CAEA 3ZZIA 4UWIA 4FD6A 5DWMA 3TOBA 2OH1A 2QECA 4UCNA 5AGEA 1J4JA 1QSMA 5BWAB 2BL1A 4MFLA 4XNHC 2Q4VA 4LUAA 2PSWA 4XNHB 4YGOA 1BOBA 4B12A 5IX3A 5F47A 4KVXA 1IYKA 2A4NA 4CGMA 1Q2DA 4AVCA 4B10A 2B4BA 2YNCC 2H5MA 4KLWA 4Q36A 5F48A 4E2AA 3F0AA 3VWEA 3V8IA 4Q38A 2VZZA 2NMTA 2EUIA 4XPLA 4L89A 4KS9A 4NF1A 2GE3A 4E8OA 3DR6A 3W6XA 2AE6A 3TOAA 1M4GA 4R3KA 4LX9A 2YNDA 3TE4A 3G3SA 2PRBA 4CYNA 4UWJA 4KORA 1YREA 4MFQA 3C26A 1Z4EA 2PR1A 3S6GA 4FD5A 4E0AA 3CXPA 2D4PA 4UFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWZ A;  2CY2 A;  3S6K A;  4X5K A;  4KOU A;  2P6E A;  1FY7 A;  3TFY A;  4KOV A;  2ZW7 A;  4JWP A;  5F49 A;  3GKR A;  3DDD A;  2VXK A;  1Y7R A;  2JEV A;  4UA3 A;  5JPH A;  1BO4 A;  2Q44 A;  2B4D A;  2Z0Z A;  3EXN A;  3LD2 A;  3G8W A;  1K4J A;  1XIX A;  2ZPA A;  3K9U A;  2B5G B;  3TT2 A;  1IB1 E;  2QIR A;  4KUB A;  5C88 A;  4AG7 A;  2I00 A;  1RXT A;  2R1I A;  4HKF A;  3SXO A;  4U5Y A;  2Q7B A;  2FSR A;  2PC1 A;  3DSB A;  4NSQ A;  3VWD A;  1U6M A;  4F6A A;  4AVA A;  4AVB A;  2B3U A;  3FIX A;  4FD7 A;  3ZJ0 A;  1I1D A;  4ORF A;  1S7L A;  4JD6 A;  2GIV A;  4PSX A;  2OU2 A;  3F8K A;  4YRH A;  4QUS A;  1L0C A;  4H6U A;  2J8N A;  5GCN A;  2B3V A;  4NEX A;  1YVO A;  4H6Z A;  4GS4 A;  4Y49 B;  4AB7 A;  2REF A;  4MI4 A;  2Q0Y A;  1B6B A;  2AJ6 A;  1YVK A;  1Z4R A;  5DWN A;  4ZBG A;  3S6F A;  1KZF A;  4QBJ A;  1S60 A;  4JXR A;  3W91 A;  1B87 A;  2JDC A;  2VQY A;  2CNT A;  5F46 A;  2R7H A;  4U9Y A;  2FE7 A;  3P2F A;  1MJ9 A;  4KZT A;  4MY0 A;  3T9Y A;  3N7Z A;  4I49 A;  4XPD C;  1M4D A;  4PK3 A;  1VKC A;  3DNS A;  2C27 A;  4PSW A;  1S7K A;  4KUA A;  2B5G A;  2FCK A;  1PU9 A;  4KOS A;  4XPD B;  3UY5 A;  2DXQ A;  1S5K A;  2OZU A;  2PQ8 A;  3BJ7 A;  1QSN A;  3EC4 A;  2ZXV A;  2G0B A;  3D2M A;  2RC4 A;  1MJA A;  1QSR A;  3QB8 A;  1IYL A;  4OAD A;  2WPW A;  5EBV A;  5FVJ A;  4HNW B;  4KOY A;  4ONU A;  1IID A;  2FT0 A;  2G3A A;  3SHP A;  1IIC A;  5H84 A;  5IB0 A;  4CAX A;  3FBU A;  4M3S A;  2P6G A;  3EY5 A;  2FXF A;  4KOT A;  3R9F A;  4JXQ A;  3W6S A;  4CS0 B;  1KUY A;  2I79 A;  3FRM A;  4NXY A;  4H89 A;  2R98 A;  2ZW5 A;  2X7B A;  2EVN A;  5CNP A;  4BMH A;  1Y9W A;  3LOD A;  4K30 A;  2OB0 A;  4M85 A;  3BLN A;  2HV2 A;  2HQY A;  1WK4 A;  4KLV A;  2VZY A;  3KKW A;  2JDD A;  3FB3 A;  3B8G A;  4B5P B;  4MY3 A;  3FXT A;  4CAV A;  4DNC A;  1UFH A;  1YGH A;  4QC6 A;  1S7F A;  3R9G A;  4CRZ B;  4R9M A;  1ON0 A;  3R95 A;  3EO4 A;  5H86 A;  4RS2 A;  1N71 A;  1QST A;  2O28 A;  1OZP A;  1I21 A;  5IV0 A;  4KOX A;  1MJB A;  3R9E A;  3NE7 A;  1P4N A;  1VHS A;  3WR7 A;  2FIA A;  5KTD A;  5E96 A;  1XMT A;  4R87 A;  2G3T A;  2B58 A;  4FD4 A;  1PUA A;  4Y49 C;  3TO7 A;  3P2H A;  2ZW6 A;  3GY9 A;  1GHE A;  4F0Y A;  1NE9 A;  1M44 A;  1SQH A;  5JQ4 A;  3CXS A;  3GYA A;  3R1K A;  5C82 A;  4HNX B;  4PK2 A;  4OAE A;  4R57 A;  1CJW A;  2Z10 A;  4QB9 A;  2BUE A;  2REE A;  3E0K A;  1Q2Y A;  4U9Z A;  2VI7 A;  4IF5 A;  4MJ8 A;  1RO5 A;  3BJ8 A;  5KTA A;  3TCV A;  3PZJ A;  1Z9U A;  2GAN A;  4MBU A;  2KCW A;  5HMN A;  4B5O A;  5I0C A;  5J8F A;  1M1D A;  2PDO A;  4B5P A;  5EC4 A;  4YFJ A;  3FNC A;  5J8C A;  2F5I A;  4IUS A;  4RI1 A;  1YLE A;  3PP9 A;  2IL4 A;  2CNM A;  1CM0 A;  4AG9 A;  3PGP A;  4J3G A;  2VBQ A;  1NSL A;  3FYN A;  4II9 A;  2CNS A;  1I12 A;  4QVT A;  2ATR A;  1XE4 A;  4CRY B;  3S6H A;  4NCZ A;  1M4I A;  2ZW4 A;  3TO9 A;  4KVM E;  1S3Z A;  2K5T A;  4UBR A;  3TTH A;  4OLL A;  4HNY B;  5KTC A;  2JLM A;  2P6F A;  4KVO E;  3I9S A;  2WPX A;  2FS5 A;  3IGR A;  1QSO A;  3JVN A;  1V0C A;  3F5B A;  4MHD A;  3CXQ A;  1KUV A;  1Y9K A;  2Y0M A;  2OZH A;  2QML A;  2BEI A;  3JUW A;  1YR0 A;  1YK3 A;  4JJX A;  2Q04 A;  4EVY A;  2VEZ A;  3D8P A;  3OWC A;  3T90 A;  2P0W A;  1XF8 A;  4KOW A;  3DR8 A;  2R8V A;  5HH1 A;  4L8A A;  5ISV A;  1KUX A;  1LRZ A;  3D2P A;  3IWG A;  1Q2C A;  4JLY A;  2OZG A;  2BSW A;  2Q4Y A;  2ARH A;  1P0H A;  2FL4 A;  1R57 A;  3EFA A;  1YX0 A;  2D4O A;  2HUZ A;  2FIW A;  1S7N A;  3TO6 A;  3R96 A;  4PV6 A;  3D3S A;  3QAH A;  2PR8 A;  1XEB A;  1NMT A;  2Z11 A;  3SXN A;  2J8R A;  4R3L A;  2J8M A;  4XPK A;  1MK4 A;  3RYO A;  2B4D B;  3H4Q A;  3I3G A;  3MGD A;  4CAW A;  1TIQ A;  3ZZI A;  4UWI A;  4FD6 A;  5DWM A;  3TOB A;  2OH1 A;  2QEC A;  1J4J A;  1QSM A;  2BL1 A;  4XNH C;  2Q4V A;  4LUA A;  2PSW A;  4XNH B;  4YGO A;  1BOB A;  5IX3 A;  5F47 A;  4KVX A;  1IYK A;  2A4N A;  1Q2D A;  4AVC A;  2B4B A;  2H5M A;  4KLW A;  5F48 A;  4E2A A;  3F0A A;  3VWE A;  3V8I A;  2VZZ A;  2NMT A;  2EUI A;  4XPL A;  4L89 A;  4NF1 A;  2GE3 A;  4E8O A;  3DR6 A;  3W6X A;  2AE6 A;  3TOA A;  1M4G A;  4R3K A;  4LX9 A;  3TE4 A;  3G3S A;  2PRB A;  4UWJ A;  4KOR A;  1YRE A;  3C26 A;  1Z4E A;  2PR1 A;  3S6G A;  4FD5 A;  4E0A A;  3CXP A;  2D4P A; 
#chains in the Genus database with same CATH topology
 1WWZ A;  2CY2 A;  3S6K A;  4X5K A;  4A38 A;  4KOU A;  2PVV A;  2P6E A;  2PJ7 A;  1FY7 A;  3TFY A;  4KOV A;  4UEZ A;  2ZW7 A;  4P4B A;  1Y0R A;  4JWP A;  1PYT B;  3IC1 A;  2O53 A;  1FNO A;  3KL9 A;  3GKR A;  5F49 A;  3DDD A;  2VXK A;  1X12 A;  1Y7R A;  2AFO A;  2JEV A;  4UA3 A;  5JPH A;  5K8N A;  1F57 A;  1BO4 A;  2Q44 A;  3GLJ A;  2B4D A;  3PFE A;  3WC6 A;  3PRT A;  2Z0Z A;  3EXN A;  3LD2 A;  4ZYQ A;  4C7H A;  3G8W A;  1JWQ A;  3GIU A;  4R6T A;  1K4J A;  5LYF A;  5JM6 A;  1XIX A;  5G1Z A;  4C2Z A;  4IAV A;  2ODF A;  5AG6 A;  2ZPA A;  3K9U A;  2B5G B;  3TT2 A;  2V8G A;  3D4U A;  1IB1 E;  2GLF A;  3D66 A;  2F7V A;  4UFV A;  4OKO A;  2QIR A;  4KUB A;  5C88 A;  2AFX A;  2I00 A;  3D7G A;  4AG7 A;  4MFP A;  1RXT A;  2C6C A;  2R1I A;  4HKF A;  4NGM A;  3SXO A;  4PPZ A;  2Q43 A;  2FSR A;  2OR4 A;  1QMU A;  4U5Y A;  2Q7B A;  2PC1 A;  3DSB A;  1Z5R A;  4NSQ A;  3VWD A;  1VHO A;  5J1Q A;  3CZX A;  1U6M A;  1ZLH A;  2EK9 A;  4AVA A;  4AVB A;  2B3U A;  4F6A A;  3FIX A;  5HVG A;  4FD7 A;  1TF8 A;  1XMB A;  3V38 A;  3D68 A;  3ZJ0 A;  4EVY A;  1I1D A;  4ORF A;  1S7L A;  4P4I A;  4JD6 A;  1CX8 A;  2GIV A;  2YNE A;  2HB6 A;  4PSX A;  2OU2 A;  2YNC A;  3F8K A;  3N5F A;  4F9V A;  4YRH A;  5LYI A;  2CTC A;  4QUS A;  1L0C A;  4H6U A;  4A31 A;  4YWY A;  3D7H A;  4NFR A;  2J8N A;  4GM5 A;  2PE3 A;  3PFO A;  4OC3 A;  1OBR A;  3IU1 A;  5GCN A;  1BPN A;  2B3V A;  4MRI A;  4NEX A;  1YVO A;  5LRK A;  4X2T A;  4H6Z A;  4GS4 A;  5LYD A;  2NYQ A;  2JBK A;  4Y49 B;  4AB7 A;  4EWT A;  3I1U A;  4CGL A;  1JQG A;  5CBM A;  1Z8T A;  2REF A;  4FAI A;  1TF9 A;  4MI4 A;  2Q0Y A;  1B6B A;  3WC5 A;  2AJ6 A;  4ZI6 A;  1YVK A;  4MCR A;  1Z4R A;  4R8F A;  5DWN A;  3WAB A;  4X3R A;  3B35 A;  3B3V A;  4ZBG A;  1NSA A;  4NGR A;  2ZEO A;  3S6F A;  2FVG A;  1KZF A;  4QBJ A;  1S60 A;  3IJ3 A;  1Q7L A;  2ZOF A;  4JXR A;  3SJG A;  3W91 A;  1B87 A;  2JDC A;  2V77 A;  2IQ6 A;  1YME A;  2VQY A;  2CNT A;  3LWU A;  1ARL A;  4CGN A;  5F46 A;  2R7H A;  3TC8 A;  4U9Y A;  1Y7E A;  2FE7 A;  7CPA A;  3P2F A;  4A39 A;  1MJ9 A;  4DUK A;  2CF4 A;  2Q4Z A;  4KZT A;  3H8E A;  3BXM A;  5G20 A;  4MY0 A;  1ZG7 A;  3T9Y A;  3HLP A;  3N7Z A;  3MN8 A;  4I49 A;  4UCP A;  4XPD C;  1M4D A;  3L2N A;  4PK3 A;  4A33 A;  3B7I A;  3ISX A;  2YGW A;  1VKC A;  2Z3N A;  3DNS A;  2C27 A;  4PSW A;  1CP6 A;  1S7K A;  1XFO A;  4KUA A;  4MHP A;  4OIW A;  2B5G A;  5AG7 A;  4EME A;  2FCK A;  1PU9 A;  4KOS A;  4XPD B;  3UY5 A;  5K8M A;  4G1P A;  3KHZ A;  4KSF A;  1LFW A;  2DXQ A;  1S5K A;  2OZU A;  2PQ8 A;  1M4L A;  2ZED A;  3V7Z A;  1IOF A;  3VH9 A;  4IHM A;  3BJ7 A;  1QSN A;  2PRQ A;  3EC4 A;  4OC1 A;  2ZXV A;  5I4M A;  2G0B A;  4B14 A;  3D2M A;  2RC4 A;  1MJA A;  1QSR A;  1Z8W A;  3QB8 A;  1IYL A;  1A2Z A;  2NSM A;  2WPW A;  4OAD A;  5EBV A;  5FVJ A;  1UWY A;  4HNW B;  2AFU A;  4KOY A;  4UFW A;  3B3S A;  2PJC A;  5D29 A;  5G21 A;  3KI9 A;  5K8O A;  4ONU A;  1ARM A;  1IID A;  2Z3P A;  2FT0 A;  1LAP A;  2G3A A;  4M6I A;  1IIC A;  3SHP A;  5H84 A;  4DJL A;  5IB0 A;  4CAX A;  3KQX A;  3FBU A;  4M3S A;  2P6G A;  3D7F A;  2FXF A;  3EY5 A;  4KOT A;  3CDX A;  1BAV A;  4JXQ A;  2PJ4 A;  3R9F A;  3W6S A;  4CS0 B;  2PVW A;  1KUY A;  2I79 A;  2EWB A;  3FRM A;  3NH5 A;  4CYP A;  2PJ0 A;  4NXY A;  3QAY A;  4H89 A;  2R98 A;  4HPS A;  3PBB A;  2ZW5 A;  4P4J A;  1BPM A;  2X7B A;  4UIA A;  1YLO A;  2EVN A;  2IMO A;  4GXH A;  5CNP A;  4M6H A;  3IFE A;  4BMH A;  1Y9W A;  4MHY A;  3LOD A;  4K30 A;  2OB0 A;  2ZEN A;  4MMO A;  3TX8 A;  5K8P A;  4M85 A;  2BOA A;  2I3C A;  3BLN A;  2HV2 A;  4UCM A;  2HQY A;  1WK4 A;  3CPX A;  2VZY A;  2AFW A;  3FF3 A;  3KKW A;  4KLV A;  2JDD A;  1ZG8 A;  2DPS A;  4NGP A;  1IGB A;  3FB3 A;  3B8G A;  1F2O A;  3BI0 A;  4O23 A;  2OOT A;  4A2Z A;  4A94 A;  1CG2 A;  4B5P B;  1PCA A;  3JTK A;  4MY3 A;  4UEE A;  4A32 A;  4C2Y A;  3FXT A;  4PQA A;  4CAV A;  1LOK A;  1UFH A;  4DNC A;  1YGH A;  5CPA A;  4W9Y A;  4F0X A;  4QC6 A;  2PJ3 A;  2Z3L A;  1S7F A;  3R9G A;  4CRZ B;  2ZEM A;  3NE8 A;  4R9M A;  1ON0 A;  3R95 A;  1CP7 A;  2PJ2 A;  3EO4 A;  1IY7 A;  4FUU A;  1XRY A;  4OC0 A;  5H86 A;  3IIB A;  3S9M A;  4RS2 A;  4B11 A;  4CPA A;  1N71 A;  1QST A;  4A37 A;  2O28 A;  1OZP A;  5G22 A;  2WZN A;  4KSI A;  4UEF A;  5JH9 A;  1ZLI A;  1I21 A;  2WSA A;  3LAC A;  2PIY A;  4KOX A;  5IV0 A;  1MJB A;  3R9E A;  3NE7 A;  1P4N A;  3JRU A;  4R7M A;  1VHS A;  5HVF A;  3WR7 A;  2DPT A;  2FIA A;  4TNU A;  3PB7 X;  5KTD A;  5E96 A;  1XMT A;  4R87 A;  1R3N A;  2B58 A;  2G3T A;  5F09 A;  4FD4 A;  4C2X A;  1VGY A;  1PUA A;  4Y49 C;  3TO7 A;  4RUH A;  3P2H A;  4KSA A;  2ZW6 A;  4MCS A;  5LYL A;  4MXU A;  3GY9 A;  1GHE A;  5LRJ A;  4P6Y A;  1IOI A;  1NE9 A;  1M44 A;  4P4D A;  4F0Y A;  1SQH A;  3IU2 A;  2RFH A;  4B13 A;  1X10 A;  5JQ4 A;  3CXS A;  3RBU A;  3GYA A;  3R1K A;  5C82 A;  3KGQ A;  1QQ9 A;  3DLJ A;  4OID A;  4IK2 A;  3FMC A;  4HNX B;  1LCP A;  2Z3K A;  4PK2 A;  1XJO A;  4OAE A;  4R57 A;  1HEE A;  4X8I A;  1CJW A;  2Z10 A;  3PBE A;  2C1C A;  3H5Z A;  4CGO A;  3LMS A;  1YW4 A;  3RNZ A;  4QB9 A;  2BUE A;  4P44 A;  2REE A;  2Q7S A;  3E0K A;  1Q2Y A;  2PJ8 A;  5A27 A;  5ELY A;  2XEJ A;  3S9L A;  4U9Z A;  1RTQ A;  2VI7 A;  4CYO A;  3DGV A;  1CPX A;  6CPA A;  3D67 A;  4IF5 A;  1LAN A;  1DE4 C;  4MJ8 A;  1RO5 A;  3BJ8 A;  5IB9 A;  5KTA A;  3TCV A;  3PZJ A;  2WYR A;  1Z9U A;  2GAN A;  4MBU A;  2KCW A;  2O4H A;  5HMN A;  2PIZ A;  4Q7A A;  4NGN A;  4B5O A;  1DTD A;  2ZEE A;  3KZW A;  5I0C A;  5J8F A;  3A9L A;  4NGQ A;  2GLJ A;  4YU9 A;  1M1D A;  2PDO A;  4B5P A;  4F8Z A;  5EC4 A;  4YFJ A;  3FNC A;  5J8C A;  2F5I A;  4NJR A;  4LQG A;  4Z65 A;  4IUS A;  2V8D A;  4RI1 A;  2AFS A;  1HDU A;  1ELM P;  1YLE A;  2HC9 A;  3SJF A;  4BBH A;  3PP9 A;  5HVH A;  2IL4 A;  3WC7 A;  4ZY0 A;  2CNM A;  1CM0 A;  3KR5 A;  2IJZ A;  2EBJ A;  4H2K A;  4OC5 A;  4ZY1 A;  4AG9 A;  4C7I A;  3PGP A;  4J3G A;  4NJQ A;  2VBQ A;  4LQ6 A;  1IU8 A;  2XEI A;  1NSL A;  3FYN A;  4II9 A;  2CNS A;  1I12 A;  2QJ8 A;  4QVT A;  5AG4 A;  2ATR A;  4CAF A;  2F8H A;  3NH4 A;  1XE4 A;  3D7D A;  4CRY B;  3GB0 A;  1TKJ A;  3S6H A;  1F2P A;  4BIN A;  2XEF A;  1TXR A;  2PJ5 A;  4NCZ A;  4ZGY B;  1M4I A;  2ZW4 A;  3HUV A;  3ISZ A;  4KVM E;  1S3Z A;  2K5T A;  4MFK A;  3TO9 A;  4UBR A;  3TTH A;  4EFD A;  4OLL A;  2V8V A;  1AYE A;  3NH8 A;  1YQE A;  2CXA A;  2Z3O A;  2GRE A;  4HNY B;  3KAS A;  5KTC A;  2JLM A;  4WWV A;  3B3C A;  2P6F A;  3KQZ A;  2QVP A;  2BCO A;  2POK A;  1YSJ A;  3B3T A;  4KVO E;  4MFJ A;  5LRG A;  3T8W A;  3I9S A;  3SI1 A;  2WPX A;  2FS5 A;  2AFZ A;  1CBX A;  1QSO A;  1Y0Y A;  2J9A A;  3IGR A;  4A30 A;  3JVN A;  4OC2 A;  1V0C A;  3CPA A;  3F5B A;  3FEE A;  4AXV A;  4MHD A;  4C68 A;  3KR4 A;  2DF5 A;  1GYT A;  3CXQ A;  3SJX A;  1KUV A;  1Y9K A;  3FH4 A;  4OP4 A;  4A95 A;  2Y0M A;  4M6G A;  2OZH A;  2QML A;  3FVL A;  2BEI A;  3JUW A;  1YR0 A;  1YK3 A;  4JJX A;  1KWM A;  2Q04 A;  2EK8 A;  3PEI A;  3IO1 A;  4ZX9 A;  2BO9 A;  2VEZ A;  3D8P A;  1FT7 A;  3OWC A;  1TKF A;  5AG5 A;  3T90 A;  4MHN A;  4BD9 A;  2P0W A;  2ZEF A;  1XF8 A;  1Z8L A;  3FED A;  4KOW A;  3PB4 X;  3DR8 A;  1BLL E;  8CPA A;  2R8V A;  3PB9 X;  5HH1 A;  4L8A A;  2Z3M A;  3NA6 A;  1KUX A;  4ONW A;  5ISV A;  3RZA A;  1LRZ A;  3K2K A;  2Q51 A;  4CYQ A;  3H8G A;  2PJA A;  3D2P A;  3IWG A;  1Q2C A;  4JLY A;  3MRU A;  1ZO0 A;  4MFZ A;  2C6G A;  4MCQ A;  4R76 A;  2OZG A;  1AUG A;  4CGP A;  4P4E A;  3IWE A;  3K9T A;  2BSW A;  2Q4Y A;  4OC4 A;  2ARH A;  1VIX A;  1P0H A;  2EO8 A;  4PXD A;  4PXB A;  2FL4 A;  1R57 A;  3EFA A;  3BHX A;  1YX0 A;  3SI0 A;  2D4O A;  3VAT A;  2HUZ A;  2FIW A;  4WJB A;  1S7N A;  3TO6 A;  4F9U A;  2WUU A;  1R43 A;  3R96 A;  4JYW A;  3RAM A;  4ZY2 A;  2C6P A;  5A28 A;  4PXC A;  2ZEH A;  2GU2 A;  4PV6 A;  3QNV A;  3D3S A;  3NFZ A;  1AMP A;  4UIB A;  4DYO A;  3QAH A;  4NGS A;  2PR8 A;  1XEB A;  1NMT A;  2Z11 A;  3SXN A;  5DS0 A;  2J8R A;  3IWW A;  4R3L A;  2PJB A;  2DEA A;  2J8M A;  4XPK A;  1EE3 P;  1MK4 A;  3RYO A;  2B4D B;  3H4Q A;  3I3G A;  3MGD A;  5HXD A;  4CAW A;  1Z8X A;  1TIQ A;  4CAE A;  1Z2L A;  3ZZI A;  3B2Y A;  4UWI A;  2ZOG A;  1H8L A;  4FD6 A;  5DWM A;  4P45 A;  4B6Z A;  3TOB A;  2OH1 A;  2QEC A;  4UCN A;  5AGE A;  5JGF A;  1J4J A;  3VAR A;  4MHZ A;  2JBJ A;  1QSM A;  3S9N A;  4PXE A;  1YW6 A;  5BWA B;  2CIJ A;  2BL1 A;  2PJ9 A;  4TWE A;  4MFL A;  3RO0 A;  4XNH C;  2Q4V A;  4LUA A;  1HDQ A;  1LAM A;  2XEG A;  4K3N A;  2PSW A;  4XNH B;  2PJ6 A;  4YGO A;  1BOB A;  3GUX A;  4B12 A;  2AFM A;  5IX3 A;  5F47 A;  3IEH A;  3FX6 A;  1CPS A;  4KVX A;  1IYK A;  2A4N A;  3FEC A;  4FBE A;  4CGM A;  1Q2D A;  4P4F A;  3PB6 X;  2ZEL A;  2ABZ A;  3FJU A;  1ELL P;  2V8H A;  4AVC A;  4B10 A;  2B4B A;  2YNC C;  4NGT A;  5EMI A;  1VHE A;  5THW A;  2H5M A;  4KLW A;  4Q36 A;  2VL1 A;  5F48 A;  4P10 A;  3KHX A;  4E2A A;  3F0A A;  3SI2 A;  4RN7 A;  3VWE A;  4MCP A;  3V8I A;  3H8F A;  2PJ1 A;  3WT4 A;  4Q38 A;  2ZEG A;  2ANP A;  2VZZ A;  2JEW A;  2NMT A;  2EUI A;  3CT9 A;  4L89 A;  4KS9 A;  4XPL A;  5D8N A;  4NF1 A;  2GE3 A;  4E8O A;  3DR6 A;  2RB7 A;  4JZ0 A;  3W6X A;  3PB8 X;  1XBU A;  2AE6 A;  3TOA A;  1M4G A;  4R3K A;  4LX9 A;  3SJE A;  2YND A;  3TE4 A;  3G3S A;  2PCU A;  3B3W A;  2ZEP A;  2GFQ A;  4FWU A;  2PRB A;  2CTB A;  4CYN A;  4UWJ A;  2QYV A;  4KOR A;  1YRE A;  4MFQ A;  1XOV A;  3BI1 A;  3C26 A;  1Z4E A;  1ZG9 A;  2PR1 A;  3S6G A;  1TKH A;  4ZX8 A;  4FD5 A;  4E0A A;  2G9D A;  3CXP A;  4OME A;  2D4P A;  4UF4 A;  4UFX A; 
#chains in the Genus database with same CATH homology
 1WWZ A;  2CY2 A;  3S6K A;  4X5K A;  4KOU A;  2P6E A;  1FY7 A;  3TFY A;  4KOV A;  2ZW7 A;  4JWP A;  5F49 A;  3GKR A;  3DDD A;  2VXK A;  1Y7R A;  2JEV A;  4UA3 A;  5JPH A;  1BO4 A;  2Q44 A;  2B4D A;  2Z0Z A;  3EXN A;  3LD2 A;  4C7H A;  3G8W A;  1K4J A;  1XIX A;  5G1Z A;  4C2Z A;  5AG6 A;  3K9U A;  2ZPA A;  2B5G B;  3TT2 A;  1IB1 E;  4UFV A;  2QIR A;  4KUB A;  5C88 A;  4AG7 A;  2I00 A;  4MFP A;  1RXT A;  2R1I A;  4HKF A;  3SXO A;  4U5Y A;  2Q7B A;  2FSR A;  2PC1 A;  3DSB A;  4NSQ A;  3VWD A;  1U6M A;  4F6A A;  4AVA A;  4AVB A;  2B3U A;  3FIX A;  4FD7 A;  3ZJ0 A;  1I1D A;  4ORF A;  1S7L A;  4JD6 A;  2GIV A;  2YNE A;  4PSX A;  2OU2 A;  2YNC A;  3F8K A;  4YRH A;  4QUS A;  1L0C A;  4H6U A;  4A31 A;  2J8N A;  3IU1 A;  5GCN A;  2B3V A;  4NEX A;  1YVO A;  4H6Z A;  4GS4 A;  4Y49 B;  4AB7 A;  4CGL A;  2REF A;  4MI4 A;  2Q0Y A;  1B6B A;  2AJ6 A;  1YVK A;  1Z4R A;  5DWN A;  4ZBG A;  3S6F A;  1KZF A;  4QBJ A;  1S60 A;  4JXR A;  3W91 A;  1B87 A;  2JDC A;  2VQY A;  2CNT A;  4CGN A;  5F46 A;  2R7H A;  4U9Y A;  2FE7 A;  3P2F A;  1MJ9 A;  4KZT A;  5G20 A;  4MY0 A;  3T9Y A;  3N7Z A;  4I49 A;  4UCP A;  4XPD C;  1M4D A;  4PK3 A;  4A33 A;  2YGW A;  1VKC A;  2Z3N A;  3DNS A;  2C27 A;  4PSW A;  1S7K A;  4KUA A;  5AG7 A;  2B5G A;  2FCK A;  1PU9 A;  4KOS A;  4XPD B;  3UY5 A;  4KSF A;  2DXQ A;  1S5K A;  2OZU A;  2PQ8 A;  3BJ7 A;  1QSN A;  3EC4 A;  2ZXV A;  2G0B A;  4B14 A;  3D2M A;  2RC4 A;  1MJA A;  1QSR A;  3QB8 A;  1IYL A;  4OAD A;  2WPW A;  5EBV A;  5FVJ A;  4HNW B;  4KOY A;  4UFW A;  5G21 A;  4ONU A;  1IID A;  2Z3P A;  2FT0 A;  2G3A A;  3SHP A;  1IIC A;  5H84 A;  5IB0 A;  4CAX A;  3FBU A;  4M3S A;  2P6G A;  3EY5 A;  2FXF A;  4KOT A;  3R9F A;  4JXQ A;  3W6S A;  4CS0 B;  4CYP A;  1KUY A;  2I79 A;  3FRM A;  4NXY A;  4H89 A;  2R98 A;  2ZW5 A;  2X7B A;  2EVN A;  5CNP A;  4BMH A;  1Y9W A;  3LOD A;  4K30 A;  2OB0 A;  4M85 A;  3BLN A;  2HV2 A;  4UCM A;  2HQY A;  1WK4 A;  4KLV A;  2VZY A;  3KKW A;  2JDD A;  2DPS A;  3FB3 A;  3B8G A;  4A2Z A;  4B5P B;  3JTK A;  4A32 A;  4MY3 A;  4C2Y A;  3FXT A;  4CAV A;  4DNC A;  1UFH A;  1YGH A;  4F0X A;  4QC6 A;  2Z3L A;  1S7F A;  3R9G A;  4CRZ B;  4R9M A;  1ON0 A;  3R95 A;  3EO4 A;  5H86 A;  4B11 A;  4RS2 A;  1N71 A;  1QST A;  2O28 A;  1OZP A;  5G22 A;  1I21 A;  2WSA A;  5IV0 A;  4KOX A;  1MJB A;  3R9E A;  3NE7 A;  1P4N A;  1VHS A;  3WR7 A;  2DPT A;  2FIA A;  5KTD A;  5E96 A;  1XMT A;  4R87 A;  2G3T A;  2B58 A;  4FD4 A;  4C2X A;  1PUA A;  4Y49 C;  3TO7 A;  3P2H A;  4KSA A;  2ZW6 A;  3GY9 A;  1GHE A;  4F0Y A;  1NE9 A;  1M44 A;  1SQH A;  3IU2 A;  4B13 A;  5JQ4 A;  3CXS A;  3GYA A;  3R1K A;  5C82 A;  4HNX B;  2Z3K A;  4PK2 A;  4OAE A;  4R57 A;  1CJW A;  2Z10 A;  3H5Z A;  4CGO A;  4QB9 A;  2BUE A;  2REE A;  3E0K A;  1Q2Y A;  5A27 A;  4U9Z A;  2VI7 A;  4CYO A;  4IF5 A;  4MJ8 A;  1RO5 A;  3BJ8 A;  5KTA A;  3TCV A;  3PZJ A;  1Z9U A;  2GAN A;  4MBU A;  2KCW A;  5HMN A;  4B5O A;  5I0C A;  5J8F A;  3A9L A;  1M1D A;  2PDO A;  4B5P A;  5EC4 A;  4YFJ A;  3FNC A;  5J8C A;  2F5I A;  4IUS A;  4RI1 A;  1YLE A;  4BBH A;  3PP9 A;  2IL4 A;  2CNM A;  1CM0 A;  4AG9 A;  4C7I A;  3PGP A;  4J3G A;  2VBQ A;  1NSL A;  3FYN A;  4II9 A;  2CNS A;  1I12 A;  4QVT A;  5AG4 A;  2ATR A;  4CAF A;  1XE4 A;  4CRY B;  3S6H A;  4ZGY B;  4NCZ A;  1M4I A;  2ZW4 A;  4MFK A;  3TO9 A;  4KVM E;  1S3Z A;  2K5T A;  4UBR A;  3TTH A;  4OLL A;  2CXA A;  2Z3O A;  4HNY B;  5KTC A;  2JLM A;  2P6F A;  4KVO E;  4MFJ A;  3I9S A;  2WPX A;  2FS5 A;  3IGR A;  1QSO A;  4A30 A;  3JVN A;  1V0C A;  3F5B A;  4MHD A;  4C68 A;  3CXQ A;  1KUV A;  1Y9K A;  4A95 A;  2Y0M A;  2OZH A;  2QML A;  2BEI A;  3JUW A;  1YR0 A;  1YK3 A;  4JJX A;  2Q04 A;  4EVY A;  2VEZ A;  3D8P A;  5AG5 A;  3OWC A;  3T90 A;  2P0W A;  1XF8 A;  4KOW A;  3DR8 A;  2R8V A;  5HH1 A;  4L8A A;  2Z3M A;  5ISV A;  1KUX A;  1LRZ A;  4CYQ A;  3D2P A;  3IWG A;  1Q2C A;  4JLY A;  1ZO0 A;  4MFZ A;  2OZG A;  4CGP A;  3IWE A;  2BSW A;  2Q4Y A;  2ARH A;  1P0H A;  2FL4 A;  1R57 A;  3EFA A;  1YX0 A;  2D4O A;  2HUZ A;  2FIW A;  1S7N A;  3TO6 A;  2WUU A;  3R96 A;  5A28 A;  4PV6 A;  3D3S A;  3QAH A;  2PR8 A;  1XEB A;  1NMT A;  2Z11 A;  3SXN A;  2J8R A;  4R3L A;  2J8M A;  4XPK A;  1MK4 A;  3RYO A;  2B4D B;  3H4Q A;  3I3G A;  3MGD A;  4CAW A;  1TIQ A;  4CAE A;  3ZZI A;  4UWI A;  4FD6 A;  5DWM A;  3TOB A;  2OH1 A;  2QEC A;  4UCN A;  5AGE A;  1J4J A;  1QSM A;  5BWA B;  2BL1 A;  4MFL A;  4XNH C;  2Q4V A;  4LUA A;  2PSW A;  4XNH B;  4YGO A;  1BOB A;  4B12 A;  5IX3 A;  5F47 A;  4KVX A;  1IYK A;  2A4N A;  4CGM A;  1Q2D A;  4AVC A;  4B10 A;  2B4B A;  2YNC C;  2H5M A;  4KLW A;  4Q36 A;  5F48 A;  4E2A A;  3F0A A;  3VWE A;  3V8I A;  4Q38 A;  2VZZ A;  2NMT A;  2EUI A;  4XPL A;  4L89 A;  4KS9 A;  4NF1 A;  2GE3 A;  4E8O A;  3DR6 A;  3W6X A;  2AE6 A;  3TOA A;  1M4G A;  4R3K A;  4LX9 A;  2YND A;  3TE4 A;  3G3S A;  2PRB A;  4CYN A;  4UWJ A;  4KOR A;  1YRE A;  4MFQ A;  3C26 A;  1Z4E A;  2PR1 A;  3S6G A;  4FD5 A;  4E0A A;  3CXP A;  2D4P A;  4UFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...