4E0AA

Crystal structure of the mutant f44r bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MIIREATVQDYEEVARLHTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQRKTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNDRAKAFYHSLGMRCQKQTMELPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1408 protein
publication title Northeast Structural Genomics Consortium Target BhR182
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e0aA00
2BL1A 4KLWA 4PK3A 4JXQA 1S7LA 4B5PA 3DR6A 3TCVA 3T90A 4AVCA 2HUZA 4PSWA 4HNXB 4XPKA 4AG7A 2FS5A 1IB1E 4F0YA 2PDOA 2PR1A 3KKWA 2BSWA 4KOTA 5DWNA 1Z4EA 4RI1A 3OWCA 3D2PA 4OADA 4E8OA 5KTDA 1XMTA 4ORFA 2B3VA 5KTAA 2B3UA 1GHEA 4MY3A 4KORA 2BUEA 3BJ8A 2OU2A 4R3LA 3SXNA 3EY5A 1NMTA 1MJ9A 1Q2DA 2I00A 1YGHA 1I12A 3BLNA 2JEVA 1S60A 2VEZA 4B5PB 2R7HA 3F0AA 2JLMA 2OZUA 3I9SA 1RXTA 2QMLA 3IGRA 3EC4A 1PUAA 4CS0B 2ARHA 3TTHA 2PR8A 3K9UA 5J8CA 5IV0A 2FXFA 4L8AA 1YX0A 4ZBGA 4QUSA 4UBRA 3DDDA 3C26A 4X5KA 4XPLA 3QB8A 4IF5A 3TO7A 1ON0A 3TOBA 1NSLA 3PZJA 3B8GA 3D8PA 1XIXA 3FB3A 4LX9A 1P4NA 1YLEA 4YGOA 3TO9A 1M1DA 3R9EA 3FRMA 1Z4RA 3F8KA 5KTCA 2G3TA 4FD6A 2G0BA 4NCZA 2J8NA 1R57A 5JQ4A 2J8RA 1S3ZA 3H4QA 1VHSA 4H6UA 4KVXA 4E2AA 1IYLA 2AJ6A 2ZW4A 1Y9WA 4JJXA 2PQ8A 3W91A 4AVAA 1QSOA 2Q4YA 3GYAA 1P0HA 3G3SA 4DNCA 4KOYA 4HKFA 4UA3A 2NMTA 2KCWA 2CNSA 1NE9A 2P6GA 5I0CA 4KUBA 4KVOE 1QSRA 5F49A 3ZZIA 1S7KA 5EBVA 4FD5A 4PK2A 2OB0A 1KZFA 3EFAA 2B4BA 3DSBA 1YK3A 3TT2A 3FXTA 1BOBA 3LD2A 1M4GA 2IL4A 4B5OA 1RO5A 2D4OA 5J8FA 2J8MA 1XF8A 2AE6A 3DR8A 3SXOA 1I1DA 5IX3A 3VWEA 1KUXA 1N71A 2ZW7A 1V0CA 2VZYA 3D3SA 3PGPA 4OLLA 4HNYB 1YR0A 4IUSA 3GY9A 4LUAA 3JVNA 4UWIA 4KOWA 3S6HA 1SQHA 4ONUA 1Q2CA 1TIQA 5E96A 3R1KA 2WPWA 2ZPAA 3ZJ0A 4PV6A 4J3GA 4CAVA 4Y49B 5F47A 1OZPA 1I21A 2CY2A 1Z9UA 3QAHA 4E0AA 5IB0A 2B4DA 3NE7A 2RC4A 2R8VA 4NSQA 2FCKA 1BO4A 4NEXA 2GANA 1L0CA 2WPXA 5F46A 4KOXA 4KUAA 2Z11A 4XPDB 4K30A 1S7FA 4MHDA 4UWJA 3W6SA 1MK4A 4RS2A 4EVYA 2HQYA 4KVME 4I49A 5ISVA 4M85A 2VXKA 2FIAA 4OAEA 2Q0YA 1M4IA 3V8IA 3LODA 2GE3A 1KUVA 4NXYA 2B5GA 4XNHC 4QC6A 1S5KA 3N7ZA 2REFA 1M4DA 2DXQA 4KLVA 4JLYA 4KZTA 3E0KA 4H6ZA 1WWZA 5FVJA 2Y0MA 2B4DB 3P2FA 2FSRA 3R9FA 5JPHA 4AG9A 4QB9A 3SHPA 4AVBA 1IYKA 3S6KA 2GIVA 4KOUA 3P2HA 2G3AA 3S6GA 3BJ7A 2PC1A 1QSNA 2Z0ZA 2Q7BA 2ZW5A 1Q2YA 1XEBA 4U9YA 4BMHA 2FIWA 4NF1A 3W6XA 2P6EA 3FNCA 2R98A 4QBJA 1QSTA 4GS4A 3TOAA 1MJAA 2Q44A 2B5GB 1YREA 1B87A 3DNSA 2D4PA 4II9A 4MI4A 1IIDA 2F5IA 2REEA 3FIXA 4MJ8A 5HMNA 3PP9A 2ZXVA 2VZZA 3FBUA 3TO6A 4CRYB 5F48A 2A4NA 4PSXA 2ZW6A 4H89A 3VWDA 1J4JA 2EUIA 3RYOA 2C27A 3R96A 2R1IA 1FY7A 5C82A 2H5MA 1XE4A 2Z10A 4HNWB 2Q4VA 3TE4A 5DWMA 2VQYA 2CNMA 1UFHA 2JDDA 2X7BA 4R57A 3FYNA 2PSWA 1YVOA 3T9YA 3IWGA 2QIRA 4R87A 1Y9KA 4L89A 2K5TA 4KOSA 3R9GA 1QSMA 4XNHB 3D2MA 1Y7RA 3CXQA 5H84A 3S6FA 1YVKA 2HV2A 3I3GA 4AB7A 2JDCA 2CNTA 4YRHA 4CRZB 2OH1A 4KOVA 4CAXA 2QECA 1M44A 1CM0A 3EO4A 4QVTA 3R95A 2I79A 2VI7A 5H86A 2Q04A 4FD7A 5EC4A 3WR7A 2FL4A 2FE7A 2P0WA 5HH1A 1CJWA 1K4JA 2BEIA 4CAWA 1S7NA 4JD6A 4FD4A 3UY5A 2ATRA 5CNPA 4M3SA 1KUYA 2P6FA 1MJBA 2EVNA 4YFJA 4Y49C 4MY0A 1U6MA 2OZGA 3TFYA 4U9ZA 4F6AA 2FT0A 1LRZA 4U5YA 2B58A 1B6BA 3EXNA 4JWPA 4MBUA 2O28A 3CXPA 1PU9A 2OZHA 1VKCA 4R9MA 3JUWA 3CXSA 4JXRA 3F5BA 3MGDA 4XPDC 5C88A 2VBQA 3GKRA 1IICA 4R3KA 1WK4A 3G8WA 5GCNA 2PRBA
chains in the Genus database with same CATH superfamily
3A9LA 2BL1A 4KLWA 2XEFA 2GREA 1A2ZA 5AG5A 4PK3A 2Z3NA 4JXQA 1S7LA 1VHOA 2CF4A 5G1ZA 4B5PA 3B35A 4EFDA 1JQGA 1ZLIA 3DR6A 3TCVA 3T90A 2V77A 4AVCA 2HUZA 4PSWA 4HNXB 1XFOA 4XPKA 4AG7A 2FS5A 4CGLA 1IB1E 4F0YA 5CPAA 2PDOA 2PR1A 3PB9X 3PB7X 3KKWA 4MHYA 4P4JA 2O53A 2BSWA 4KOTA 4X3RA 5DWNA 1Z4EA 4RI1A 4CPAA 3OWCA 3D2PA 4OADA 2ZEDA 4E8OA 2Q51A 5KTDA 1XMTA 2DEAA 4M6HA 3SI0A 4ORFA 2GLJA 3MN8A 3IC1A 4MFJA 2B3VA 2PJAA 2WUUA 4RUHA 5JGFA 5KTAA 3FEDA 4O23A 2B3UA 1GHEA 4OIWA 4IHMA 4MY3A 2C6PA 1ARMA 4A33A 3SJGA 4NGRA 4KORA 3IJ3A 4CYPA 2BUEA 2PJ4A 3BJ8A 4GXHA 4ONWA 1OBRA 2OU2A 4R3LA 2JBJA 2YNCC 3EY5A 3SXNA 1NMTA 2YNEA 4ZI6A 1MJ9A 4UFXA 1Q2DA 1Y7EA 7CPAA 2I00A 3KGQA 1YGHA 1I12A 1CPSA 3B3TA 3KQXA 3BLNA 2JEVA 1S60A 4NFRA 2VEZA 1PYTB 4B5PB 2R7HA 3F0AA 2JLMA 2PIZA 4PQAA 2Q4ZA 5GCNA 2OZUA 3I9SA 2HC9A 1RXTA 1QQ9A 2QMLA 3IGRA 1LFWA 2V8HA 1Z8TA 4CGPA 4LQGA 3EC4A 1PUAA 3KASA 2PJ5A 2AFXA 5THWA 4CS0B 2ARHA 3TTHA 2PR8A 3K9UA 5J8CA 3NH5A 5IV0A 1YQEA 2FXFA 1CPXA 4L8AA 3BI1A 1YX0A 2ZEPA 3FECA 4ZBGA 4P4BA 3T8WA 4QUSA 4UBRA 4KS9A 4P44A 1Y0YA 4MMOA 3DDDA 3BHXA 4FBEA 2EO8A 3GB0A 3C26A 4X5KA 4XPLA 4MFZA 3QNVA 4A37A 3QB8A 4IF5A 2PVVA 3TO7A 2XEJA 2XEIA 1ON0A 3TOBA 1NSLA 3D4UA 1F2PA 3PZJA 3B8GA 3D8PA 1XIXA 3DGVA 3FB3A 4LX9A 1P4NA 1TKHA 2F8HA 2J9AA 1YLEA 2V8DA 2ZEFA 2GU2A 3WC5A 1ARLA 2BOAA 4YGOA 1VGYA 3B3SA 3TO9A 2YNDA 1M1DA 4W9YA 4P4DA 4Q7AA 3GIUA 4UIAA 4EMEA 3R9EA 3FMCA 3FRMA 1X10A 1Z4RA 3D7DA 4X8IA 1ELMP 5K8NA 3F8KA 3V7ZA 4Q36A 5KTCA 1BPNA 2G3TA 4TWEA 2G0BA 4FD6A 1PCAA 3TC8A 3S9MA 3D7FA 1LCPA 4NCZA 2J8NA 4DYOA 1R57A 4ZY1A 3NFZA 4GM5A 3MRUA 4PXBA 4CAEA 5JQ4A 2J8RA 1S3ZA 2ZEOA 1VHSA 2CXAA 3H4QA 3IEHA 4H6UA 4KVXA 2AFZA 1IYLA 1F57A 4PXDA 4DUKA 4E2AA 2AJ6A 2ZW4A 4C7HA 3H8FA 1Y0RA 1Y9WA 4JJXA 2PQ8A 5AG7A 3W91A 4AVAA 3KR4A 2IMOA 1QSOA 2Q4YA 3GYAA 4UF4A 1YMEA 1XRYA 1P0HA 3GUXA 4UCNA 4K3NA 3G3SA 3RBUA 3SJXA 4KOYA 4DNCA 4HKFA 1RTQA 4UA3A 2NMTA 2KCWA 2CNSA 2Q7SA 1NE9A 1TKFA 2ODFA 2P6GA 4KUBA 4R8FA 4R7MA 5I0CA 4KVOE 1QSRA 5F49A 3SJFA 3ZZIA 1S7KA 1TF9A 2ZOGA 5EBVA 4FD5A 4RN7A 2CIJA 1F2OA 5D29A 3BXMA 2OB0A 4PK2A 1FT7A 4ZY2A 5JM6A 4JZ0A 4MRIA 1KZFA 3EFAA 1Z8LA 2CTBA 2B4BA 3DSBA 1YK3A 3H5ZA 3VATA 1DE4C 4MCPA 3TT2A 3NH4A 3FXTA 1BOBA 3LD2A 1M4GA 5EMIA 2IL4A 4B5OA 1RO5A 3KHXA 2D4OA 5J8FA 2J8MA 2ZOFA 1DTDA 1XF8A 3TX8A 2Z3MA 3B3CA 2AE6A 3D7GA 3DR8A 3SXOA 4CYOA 1I1DA 5IX3A 4OIDA 4MFLA 2C6GA 3B3WA 3VWEA 3FEEA 1KUXA 4DJLA 1N71A 2ZW7A 1V0CA 1R43A 3H8EA 2VZYA 3KI9A 1IU8A 3D3SA 2PE3A 3CPXA 3PGPA 4MCSA 4UEZA 2PCUA 4OLLA 4HPSA 4HNYB 4P4EA 4UCMA 4TNUA 6CPAA 1YLOA 1YR0A 3PB8X 4IUSA 3GY9A 4MHZA 4LUAA 3JVNA 4UWIA 1AYEA 2IJZA 2EK9A 4KOWA 4P10A 1KWMA 2PJ3A 5LYLA 3PRTA 4UIBA 4MCRA 1UWYA 3WABA 4UEFA 3S6HA 1SQHA 4A95A 2ZENA 4ONUA 1LOKA 1Q2CA 1TIQA 3L2NA 5E96A 3R1KA 2WPWA 1R3NA 5AG4A 2ZPAA 2Z3PA 1HEEA 3ZJ0A 3B3VA 4PV6A 4J3GA 4F9VA 4CAVA 1VHEA 4YWYA 4Y49B 4C7IA 4P6YA 5LYFA 4WWVA 4OC4A 4B12A 4KSFA 3KL9A 1OZPA 1Z5RA 5F47A 1Q7LA 1I21A 2CY2A 1Z9UA 3QAHA 4E0AA 2AFOA 4A39A 5IB0A 3IIBA 1YW4A 4KSIA 4X2TA 5LYIA 3KZWA 2B4DA 3NE7A 4ZYQA 2RC4A 2R8VA 4NGTA 3B2YA 4YU9A 4A2ZA 4NSQA 1H8LA 2FCKA 1BO4A 4NEXA 2GANA 3FJUA 1L0CA 1ZLHA 2WPXA 5F46A 4KOXA 1IGBA 3D68A 4KUAA 4UEEA 2Z11A 1FNOA 5LYDA 3D67A 4XPDB 4K30A 1S7FA 2PJ1A 4MHDA 4MCQA 4UWJA 3W6SA 4CGMA 1MK4A 2YNCA 5CBMA 4RS2A 4EVYA 4B14A 2HQYA 3CPAA 4KVME 4I49A 5ISVA 1JWQA 4M85A 2VXKA 1LAPA 4OKOA 1Z2LA 3KR5A 4C2XA 2FIAA 4OAEA 2Q0YA 2OOTA 1YSJA 2DPSA 1M4IA 4MHPA 3V8IA 4BINA 3LODA 4OMEA 2ABZA 2FVGA 3FH4A 1TXRA 1KUVA 2GE3A 2GLFA 3FX6A 3K9TA 4NJQA 4NXYA 1NSAA 4B6ZA 1ZG7A 1BPMA 2B5GA 2EK8A 3NH8A 3FF3A 4Q38A 4C2ZA 1ZO0A 4XNHC 4QC6A 1S5KA 3N7ZA 5LRKA 2REFA 4NJRA 1M4DA 4IK2A 4UCPA 2DXQA 2QYVA 4KLVA 5HVGA 2I3CA 4C2YA 2ZEEA 4JLYA 3V38A 3PBEA 4KZTA 3S9NA 3SJEA 2HB6A 3E0KA 4H6ZA 5ELYA 1WWZA 1AUGA 1IY7A 5F09A 5FVJA 4CAFA 2Y0MA 2B4DB 3P2FA 3WC7A 2FSRA 3SI1A 1LANA 2NYQA 2OR4A 5K8MA 3R9FA 5JPHA 2C1CA 4AG9A 2PJ7A 1CP6A 4QB9A 3SHPA 4AVBA 5HXDA 1IYKA 4G1PA 3I1UA 3S6KA 2GIVA 4KOUA 3P2HA 1Z8WA 2V8GA 2G3AA 4NGNA 3KHZA 4AXVA 2PJ8A 3S6GA 2EWBA 2JBKA 4CYNA 3BJ7A 2PC1A 1QSNA 2Z0ZA 1TKJA 2Q7BA 2ZW5A 1Q2YA 1XEBA 4U9YA 4BMHA 2FIWA 4NF1A 4NGMA 3W6XA 2P6EA 2QJ8A 3ISXA 3FNCA 4P4FA 2R98A 3D66A 5JH9A 4QBJA 2JEWA 1QSTA 2PIYA 4GS4A 3TOAA 1MJAA 5G21A 4UFVA 2Q44A 2B5GB 1QMUA 2ZELA 1YREA 5IB9A 1M4LA 1AMPA 1B87A 4MXUA 4MFPA 3DNSA 2D4PA 4II9A 4MI4A 1YW6A 4NGSA 1IIDA 2F5IA 3IU2A 2REEA 3WC6A 2DF5A 3FIXA 4MJ8A 5HMNA 3PP9A 2ZXVA 2VZZA 2ZEMA 3FBUA 4NGQA 4NGPA 3TO6A 3RO0A 4CRYB 1CX8A 3HLPA 4PXCA 5F48A 2DPTA 2ZEHA 2A4NA 4CGNA 4PSXA 2RFHA 2ZW6A 3LWUA 4JYWA 1ZG9A 2AFWA 3IFEA 4H89A 3SI2A 4A32A 1XJOA 4M6IA 4IAVA 3FVLA 3VWDA 2PJCA 2WZNA 2O4HA 1J4JA 4A31A 2EUIA 3RYOA 4EWTA 2C27A 5A27A 5K8PA 3R96A 3RNZA 4LQ6A 2R1IA 1FY7A 3PB6X 5C82A 4PPZA 2H5MA 2RB7A 1XE4A 2Z10A 4HNWB 5LRGA 2Q4VA 3TE4A 3H8GA 1XMBA 5DWMA 2VQYA 4ZGYB 5I4MA 2CNMA 1BLLE 4FWUA 2GFQA 1TF8A 1CG2A 1UFHA 2JDDA 2X7BA 4F0XA 4R57A 3RAMA 3LACA 3FYNA 2PSWA 1YVOA 3T9YA 3IWGA 1ELLP 2PVWA 1HDUA 3ISZA 8CPAA 2QIRA 4C68A 2CTCA 3IWEA 4R87A 4KSAA 1Y9KA 4L89A 2K5TA 1XBUA 4KOSA 1QSMA 2AFSA 4XNHB 3R9GA 4A94A 3PFOA 5A28A 3NE8A 3D2MA 1Y7RA 2Q43A 3QAYA 4WJBA 3HUVA 2F7VA 4OC1A 3KQZA 4ZX9A 3CXQA 4P4IA 5H84A 1LAMA 3S6FA 2PJ0A 4F8ZA 1YVKA 1VIXA 3B7IA 3VH9A 2HV2A 4ZX8A 1IOIA 3I3GA 4AB7A 2JDCA 2CNTA 4P45A 4PXEA 4YRHA 4BBHA 2OH1A 4CRZB 2AFMA 4R76A 2PJ9A 3PB4X 4KOVA 4CAXA 5D8NA 2QECA 1M44A 1CM0A 3EO4A 4QVTA 5HVFA 3R95A 2I79A 2BCOA 2VL1A 4M6GA 2Z3LA 3WT4A 2VI7A 1X12A 1IOFA 5H86A 5AGEA 2Q04A 3PFEA 3CDXA 4A30A 3BI0A 4FD7A 2Z3KA 5EC4A 3WR7A 2FL4A 3S9LA 1GYTA 4Z65A 2FE7A 4OC2A 2P0WA 2BO9A 2PRQA 1CJWA 1K4JA 2BEIA 5HH1A 4F9UA 4CAWA 5BWAB 1HDQA 1S7NA 4JD6A 3VARA 3DLJA 4FD4A 3UY5A 3GLJA 2ATRA 2PJ6A 5G22A 4ZY0A 5CNPA 4UFWA 4M3SA 1EE3P 1KUYA 3PEIA 3LMSA 5HVHA 2WYRA 5G20A 2P6FA 2ANPA 2XEGA 2EBJA 3IWWA 3N5FA 3NA6A 1MJBA 3D7HA 5DS0A 2EVNA 4B10A 1CBXA 1Z8XA 4B13A 4YFJA 4Y49C 4MY0A 2YGWA 4CGOA 2PJ2A 4FUUA 1U6MA 2G9DA 3PBBA 5LRJA 4FAIA 2OZGA 2WSAA 1BAVA 5K8OA 3TFYA 4A38A 4BD9A 4U9ZA 2QVPA 4F6AA 2FT0A 1LRZA 2PJBA 4U5YA 2B58A 3JTKA 4OP4A 2IQ6A 3RZAA 2C6CA 4OC5A 1B6BA 3EXNA 3IU1A 2Z3OA 3K2KA 2O28A 3CXPA 2V8VA 4JWPA 2NSMA 1PU9A 2POKA 4MBUA 4OC3A 4CYQA 4MFQA 2OZHA 1VKCA 1CP7A 4R9MA 5J1QA 3JUWA 4OC0A 4B11A 3CXSA 2ZEGA 3IO1A 4H2KA 4MHNA 4R6TA 5AG6A 4JXRA 3F5BA 3MGDA 4XPDC 5C88A 2VBQA 3GKRA 3JRUA 3CT9A 4MFKA 2AFUA 1IICA 4R3KA 1WK4A 1XOVA 1ZG8A 3G8WA 2PRBA 3CZXA
chains in the Genus database with same CATH topology
3A9LA 2BL1A 4KLWA 5AG5A 4PK3A 2Z3NA 4JXQA 1S7LA 5G1ZA 4B5PA 3DR6A 3TCVA 3T90A 4AVCA 2HUZA 4PSWA 4HNXB 4XPKA 4AG7A 2FS5A 4CGLA 1IB1E 4F0YA 2PDOA 2PR1A 3KKWA 2BSWA 4KOTA 5DWNA 1Z4EA 4RI1A 3OWCA 3D2PA 4OADA 4E8OA 5KTDA 1XMTA 4ORFA 4MFJA 2B3VA 2WUUA 5KTAA 2B3UA 1GHEA 4MY3A 4A33A 4KORA 4CYPA 2BUEA 3BJ8A 2OU2A 4R3LA 3SXNA 2YNCC 3EY5A 1NMTA 2YNEA 1MJ9A 4UFXA 1Q2DA 2I00A 1YGHA 1I12A 3BLNA 2JEVA 1S60A 2VEZA 4B5PB 2R7HA 3F0AA 2JLMA 2OZUA 3I9SA 1RXTA 2QMLA 3IGRA 4CGPA 3EC4A 1PUAA 4CS0B 2ARHA 3TTHA 2PR8A 3K9UA 5J8CA 5IV0A 2FXFA 4L8AA 1YX0A 4ZBGA 4QUSA 4UBRA 4KS9A 3DDDA 3C26A 4X5KA 4XPLA 4MFZA 3QB8A 4IF5A 3TO7A 1ON0A 3TOBA 1NSLA 3PZJA 3B8GA 3D8PA 1XIXA 3FB3A 4LX9A 1P4NA 1YLEA 4YGOA 3TO9A 2YNDA 1M1DA 3R9EA 3FRMA 1Z4RA 3F8KA 5KTCA 4Q36A 2G3TA 4FD6A 2G0BA 4NCZA 2J8NA 1R57A 4CAEA 5JQ4A 2J8RA 1S3ZA 3H4QA 1VHSA 2CXAA 4H6UA 4KVXA 4E2AA 1IYLA 2AJ6A 2ZW4A 4C7HA 1Y9WA 4JJXA 2PQ8A 5AG7A 3W91A 4AVAA 1QSOA 2Q4YA 3GYAA 1P0HA 4UCNA 3G3SA 4DNCA 4KOYA 4HKFA 4UA3A 2NMTA 2KCWA 2CNSA 1NE9A 2P6GA 5I0CA 4KUBA 4KVOE 1QSRA 5F49A 3ZZIA 1S7KA 5EBVA 4FD5A 4PK2A 2OB0A 1KZFA 3EFAA 2B4BA 3DSBA 1YK3A 3H5ZA 3TT2A 3FXTA 1BOBA 3LD2A 1M4GA 2IL4A 4B5OA 1RO5A 2D4OA 5J8FA 2J8MA 1XF8A 2Z3MA 2AE6A 3DR8A 3SXOA 4CYOA 1I1DA 5IX3A 4MFLA 3VWEA 1KUXA 1N71A 2ZW7A 1V0CA 2VZYA 3D3SA 3PGPA 4OLLA 4HNYB 4UCMA 1YR0A 4IUSA 3GY9A 4LUAA 3JVNA 4UWIA 4KOWA 3S6HA 1SQHA 4A95A 4ONUA 1Q2CA 1TIQA 5E96A 3R1KA 2WPWA 5AG4A 2ZPAA 2Z3PA 3ZJ0A 4PV6A 4J3GA 4CAVA 4Y49B 4C7IA 4B12A 4KSFA 5F47A 1OZPA 1I21A 2CY2A 1Z9UA 3QAHA 4E0AA 5IB0A 2B4DA 3NE7A 2RC4A 2R8VA 4A2ZA 4NSQA 2FCKA 1BO4A 4NEXA 2GANA 1L0CA 2WPXA 5F46A 4KOXA 4KUAA 2Z11A 4XPDB 4K30A 1S7FA 4MHDA 4UWJA 3W6SA 4CGMA 1MK4A 2YNCA 4RS2A 4EVYA 4B14A 2HQYA 4KVME 4I49A 5ISVA 4M85A 2VXKA 4C2XA 2FIAA 4OAEA 2Q0YA 2DPSA 1M4IA 3V8IA 3LODA 2GE3A 1KUVA 4NXYA 2B5GA 4Q38A 4C2ZA 1ZO0A 4XNHC 4QC6A 1S5KA 3N7ZA 2REFA 1M4DA 4UCPA 2DXQA 4KLVA 4C2YA 4JLYA 4KZTA 3E0KA 4H6ZA 1WWZA 5FVJA 4CAFA 2Y0MA 2B4DB 3P2FA 2FSRA 3R9FA 5JPHA 4AG9A 4QB9A 3SHPA 4AVBA 1IYKA 3S6KA 2GIVA 4KOUA 3P2HA 2G3AA 3S6GA 4CYNA 3BJ7A 2PC1A 1QSNA 2Z0ZA 2Q7BA 2ZW5A 1Q2YA 1XEBA 4U9YA 4BMHA 2FIWA 4NF1A 3W6XA 2P6EA 3FNCA 2R98A 4QBJA 1QSTA 4GS4A 3TOAA 1MJAA 5G21A 4UFVA 2Q44A 2B5GB 1YREA 1B87A 4MFPA 3DNSA 2D4PA 4II9A 4MI4A 1IIDA 2F5IA 3IU2A 2REEA 3FIXA 4MJ8A 5HMNA 3PP9A 2ZXVA 2VZZA 3FBUA 3TO6A 4CRYB 5F48A 2DPTA 2A4NA 4CGNA 4PSXA 2ZW6A 4H89A 4A32A 3VWDA 1J4JA 4A31A 2EUIA 3RYOA 2C27A 5A27A 3R96A 2R1IA 1FY7A 5C82A 2H5MA 1XE4A 2Z10A 4HNWB 2Q4VA 3TE4A 5DWMA 2VQYA 4ZGYB 2CNMA 1UFHA 2JDDA 2X7BA 4F0XA 4R57A 3FYNA 2PSWA 1YVOA 3T9YA 3IWGA 2QIRA 4C68A 3IWEA 4R87A 4KSAA 1Y9KA 4L89A 2K5TA 4KOSA 3R9GA 1QSMA 4XNHB 5A28A 3D2MA 1Y7RA 3CXQA 5H84A 3S6FA 1YVKA 2HV2A 3I3GA 4AB7A 2JDCA 2CNTA 4YRHA 4BBHA 4CRZB 2OH1A 4KOVA 4CAXA 2QECA 1M44A 1CM0A 3EO4A 4QVTA 3R95A 2I79A 2Z3LA 2VI7A 5H86A 5AGEA 2Q04A 4A30A 4FD7A 2Z3KA 5EC4A 3WR7A 2FL4A 2FE7A 2P0WA 5HH1A 1CJWA 1K4JA 2BEIA 4CAWA 5BWAB 1S7NA 4JD6A 4FD4A 3UY5A 2ATRA 5G22A 5CNPA 4UFWA 4M3SA 1KUYA 5G20A 2P6FA 1MJBA 2EVNA 4B10A 4B13A 4YFJA 4Y49C 4MY0A 2YGWA 4CGOA 1U6MA 2OZGA 2WSAA 3TFYA 4U9ZA 4F6AA 2FT0A 1LRZA 4U5YA 2B58A 3JTKA 1B6BA 3EXNA 3IU1A 2Z3OA 4JWPA 2O28A 3CXPA 4MBUA 1PU9A 4CYQA 4MFQA 2OZHA 1VKCA 4R9MA 3JUWA 4B11A 3CXSA 5AG6A 4JXRA 3F5BA 3MGDA 4XPDC 5C88A 2VBQA 3GKRA 4MFKA 1IICA 4R3KA 1WK4A 3G8WA 5GCNA 2PRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL1 A;  4KLW A;  4PK3 A;  4JXQ A;  1S7L A;  4B5P A;  3DR6 A;  3TCV A;  3T90 A;  4AVC A;  2HUZ A;  4PSW A;  4HNX B;  4XPK A;  4AG7 A;  2FS5 A;  1IB1 E;  4F0Y A;  2PDO A;  2PR1 A;  3KKW A;  2BSW A;  4KOT A;  5DWN A;  1Z4E A;  4RI1 A;  3OWC A;  3D2P A;  4OAD A;  4E8O A;  5KTD A;  1XMT A;  4ORF A;  2B3V A;  5KTA A;  2B3U A;  1GHE A;  4MY3 A;  4KOR A;  2BUE A;  3BJ8 A;  2OU2 A;  4R3L A;  3SXN A;  3EY5 A;  1NMT A;  1MJ9 A;  1Q2D A;  2I00 A;  1YGH A;  1I12 A;  3BLN A;  2JEV A;  1S60 A;  2VEZ A;  4B5P B;  2R7H A;  3F0A A;  2JLM A;  2OZU A;  3I9S A;  1RXT A;  2QML A;  3IGR A;  3EC4 A;  1PUA A;  4CS0 B;  2ARH A;  3TTH A;  2PR8 A;  3K9U A;  5J8C A;  5IV0 A;  2FXF A;  4L8A A;  1YX0 A;  4ZBG A;  4QUS A;  4UBR A;  3DDD A;  3C26 A;  4X5K A;  4XPL A;  3QB8 A;  4IF5 A;  3TO7 A;  1ON0 A;  3TOB A;  1NSL A;  3PZJ A;  3B8G A;  3D8P A;  1XIX A;  3FB3 A;  4LX9 A;  1P4N A;  1YLE A;  4YGO A;  3TO9 A;  1M1D A;  3R9E A;  3FRM A;  1Z4R A;  3F8K A;  5KTC A;  2G3T A;  4FD6 A;  2G0B A;  4NCZ A;  2J8N A;  1R57 A;  5JQ4 A;  2J8R A;  1S3Z A;  3H4Q A;  1VHS A;  4H6U A;  4KVX A;  4E2A A;  1IYL A;  2AJ6 A;  2ZW4 A;  1Y9W A;  4JJX A;  2PQ8 A;  3W91 A;  4AVA A;  1QSO A;  2Q4Y A;  3GYA A;  1P0H A;  3G3S A;  4DNC A;  4KOY A;  4HKF A;  4UA3 A;  2NMT A;  2KCW A;  2CNS A;  1NE9 A;  2P6G A;  5I0C A;  4KUB A;  4KVO E;  1QSR A;  5F49 A;  3ZZI A;  1S7K A;  5EBV A;  4FD5 A;  4PK2 A;  2OB0 A;  1KZF A;  3EFA A;  2B4B A;  3DSB A;  1YK3 A;  3TT2 A;  3FXT A;  1BOB A;  3LD2 A;  1M4G A;  2IL4 A;  4B5O A;  1RO5 A;  2D4O A;  5J8F A;  2J8M A;  1XF8 A;  2AE6 A;  3DR8 A;  3SXO A;  1I1D A;  5IX3 A;  3VWE A;  1KUX A;  1N71 A;  2ZW7 A;  1V0C A;  2VZY A;  3D3S A;  3PGP A;  4OLL A;  4HNY B;  1YR0 A;  4IUS A;  3GY9 A;  4LUA A;  3JVN A;  4UWI A;  4KOW A;  3S6H A;  1SQH A;  4ONU A;  1Q2C A;  1TIQ A;  5E96 A;  3R1K A;  2WPW A;  2ZPA A;  3ZJ0 A;  4PV6 A;  4J3G A;  4CAV A;  4Y49 B;  5F47 A;  1OZP A;  1I21 A;  2CY2 A;  1Z9U A;  3QAH A;  4E0A A;  5IB0 A;  2B4D A;  3NE7 A;  2RC4 A;  2R8V A;  4NSQ A;  2FCK A;  1BO4 A;  4NEX A;  2GAN A;  1L0C A;  2WPX A;  5F46 A;  4KOX A;  4KUA A;  2Z11 A;  4XPD B;  4K30 A;  1S7F A;  4MHD A;  4UWJ A;  3W6S A;  1MK4 A;  4RS2 A;  4EVY A;  2HQY A;  4KVM E;  4I49 A;  5ISV A;  4M85 A;  2VXK A;  2FIA A;  4OAE A;  2Q0Y A;  1M4I A;  3V8I A;  3LOD A;  2GE3 A;  1KUV A;  4NXY A;  2B5G A;  4XNH C;  4QC6 A;  1S5K A;  3N7Z A;  2REF A;  1M4D A;  2DXQ A;  4KLV A;  4JLY A;  4KZT A;  3E0K A;  4H6Z A;  1WWZ A;  5FVJ A;  2Y0M A;  2B4D B;  3P2F A;  2FSR A;  3R9F A;  5JPH A;  4AG9 A;  4QB9 A;  3SHP A;  4AVB A;  1IYK A;  3S6K A;  2GIV A;  4KOU A;  3P2H A;  2G3A A;  3S6G A;  3BJ7 A;  2PC1 A;  1QSN A;  2Z0Z A;  2Q7B A;  2ZW5 A;  1Q2Y A;  1XEB A;  4U9Y A;  4BMH A;  2FIW A;  4NF1 A;  3W6X A;  2P6E A;  3FNC A;  2R98 A;  4QBJ A;  1QST A;  4GS4 A;  3TOA A;  1MJA A;  2Q44 A;  2B5G B;  1YRE A;  1B87 A;  3DNS A;  2D4P A;  4II9 A;  4MI4 A;  1IID A;  2F5I A;  2REE A;  3FIX A;  4MJ8 A;  5HMN A;  3PP9 A;  2ZXV A;  2VZZ A;  3FBU A;  3TO6 A;  4CRY B;  5F48 A;  2A4N A;  4PSX A;  2ZW6 A;  4H89 A;  3VWD A;  1J4J A;  2EUI A;  3RYO A;  2C27 A;  3R96 A;  2R1I A;  1FY7 A;  5C82 A;  2H5M A;  1XE4 A;  2Z10 A;  4HNW B;  2Q4V A;  3TE4 A;  5DWM A;  2VQY A;  2CNM A;  1UFH A;  2JDD A;  2X7B A;  4R57 A;  3FYN A;  2PSW A;  1YVO A;  3T9Y A;  3IWG A;  2QIR A;  4R87 A;  1Y9K A;  4L89 A;  2K5T A;  4KOS A;  3R9G A;  1QSM A;  4XNH B;  3D2M A;  1Y7R A;  3CXQ A;  5H84 A;  3S6F A;  1YVK A;  2HV2 A;  3I3G A;  4AB7 A;  2JDC A;  2CNT A;  4YRH A;  4CRZ B;  2OH1 A;  4KOV A;  4CAX A;  2QEC A;  1M44 A;  1CM0 A;  3EO4 A;  4QVT A;  3R95 A;  2I79 A;  2VI7 A;  5H86 A;  2Q04 A;  4FD7 A;  5EC4 A;  3WR7 A;  2FL4 A;  2FE7 A;  2P0W A;  5HH1 A;  1CJW A;  1K4J A;  2BEI A;  4CAW A;  1S7N A;  4JD6 A;  4FD4 A;  3UY5 A;  2ATR A;  5CNP A;  4M3S A;  1KUY A;  2P6F A;  1MJB A;  2EVN A;  4YFJ A;  4Y49 C;  4MY0 A;  1U6M A;  2OZG A;  3TFY A;  4U9Z A;  4F6A A;  2FT0 A;  1LRZ A;  4U5Y A;  2B58 A;  1B6B A;  3EXN A;  4JWP A;  4MBU A;  2O28 A;  3CXP A;  1PU9 A;  2OZH A;  1VKC A;  4R9M A;  3JUW A;  3CXS A;  4JXR A;  3F5B A;  3MGD A;  4XPD C;  5C88 A;  2VBQ A;  3GKR A;  1IIC A;  4R3K A;  1WK4 A;  3G8W A;  5GCN A;  2PRB A; 
#chains in the Genus database with same CATH topology
 3A9L A;  2BL1 A;  4KLW A;  2XEF A;  2GRE A;  1A2Z A;  5AG5 A;  4PK3 A;  2Z3N A;  4JXQ A;  1S7L A;  1VHO A;  2CF4 A;  5G1Z A;  4B5P A;  3B35 A;  4EFD A;  1JQG A;  1ZLI A;  3DR6 A;  3TCV A;  3T90 A;  2V77 A;  4AVC A;  2HUZ A;  4PSW A;  4HNX B;  1XFO A;  4XPK A;  4AG7 A;  2FS5 A;  4CGL A;  1IB1 E;  4F0Y A;  5CPA A;  2PDO A;  2PR1 A;  3PB9 X;  3PB7 X;  3KKW A;  4MHY A;  4P4J A;  2O53 A;  2BSW A;  4KOT A;  4X3R A;  5DWN A;  1Z4E A;  4RI1 A;  4CPA A;  3OWC A;  3D2P A;  4OAD A;  2ZED A;  4E8O A;  2Q51 A;  5KTD A;  1XMT A;  2DEA A;  4M6H A;  3SI0 A;  4ORF A;  2GLJ A;  3MN8 A;  3IC1 A;  4MFJ A;  2B3V A;  2PJA A;  2WUU A;  4RUH A;  5JGF A;  5KTA A;  3FED A;  4O23 A;  2B3U A;  1GHE A;  4OIW A;  4IHM A;  4MY3 A;  2C6P A;  1ARM A;  4A33 A;  3SJG A;  4NGR A;  4KOR A;  3IJ3 A;  4CYP A;  2BUE A;  2PJ4 A;  3BJ8 A;  4GXH A;  4ONW A;  1OBR A;  2OU2 A;  4R3L A;  2JBJ A;  2YNC C;  3EY5 A;  3SXN A;  1NMT A;  2YNE A;  4ZI6 A;  1MJ9 A;  4UFX A;  1Q2D A;  1Y7E A;  7CPA A;  2I00 A;  3KGQ A;  1YGH A;  1I12 A;  1CPS A;  3B3T A;  3KQX A;  3BLN A;  2JEV A;  1S60 A;  4NFR A;  2VEZ A;  1PYT B;  4B5P B;  2R7H A;  3F0A A;  2JLM A;  2PIZ A;  4PQA A;  2Q4Z A;  5GCN A;  2OZU A;  3I9S A;  2HC9 A;  1RXT A;  1QQ9 A;  2QML A;  3IGR A;  1LFW A;  2V8H A;  1Z8T A;  4CGP A;  4LQG A;  3EC4 A;  1PUA A;  3KAS A;  2PJ5 A;  2AFX A;  5THW A;  4CS0 B;  2ARH A;  3TTH A;  2PR8 A;  3K9U A;  5J8C A;  3NH5 A;  5IV0 A;  1YQE A;  2FXF A;  1CPX A;  4L8A A;  3BI1 A;  1YX0 A;  2ZEP A;  3FEC A;  4ZBG A;  4P4B A;  3T8W A;  4QUS A;  4UBR A;  4KS9 A;  4P44 A;  1Y0Y A;  4MMO A;  3DDD A;  3BHX A;  4FBE A;  2EO8 A;  3GB0 A;  3C26 A;  4X5K A;  4XPL A;  4MFZ A;  3QNV A;  4A37 A;  3QB8 A;  4IF5 A;  2PVV A;  3TO7 A;  2XEJ A;  2XEI A;  1ON0 A;  3TOB A;  1NSL A;  3D4U A;  1F2P A;  3PZJ A;  3B8G A;  3D8P A;  1XIX A;  3DGV A;  3FB3 A;  4LX9 A;  1P4N A;  1TKH A;  2F8H A;  2J9A A;  1YLE A;  2V8D A;  2ZEF A;  2GU2 A;  3WC5 A;  1ARL A;  2BOA A;  4YGO A;  1VGY A;  3B3S A;  3TO9 A;  2YND A;  1M1D A;  4W9Y A;  4P4D A;  4Q7A A;  3GIU A;  4UIA A;  4EME A;  3R9E A;  3FMC A;  3FRM A;  1X10 A;  1Z4R A;  3D7D A;  4X8I A;  1ELM P;  5K8N A;  3F8K A;  3V7Z A;  4Q36 A;  5KTC A;  1BPN A;  2G3T A;  4TWE A;  2G0B A;  4FD6 A;  1PCA A;  3TC8 A;  3S9M A;  3D7F A;  1LCP A;  4NCZ A;  2J8N A;  4DYO A;  1R57 A;  4ZY1 A;  3NFZ A;  4GM5 A;  3MRU A;  4PXB A;  4CAE A;  5JQ4 A;  2J8R A;  1S3Z A;  2ZEO A;  1VHS A;  2CXA A;  3H4Q A;  3IEH A;  4H6U A;  4KVX A;  2AFZ A;  1IYL A;  1F57 A;  4PXD A;  4DUK A;  4E2A A;  2AJ6 A;  2ZW4 A;  4C7H A;  3H8F A;  1Y0R A;  1Y9W A;  4JJX A;  2PQ8 A;  5AG7 A;  3W91 A;  4AVA A;  3KR4 A;  2IMO A;  1QSO A;  2Q4Y A;  3GYA A;  4UF4 A;  1YME A;  1XRY A;  1P0H A;  3GUX A;  4UCN A;  4K3N A;  3G3S A;  3RBU A;  3SJX A;  4KOY A;  4DNC A;  4HKF A;  1RTQ A;  4UA3 A;  2NMT A;  2KCW A;  2CNS A;  2Q7S A;  1NE9 A;  1TKF A;  2ODF A;  2P6G A;  4KUB A;  4R8F A;  4R7M A;  5I0C A;  4KVO E;  1QSR A;  5F49 A;  3SJF A;  3ZZI A;  1S7K A;  1TF9 A;  2ZOG A;  5EBV A;  4FD5 A;  4RN7 A;  2CIJ A;  1F2O A;  5D29 A;  3BXM A;  2OB0 A;  4PK2 A;  1FT7 A;  4ZY2 A;  5JM6 A;  4JZ0 A;  4MRI A;  1KZF A;  3EFA A;  1Z8L A;  2CTB A;  2B4B A;  3DSB A;  1YK3 A;  3H5Z A;  3VAT A;  1DE4 C;  4MCP A;  3TT2 A;  3NH4 A;  3FXT A;  1BOB A;  3LD2 A;  1M4G A;  5EMI A;  2IL4 A;  4B5O A;  1RO5 A;  3KHX A;  2D4O A;  5J8F A;  2J8M A;  2ZOF A;  1DTD A;  1XF8 A;  3TX8 A;  2Z3M A;  3B3C A;  2AE6 A;  3D7G A;  3DR8 A;  3SXO A;  4CYO A;  1I1D A;  5IX3 A;  4OID A;  4MFL A;  2C6G A;  3B3W A;  3VWE A;  3FEE A;  1KUX A;  4DJL A;  1N71 A;  2ZW7 A;  1V0C A;  1R43 A;  3H8E A;  2VZY A;  3KI9 A;  1IU8 A;  3D3S A;  2PE3 A;  3CPX A;  3PGP A;  4MCS A;  4UEZ A;  2PCU A;  4OLL A;  4HPS A;  4HNY B;  4P4E A;  4UCM A;  4TNU A;  6CPA A;  1YLO A;  1YR0 A;  3PB8 X;  4IUS A;  3GY9 A;  4MHZ A;  4LUA A;  3JVN A;  4UWI A;  1AYE A;  2IJZ A;  2EK9 A;  4KOW A;  4P10 A;  1KWM A;  2PJ3 A;  5LYL A;  3PRT A;  4UIB A;  4MCR A;  1UWY A;  3WAB A;  4UEF A;  3S6H A;  1SQH A;  4A95 A;  2ZEN A;  4ONU A;  1LOK A;  1Q2C A;  1TIQ A;  3L2N A;  5E96 A;  3R1K A;  2WPW A;  1R3N A;  5AG4 A;  2ZPA A;  2Z3P A;  1HEE A;  3ZJ0 A;  3B3V A;  4PV6 A;  4J3G A;  4F9V A;  4CAV A;  1VHE A;  4YWY A;  4Y49 B;  4C7I A;  4P6Y A;  5LYF A;  4WWV A;  4OC4 A;  4B12 A;  4KSF A;  3KL9 A;  1OZP A;  1Z5R A;  5F47 A;  1Q7L A;  1I21 A;  2CY2 A;  1Z9U A;  3QAH A;  4E0A A;  2AFO A;  4A39 A;  5IB0 A;  3IIB A;  1YW4 A;  4KSI A;  4X2T A;  5LYI A;  3KZW A;  2B4D A;  3NE7 A;  4ZYQ A;  2RC4 A;  2R8V A;  4NGT A;  3B2Y A;  4YU9 A;  4A2Z A;  4NSQ A;  1H8L A;  2FCK A;  1BO4 A;  4NEX A;  2GAN A;  3FJU A;  1L0C A;  1ZLH A;  2WPX A;  5F46 A;  4KOX A;  1IGB A;  3D68 A;  4KUA A;  4UEE A;  2Z11 A;  1FNO A;  5LYD A;  3D67 A;  4XPD B;  4K30 A;  1S7F A;  2PJ1 A;  4MHD A;  4MCQ A;  4UWJ A;  3W6S A;  4CGM A;  1MK4 A;  2YNC A;  5CBM A;  4RS2 A;  4EVY A;  4B14 A;  2HQY A;  3CPA A;  4KVM E;  4I49 A;  5ISV A;  1JWQ A;  4M85 A;  2VXK A;  1LAP A;  4OKO A;  1Z2L A;  3KR5 A;  4C2X A;  2FIA A;  4OAE A;  2Q0Y A;  2OOT A;  1YSJ A;  2DPS A;  1M4I A;  4MHP A;  3V8I A;  4BIN A;  3LOD A;  4OME A;  2ABZ A;  2FVG A;  3FH4 A;  1TXR A;  1KUV A;  2GE3 A;  2GLF A;  3FX6 A;  3K9T A;  4NJQ A;  4NXY A;  1NSA A;  4B6Z A;  1ZG7 A;  1BPM A;  2B5G A;  2EK8 A;  3NH8 A;  3FF3 A;  4Q38 A;  4C2Z A;  1ZO0 A;  4XNH C;  4QC6 A;  1S5K A;  3N7Z A;  5LRK A;  2REF A;  4NJR A;  1M4D A;  4IK2 A;  4UCP A;  2DXQ A;  2QYV A;  4KLV A;  5HVG A;  2I3C A;  4C2Y A;  2ZEE A;  4JLY A;  3V38 A;  3PBE A;  4KZT A;  3S9N A;  3SJE A;  2HB6 A;  3E0K A;  4H6Z A;  5ELY A;  1WWZ A;  1AUG A;  1IY7 A;  5F09 A;  5FVJ A;  4CAF A;  2Y0M A;  2B4D B;  3P2F A;  3WC7 A;  2FSR A;  3SI1 A;  1LAN A;  2NYQ A;  2OR4 A;  5K8M A;  3R9F A;  5JPH A;  2C1C A;  4AG9 A;  2PJ7 A;  1CP6 A;  4QB9 A;  3SHP A;  4AVB A;  5HXD A;  1IYK A;  4G1P A;  3I1U A;  3S6K A;  2GIV A;  4KOU A;  3P2H A;  1Z8W A;  2V8G A;  2G3A A;  4NGN A;  3KHZ A;  4AXV A;  2PJ8 A;  3S6G A;  2EWB A;  2JBK A;  4CYN A;  3BJ7 A;  2PC1 A;  1QSN A;  2Z0Z A;  1TKJ A;  2Q7B A;  2ZW5 A;  1Q2Y A;  1XEB A;  4U9Y A;  4BMH A;  2FIW A;  4NF1 A;  4NGM A;  3W6X A;  2P6E A;  2QJ8 A;  3ISX A;  3FNC A;  4P4F A;  2R98 A;  3D66 A;  5JH9 A;  4QBJ A;  2JEW A;  1QST A;  2PIY A;  4GS4 A;  3TOA A;  1MJA A;  5G21 A;  4UFV A;  2Q44 A;  2B5G B;  1QMU A;  2ZEL A;  1YRE A;  5IB9 A;  1M4L A;  1AMP A;  1B87 A;  4MXU A;  4MFP A;  3DNS A;  2D4P A;  4II9 A;  4MI4 A;  1YW6 A;  4NGS A;  1IID A;  2F5I A;  3IU2 A;  2REE A;  3WC6 A;  2DF5 A;  3FIX A;  4MJ8 A;  5HMN A;  3PP9 A;  2ZXV A;  2VZZ A;  2ZEM A;  3FBU A;  4NGQ A;  4NGP A;  3TO6 A;  3RO0 A;  4CRY B;  1CX8 A;  3HLP A;  4PXC A;  5F48 A;  2DPT A;  2ZEH A;  2A4N A;  4CGN A;  4PSX A;  2RFH A;  2ZW6 A;  3LWU A;  4JYW A;  1ZG9 A;  2AFW A;  3IFE A;  4H89 A;  3SI2 A;  4A32 A;  1XJO A;  4M6I A;  4IAV A;  3FVL A;  3VWD A;  2PJC A;  2WZN A;  2O4H A;  1J4J A;  4A31 A;  2EUI A;  3RYO A;  4EWT A;  2C27 A;  5A27 A;  5K8P A;  3R96 A;  3RNZ A;  4LQ6 A;  2R1I A;  1FY7 A;  3PB6 X;  5C82 A;  4PPZ A;  2H5M A;  2RB7 A;  1XE4 A;  2Z10 A;  4HNW B;  5LRG A;  2Q4V A;  3TE4 A;  3H8G A;  1XMB A;  5DWM A;  2VQY A;  4ZGY B;  5I4M A;  2CNM A;  1BLL E;  4FWU A;  2GFQ A;  1TF8 A;  1CG2 A;  1UFH A;  2JDD A;  2X7B A;  4F0X A;  4R57 A;  3RAM A;  3LAC A;  3FYN A;  2PSW A;  1YVO A;  3T9Y A;  3IWG A;  1ELL P;  2PVW A;  1HDU A;  3ISZ A;  8CPA A;  2QIR A;  4C68 A;  2CTC A;  3IWE A;  4R87 A;  4KSA A;  1Y9K A;  4L89 A;  2K5T A;  1XBU A;  4KOS A;  1QSM A;  2AFS A;  4XNH B;  3R9G A;  4A94 A;  3PFO A;  5A28 A;  3NE8 A;  3D2M A;  1Y7R A;  2Q43 A;  3QAY A;  4WJB A;  3HUV A;  2F7V A;  4OC1 A;  3KQZ A;  4ZX9 A;  3CXQ A;  4P4I A;  5H84 A;  1LAM A;  3S6F A;  2PJ0 A;  4F8Z A;  1YVK A;  1VIX A;  3B7I A;  3VH9 A;  2HV2 A;  4ZX8 A;  1IOI A;  3I3G A;  4AB7 A;  2JDC A;  2CNT A;  4P45 A;  4PXE A;  4YRH A;  4BBH A;  2OH1 A;  4CRZ B;  2AFM A;  4R76 A;  2PJ9 A;  3PB4 X;  4KOV A;  4CAX A;  5D8N A;  2QEC A;  1M44 A;  1CM0 A;  3EO4 A;  4QVT A;  5HVF A;  3R95 A;  2I79 A;  2BCO A;  2VL1 A;  4M6G A;  2Z3L A;  3WT4 A;  2VI7 A;  1X12 A;  1IOF A;  5H86 A;  5AGE A;  2Q04 A;  3PFE A;  3CDX A;  4A30 A;  3BI0 A;  4FD7 A;  2Z3K A;  5EC4 A;  3WR7 A;  2FL4 A;  3S9L A;  1GYT A;  4Z65 A;  2FE7 A;  4OC2 A;  2P0W A;  2BO9 A;  2PRQ A;  1CJW A;  1K4J A;  2BEI A;  5HH1 A;  4F9U A;  4CAW A;  5BWA B;  1HDQ A;  1S7N A;  4JD6 A;  3VAR A;  3DLJ A;  4FD4 A;  3UY5 A;  3GLJ A;  2ATR A;  2PJ6 A;  5G22 A;  4ZY0 A;  5CNP A;  4UFW A;  4M3S A;  1EE3 P;  1KUY A;  3PEI A;  3LMS A;  5HVH A;  2WYR A;  5G20 A;  2P6F A;  2ANP A;  2XEG A;  2EBJ A;  3IWW A;  3N5F A;  3NA6 A;  1MJB A;  3D7H A;  5DS0 A;  2EVN A;  4B10 A;  1CBX A;  1Z8X A;  4B13 A;  4YFJ A;  4Y49 C;  4MY0 A;  2YGW A;  4CGO A;  2PJ2 A;  4FUU A;  1U6M A;  2G9D A;  3PBB A;  5LRJ A;  4FAI A;  2OZG A;  2WSA A;  1BAV A;  5K8O A;  3TFY A;  4A38 A;  4BD9 A;  4U9Z A;  2QVP A;  4F6A A;  2FT0 A;  1LRZ A;  2PJB A;  4U5Y A;  2B58 A;  3JTK A;  4OP4 A;  2IQ6 A;  3RZA A;  2C6C A;  4OC5 A;  1B6B A;  3EXN A;  3IU1 A;  2Z3O A;  3K2K A;  2O28 A;  3CXP A;  2V8V A;  4JWP A;  2NSM A;  1PU9 A;  2POK A;  4MBU A;  4OC3 A;  4CYQ A;  4MFQ A;  2OZH A;  1VKC A;  1CP7 A;  4R9M A;  5J1Q A;  3JUW A;  4OC0 A;  4B11 A;  3CXS A;  2ZEG A;  3IO1 A;  4H2K A;  4MHN A;  4R6T A;  5AG6 A;  4JXR A;  3F5B A;  3MGD A;  4XPD C;  5C88 A;  2VBQ A;  3GKR A;  3JRU A;  3CT9 A;  4MFK A;  2AFU A;  1IIC A;  4R3K A;  1WK4 A;  1XOV A;  1ZG8 A;  3G8W A;  2PRB A;  3CZX A; 
#chains in the Genus database with same CATH homology
 3A9L A;  2BL1 A;  4KLW A;  5AG5 A;  4PK3 A;  2Z3N A;  4JXQ A;  1S7L A;  5G1Z A;  4B5P A;  3DR6 A;  3TCV A;  3T90 A;  4AVC A;  2HUZ A;  4PSW A;  4HNX B;  4XPK A;  4AG7 A;  2FS5 A;  4CGL A;  1IB1 E;  4F0Y A;  2PDO A;  2PR1 A;  3KKW A;  2BSW A;  4KOT A;  5DWN A;  1Z4E A;  4RI1 A;  3OWC A;  3D2P A;  4OAD A;  4E8O A;  5KTD A;  1XMT A;  4ORF A;  4MFJ A;  2B3V A;  2WUU A;  5KTA A;  2B3U A;  1GHE A;  4MY3 A;  4A33 A;  4KOR A;  4CYP A;  2BUE A;  3BJ8 A;  2OU2 A;  4R3L A;  3SXN A;  2YNC C;  3EY5 A;  1NMT A;  2YNE A;  1MJ9 A;  4UFX A;  1Q2D A;  2I00 A;  1YGH A;  1I12 A;  3BLN A;  2JEV A;  1S60 A;  2VEZ A;  4B5P B;  2R7H A;  3F0A A;  2JLM A;  2OZU A;  3I9S A;  1RXT A;  2QML A;  3IGR A;  4CGP A;  3EC4 A;  1PUA A;  4CS0 B;  2ARH A;  3TTH A;  2PR8 A;  3K9U A;  5J8C A;  5IV0 A;  2FXF A;  4L8A A;  1YX0 A;  4ZBG A;  4QUS A;  4UBR A;  4KS9 A;  3DDD A;  3C26 A;  4X5K A;  4XPL A;  4MFZ A;  3QB8 A;  4IF5 A;  3TO7 A;  1ON0 A;  3TOB A;  1NSL A;  3PZJ A;  3B8G A;  3D8P A;  1XIX A;  3FB3 A;  4LX9 A;  1P4N A;  1YLE A;  4YGO A;  3TO9 A;  2YND A;  1M1D A;  3R9E A;  3FRM A;  1Z4R A;  3F8K A;  5KTC A;  4Q36 A;  2G3T A;  4FD6 A;  2G0B A;  4NCZ A;  2J8N A;  1R57 A;  4CAE A;  5JQ4 A;  2J8R A;  1S3Z A;  3H4Q A;  1VHS A;  2CXA A;  4H6U A;  4KVX A;  4E2A A;  1IYL A;  2AJ6 A;  2ZW4 A;  4C7H A;  1Y9W A;  4JJX A;  2PQ8 A;  5AG7 A;  3W91 A;  4AVA A;  1QSO A;  2Q4Y A;  3GYA A;  1P0H A;  4UCN A;  3G3S A;  4DNC A;  4KOY A;  4HKF A;  4UA3 A;  2NMT A;  2KCW A;  2CNS A;  1NE9 A;  2P6G A;  5I0C A;  4KUB A;  4KVO E;  1QSR A;  5F49 A;  3ZZI A;  1S7K A;  5EBV A;  4FD5 A;  4PK2 A;  2OB0 A;  1KZF A;  3EFA A;  2B4B A;  3DSB A;  1YK3 A;  3H5Z A;  3TT2 A;  3FXT A;  1BOB A;  3LD2 A;  1M4G A;  2IL4 A;  4B5O A;  1RO5 A;  2D4O A;  5J8F A;  2J8M A;  1XF8 A;  2Z3M A;  2AE6 A;  3DR8 A;  3SXO A;  4CYO A;  1I1D A;  5IX3 A;  4MFL A;  3VWE A;  1KUX A;  1N71 A;  2ZW7 A;  1V0C A;  2VZY A;  3D3S A;  3PGP A;  4OLL A;  4HNY B;  4UCM A;  1YR0 A;  4IUS A;  3GY9 A;  4LUA A;  3JVN A;  4UWI A;  4KOW A;  3S6H A;  1SQH A;  4A95 A;  4ONU A;  1Q2C A;  1TIQ A;  5E96 A;  3R1K A;  2WPW A;  5AG4 A;  2ZPA A;  2Z3P A;  3ZJ0 A;  4PV6 A;  4J3G A;  4CAV A;  4Y49 B;  4C7I A;  4B12 A;  4KSF A;  5F47 A;  1OZP A;  1I21 A;  2CY2 A;  1Z9U A;  3QAH A;  4E0A A;  5IB0 A;  2B4D A;  3NE7 A;  2RC4 A;  2R8V A;  4A2Z A;  4NSQ A;  2FCK A;  1BO4 A;  4NEX A;  2GAN A;  1L0C A;  2WPX A;  5F46 A;  4KOX A;  4KUA A;  2Z11 A;  4XPD B;  4K30 A;  1S7F A;  4MHD A;  4UWJ A;  3W6S A;  4CGM A;  1MK4 A;  2YNC A;  4RS2 A;  4EVY A;  4B14 A;  2HQY A;  4KVM E;  4I49 A;  5ISV A;  4M85 A;  2VXK A;  4C2X A;  2FIA A;  4OAE A;  2Q0Y A;  2DPS A;  1M4I A;  3V8I A;  3LOD A;  2GE3 A;  1KUV A;  4NXY A;  2B5G A;  4Q38 A;  4C2Z A;  1ZO0 A;  4XNH C;  4QC6 A;  1S5K A;  3N7Z A;  2REF A;  1M4D A;  4UCP A;  2DXQ A;  4KLV A;  4C2Y A;  4JLY A;  4KZT A;  3E0K A;  4H6Z A;  1WWZ A;  5FVJ A;  4CAF A;  2Y0M A;  2B4D B;  3P2F A;  2FSR A;  3R9F A;  5JPH A;  4AG9 A;  4QB9 A;  3SHP A;  4AVB A;  1IYK A;  3S6K A;  2GIV A;  4KOU A;  3P2H A;  2G3A A;  3S6G A;  4CYN A;  3BJ7 A;  2PC1 A;  1QSN A;  2Z0Z A;  2Q7B A;  2ZW5 A;  1Q2Y A;  1XEB A;  4U9Y A;  4BMH A;  2FIW A;  4NF1 A;  3W6X A;  2P6E A;  3FNC A;  2R98 A;  4QBJ A;  1QST A;  4GS4 A;  3TOA A;  1MJA A;  5G21 A;  4UFV A;  2Q44 A;  2B5G B;  1YRE A;  1B87 A;  4MFP A;  3DNS A;  2D4P A;  4II9 A;  4MI4 A;  1IID A;  2F5I A;  3IU2 A;  2REE A;  3FIX A;  4MJ8 A;  5HMN A;  3PP9 A;  2ZXV A;  2VZZ A;  3FBU A;  3TO6 A;  4CRY B;  5F48 A;  2DPT A;  2A4N A;  4CGN A;  4PSX A;  2ZW6 A;  4H89 A;  4A32 A;  3VWD A;  1J4J A;  4A31 A;  2EUI A;  3RYO A;  2C27 A;  5A27 A;  3R96 A;  2R1I A;  1FY7 A;  5C82 A;  2H5M A;  1XE4 A;  2Z10 A;  4HNW B;  2Q4V A;  3TE4 A;  5DWM A;  2VQY A;  4ZGY B;  2CNM A;  1UFH A;  2JDD A;  2X7B A;  4F0X A;  4R57 A;  3FYN A;  2PSW A;  1YVO A;  3T9Y A;  3IWG A;  2QIR A;  4C68 A;  3IWE A;  4R87 A;  4KSA A;  1Y9K A;  4L89 A;  2K5T A;  4KOS A;  3R9G A;  1QSM A;  4XNH B;  5A28 A;  3D2M A;  1Y7R A;  3CXQ A;  5H84 A;  3S6F A;  1YVK A;  2HV2 A;  3I3G A;  4AB7 A;  2JDC A;  2CNT A;  4YRH A;  4BBH A;  4CRZ B;  2OH1 A;  4KOV A;  4CAX A;  2QEC A;  1M44 A;  1CM0 A;  3EO4 A;  4QVT A;  3R95 A;  2I79 A;  2Z3L A;  2VI7 A;  5H86 A;  5AGE A;  2Q04 A;  4A30 A;  4FD7 A;  2Z3K A;  5EC4 A;  3WR7 A;  2FL4 A;  2FE7 A;  2P0W A;  5HH1 A;  1CJW A;  1K4J A;  2BEI A;  4CAW A;  5BWA B;  1S7N A;  4JD6 A;  4FD4 A;  3UY5 A;  2ATR A;  5G22 A;  5CNP A;  4UFW A;  4M3S A;  1KUY A;  5G20 A;  2P6F A;  1MJB A;  2EVN A;  4B10 A;  4B13 A;  4YFJ A;  4Y49 C;  4MY0 A;  2YGW A;  4CGO A;  1U6M A;  2OZG A;  2WSA A;  3TFY A;  4U9Z A;  4F6A A;  2FT0 A;  1LRZ A;  4U5Y A;  2B58 A;  3JTK A;  1B6B A;  3EXN A;  3IU1 A;  2Z3O A;  4JWP A;  2O28 A;  3CXP A;  4MBU A;  1PU9 A;  4CYQ A;  4MFQ A;  2OZH A;  1VKC A;  4R9M A;  3JUW A;  4B11 A;  3CXS A;  5AG6 A;  4JXR A;  3F5B A;  3MGD A;  4XPD C;  5C88 A;  2VBQ A;  3GKR A;  4MFK A;  1IIC A;  4R3K A;  1WK4 A;  3G8W A;  5GCN A;  2PRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...