4CRZB

Direct visualisation of strain-induced protein prost-translational modification
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWEKCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 36
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4crzB00
4ONUA 2JEVA 1I21A 2R8VA 4KUAA 2J8RA 3PZJA 3F5BA 4KOWA 3F0AA 1QSMA 5IV0A 1IB1E 3D2PA 5EC4A 1IYKA 5IX3A 2WPWA 2OB0A 4NEXA 2HV2A 2VZYA 4GS4A 3TFYA 3TE4A 2R98A 3R96A 1V0CA 2JDDA 3TOAA 1QSNA 2D4PA 4PV6A 2HQYA 2I79A 4CAXA 3VWEA 3DNSA 4H6ZA 5KTAA 4QUSA 3DR8A 2ARHA 2VQYA 1KUVA 5CNPA 4L8AA 5F46A 2BEIA 4B5PB 4CAVA 1KZFA 1IIDA 3FRMA 1S60A 2ZW5A 3F8KA 2BL1A 4NSQA 2G3AA 1P0HA 4E0AA 4HNXB 5DWNA 4ORFA 2PR1A 3BJ7A 3EC4A 1S5KA 1UFHA 1YX0A 2B5GB 4YFJA 5C88A 2OZUA 3CXPA 1P4NA 5J8CA 1YVKA 1M4GA 4K30A 4MY0A 3FB3A 1MJAA 1MJ9A 3TO7A 1ON0A 4M85A 2Z10A 3FXTA 4F0YA 2QIRA 5F48A 2IL4A 2R7HA 4JXRA 4KOYA 1QSOA 1YR0A 3TO9A 4PSWA 3PP9A 3D8PA 3R9EA 3DDDA 3W91A 2B4DA 5EBVA 1I1DA 3CXSA 1Q2YA 3TO6A 4UWJA 2BSWA 2AJ6A 3C26A 2DXQA 4ZBGA 2X7BA 2CNMA 2FIAA 4H6UA 2AE6A 3IGRA 2EVNA 1CJWA 4KOVA 1I12A 4KZTA 3SXNA 3FYNA 2PC1A 3DR6A 2REEA 4FD6A 5F49A 3MGDA 2VBQA 2P6EA 2P6FA 5DWMA 4CAWA 1QSTA 2Q7BA 3UY5A 4R57A 4MHDA 4J3GA 2GANA 2VI7A 4KLWA 4UWIA 2JDCA 1S7NA 1Q2DA 4HNWB 3S6GA 1Z4RA 3D3SA 5JPHA 4H89A 4U9YA 2QMLA 2OH1A 3T9YA 4XNHB 3EO4A 3S6KA 4EVYA 4UBRA 4KUBA 3QB8A 3SXOA 4BMHA 2I00A 2PR8A 1MJBA 2VXKA 2ZXVA 1RXTA 4U5YA 1Y7RA 3BLNA 5GCNA 1LRZA 4R3LA 4NF1A 3R9GA 3BJ8A 1M4IA 1RO5A 2JLMA 1J4JA 2CNSA 2B3VA 2BUEA 1YGHA 3LODA 2H5MA 4HNYB 2VZZA 3P2HA 4R87A 5KTCA 3GYAA 2B4DB 3KKWA 3E0KA 3G3SA 2D4OA 3R9FA 3RYOA 1N71A 1NMTA 3FNCA 2G0BA 4KLVA 5FVJA 2F5IA 2OZGA 3W6SA 4NXYA 2Y0MA 1PUAA 4X5KA 2FE7A 2J8MA 1XE4A 4JWPA 4XPKA 2A4NA 1FY7A 3I9SA 3EXNA 3NE7A 2PQ8A 1R57A 4PK2A 3R95A 4FD7A 2FL4A 2HUZA 3G8WA 3T90A 1XEBA 3GY9A 1YK3A 2C27A 3PGPA 4E8OA 2Q4YA 3EY5A 2Z0ZA 2ZW6A 3W6XA 5IB0A 1B6BA 4KOUA 4XPDC 2ZPAA 3DSBA 1BOBA 4B5PA 1M44A 3VWDA 3V8IA 1MK4A 1YREA 2OZHA 2B4BA 2RC4A 4RS2A 4JLYA 4R9MA 3S6FA 3N7ZA 4Y49B 1KUXA 2Q4VA 2K5TA 3P2FA 2FS5A 4QC6A 4AVAA 1YVOA 1M4DA 4NCZA 2B5GA 2ZW7A 4U9ZA 4KORA 4QB9A 4LX9A 4XNHC 4QBJA 1IICA 1Z4EA 1B87A 2CY2A 2WPXA 3GKRA 3K9UA 3ZZIA 5KTDA 1S7FA 5E96A 2PRBA 2G3TA 2P0WA 3SHPA 3IWGA 4B5OA 1IYLA 4HKFA 5F47A 4OLLA 1SQHA 4AVCA 1L0CA 2VEZA 1K4JA 4YGOA 4M3SA 4MBUA 3TT2A 1NE9A 2REFA 5H84A 2Q44A 4MY3A 1Z9UA 2FIWA 4AB7A 1S3ZA 4RI1A 3B8GA 4LUAA 4KOXA 4AVBA 1PU9A 5ISVA 1XIXA 3CXQA 1GHEA 1XMTA 2J8NA 2EUIA 4CRZB 1VKCA 4OADA 2FSRA 1QSRA 1M1DA 2PSWA 4MI4A 3S6HA 5J8FA 1S7KA 2FXFA 5HMNA 4QVTA 1WK4A 2Z11A 3TCVA 3JUWA 4JD6A 3H4QA 1S7LA 4FD5A 2FCKA 4AG7A 1YLEA 2GIVA 4UA3A 2PDOA 5I0CA 2Q04A 5C82A 4PSXA 1XF8A 4OAEA 3OWCA 4II9A 2R1IA 4KOTA 1BO4A 4Y49C 3EFAA 4L89A 4AG9A 4PK3A 4XPLA 2GE3A 3WR7A 1KUYA 4IF5A 4JJXA 4F6AA 2ZW4A 2B58A 3ZJ0A 3R1KA 2Q0YA 2B3UA 4KVME 4KVXA 4YRHA 1NSLA 3LD2A 3QAHA 1Q2CA 3FIXA 2O28A 3FBUA 2P6GA 4FD4A 1OZPA 4R3KA 1VHSA 4CS0B 2ATRA 2OU2A 3JVNA 4E2AA 2KCWA 5HH1A 4JXQA 4XPDB 4KOSA 2QECA 4I49A 1Y9WA 4IUSA 4MJ8A 1U6MA 5JQ4A 1CM0A 3I3GA 3TTHA 3D2MA 1TIQA 3TOBA 2CNTA 4DNCA 2NMTA 4CRYB 1Y9KA 1WWZA 4KVOE 2FT0A 5H86A
chains in the Genus database with same CATH superfamily
4ONUA 4LQ6A 2JEVA 3S9MA 1I21A 2R8VA 4KUAA 1HEEA 2J8RA 3K9TA 4OKOA 3FX6A 3PZJA 3F5BA 4P4IA 2YNEA 4KOWA 1Q7LA 1QSMA 3F0AA 4UFXA 5IV0A 1IB1E 5G1ZA 1CBXA 5LRJA 2XEJA 3D2PA 5EC4A 1IYKA 2FVGA 2ZENA 5IX3A 1TKJA 2WPWA 3KHXA 2OB0A 4NEXA 2HV2A 2VZYA 3K2KA 4NFRA 4RN7A 4B14A 4CGMA 4GS4A 3TFYA 3TE4A 2Q7SA 2R98A 3H8FA 3R96A 4F0XA 1V0CA 2JDDA 3TOAA 1QSNA 2D4PA 4PV6A 1YMEA 2HQYA 2I79A 3VWEA 4CAXA 3DNSA 4OIDA 1IOFA 4H6ZA 3VATA 5I4MA 4CAFA 5KTAA 1Y7EA 4QUSA 2XEIA 4DYOA 3DR8A 2ARHA 4YU9A 4H2KA 2VQYA 4CGOA 1KUVA 4B5OA 4EWTA 5CNPA 2IJZA 4L8AA 5F46A 3A9LA 2BEIA 3GIUA 4MRIA 5AG7A 2ZEFA 4B5PB 4CAVA 2BOAA 4UFVA 4B11A 4P4FA 1KZFA 1IIDA 3FRMA 5LYIA 3TC8A 1S60A 3VH9A 2CIJA 2ZW5A 1ARMA 4O23A 3GUXA 3F8KA 1DE4C 2BL1A 4C7IA 2CTCA 4NSQA 2G3AA 1P0HA 3PRTA 3WABA 4E0AA 4HNXB 3N5FA 5F09A 3CPAA 5DWNA 2AFOA 4ORFA 2PR1A 3BJ7A 3EC4A 1F2OA 3NH8A 1S5KA 1CP6A 1UFHA 1YX0A 2B5GB 2PCUA 4W9YA 4YFJA 1TKFA 2OZUA 3CXPA 1P4NA 4EMEA 4Q7AA 5C88A 5J8CA 1YVKA 1M4GA 4K30A 3D68A 4MY0A 3FB3A 4C7HA 3DGVA 4BBHA 1MJAA 1MJ9A 3TO7A 1ON0A 1ZG9A 4M85A 2Z10A 3FXTA 2C6CA 2QIRA 5F48A 3B3SA 4F0YA 2IL4A 2R7HA 4JXRA 4KOYA 3D67A 5K8PA 1QSOA 3KR5A 3NFZA 1YR0A 3B2YA 3TO9A 2OR4A 5D8NA 3SI2A 4PSWA 2ZEEA 4GXHA 3PP9A 4BD9A 3D8PA 3R9EA 1ZLHA 3DDDA 3JTKA 4NJQA 3W91A 2B4DA 5JH9A 4OC0A 2V8HA 4KSAA 3NA6A 5EBVA 1I1DA 2YNDA 3CXSA 1Q2YA 1VGYA 2PJ2A 3PEIA 3RNZA 3TO6A 1X10A 4UWJA 3D7FA 4AXVA 3JRUA 5AG4A 2BSWA 1VHOA 2AJ6A 6CPAA 1PCAA 3C26A 2V8VA 2DXQA 2GLJA 4NGTA 4PXDA 4ZBGA 2X7BA 2CNMA 5AG6A 2FIAA 4LQGA 2O53A 4ZY1A 2PJ4A 2PJ6A 4R7MA 4H6UA 2AE6A 3IGRA 4MFPA 4NGMA 1CX8A 2Z3KA 3V38A 2EVNA 1CJWA 2Z3MA 3IIBA 4MCSA 4CYQA 2GFQA 4KOVA 1I12A 4KZTA 1AUGA 3B35A 4ZX9A 2QVPA 3SXNA 3MN8A 2JEWA 2HC9A 4CYNA 4OC3A 4TNUA 3FYNA 2AFZA 2PC1A 4B12A 3DR6A 1XOVA 2REEA 4FD6A 5F49A 3WC7A 1Z8LA 3MGDA 2OOTA 1RTQA 4F9UA 2VBQA 2P6EA 2P6FA 2PVVA 3FEEA 4OC2A 5LRGA 3B3TA 5DWMA 4CAWA 2XEFA 1QSTA 4Z65A 1Z5RA 3IWEA 4OC5A 2Q7BA 3UY5A 4A30A 7CPAA 4R57A 4NGNA 2POKA 4J3GA 4MFLA 4MHDA 3B7IA 2YNCA 1LANA 2GANA 2VI7A 3DLJA 4KLWA 4UWIA 2JDCA 1S7NA 1Q2DA 4HNWB 3S6GA 1Z4RA 3S9NA 3D3SA 5JPHA 1QQ9A 4H89A 2AFMA 4U9YA 3KHZA 4C2YA 2QMLA 2OH1A 3T9YA 2ZEOA 2PJ8A 4XNHB 3EO4A 3S6KA 3KQZA 4EVYA 4JZ0A 2AFSA 4UBRA 4KUBA 2RFHA 3QB8A 3SXOA 4BMHA 2I00A 2PR8A 1ZO0A 4KSFA 1MJBA 2VXKA 2XEGA 2PIZA 2ZXVA 3H8GA 3ISXA 4OC1A 5HVGA 1RXTA 4U5YA 4FBEA 1Y7RA 3PB9X 3BLNA 4ZY0A 3WC5A 4MHZA 1CP7A 5GCNA 1XBUA 1LRZA 4M6IA 4IHMA 1Y0YA 4P10A 4OMEA 3H5ZA 3FVLA 4R3LA 1Z8WA 2HB6A 1XFOA 3IWWA 4IK2A 1ELLP 4NF1A 3R9GA 4X8IA 3BJ8A 1M4IA 1RO5A 1JQGA 4MCQA 3HUVA 4ZX8A 5IB9A 2JLMA 2PJ9A 2Q43A 4UCPA 4EFDA 1J4JA 3L2NA 2EWBA 2CNSA 2B3VA 2VL1A 4P45A 4B6ZA 2BUEA 1ZG7A 1LFWA 1YGHA 1Z8TA 3LODA 2H5MA 4HNYB 2VZZA 3ISZA 4C68A 3WT4A 1X12A 2WUUA 2WYRA 2Z3PA 3P2HA 3PBEA 4C2ZA 4R87A 5KTCA 3GYAA 3NE8A 3B3CA 3NH4A 2B4DB 3KKWA 4TWEA 3E0KA 3G3SA 2D4OA 2AFUA 3BI0A 3B3VA 3R9FA 2Q4ZA 3RYOA 1N71A 1NMTA 2IQ6A 2Z3NA 3FNCA 1BPMA 3PFOA 4C2XA 4CGLA 3SI1A 3D7HA 5HVHA 2G0BA 2YNCC 4KLVA 5FVJA 2F5IA 3FEDA 1CG2A 2OZGA 2PJ5A 4NXYA 2Y0MA 3W6SA 5G22A 1PUAA 4X2TA 4X5KA 2Z3OA 2FE7A 2J8MA 2PIYA 3BXMA 1XE4A 4JWPA 4XPKA 2A4NA 1FY7A 2CTBA 3EXNA 3I9SA 3NE7A 5G21A 3GB0A 2PQ8A 5EMIA 5K8MA 2DPSA 1TKHA 4UEZA 1YLOA 1R57A 3PBBA 2AFWA 4PK2A 3R95A 2BCOA 4UCMA 2C6PA 4F9VA 2DEAA 4FD7A 8CPAA 1VHEA 1YW4A 2PJAA 2FL4A 3QNVA 3LMSA 4WJBA 5AG5A 1IY7A 2HUZA 4KSIA 3G8WA 3T90A 1Z8XA 3H8EA 1CPXA 2C1CA 4PQAA 1XEBA 3GY9A 1YK3A 2EO8A 2C27A 4NGQA 3SJXA 3PGPA 2O4HA 4E8OA 2Q4YA 4K3NA 4P4BA 4PPZA 2Z3LA 5A28A 1ZG8A 2DF5A 3EY5A 1XRYA 1BLLE 1ELMP 4R8FA 5LYDA 1FNOA 2Z0ZA 2ZW6A 5DS0A 3W6XA 4NGRA 4NGSA 3QAYA 5IB0A 1B6BA 4KOUA 2ZOGA 4XPDC 2ZPAA 3DSBA 1BOBA 4CGNA 4B5PA 1M44A 2V8GA 4PXBA 4A95A 2ABZA 3FH4A 1FT7A 3V8IA 3VWDA 3SJFA 1MK4A 3KQXA 4WWVA 1YREA 2OZHA 1IU8A 2B4BA 2RC4A 4RS2A 3D7GA 4JLYA 4R9MA 2BO9A 5A27A 3IJ3A 4GM5A 3S6FA 3N7ZA 4Y49B 1KUXA 2Q4VA 4ZGYB 2K5TA 3P2FA 2FS5A 4A33A 4QC6A 4AVAA 1YVOA 4NJRA 1M4DA 3D66A 4NCZA 4UF4A 2B5GA 2ZW7A 1BPNA 4U9ZA 2PJCA 1TXRA 4KORA 2I3CA 3B3WA 2PJ1A 4UIBA 4QB9A 4UCNA 3RAMA 4LX9A 4UFWA 5AGEA 2EK9A 4XNHC 4QBJA 1IICA 1Z4EA 3LACA 1B87A 2CY2A 2WPXA 3GKRA 3K9UA 3ZZIA 5KTDA 3PB4X 4MMOA 1S7FA 1AMPA 4A37A 2PRQA 5E96A 2PRBA 2YGWA 1Y0RA 2G3TA 2P0WA 3SHPA 2ZEDA 4MCPA 2ZEGA 3IEHA 3KI9A 3IWGA 2Q51A 3PB7X 2J9AA 2RB7A 4ONWA 2PJ7A 1GYTA 2ZELA 3SI0A 1IYLA 4HKFA 5F47A 4OLLA 1VIXA 1SQHA 4MHPA 4AVCA 1YSJA 2CF4A 2JBKA 1L0CA 2VEZA 1K4JA 1F2PA 4YGOA 4FUUA 4M3SA 3CT9A 2ANPA 4CPAA 1IOIA 2CXAA 5CBMA 3VARA 4A39A 3PB8X 4B13A 4JYWA 2GLFA 3RO0A 4MBUA 4F8ZA 4A31A 2V77A 1HDUA 3TT2A 1NE9A 4UEEA 2REFA 5H84A 1TF9A 2Q44A 4MY3A 4R76A 4OIWA 4A32A 1Z9UA 2FIWA 4AB7A 1S3ZA 4RI1A 4CYOA 2F8HA 1DTDA 3B8GA 4MHNA 4LUAA 4KOXA 4AVBA 1PU9A 5J1QA 4P4DA 3IU2A 3FF3A 1XIXA 4BINA 5ISVA 3CXQA 3FMCA 4MHYA 1GHEA 5BWAB 2JBJA 1XMTA 2J8NA 4G1PA 4DUKA 2EUIA 1NSAA 1JWQA 4MFKA 5K8OA 4CRZB 2ZEMA 1IGBA 1LOKA 1VKCA 4OADA 2FSRA 5CPAA 5JGFA 1QSRA 5LRKA 1M1DA 4ZY2A 2EBJA 2PSWA 4MI4A 4Q38A 3PB6X 4FAIA 2GREA 1ZLIA 4ZI6A 3S6HA 2V8DA 4E2AA 3KGQA 1S7KA 1R43A 2FXFA 1YQEA 4QVTA 5HMNA 5J8FA 1WK4A 2Z11A 3TCVA 4B10A 3JUWA 4M6HA 2EK8A 4JD6A 4P6YA 3S9LA 3H4QA 4PXEA 1S7LA 4MCRA 2G9DA 4OC4A 3SJGA 4M6GA 4FD5A 2FCKA 4A2ZA 3D4UA 3LWUA 4AG7A 1CPSA 1UWYA 1A2ZA 1YLEA 2GIVA 4UA3A 3NH5A 1F57A 3RBUA 2PDOA 2QYVA 2F7VA 5I0CA 2Q04A 3IU1A 3PFEA 3GLJA 5C82A 2GU2A 5ELYA 1YW6A 3HLPA 4PSXA 1XF8A 3FJUA 4OAEA 4DJLA 4MFJA 4MFQA 4Q36A 3OWCA 5HXDA 4II9A 2QJ8A 4A94A 2R1IA 4KOTA 2ZEPA 1BO4A 2PJ3A 4Y49C 3EFAA 1BAVA 2WSAA 5LYFA 4FWUA 4L89A 4AG9A 3I1UA 2WZNA 4PK3A 4P44A 4XPLA 1QMUA 2GE3A 3WR7A 3RZAA 3T8WA 4MXUA 1KUYA 2ODFA 3KL9A 3CDXA 3SJEA 5K8NA 3BHXA 4IF5A 2PE3A 1KWMA 4JJXA 3V7ZA 4F6AA 2ZW4A 3IO1A 2B58A 3ZJ0A 3R1KA 4PXCA 2Q0YA 4OP4A 2B3UA 4KVME 1HDQA 1LAPA 4KVXA 3KASA 3MRUA 3BI1A 4YRHA 4NGPA 1NSLA 3WC6A 3LD2A 3QAHA 1LAMA 1Q2CA 4P4JA 2NYQA 3KZWA 1Z2LA 1EE3P 3FIXA 2O28A 2ZOFA 1H8LA 2NSMA 1M4LA 3FBUA 2P6GA 4FD4A 1OZPA 4R3KA 1AYEA 2AFXA 2ZEHA 1VHSA 4CAEA 2PVWA 4X3RA 1LCPA 3D7DA 4CS0B 1XMBA 2ATRA 2OU2A 3JVNA 4MFZA 2KCWA 2PJ0A 5G20A 5HH1A 4JXQA 4CYPA 5JM6A 4CGPA 4XPDB 4RUHA 2PJBA 4KOSA 4IAVA 4YWYA 5D29A 3IFEA 1XJOA 2QECA 1R3NA 3CZXA 1TF8A 3IC1A 2C6GA 4I49A 3KR4A 4R6TA 1Y9WA 4P4EA 4IUSA 4MJ8A 4ZYQA 1U6MA 1OBRA 5JQ4A 1CM0A 3I3GA 3TTHA 5THWA 3D2MA 1TIQA 4A38A 5LYLA 4UIAA 3TOBA 5HVFA 3TX8A 2CNTA 1PYTB 2NMTA 1ARLA 2DPTA 4HPSA 4CRYB 4DNCA 1Y9KA 1WWZA 2IMOA 4KVOE 2FT0A 4KS9A 3FECA 4UEFA 3CPXA 5H86A
chains in the Genus database with same CATH topology
4ONUA 2JEVA 1I21A 2R8VA 4KUAA 2J8RA 3PZJA 3F5BA 2YNEA 4KOWA 3F0AA 1QSMA 4UFXA 5IV0A 1IB1E 5G1ZA 3D2PA 5EC4A 1IYKA 5IX3A 2WPWA 2OB0A 4NEXA 2HV2A 2VZYA 4B14A 4CGMA 4GS4A 3TFYA 3TE4A 2R98A 3R96A 4F0XA 1V0CA 2JDDA 3TOAA 1QSNA 2D4PA 4PV6A 2HQYA 2I79A 4CAXA 3VWEA 3DNSA 4H6ZA 4CAFA 5KTAA 4QUSA 3DR8A 2ARHA 2VQYA 4CGOA 1KUVA 5CNPA 4L8AA 5F46A 3A9LA 2BEIA 5AG7A 4B5PB 4CAVA 4UFVA 4B11A 1KZFA 1IIDA 3FRMA 1S60A 2ZW5A 3F8KA 2BL1A 4C7IA 4NSQA 2G3AA 1P0HA 4E0AA 4HNXB 5DWNA 4ORFA 2PR1A 3BJ7A 3EC4A 1S5KA 1UFHA 1YX0A 2B5GB 4YFJA 5C88A 2OZUA 3CXPA 1P4NA 5J8CA 1YVKA 1M4GA 4K30A 4MY0A 3FB3A 4C7HA 4BBHA 1MJAA 1MJ9A 3TO7A 1ON0A 4M85A 2Z10A 3FXTA 4F0YA 2QIRA 5F48A 2IL4A 2R7HA 4JXRA 4KOYA 1QSOA 1YR0A 3TO9A 4PSWA 3PP9A 3D8PA 3R9EA 3DDDA 3JTKA 3W91A 2B4DA 4KSAA 5EBVA 1I1DA 2YNDA 3CXSA 1Q2YA 3TO6A 4UWJA 5AG4A 2BSWA 2AJ6A 3C26A 2DXQA 4ZBGA 2X7BA 2CNMA 5AG6A 2FIAA 4H6UA 2AE6A 3IGRA 4MFPA 2Z3KA 2EVNA 1CJWA 2Z3MA 4CYQA 4KOVA 1I12A 4KZTA 3SXNA 4CYNA 3FYNA 2PC1A 4B12A 3DR6A 2REEA 4FD6A 5F49A 3MGDA 2VBQA 2P6EA 2P6FA 5DWMA 4CAWA 1QSTA 3IWEA 2Q7BA 3UY5A 4A30A 4R57A 4MFLA 4J3GA 4MHDA 2YNCA 2GANA 2VI7A 4KLWA 4UWIA 2JDCA 1S7NA 1Q2DA 4HNWB 3S6GA 1Z4RA 3D3SA 5JPHA 4H89A 4U9YA 4C2YA 2QMLA 2OH1A 3T9YA 4XNHB 3EO4A 3S6KA 4EVYA 4UBRA 4KUBA 3QB8A 3SXOA 4BMHA 2I00A 2PR8A 1ZO0A 4KSFA 1MJBA 2VXKA 2ZXVA 1RXTA 4U5YA 1Y7RA 3BLNA 5GCNA 1LRZA 3H5ZA 4R3LA 4NF1A 3R9GA 3BJ8A 1M4IA 1RO5A 2JLMA 4UCPA 1J4JA 2CNSA 2B3VA 2BUEA 1YGHA 3LODA 2H5MA 4HNYB 2VZZA 4C68A 2WUUA 3P2HA 4C2ZA 2Z3PA 4R87A 5KTCA 3GYAA 2B4DB 3KKWA 3E0KA 3G3SA 2D4OA 3R9FA 4C2XA 3RYOA 1N71A 1NMTA 2Z3NA 3FNCA 4CGLA 2G0BA 2YNCC 4KLVA 5FVJA 2F5IA 2OZGA 3W6SA 4NXYA 2Y0MA 5G22A 1PUAA 4X5KA 2Z3OA 2FE7A 2J8MA 1XE4A 4JWPA 4XPKA 2A4NA 1FY7A 3I9SA 3EXNA 3NE7A 5G21A 2PQ8A 2DPSA 1R57A 4PK2A 3R95A 4UCMA 4FD7A 2FL4A 5AG5A 2HUZA 3G8WA 3T90A 1XEBA 3GY9A 1YK3A 2C27A 3PGPA 4E8OA 2Q4YA 5A28A 2Z3LA 3EY5A 2Z0ZA 2ZW6A 3W6XA 5IB0A 1B6BA 4KOUA 4XPDC 2ZPAA 3DSBA 1BOBA 4CGNA 4B5PA 1M44A 4A95A 3VWDA 3V8IA 1MK4A 1YREA 2OZHA 2B4BA 2RC4A 4RS2A 4JLYA 4R9MA 5A27A 3S6FA 3N7ZA 4Y49B 1KUXA 2Q4VA 4ZGYB 2K5TA 3P2FA 2FS5A 4A33A 4QC6A 4AVAA 1YVOA 1M4DA 4NCZA 2B5GA 2ZW7A 4U9ZA 4KORA 4QB9A 4UCNA 4LX9A 4UFWA 5AGEA 4XNHC 4QBJA 1IICA 1Z4EA 1B87A 2CY2A 2WPXA 3GKRA 3K9UA 3ZZIA 5KTDA 1S7FA 5E96A 2PRBA 2YGWA 2G3TA 2P0WA 3SHPA 3IWGA 4B5OA 1IYLA 4HKFA 5F47A 4OLLA 1SQHA 4AVCA 1L0CA 2VEZA 1K4JA 4YGOA 4M3SA 2CXAA 4B13A 4MBUA 4A31A 3TT2A 1NE9A 2REFA 5H84A 2Q44A 4MY3A 4A32A 1Z9UA 2FIWA 4AB7A 1S3ZA 4RI1A 4CYOA 3B8GA 4LUAA 4KOXA 4AVBA 1PU9A 3IU2A 5ISVA 1XIXA 3CXQA 1GHEA 5BWAB 1XMTA 2J8NA 2EUIA 4MFKA 4CRZB 1VKCA 4OADA 2FSRA 1QSRA 1M1DA 2PSWA 4MI4A 4Q38A 3S6HA 5J8FA 1S7KA 2FXFA 5HMNA 4QVTA 1WK4A 2Z11A 3TCVA 4B10A 3JUWA 4JD6A 3H4QA 1S7LA 4FD5A 2FCKA 4A2ZA 4AG7A 1YLEA 2GIVA 4UA3A 2PDOA 5I0CA 2Q04A 3IU1A 5C82A 4PSXA 1XF8A 4OAEA 4MFJA 4MFQA 4Q36A 3OWCA 4II9A 2R1IA 4KOTA 1BO4A 4Y49C 3EFAA 2WSAA 4L89A 4AG9A 4PK3A 4XPLA 2GE3A 3WR7A 1KUYA 4IF5A 4JJXA 4F6AA 2ZW4A 2B58A 3ZJ0A 3R1KA 2Q0YA 2B3UA 4KVME 4KVXA 4YRHA 1NSLA 3LD2A 3QAHA 1Q2CA 3FIXA 2O28A 3FBUA 2P6GA 4FD4A 1OZPA 4R3KA 4CAEA 1VHSA 4CS0B 2ATRA 2OU2A 3JVNA 4MFZA 5G20A 2KCWA 5HH1A 4CYPA 4E2AA 4JXQA 4CGPA 4XPDB 4KOSA 2QECA 4I49A 1Y9WA 4IUSA 4MJ8A 1U6MA 5JQ4A 1CM0A 3I3GA 3TTHA 3D2MA 1TIQA 3TOBA 2CNTA 2DPTA 2NMTA 4DNCA 4CRYB 1Y9KA 1WWZA 4KVOE 2FT0A 4KS9A 5H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ONU A;  2JEV A;  1I21 A;  2R8V A;  4KUA A;  2J8R A;  3PZJ A;  3F5B A;  4KOW A;  3F0A A;  1QSM A;  5IV0 A;  1IB1 E;  3D2P A;  5EC4 A;  1IYK A;  5IX3 A;  2WPW A;  2OB0 A;  4NEX A;  2HV2 A;  2VZY A;  4GS4 A;  3TFY A;  3TE4 A;  2R98 A;  3R96 A;  1V0C A;  2JDD A;  3TOA A;  1QSN A;  2D4P A;  4PV6 A;  2HQY A;  2I79 A;  4CAX A;  3VWE A;  3DNS A;  4H6Z A;  5KTA A;  4QUS A;  3DR8 A;  2ARH A;  2VQY A;  1KUV A;  5CNP A;  4L8A A;  5F46 A;  2BEI A;  4B5P B;  4CAV A;  1KZF A;  1IID A;  3FRM A;  1S60 A;  2ZW5 A;  3F8K A;  2BL1 A;  4NSQ A;  2G3A A;  1P0H A;  4E0A A;  4HNX B;  5DWN A;  4ORF A;  2PR1 A;  3BJ7 A;  3EC4 A;  1S5K A;  1UFH A;  1YX0 A;  2B5G B;  4YFJ A;  5C88 A;  2OZU A;  3CXP A;  1P4N A;  5J8C A;  1YVK A;  1M4G A;  4K30 A;  4MY0 A;  3FB3 A;  1MJA A;  1MJ9 A;  3TO7 A;  1ON0 A;  4M85 A;  2Z10 A;  3FXT A;  4F0Y A;  2QIR A;  5F48 A;  2IL4 A;  2R7H A;  4JXR A;  4KOY A;  1QSO A;  1YR0 A;  3TO9 A;  4PSW A;  3PP9 A;  3D8P A;  3R9E A;  3DDD A;  3W91 A;  2B4D A;  5EBV A;  1I1D A;  3CXS A;  1Q2Y A;  3TO6 A;  4UWJ A;  2BSW A;  2AJ6 A;  3C26 A;  2DXQ A;  4ZBG A;  2X7B A;  2CNM A;  2FIA A;  4H6U A;  2AE6 A;  3IGR A;  2EVN A;  1CJW A;  4KOV A;  1I12 A;  4KZT A;  3SXN A;  3FYN A;  2PC1 A;  3DR6 A;  2REE A;  4FD6 A;  5F49 A;  3MGD A;  2VBQ A;  2P6E A;  2P6F A;  5DWM A;  4CAW A;  1QST A;  2Q7B A;  3UY5 A;  4R57 A;  4MHD A;  4J3G A;  2GAN A;  2VI7 A;  4KLW A;  4UWI A;  2JDC A;  1S7N A;  1Q2D A;  4HNW B;  3S6G A;  1Z4R A;  3D3S A;  5JPH A;  4H89 A;  4U9Y A;  2QML A;  2OH1 A;  3T9Y A;  4XNH B;  3EO4 A;  3S6K A;  4EVY A;  4UBR A;  4KUB A;  3QB8 A;  3SXO A;  4BMH A;  2I00 A;  2PR8 A;  1MJB A;  2VXK A;  2ZXV A;  1RXT A;  4U5Y A;  1Y7R A;  3BLN A;  5GCN A;  1LRZ A;  4R3L A;  4NF1 A;  3R9G A;  3BJ8 A;  1M4I A;  1RO5 A;  2JLM A;  1J4J A;  2CNS A;  2B3V A;  2BUE A;  1YGH A;  3LOD A;  2H5M A;  4HNY B;  2VZZ A;  3P2H A;  4R87 A;  5KTC A;  3GYA A;  2B4D B;  3KKW A;  3E0K A;  3G3S A;  2D4O A;  3R9F A;  3RYO A;  1N71 A;  1NMT A;  3FNC A;  2G0B A;  4KLV A;  5FVJ A;  2F5I A;  2OZG A;  3W6S A;  4NXY A;  2Y0M A;  1PUA A;  4X5K A;  2FE7 A;  2J8M A;  1XE4 A;  4JWP A;  4XPK A;  2A4N A;  1FY7 A;  3I9S A;  3EXN A;  3NE7 A;  2PQ8 A;  1R57 A;  4PK2 A;  3R95 A;  4FD7 A;  2FL4 A;  2HUZ A;  3G8W A;  3T90 A;  1XEB A;  3GY9 A;  1YK3 A;  2C27 A;  3PGP A;  4E8O A;  2Q4Y A;  3EY5 A;  2Z0Z A;  2ZW6 A;  3W6X A;  5IB0 A;  1B6B A;  4KOU A;  4XPD C;  2ZPA A;  3DSB A;  1BOB A;  4B5P A;  1M44 A;  3VWD A;  3V8I A;  1MK4 A;  1YRE A;  2OZH A;  2B4B A;  2RC4 A;  4RS2 A;  4JLY A;  4R9M A;  3S6F A;  3N7Z A;  4Y49 B;  1KUX A;  2Q4V A;  2K5T A;  3P2F A;  2FS5 A;  4QC6 A;  4AVA A;  1YVO A;  1M4D A;  4NCZ A;  2B5G A;  2ZW7 A;  4U9Z A;  4KOR A;  4QB9 A;  4LX9 A;  4XNH C;  4QBJ A;  1IIC A;  1Z4E A;  1B87 A;  2CY2 A;  2WPX A;  3GKR A;  3K9U A;  3ZZI A;  5KTD A;  1S7F A;  5E96 A;  2PRB A;  2G3T A;  2P0W A;  3SHP A;  3IWG A;  4B5O A;  1IYL A;  4HKF A;  5F47 A;  4OLL A;  1SQH A;  4AVC A;  1L0C A;  2VEZ A;  1K4J A;  4YGO A;  4M3S A;  4MBU A;  3TT2 A;  1NE9 A;  2REF A;  5H84 A;  2Q44 A;  4MY3 A;  1Z9U A;  2FIW A;  4AB7 A;  1S3Z A;  4RI1 A;  3B8G A;  4LUA A;  4KOX A;  4AVB A;  1PU9 A;  5ISV A;  1XIX A;  3CXQ A;  1GHE A;  1XMT A;  2J8N A;  2EUI A;  4CRZ B;  1VKC A;  4OAD A;  2FSR A;  1QSR A;  1M1D A;  2PSW A;  4MI4 A;  3S6H A;  5J8F A;  1S7K A;  2FXF A;  5HMN A;  4QVT A;  1WK4 A;  2Z11 A;  3TCV A;  3JUW A;  4JD6 A;  3H4Q A;  1S7L A;  4FD5 A;  2FCK A;  4AG7 A;  1YLE A;  2GIV A;  4UA3 A;  2PDO A;  5I0C A;  2Q04 A;  5C82 A;  4PSX A;  1XF8 A;  4OAE A;  3OWC A;  4II9 A;  2R1I A;  4KOT A;  1BO4 A;  4Y49 C;  3EFA A;  4L89 A;  4AG9 A;  4PK3 A;  4XPL A;  2GE3 A;  3WR7 A;  1KUY A;  4IF5 A;  4JJX A;  4F6A A;  2ZW4 A;  2B58 A;  3ZJ0 A;  3R1K A;  2Q0Y A;  2B3U A;  4KVM E;  4KVX A;  4YRH A;  1NSL A;  3LD2 A;  3QAH A;  1Q2C A;  3FIX A;  2O28 A;  3FBU A;  2P6G A;  4FD4 A;  1OZP A;  4R3K A;  1VHS A;  4CS0 B;  2ATR A;  2OU2 A;  3JVN A;  4E2A A;  2KCW A;  5HH1 A;  4JXQ A;  4XPD B;  4KOS A;  2QEC A;  4I49 A;  1Y9W A;  4IUS A;  4MJ8 A;  1U6M A;  5JQ4 A;  1CM0 A;  3I3G A;  3TTH A;  3D2M A;  1TIQ A;  3TOB A;  2CNT A;  4DNC A;  2NMT A;  4CRY B;  1Y9K A;  1WWZ A;  4KVO E;  2FT0 A;  5H86 A; 
#chains in the Genus database with same CATH topology
 4ONU A;  4LQ6 A;  2JEV A;  3S9M A;  1I21 A;  2R8V A;  4KUA A;  1HEE A;  2J8R A;  3K9T A;  4OKO A;  3FX6 A;  3PZJ A;  3F5B A;  4P4I A;  2YNE A;  4KOW A;  1Q7L A;  1QSM A;  3F0A A;  4UFX A;  5IV0 A;  1IB1 E;  5G1Z A;  1CBX A;  5LRJ A;  2XEJ A;  3D2P A;  5EC4 A;  1IYK A;  2FVG A;  2ZEN A;  5IX3 A;  1TKJ A;  2WPW A;  3KHX A;  2OB0 A;  4NEX A;  2HV2 A;  2VZY A;  3K2K A;  4NFR A;  4RN7 A;  4B14 A;  4CGM A;  4GS4 A;  3TFY A;  3TE4 A;  2Q7S A;  2R98 A;  3H8F A;  3R96 A;  4F0X A;  1V0C A;  2JDD A;  3TOA A;  1QSN A;  2D4P A;  4PV6 A;  1YME A;  2HQY A;  2I79 A;  3VWE A;  4CAX A;  3DNS A;  4OID A;  1IOF A;  4H6Z A;  3VAT A;  5I4M A;  4CAF A;  5KTA A;  1Y7E A;  4QUS A;  2XEI A;  4DYO A;  3DR8 A;  2ARH A;  4YU9 A;  4H2K A;  2VQY A;  4CGO A;  1KUV A;  4B5O A;  4EWT A;  5CNP A;  2IJZ A;  4L8A A;  5F46 A;  3A9L A;  2BEI A;  3GIU A;  4MRI A;  5AG7 A;  2ZEF A;  4B5P B;  4CAV A;  2BOA A;  4UFV A;  4B11 A;  4P4F A;  1KZF A;  1IID A;  3FRM A;  5LYI A;  3TC8 A;  1S60 A;  3VH9 A;  2CIJ A;  2ZW5 A;  1ARM A;  4O23 A;  3GUX A;  3F8K A;  1DE4 C;  2BL1 A;  4C7I A;  2CTC A;  4NSQ A;  2G3A A;  1P0H A;  3PRT A;  3WAB A;  4E0A A;  4HNX B;  3N5F A;  5F09 A;  3CPA A;  5DWN A;  2AFO A;  4ORF A;  2PR1 A;  3BJ7 A;  3EC4 A;  1F2O A;  3NH8 A;  1S5K A;  1CP6 A;  1UFH A;  1YX0 A;  2B5G B;  2PCU A;  4W9Y A;  4YFJ A;  1TKF A;  2OZU A;  3CXP A;  1P4N A;  4EME A;  4Q7A A;  5C88 A;  5J8C A;  1YVK A;  1M4G A;  4K30 A;  3D68 A;  4MY0 A;  3FB3 A;  4C7H A;  3DGV A;  4BBH A;  1MJA A;  1MJ9 A;  3TO7 A;  1ON0 A;  1ZG9 A;  4M85 A;  2Z10 A;  3FXT A;  2C6C A;  2QIR A;  5F48 A;  3B3S A;  4F0Y A;  2IL4 A;  2R7H A;  4JXR A;  4KOY A;  3D67 A;  5K8P A;  1QSO A;  3KR5 A;  3NFZ A;  1YR0 A;  3B2Y A;  3TO9 A;  2OR4 A;  5D8N A;  3SI2 A;  4PSW A;  2ZEE A;  4GXH A;  3PP9 A;  4BD9 A;  3D8P A;  3R9E A;  1ZLH A;  3DDD A;  3JTK A;  4NJQ A;  3W91 A;  2B4D A;  5JH9 A;  4OC0 A;  2V8H A;  4KSA A;  3NA6 A;  5EBV A;  1I1D A;  2YND A;  3CXS A;  1Q2Y A;  1VGY A;  2PJ2 A;  3PEI A;  3RNZ A;  3TO6 A;  1X10 A;  4UWJ A;  3D7F A;  4AXV A;  3JRU A;  5AG4 A;  2BSW A;  1VHO A;  2AJ6 A;  6CPA A;  1PCA A;  3C26 A;  2V8V A;  2DXQ A;  2GLJ A;  4NGT A;  4PXD A;  4ZBG A;  2X7B A;  2CNM A;  5AG6 A;  2FIA A;  4LQG A;  2O53 A;  4ZY1 A;  2PJ4 A;  2PJ6 A;  4R7M A;  4H6U A;  2AE6 A;  3IGR A;  4MFP A;  4NGM A;  1CX8 A;  2Z3K A;  3V38 A;  2EVN A;  1CJW A;  2Z3M A;  3IIB A;  4MCS A;  4CYQ A;  2GFQ A;  4KOV A;  1I12 A;  4KZT A;  1AUG A;  3B35 A;  4ZX9 A;  2QVP A;  3SXN A;  3MN8 A;  2JEW A;  2HC9 A;  4CYN A;  4OC3 A;  4TNU A;  3FYN A;  2AFZ A;  2PC1 A;  4B12 A;  3DR6 A;  1XOV A;  2REE A;  4FD6 A;  5F49 A;  3WC7 A;  1Z8L A;  3MGD A;  2OOT A;  1RTQ A;  4F9U A;  2VBQ A;  2P6E A;  2P6F A;  2PVV A;  3FEE A;  4OC2 A;  5LRG A;  3B3T A;  5DWM A;  4CAW A;  2XEF A;  1QST A;  4Z65 A;  1Z5R A;  3IWE A;  4OC5 A;  2Q7B A;  3UY5 A;  4A30 A;  7CPA A;  4R57 A;  4NGN A;  2POK A;  4J3G A;  4MFL A;  4MHD A;  3B7I A;  2YNC A;  1LAN A;  2GAN A;  2VI7 A;  3DLJ A;  4KLW A;  4UWI A;  2JDC A;  1S7N A;  1Q2D A;  4HNW B;  3S6G A;  1Z4R A;  3S9N A;  3D3S A;  5JPH A;  1QQ9 A;  4H89 A;  2AFM A;  4U9Y A;  3KHZ A;  4C2Y A;  2QML A;  2OH1 A;  3T9Y A;  2ZEO A;  2PJ8 A;  4XNH B;  3EO4 A;  3S6K A;  3KQZ A;  4EVY A;  4JZ0 A;  2AFS A;  4UBR A;  4KUB A;  2RFH A;  3QB8 A;  3SXO A;  4BMH A;  2I00 A;  2PR8 A;  1ZO0 A;  4KSF A;  1MJB A;  2VXK A;  2XEG A;  2PIZ A;  2ZXV A;  3H8G A;  3ISX A;  4OC1 A;  5HVG A;  1RXT A;  4U5Y A;  4FBE A;  1Y7R A;  3PB9 X;  3BLN A;  4ZY0 A;  3WC5 A;  4MHZ A;  1CP7 A;  5GCN A;  1XBU A;  1LRZ A;  4M6I A;  4IHM A;  1Y0Y A;  4P10 A;  4OME A;  3H5Z A;  3FVL A;  4R3L A;  1Z8W A;  2HB6 A;  1XFO A;  3IWW A;  4IK2 A;  1ELL P;  4NF1 A;  3R9G A;  4X8I A;  3BJ8 A;  1M4I A;  1RO5 A;  1JQG A;  4MCQ A;  3HUV A;  4ZX8 A;  5IB9 A;  2JLM A;  2PJ9 A;  2Q43 A;  4UCP A;  4EFD A;  1J4J A;  3L2N A;  2EWB A;  2CNS A;  2B3V A;  2VL1 A;  4P45 A;  4B6Z A;  2BUE A;  1ZG7 A;  1LFW A;  1YGH A;  1Z8T A;  3LOD A;  2H5M A;  4HNY B;  2VZZ A;  3ISZ A;  4C68 A;  3WT4 A;  1X12 A;  2WUU A;  2WYR A;  2Z3P A;  3P2H A;  3PBE A;  4C2Z A;  4R87 A;  5KTC A;  3GYA A;  3NE8 A;  3B3C A;  3NH4 A;  2B4D B;  3KKW A;  4TWE A;  3E0K A;  3G3S A;  2D4O A;  2AFU A;  3BI0 A;  3B3V A;  3R9F A;  2Q4Z A;  3RYO A;  1N71 A;  1NMT A;  2IQ6 A;  2Z3N A;  3FNC A;  1BPM A;  3PFO A;  4C2X A;  4CGL A;  3SI1 A;  3D7H A;  5HVH A;  2G0B A;  2YNC C;  4KLV A;  5FVJ A;  2F5I A;  3FED A;  1CG2 A;  2OZG A;  2PJ5 A;  4NXY A;  2Y0M A;  3W6S A;  5G22 A;  1PUA A;  4X2T A;  4X5K A;  2Z3O A;  2FE7 A;  2J8M A;  2PIY A;  3BXM A;  1XE4 A;  4JWP A;  4XPK A;  2A4N A;  1FY7 A;  2CTB A;  3EXN A;  3I9S A;  3NE7 A;  5G21 A;  3GB0 A;  2PQ8 A;  5EMI A;  5K8M A;  2DPS A;  1TKH A;  4UEZ A;  1YLO A;  1R57 A;  3PBB A;  2AFW A;  4PK2 A;  3R95 A;  2BCO A;  4UCM A;  2C6P A;  4F9V A;  2DEA A;  4FD7 A;  8CPA A;  1VHE A;  1YW4 A;  2PJA A;  2FL4 A;  3QNV A;  3LMS A;  4WJB A;  5AG5 A;  1IY7 A;  2HUZ A;  4KSI A;  3G8W A;  3T90 A;  1Z8X A;  3H8E A;  1CPX A;  2C1C A;  4PQA A;  1XEB A;  3GY9 A;  1YK3 A;  2EO8 A;  2C27 A;  4NGQ A;  3SJX A;  3PGP A;  2O4H A;  4E8O A;  2Q4Y A;  4K3N A;  4P4B A;  4PPZ A;  2Z3L A;  5A28 A;  1ZG8 A;  2DF5 A;  3EY5 A;  1XRY A;  1BLL E;  1ELM P;  4R8F A;  5LYD A;  1FNO A;  2Z0Z A;  2ZW6 A;  5DS0 A;  3W6X A;  4NGR A;  4NGS A;  3QAY A;  5IB0 A;  1B6B A;  4KOU A;  2ZOG A;  4XPD C;  2ZPA A;  3DSB A;  1BOB A;  4CGN A;  4B5P A;  1M44 A;  2V8G A;  4PXB A;  4A95 A;  2ABZ A;  3FH4 A;  1FT7 A;  3V8I A;  3VWD A;  3SJF A;  1MK4 A;  3KQX A;  4WWV A;  1YRE A;  2OZH A;  1IU8 A;  2B4B A;  2RC4 A;  4RS2 A;  3D7G A;  4JLY A;  4R9M A;  2BO9 A;  5A27 A;  3IJ3 A;  4GM5 A;  3S6F A;  3N7Z A;  4Y49 B;  1KUX A;  2Q4V A;  4ZGY B;  2K5T A;  3P2F A;  2FS5 A;  4A33 A;  4QC6 A;  4AVA A;  1YVO A;  4NJR A;  1M4D A;  3D66 A;  4NCZ A;  4UF4 A;  2B5G A;  2ZW7 A;  1BPN A;  4U9Z A;  2PJC A;  1TXR A;  4KOR A;  2I3C A;  3B3W A;  2PJ1 A;  4UIB A;  4QB9 A;  4UCN A;  3RAM A;  4LX9 A;  4UFW A;  5AGE A;  2EK9 A;  4XNH C;  4QBJ A;  1IIC A;  1Z4E A;  3LAC A;  1B87 A;  2CY2 A;  2WPX A;  3GKR A;  3K9U A;  3ZZI A;  5KTD A;  3PB4 X;  4MMO A;  1S7F A;  1AMP A;  4A37 A;  2PRQ A;  5E96 A;  2PRB A;  2YGW A;  1Y0R A;  2G3T A;  2P0W A;  3SHP A;  2ZED A;  4MCP A;  2ZEG A;  3IEH A;  3KI9 A;  3IWG A;  2Q51 A;  3PB7 X;  2J9A A;  2RB7 A;  4ONW A;  2PJ7 A;  1GYT A;  2ZEL A;  3SI0 A;  1IYL A;  4HKF A;  5F47 A;  4OLL A;  1VIX A;  1SQH A;  4MHP A;  4AVC A;  1YSJ A;  2CF4 A;  2JBK A;  1L0C A;  2VEZ A;  1K4J A;  1F2P A;  4YGO A;  4FUU A;  4M3S A;  3CT9 A;  2ANP A;  4CPA A;  1IOI A;  2CXA A;  5CBM A;  3VAR A;  4A39 A;  3PB8 X;  4B13 A;  4JYW A;  2GLF A;  3RO0 A;  4MBU A;  4F8Z A;  4A31 A;  2V77 A;  1HDU A;  3TT2 A;  1NE9 A;  4UEE A;  2REF A;  5H84 A;  1TF9 A;  2Q44 A;  4MY3 A;  4R76 A;  4OIW A;  4A32 A;  1Z9U A;  2FIW A;  4AB7 A;  1S3Z A;  4RI1 A;  4CYO A;  2F8H A;  1DTD A;  3B8G A;  4MHN A;  4LUA A;  4KOX A;  4AVB A;  1PU9 A;  5J1Q A;  4P4D A;  3IU2 A;  3FF3 A;  1XIX A;  4BIN A;  5ISV A;  3CXQ A;  3FMC A;  4MHY A;  1GHE A;  5BWA B;  2JBJ A;  1XMT A;  2J8N A;  4G1P A;  4DUK A;  2EUI A;  1NSA A;  1JWQ A;  4MFK A;  5K8O A;  4CRZ B;  2ZEM A;  1IGB A;  1LOK A;  1VKC A;  4OAD A;  2FSR A;  5CPA A;  5JGF A;  1QSR A;  5LRK A;  1M1D A;  4ZY2 A;  2EBJ A;  2PSW A;  4MI4 A;  4Q38 A;  3PB6 X;  4FAI A;  2GRE A;  1ZLI A;  4ZI6 A;  3S6H A;  2V8D A;  4E2A A;  3KGQ A;  1S7K A;  1R43 A;  2FXF A;  1YQE A;  4QVT A;  5HMN A;  5J8F A;  1WK4 A;  2Z11 A;  3TCV A;  4B10 A;  3JUW A;  4M6H A;  2EK8 A;  4JD6 A;  4P6Y A;  3S9L A;  3H4Q A;  4PXE A;  1S7L A;  4MCR A;  2G9D A;  4OC4 A;  3SJG A;  4M6G A;  4FD5 A;  2FCK A;  4A2Z A;  3D4U A;  3LWU A;  4AG7 A;  1CPS A;  1UWY A;  1A2Z A;  1YLE A;  2GIV A;  4UA3 A;  3NH5 A;  1F57 A;  3RBU A;  2PDO A;  2QYV A;  2F7V A;  5I0C A;  2Q04 A;  3IU1 A;  3PFE A;  3GLJ A;  5C82 A;  2GU2 A;  5ELY A;  1YW6 A;  3HLP A;  4PSX A;  1XF8 A;  3FJU A;  4OAE A;  4DJL A;  4MFJ A;  4MFQ A;  4Q36 A;  3OWC A;  5HXD A;  4II9 A;  2QJ8 A;  4A94 A;  2R1I A;  4KOT A;  2ZEP A;  1BO4 A;  2PJ3 A;  4Y49 C;  3EFA A;  1BAV A;  2WSA A;  5LYF A;  4FWU A;  4L89 A;  4AG9 A;  3I1U A;  2WZN A;  4PK3 A;  4P44 A;  4XPL A;  1QMU A;  2GE3 A;  3WR7 A;  3RZA A;  3T8W A;  4MXU A;  1KUY A;  2ODF A;  3KL9 A;  3CDX A;  3SJE A;  5K8N A;  3BHX A;  4IF5 A;  2PE3 A;  1KWM A;  4JJX A;  3V7Z A;  4F6A A;  2ZW4 A;  3IO1 A;  2B58 A;  3ZJ0 A;  3R1K A;  4PXC A;  2Q0Y A;  4OP4 A;  2B3U A;  4KVM E;  1HDQ A;  1LAP A;  4KVX A;  3KAS A;  3MRU A;  3BI1 A;  4YRH A;  4NGP A;  1NSL A;  3WC6 A;  3LD2 A;  3QAH A;  1LAM A;  1Q2C A;  4P4J A;  2NYQ A;  3KZW A;  1Z2L A;  1EE3 P;  3FIX A;  2O28 A;  2ZOF A;  1H8L A;  2NSM A;  1M4L A;  3FBU A;  2P6G A;  4FD4 A;  1OZP A;  4R3K A;  1AYE A;  2AFX A;  2ZEH A;  1VHS A;  4CAE A;  2PVW A;  4X3R A;  1LCP A;  3D7D A;  4CS0 B;  1XMB A;  2ATR A;  2OU2 A;  3JVN A;  4MFZ A;  2KCW A;  2PJ0 A;  5G20 A;  5HH1 A;  4JXQ A;  4CYP A;  5JM6 A;  4CGP A;  4XPD B;  4RUH A;  2PJB A;  4KOS A;  4IAV A;  4YWY A;  5D29 A;  3IFE A;  1XJO A;  2QEC A;  1R3N A;  3CZX A;  1TF8 A;  3IC1 A;  2C6G A;  4I49 A;  3KR4 A;  4R6T A;  1Y9W A;  4P4E A;  4IUS A;  4MJ8 A;  4ZYQ A;  1U6M A;  1OBR A;  5JQ4 A;  1CM0 A;  3I3G A;  3TTH A;  5THW A;  3D2M A;  1TIQ A;  4A38 A;  5LYL A;  4UIA A;  3TOB A;  5HVF A;  3TX8 A;  2CNT A;  1PYT B;  2NMT A;  1ARL A;  2DPT A;  4HPS A;  4CRY B;  4DNC A;  1Y9K A;  1WWZ A;  2IMO A;  4KVO E;  2FT0 A;  4KS9 A;  3FEC A;  4UEF A;  3CPX A;  5H86 A; 
#chains in the Genus database with same CATH homology
 4ONU A;  2JEV A;  1I21 A;  2R8V A;  4KUA A;  2J8R A;  3PZJ A;  3F5B A;  2YNE A;  4KOW A;  3F0A A;  1QSM A;  4UFX A;  5IV0 A;  1IB1 E;  5G1Z A;  3D2P A;  5EC4 A;  1IYK A;  5IX3 A;  2WPW A;  2OB0 A;  4NEX A;  2HV2 A;  2VZY A;  4B14 A;  4CGM A;  4GS4 A;  3TFY A;  3TE4 A;  2R98 A;  3R96 A;  4F0X A;  1V0C A;  2JDD A;  3TOA A;  1QSN A;  2D4P A;  4PV6 A;  2HQY A;  2I79 A;  4CAX A;  3VWE A;  3DNS A;  4H6Z A;  4CAF A;  5KTA A;  4QUS A;  3DR8 A;  2ARH A;  2VQY A;  4CGO A;  1KUV A;  5CNP A;  4L8A A;  5F46 A;  3A9L A;  2BEI A;  5AG7 A;  4B5P B;  4CAV A;  4UFV A;  4B11 A;  1KZF A;  1IID A;  3FRM A;  1S60 A;  2ZW5 A;  3F8K A;  2BL1 A;  4C7I A;  4NSQ A;  2G3A A;  1P0H A;  4E0A A;  4HNX B;  5DWN A;  4ORF A;  2PR1 A;  3BJ7 A;  3EC4 A;  1S5K A;  1UFH A;  1YX0 A;  2B5G B;  4YFJ A;  5C88 A;  2OZU A;  3CXP A;  1P4N A;  5J8C A;  1YVK A;  1M4G A;  4K30 A;  4MY0 A;  3FB3 A;  4C7H A;  4BBH A;  1MJA A;  1MJ9 A;  3TO7 A;  1ON0 A;  4M85 A;  2Z10 A;  3FXT A;  4F0Y A;  2QIR A;  5F48 A;  2IL4 A;  2R7H A;  4JXR A;  4KOY A;  1QSO A;  1YR0 A;  3TO9 A;  4PSW A;  3PP9 A;  3D8P A;  3R9E A;  3DDD A;  3JTK A;  3W91 A;  2B4D A;  4KSA A;  5EBV A;  1I1D A;  2YND A;  3CXS A;  1Q2Y A;  3TO6 A;  4UWJ A;  5AG4 A;  2BSW A;  2AJ6 A;  3C26 A;  2DXQ A;  4ZBG A;  2X7B A;  2CNM A;  5AG6 A;  2FIA A;  4H6U A;  2AE6 A;  3IGR A;  4MFP A;  2Z3K A;  2EVN A;  1CJW A;  2Z3M A;  4CYQ A;  4KOV A;  1I12 A;  4KZT A;  3SXN A;  4CYN A;  3FYN A;  2PC1 A;  4B12 A;  3DR6 A;  2REE A;  4FD6 A;  5F49 A;  3MGD A;  2VBQ A;  2P6E A;  2P6F A;  5DWM A;  4CAW A;  1QST A;  3IWE A;  2Q7B A;  3UY5 A;  4A30 A;  4R57 A;  4MFL A;  4J3G A;  4MHD A;  2YNC A;  2GAN A;  2VI7 A;  4KLW A;  4UWI A;  2JDC A;  1S7N A;  1Q2D A;  4HNW B;  3S6G A;  1Z4R A;  3D3S A;  5JPH A;  4H89 A;  4U9Y A;  4C2Y A;  2QML A;  2OH1 A;  3T9Y A;  4XNH B;  3EO4 A;  3S6K A;  4EVY A;  4UBR A;  4KUB A;  3QB8 A;  3SXO A;  4BMH A;  2I00 A;  2PR8 A;  1ZO0 A;  4KSF A;  1MJB A;  2VXK A;  2ZXV A;  1RXT A;  4U5Y A;  1Y7R A;  3BLN A;  5GCN A;  1LRZ A;  3H5Z A;  4R3L A;  4NF1 A;  3R9G A;  3BJ8 A;  1M4I A;  1RO5 A;  2JLM A;  4UCP A;  1J4J A;  2CNS A;  2B3V A;  2BUE A;  1YGH A;  3LOD A;  2H5M A;  4HNY B;  2VZZ A;  4C68 A;  2WUU A;  3P2H A;  4C2Z A;  2Z3P A;  4R87 A;  5KTC A;  3GYA A;  2B4D B;  3KKW A;  3E0K A;  3G3S A;  2D4O A;  3R9F A;  4C2X A;  3RYO A;  1N71 A;  1NMT A;  2Z3N A;  3FNC A;  4CGL A;  2G0B A;  2YNC C;  4KLV A;  5FVJ A;  2F5I A;  2OZG A;  3W6S A;  4NXY A;  2Y0M A;  5G22 A;  1PUA A;  4X5K A;  2Z3O A;  2FE7 A;  2J8M A;  1XE4 A;  4JWP A;  4XPK A;  2A4N A;  1FY7 A;  3I9S A;  3EXN A;  3NE7 A;  5G21 A;  2PQ8 A;  2DPS A;  1R57 A;  4PK2 A;  3R95 A;  4UCM A;  4FD7 A;  2FL4 A;  5AG5 A;  2HUZ A;  3G8W A;  3T90 A;  1XEB A;  3GY9 A;  1YK3 A;  2C27 A;  3PGP A;  4E8O A;  2Q4Y A;  5A28 A;  2Z3L A;  3EY5 A;  2Z0Z A;  2ZW6 A;  3W6X A;  5IB0 A;  1B6B A;  4KOU A;  4XPD C;  2ZPA A;  3DSB A;  1BOB A;  4CGN A;  4B5P A;  1M44 A;  4A95 A;  3VWD A;  3V8I A;  1MK4 A;  1YRE A;  2OZH A;  2B4B A;  2RC4 A;  4RS2 A;  4JLY A;  4R9M A;  5A27 A;  3S6F A;  3N7Z A;  4Y49 B;  1KUX A;  2Q4V A;  4ZGY B;  2K5T A;  3P2F A;  2FS5 A;  4A33 A;  4QC6 A;  4AVA A;  1YVO A;  1M4D A;  4NCZ A;  2B5G A;  2ZW7 A;  4U9Z A;  4KOR A;  4QB9 A;  4UCN A;  4LX9 A;  4UFW A;  5AGE A;  4XNH C;  4QBJ A;  1IIC A;  1Z4E A;  1B87 A;  2CY2 A;  2WPX A;  3GKR A;  3K9U A;  3ZZI A;  5KTD A;  1S7F A;  5E96 A;  2PRB A;  2YGW A;  2G3T A;  2P0W A;  3SHP A;  3IWG A;  4B5O A;  1IYL A;  4HKF A;  5F47 A;  4OLL A;  1SQH A;  4AVC A;  1L0C A;  2VEZ A;  1K4J A;  4YGO A;  4M3S A;  2CXA A;  4B13 A;  4MBU A;  4A31 A;  3TT2 A;  1NE9 A;  2REF A;  5H84 A;  2Q44 A;  4MY3 A;  4A32 A;  1Z9U A;  2FIW A;  4AB7 A;  1S3Z A;  4RI1 A;  4CYO A;  3B8G A;  4LUA A;  4KOX A;  4AVB A;  1PU9 A;  3IU2 A;  5ISV A;  1XIX A;  3CXQ A;  1GHE A;  5BWA B;  1XMT A;  2J8N A;  2EUI A;  4MFK A;  4CRZ B;  1VKC A;  4OAD A;  2FSR A;  1QSR A;  1M1D A;  2PSW A;  4MI4 A;  4Q38 A;  3S6H A;  5J8F A;  1S7K A;  2FXF A;  5HMN A;  4QVT A;  1WK4 A;  2Z11 A;  3TCV A;  4B10 A;  3JUW A;  4JD6 A;  3H4Q A;  1S7L A;  4FD5 A;  2FCK A;  4A2Z A;  4AG7 A;  1YLE A;  2GIV A;  4UA3 A;  2PDO A;  5I0C A;  2Q04 A;  3IU1 A;  5C82 A;  4PSX A;  1XF8 A;  4OAE A;  4MFJ A;  4MFQ A;  4Q36 A;  3OWC A;  4II9 A;  2R1I A;  4KOT A;  1BO4 A;  4Y49 C;  3EFA A;  2WSA A;  4L89 A;  4AG9 A;  4PK3 A;  4XPL A;  2GE3 A;  3WR7 A;  1KUY A;  4IF5 A;  4JJX A;  4F6A A;  2ZW4 A;  2B58 A;  3ZJ0 A;  3R1K A;  2Q0Y A;  2B3U A;  4KVM E;  4KVX A;  4YRH A;  1NSL A;  3LD2 A;  3QAH A;  1Q2C A;  3FIX A;  2O28 A;  3FBU A;  2P6G A;  4FD4 A;  1OZP A;  4R3K A;  4CAE A;  1VHS A;  4CS0 B;  2ATR A;  2OU2 A;  3JVN A;  4MFZ A;  5G20 A;  2KCW A;  5HH1 A;  4CYP A;  4E2A A;  4JXQ A;  4CGP A;  4XPD B;  4KOS A;  2QEC A;  4I49 A;  1Y9W A;  4IUS A;  4MJ8 A;  1U6M A;  5JQ4 A;  1CM0 A;  3I3G A;  3TTH A;  3D2M A;  1TIQ A;  3TOB A;  2CNT A;  2DPT A;  2NMT A;  4DNC A;  4CRY B;  1Y9K A;  1WWZ A;  4KVO E;  2FT0 A;  4KS9 A;  5H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...