4CRZB

Direct visualisation of strain-induced protein prost-translational modification
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWEKCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 36
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4crzB00
4OADA 4KVOE 2PR1A 1NSLA 3IWGA 2JDDA 2EVNA 2GIVA 2CNSA 2WPWA 3TOBA 4AVBA 4JXRA 2B5GB 2CY2A 4KORA 4KOXA 1Q2DA 2Q4YA 4AG9A 3EO4A 3ZZIA 4LUAA 1S5KA 3ZJ0A 3QAHA 4M85A 2EUIA 3GY9A 3DSBA 5F49A 1KZFA 2OZUA 4H89A 3F0AA 3SXOA 3T9YA 3TE4A 5J8CA 4MHDA 3F5BA 3F8KA 1Y7RA 1QSMA 2FS5A 2VZZA 4HKFA 2A4NA 2Z0ZA 2AJ6A 1BOBA 2HUZA 1V0CA 2Y0MA 4PV6A 1QSOA 4NF1A 4ORFA 2JEVA 2J8MA 4XPDB 1PU9A 2G3AA 2FL4A 1YK3A 1YVOA 2QIRA 5IV0A 4DNCA 5H86A 4BMHA 1QSRA 1L0CA 1CM0A 4AB7A 4JXQA 3FB3A 3UY5A 4XNHB 4QC6A 3SXNA 1RXTA 2NMTA 4CS0B 4U9ZA 1S7LA 1Y9WA 3R96A 1PUAA 4NCZA 2P0WA 3GYAA 4JD6A 3W6SA 4MY0A 4QVTA 1M4GA 2CNTA 2FCKA 2VQYA 4HNXB 1TIQA 1Y9KA 2Z11A 4R9MA 2Z10A 3PZJA 4FD6A 5GCNA 2GE3A 1S60A 1XE4A 4NSQA 2OZGA 2VZYA 1IYKA 4E8OA 2QECA 2OB0A 2G3TA 4NEXA 2PQ8A 2ATRA 4ONUA 1P0HA 5KTDA 3R9FA 3R9GA 1P4NA 2OU2A 2BEIA 4KVXA 2FE7A 4E0AA 1ON0A 3S6KA 3OWCA 4JLYA 3EY5A 2IL4A 3CXPA 1I21A 5DWNA 3CXSA 4UBRA 2J8NA 2K5TA 3EC4A 1MJ9A 1QSTA 2RC4A 3FYNA 3CXQA 2FIWA 1Z9UA 4AG7A 4MBUA 2BUEA 1IIDA 2DXQA 4II9A 2WPXA 5HH1A 2O28A 2G0BA 4F6AA 4QBJA 4KOUA 3SHPA 2BL1A 4KOWA 1YX0A 4K30A 4XPLA 3TOAA 4CRZB 3S6HA 3TCVA 2ZW7A 3P2HA 4L8AA 2J8RA 2F5IA 2PDOA 4PK2A 2B3UA 4NXYA 2CNMA 3BJ7A 4B5OA 2REEA 2Q04A 1B6BA 2Q7BA 2B58A 4KOTA 2X7BA 2R98A 4YFJA 5J8FA 1LRZA 1GHEA 3RYOA 1S7NA 5F47A 2PR8A 1N71A 1J4JA 3TTHA 3D3SA 1YREA 1IB1E 1UFHA 3TO7A 2QMLA 2R7HA 3TO6A 4X5KA 5JPHA 4CRYB 4MY3A 1S3ZA 3DR6A 3B8GA 2VBQA 3WR7A 4KZTA 2HV2A 3I3GA 3FNCA 3VWDA 3P2FA 4CAWA 4H6UA 3LD2A 2ARHA 2PRBA 4R87A 4KLVA 4OAEA 4H6ZA 5IB0A 2B4DA 1YR0A 2D4PA 3EXNA 2P6GA 2ZXVA 3KKWA 4FD7A 3EFAA 5CNPA 4HNWB 1IYLA 4CAVA 2I00A 1YVKA 4U9YA 4Y49C 1I1DA 4MI4A 3W91A 3NE7A 4HNYB 2B3VA 4B5PA 1WWZA 3JUWA 1IICA 4F0YA 1Q2CA 4KUAA 4KOVA 4M3SA 1YLEA 2ZPAA 4KOYA 3T90A 1XIXA 3DDDA 1Q2YA 1Z4EA 3FIXA 1KUXA 1SQHA 3N7ZA 2JLMA 4XPKA 3FRMA 2OZHA 1YGHA 2P6FA 3S6FA 4AVAA 2FIAA 4LX9A 5ISVA 4EVYA 3JVNA 2P6EA 1KUYA 2OH1A 2R1IA 4AVCA 3H4QA 3S6GA 4IUSA 4PSXA 3G3SA 4OLLA 1B87A 1R57A 4UWIA 2FSRA 4U5YA 3TO9A 3D2PA 3V8IA 4YRHA 1RO5A 2VXKA 1NE9A 3QB8A 4JJXA 1M1DA 2FT0A 2B5GA 5EBVA 4GS4A 1CJWA 4UWJA 3R9EA 2Q44A 4YGOA 4KLWA 4L89A 2HQYA 4KUBA 1XMTA 1FY7A 2JDCA 4FD4A 4Y49B 3DNSA 2C27A 3I9SA 5F48A 3TFYA 3MGDA 2PC1A 2H5MA 4RI1A 2R8VA 1XF8A 4R3LA 2VI7A 1S7FA 2Q0YA 1MJBA 1WK4A 2ZW5A 5JQ4A 5FVJA 4R3KA 2Q4VA 3D2MA 2ZW6A 2BSWA 1M4IA 4QUSA 2FXFA 4RS2A 1K4JA 4JWPA 3PGPA 3R1KA 4KOSA 1VHSA 2KCWA 3G8WA 3TT2A 1I12A 5DWMA 5KTCA 1OZPA 2B4DB 5I0CA 2PSWA 3IGRA 3LODA 1M44A 4PSWA 3PP9A 3GKRA 3K9UA 5F46A 1NMTA 1XEBA 2GANA 5H84A 5KTAA 3DR8A 4J3GA 4QB9A 1Z4RA 1MJAA 4B5PB 2REFA 4E2AA 3E0KA 3D8PA 5IX3A 4UA3A 2AE6A 4PK3A 1QSNA 4CAXA 5C82A 4IF5A 5EC4A 2VEZA 1VKCA 1MK4A 2B4BA 1BO4A 2I79A 4I49A 4KVME 4XPDC 4MJ8A 5C88A 3C26A 5E96A 3BLNA 3R95A 2D4OA 2ZW4A 3FBUA 3W6XA 1U6MA 4FD5A 1M4DA 4XNHC 4ZBGA 4R57A 1S7KA 3VWEA 1KUVA 3BJ8A 3FXTA 5HMNA
chains in the Genus database with same CATH superfamily
4OADA 4KVOE 1TXRA 3IFEA 3LMSA 2PR1A 2Z3OA 3SI2A 1NSLA 3IWGA 2JDDA 2EVNA 2GIVA 2CNSA 2ZENA 4OC3A 3V7ZA 2WPWA 3TOBA 4UFXA 4AVBA 3FECA 3FX6A 3PFOA 2AFWA 4NFRA 4JXRA 2B5GB 3T8WA 1HEEA 2CY2A 4KORA 3ISZA 4EFDA 3GIUA 4KOXA 2V8GA 4JZ0A 5JM6A 1Q2DA 2Q4YA 4AG9A 8CPAA 3EO4A 4TNUA 3ZZIA 2VL1A 4LUAA 4OKOA 1S5KA 3BI0A 3ZJ0A 3QAHA 4M85A 4OC4A 4R8FA 2EUIA 2PRQA 2Q4ZA 3GY9A 3DSBA 5D8NA 5F49A 1KZFA 2CXAA 4C2XA 2OZUA 4H89A 1LFWA 4UIBA 3F0AA 1Z8TA 4UF4A 4NGSA 2ABZA 1ARMA 4NGQA 2XEFA 3SXOA 2ZEGA 3T9YA 4FWUA 1CPXA 3FJUA 3CPXA 3TE4A 1X10A 5J8CA 4MHDA 5LRGA 3F5BA 3F8KA 4C2ZA 3FEEA 1Y7RA 3SI0A 1QSMA 2FS5A 2VZZA 4HKFA 2A4NA 2YNDA 2Z0ZA 5EMIA 4CYQA 1TKFA 3JRUA 2GLFA 2AJ6A 4KS9A 2ZEHA 1ZLIA 2V8HA 1BOBA 3PBEA 2PVWA 2HUZA 1V0CA 2Y0MA 4PV6A 3RBUA 2PIZA 1QSOA 2IMOA 2Q51A 4NF1A 4ORFA 3GB0A 1VGYA 3B3TA 3KI9A 3WT4A 2JEVA 1ZLHA 2J8MA 2Z3KA 4XPDB 1PU9A 4BBHA 1Z8LA 2G3AA 2FL4A 1YK3A 1YVOA 1LCPA 2QIRA 3N5FA 5IV0A 5JGFA 4C2YA 1Y7EA 4DNCA 5H86A 4BMHA 2PJ6A 4M6IA 5HVGA 1QSRA 4ZI6A 2BOAA 1L0CA 1CM0A 4MCSA 3SI1A 5AG6A 4AB7A 4PXDA 4JXQA 3FB3A 3UY5A 4P45A 4XNHB 5THWA 4QC6A 3SXNA 2EK8A 3IIBA 1RXTA 7CPAA 4RN7A 2NMTA 4UCMA 4CPAA 4CS0B 4P4EA 1S7LA 4U9ZA 1Y9WA 5K8MA 1ZG7A 2EBJA 2PIYA 2JBJA 2ZELA 3D7DA 1BPMA 3R96A 1PUAA 4NCZA 4OC5A 2P0WA 3GYAA 4JD6A 3W6SA 4MY0A 4QVTA 2NSMA 1M4GA 2CNTA 5K8OA 1Z8XA 2FCKA 2VQYA 3NA6A 4ZX8A 4HNXB 2QYVA 1TIQA 5DS0A 4MMOA 2PE3A 1Z2LA 1NSAA 5JH9A 4ZY2A 1Y9KA 2Z11A 4R9MA 2Z10A 2XEJA 3PZJA 4FD6A 5GCNA 2GE3A 3QAYA 1IGBA 1S60A 3BI1A 3SJGA 4DJLA 1CPSA 1XE4A 4NSQA 2OZGA 4CYOA 2VZYA 3PBBA 3RO0A 1IYKA 4E8OA 1TF8A 2QVPA 2QECA 2WUUA 4B6ZA 3CDXA 2DPTA 3D67A 2OB0A 1YW4A 5ELYA 2G3TA 2AFZA 4NEXA 2PQ8A 2ATRA 4CGMA 1IY7A 2EO8A 1P0HA 4ONUA 5G22A 5KTDA 2ZEEA 1QQ9A 4CGOA 1KWMA 3R9FA 1P4NA 3R9GA 4F0XA 2OU2A 2PJAA 2ZEMA 2BEIA 2PCUA 5AG5A 3VARA 4KVXA 4X3RA 2FE7A 4B12A 4E0AA 1ON0A 4MHZA 3S6KA 2PVVA 3OWCA 4PXEA 4A33A 4JLYA 3EY5A 2IL4A 3CXPA 1IU8A 1I21A 5LYFA 2PJ2A 5DWNA 4F8ZA 3PFEA 2ZOFA 4A30A 3CXSA 1LAPA 4NJRA 4M6GA 1Y0YA 4UBRA 2J8NA 1Z5RA 2K5TA 1AUGA 2V8DA 2Q7SA 3EC4A 4MFZA 2PJ5A 3HUVA 3MN8A 3WC7A 1MJ9A 4A94A 4HPSA 1QSTA 2RC4A 2XEIA 5BWAB 3FYNA 1DTDA 2YNCC 1A2ZA 3IWWA 3CXQA 3CPAA 2NYQA 4ZYQA 2FIWA 2I3CA 1ZG8A 3PB8X 1Z9UA 4MFPA 4P4DA 4AG7A 1ARLA 4MBUA 1JQGA 1BAVA 2BUEA 1IIDA 4ZY0A 3NH5A 2DXQA 4II9A 2WPXA 5D29A 5HH1A 1LANA 2O28A 2G0BA 4F6AA 4A39A 2AFOA 4QBJA 3K2KA 4KOUA 4PPZA 3ISXA 3SHPA 2CTBA 4P4BA 2BL1A 1PCAA 1VHOA 1YX0A 1CG2A 4KOWA 2RFHA 4MHNA 4K30A 4XPLA 1LAMA 2Z3PA 3TOAA 1ZG9A 2BO9A 2V77A 3S6HA 4CAFA 4CRZB 2IQ6A 2YNEA 3BHXA 3SJXA 3TCVA 3GUXA 3WC5A 2ZW7A 3P2HA 5HVFA 4L8AA 2FVGA 2J8RA 3KL9A 1QMUA 4MXUA 2F5IA 2PDOA 4P4IA 1FT7A 1YSJA 3KGQA 3PB9X 4A31A 1Q7LA 3HLPA 4PK2A 4MFKA 1XFOA 2B3UA 4GXHA 4NXYA 5K8PA 2CNMA 3BJ7A 4R76A 3QNVA 4B5OA 3PB4X 4RUHA 2REEA 2Q04A 1B6BA 2GREA 4UEZA 2Q7BA 2B58A 3KQZA 3SJFA 2YGWA 3H8GA 4KOTA 2X7BA 2R98A 3NE8A 1M4LA 4YFJA 1F2PA 4UEEA 1LRZA 1GHEA 3H5ZA 3RYOA 1S7NA 5F47A 4A95A 2PR8A 1N71A 4CGLA 2PJ0A 4ZGYB 4C68A 1J4JA 3B3VA 3TTHA 3D3SA 3FMCA 1YREA 1OBRA 1IB1E 4H2KA 4G1PA 1UFHA 2ZOGA 3TO7A 2ZEOA 2QMLA 2R7HA 3IU1A 3TO6A 4F9UA 4X5KA 2JEWA 5A28A 5JPHA 4CRYB 4MY3A 1S3ZA 3DR6A 4KSAA 2VBQA 2Z3MA 3B8GA 4X2TA 5CPAA 5AG7A 3WR7A 4KZTA 2HV2A 3I3GA 3FNCA 3VWDA 2C6PA 2RB7A 3P2FA 2F8HA 4OIDA 4H6UA 4CAWA 1X12A 2YNCA 4MCPA 4WJBA 3LD2A 2ARHA 2O4HA 2PRBA 4OC0A 3KR4A 3LWUA 4R87A 4EMEA 4C7IA 5LYDA 3FEDA 4KLVA 1RTQA 4OMEA 2C6CA 4OAEA 2ZEDA 4H6ZA 3CT9A 3NH8A 4CGNA 3PB6X 5IB0A 2PJCA 2GFQA 2B4DA 1YR0A 2F7VA 2D4PA 2IJZA 4DUKA 3EXNA 3IU2A 4PXCA 2P6GA 5K8NA 1XRYA 2PJBA 2ZXVA 2CF4A 3D7GA 3KKWA 3EFAA 1TKJA 4FD7A 5AGEA 5CNPA 4ZX9A 3RNZA 4HNWB 1IYLA 4MHPA 4CAVA 2I00A 2Z3NA 3LACA 1EE3P 1YVKA 3VATA 4R7MA 4U9YA 1ELMP 4Y49C 1I1DA 4IAVA 4NGNA 3GLJA 3PB7X 4MI4A 3KQXA 3W91A 4MFQA 3NE7A 4HNYB 2B3VA 4B5PA 1WWZA 3D7HA 3JUWA 1IICA 4F0YA 1Q2CA 2PJ4A 1CP7A 4KUAA 3PRTA 4MCRA 4BINA 4KOVA 4M3SA 2Z3LA 1YLEA 4UFVA 2ZPAA 2PJ1A 3B2YA 3B3SA 4F9VA 4PXBA 4KOYA 3T90A 1XIXA 3A9LA 2PJ3A 3B35A 1Q2YA 1Z4EA 3DDDA 3RAMA 4B14A 1ELLP 3FIXA 1JWQA 1KUXA 1DE4C 2G9DA 1F2OA 1XBUA 4A2ZA 3L2NA 1PYTB 4TWEA 1SQHA 3N7ZA 2JLMA 4XPKA 4P6YA 3FRMA 2OZHA 1YGHA 2P6FA 3S6FA 4AVAA 1FNOA 4B11A 2FIAA 4LX9A 5ISVA 4EVYA 3JVNA 2ODFA 2P6EA 1XMBA 1R3NA 4CYNA 1KUYA 4Q36A 2OH1A 2R1IA 4PQAA 4AVCA 4UFWA 1AMPA 3H4QA 2EWBA 5G1ZA 3S6GA 4GM5A 4WWVA 4IUSA 4AXVA 4BD9A 4FBEA 2QJ8A 4PSXA 3G3SA 4OLLA 1B87A 1Y0RA 3MRUA 1R57A 4UWIA 2FSRA 4U5YA 3B3CA 3TO9A 3D2PA 2CTCA 3CZXA 1CBXA 1TKHA 4MRIA 1ZO0A 4ONWA 4UCNA 3V8IA 4FAIA 4YRHA 4NJQA 2J9AA 5J8FA 1RO5A 3TC8A 3IJ3A 4MFLA 2O53A 4P44A 3NFZA 2VXKA 1NE9A 2GU2A 1R43A 3QB8A 4JJXA 1YMEA 2XEGA 3KZWA 1M1DA 2FT0A 3S9MA 4ZY1A 5HXDA 1VIXA 2B5GA 5EBVA 4GS4A 4EWTA 1CJWA 4UWJA 4FUUA 3R9EA 4DYOA 2Q44A 1YLOA 4O23A 4YGOA 4KLWA 4YWYA 1IOFA 4L89A 4UCPA 2BCOA 2HQYA 4KUBA 3WC6A 1XMTA 4P10A 1FY7A 2OR4A 2JDCA 4FD4A 4YU9A 4Y49B 5LRKA 5J1QA 3DNSA 2C27A 2PJ9A 1XJOA 3D66A 2Q43A 3I9SA 5F48A 3MGDA 2PC1A 4UEFA 3TFYA 4KSIA 2H5MA 4RI1A 3BXMA 2R8VA 1AYEA 1XF8A 3KR5A 1UWYA 4R3LA 2VI7A 1S7FA 2AFSA 2Q0YA 1MJBA 2C6GA 2POKA 1WK4A 1CX8A 2ZW5A 4R6TA 5HVHA 5I4MA 4NGPA 4B13A 5JQ4A 4LQGA 2AFMA 3DLJA 1BLLE 3JTKA 5FVJA 4R3KA 2Q4VA 1IOIA 3D2MA 2ZW6A 2ANPA 4A37A 2BSWA 3KHXA 2OOTA 1CP6A 1M4IA 4QUSA 3IEHA 4Q7AA 2FXFA 4LQ6A 4RS2A 1HDUA 2AFXA 5F09A 4CGPA 4A32A 3B7IA 3D68A 1BPNA 2DEAA 3FH4A 2WZNA 4P4FA 5AG4A 1K4JA 3B3WA 3PEIA 4M6HA 2CIJA 4JWPA 3WABA 3PGPA 3R1KA 4IK2A 4K3NA 4KOSA 1VHSA 5IB9A 3D7FA 2AFUA 5G20A 1XOVA 2KCWA 3G8WA 3TT2A 1I12A 5DWMA 5KTCA 1OZPA 2B4DB 5A27A 4A38A 5I0CA 2PSWA 2EK9A 2PJ8A 3IGRA 3LODA 1F57A 1M44A 1YW6A 2WYRA 2ZEFA 4X8IA 4PSWA 3PP9A 1H8LA 3GKRA 3V38A 3S9NA 3K9UA 5F46A 1GYTA 1NMTA 4Z65A 1XEBA 2GANA 4Q38A 5H84A 5KTAA 3DR8A 1Z8WA 3K9TA 4J3GA 3SJEA 5LYIA 2C1CA 1YQEA 4QB9A 3IWEA 1Z4RA 4B10A 1MJAA 5G21A 4B5PB 2REFA 4OC1A 4E2AA 3E0KA 4MFJA 3I1UA 4KSFA 3D8PA 3VH9A 4MCQA 5IX3A 1VHEA 1TF9A 4UA3A 4OC2A 2JBKA 4CYPA 3D4UA 2DF5A 3RZAA 4W9YA 2AE6A 4PK3A 1QSNA 4CAXA 2WSAA 5C82A 4IF5A 4UIAA 5EC4A 3TX8A 2VEZA 1VKCA 4JYWA 4NGTA 3IC1A 2B4BA 1LOKA 1MK4A 3S9LA 1BO4A 3KASA 4CAEA 2I79A 4IHMA 4I49A 5CBMA 2HC9A 4KVME 4XPDC 3DGVA 4MJ8A 3NH4A 5C88A 5LYLA 3C26A 5E96A 4C7HA 2ZEPA 3BLNA 3IO1A 4NGMA 2GLJA 3FVLA 3R95A 2D4OA 2ZW4A 6CPAA 2PJ7A 3FBUA 4NGRA 3W6XA 3H8FA 1U6MA 4MHYA 4P4JA 3FF3A 4FD5A 4OIWA 2V8VA 1M4DA 3H8EA 4OP4A 3KHZA 4XNHC 2HB6A 4R57A 1S7KA 2DPSA 4ZBGA 5LRJA 3VWEA 1KUVA 3BJ8A 3FXTA 1HDQA 5HMNA
chains in the Genus database with same CATH topology
4OADA 4KVOE 2PR1A 2Z3OA 1NSLA 3IWGA 2JDDA 2EVNA 2GIVA 2CNSA 2WPWA 3TOBA 4UFXA 4AVBA 4JXRA 2B5GB 2CY2A 4KORA 4KOXA 1Q2DA 2Q4YA 4AG9A 3EO4A 3ZZIA 4LUAA 1S5KA 3ZJ0A 3QAHA 4M85A 2EUIA 3GY9A 3DSBA 5F49A 1KZFA 2CXAA 4C2XA 2OZUA 4H89A 3F0AA 3SXOA 3T9YA 3TE4A 5J8CA 4MHDA 4C2ZA 3F5BA 3F8KA 1Y7RA 1QSMA 2FS5A 2VZZA 4HKFA 2A4NA 2YNDA 2Z0ZA 4CYQA 4KS9A 2AJ6A 1BOBA 2HUZA 1V0CA 2Y0MA 4PV6A 1QSOA 4NF1A 4ORFA 2JEVA 2J8MA 2Z3KA 4XPDB 1PU9A 4BBHA 2G3AA 2FL4A 1YK3A 1YVOA 2QIRA 5IV0A 4C2YA 4DNCA 5H86A 4BMHA 1QSRA 1L0CA 1CM0A 5AG6A 4AB7A 4JXQA 3FB3A 3UY5A 4XNHB 4QC6A 3SXNA 1RXTA 2NMTA 4UCMA 4CS0B 4U9ZA 1S7LA 1Y9WA 3R96A 1PUAA 4NCZA 2P0WA 3GYAA 4JD6A 3W6SA 4MY0A 4QVTA 1M4GA 2CNTA 2FCKA 2VQYA 4HNXB 1TIQA 1Y9KA 2Z11A 4R9MA 2Z10A 3PZJA 4FD6A 5GCNA 2GE3A 1S60A 1XE4A 4NSQA 2OZGA 4CYOA 2VZYA 1IYKA 4E8OA 2WUUA 2QECA 2DPTA 2OB0A 2G3TA 4NEXA 2PQ8A 2ATRA 4CGMA 4ONUA 1P0HA 5G22A 5KTDA 4CGOA 3R9FA 3R9GA 1P4NA 4F0XA 2OU2A 2BEIA 5AG5A 4KVXA 4B12A 2FE7A 4E0AA 1ON0A 3S6KA 3OWCA 4A33A 4JLYA 3EY5A 2IL4A 3CXPA 1I21A 5DWNA 4A30A 3CXSA 4UBRA 2J8NA 2K5TA 3EC4A 4MFZA 1MJ9A 1QSTA 2RC4A 5BWAB 3FYNA 2YNCC 3CXQA 2FIWA 1Z9UA 4MFPA 4AG7A 4MBUA 2BUEA 1IIDA 2DXQA 4II9A 2WPXA 5HH1A 2O28A 2G0BA 4F6AA 4QBJA 4KOUA 3SHPA 2BL1A 4KOWA 1YX0A 4K30A 4XPLA 2Z3PA 3TOAA 4CRZB 4CAFA 3S6HA 2YNEA 3TCVA 2ZW7A 3P2HA 4L8AA 2J8RA 2F5IA 2PDOA 4A31A 4PK2A 4MFKA 2B3UA 4NXYA 2CNMA 3BJ7A 4B5OA 2REEA 2Q04A 1B6BA 2Q7BA 2B58A 2YGWA 4KOTA 2X7BA 2R98A 4YFJA 5J8FA 1LRZA 1GHEA 3H5ZA 3RYOA 1S7NA 5F47A 4A95A 2PR8A 1N71A 4CGLA 4ZGYB 4C68A 1J4JA 3TTHA 3D3SA 1YREA 1IB1E 1UFHA 3TO7A 2QMLA 2R7HA 3IU1A 3TO6A 4X5KA 5A28A 5JPHA 4CRYB 4MY3A 1S3ZA 3DR6A 4KSAA 3B8GA 2VBQA 2Z3MA 5AG7A 3WR7A 4KZTA 2HV2A 3I3GA 3FNCA 3VWDA 3P2FA 4CAWA 4H6UA 2YNCA 3LD2A 2ARHA 2PRBA 4R87A 4C7IA 4KLVA 4OAEA 4H6ZA 4CGNA 5IB0A 2B4DA 1YR0A 2D4PA 3EXNA 3IU2A 2P6GA 2ZXVA 3KKWA 4FD7A 5AGEA 3EFAA 5CNPA 4HNWB 1IYLA 4CAVA 2I00A 2Z3NA 1YVKA 4U9YA 4Y49C 1I1DA 4MI4A 3W91A 4MFQA 3NE7A 4HNYB 2B3VA 4B5PA 1WWZA 3JUWA 1IICA 4F0YA 1Q2CA 4KUAA 4KOVA 4M3SA 2Z3LA 1YLEA 4UFVA 2ZPAA 4KOYA 3T90A 1XIXA 3A9LA 4B14A 3DDDA 1Q2YA 1Z4EA 3FIXA 1KUXA 4A2ZA 1SQHA 3N7ZA 2JLMA 4XPKA 3FRMA 2OZHA 1YGHA 2P6FA 3S6FA 4AVAA 4B11A 2FIAA 4LX9A 5ISVA 4EVYA 3JVNA 2P6EA 4CYNA 1KUYA 4Q36A 2OH1A 2R1IA 4AVCA 4UFWA 3H4QA 5G1ZA 3S6GA 4IUSA 4PSXA 3G3SA 4OLLA 1B87A 1R57A 4UWIA 2FSRA 4U5YA 3TO9A 3D2PA 3V8IA 1ZO0A 4UCNA 4YRHA 1RO5A 4MFLA 2VXKA 1NE9A 3QB8A 4JJXA 1M1DA 2FT0A 2B5GA 5EBVA 4GS4A 1CJWA 4UWJA 3R9EA 2Q44A 4YGOA 4KLWA 4L89A 4UCPA 2HQYA 4KUBA 1XMTA 1FY7A 2JDCA 4FD4A 4Y49B 3DNSA 2C27A 3I9SA 5F48A 3TFYA 3MGDA 2PC1A 2H5MA 4RI1A 2R8VA 1XF8A 4R3LA 2VI7A 1S7FA 2Q0YA 1MJBA 1WK4A 2ZW5A 4B13A 5JQ4A 3JTKA 5FVJA 4R3KA 2Q4VA 3D2MA 2ZW6A 2BSWA 1M4IA 4QUSA 2FXFA 4RS2A 4CGPA 4A32A 5AG4A 1K4JA 4JWPA 3PGPA 3R1KA 4KOSA 1VHSA 5G20A 2KCWA 3G8WA 3TT2A 1I12A 5DWMA 5KTCA 1OZPA 2B4DB 5A27A 5I0CA 2PSWA 3IGRA 3LODA 1M44A 4PSWA 3PP9A 3GKRA 3K9UA 5F46A 1NMTA 1XEBA 2GANA 4Q38A 5H84A 5KTAA 3DR8A 4J3GA 4QB9A 3IWEA 1Z4RA 4B10A 1MJAA 5G21A 4B5PB 2REFA 4E2AA 3E0KA 4MFJA 4KSFA 3D8PA 5IX3A 4UA3A 4CYPA 2AE6A 4PK3A 1QSNA 4CAXA 2WSAA 5C82A 4IF5A 5EC4A 2VEZA 1VKCA 1MK4A 2B4BA 1BO4A 4CAEA 2I79A 4I49A 4KVME 4XPDC 4MJ8A 5C88A 3C26A 5E96A 4C7HA 3BLNA 3R95A 2D4OA 2ZW4A 3FBUA 3W6XA 1U6MA 4FD5A 1M4DA 4XNHC 4ZBGA 4R57A 1S7KA 2DPSA 3VWEA 1KUVA 3BJ8A 3FXTA 5HMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAD A;  4KVO E;  2PR1 A;  1NSL A;  3IWG A;  2JDD A;  2EVN A;  2GIV A;  2CNS A;  2WPW A;  3TOB A;  4AVB A;  4JXR A;  2B5G B;  2CY2 A;  4KOR A;  4KOX A;  1Q2D A;  2Q4Y A;  4AG9 A;  3EO4 A;  3ZZI A;  4LUA A;  1S5K A;  3ZJ0 A;  3QAH A;  4M85 A;  2EUI A;  3GY9 A;  3DSB A;  5F49 A;  1KZF A;  2OZU A;  4H89 A;  3F0A A;  3SXO A;  3T9Y A;  3TE4 A;  5J8C A;  4MHD A;  3F5B A;  3F8K A;  1Y7R A;  1QSM A;  2FS5 A;  2VZZ A;  4HKF A;  2A4N A;  2Z0Z A;  2AJ6 A;  1BOB A;  2HUZ A;  1V0C A;  2Y0M A;  4PV6 A;  1QSO A;  4NF1 A;  4ORF A;  2JEV A;  2J8M A;  4XPD B;  1PU9 A;  2G3A A;  2FL4 A;  1YK3 A;  1YVO A;  2QIR A;  5IV0 A;  4DNC A;  5H86 A;  4BMH A;  1QSR A;  1L0C A;  1CM0 A;  4AB7 A;  4JXQ A;  3FB3 A;  3UY5 A;  4XNH B;  4QC6 A;  3SXN A;  1RXT A;  2NMT A;  4CS0 B;  4U9Z A;  1S7L A;  1Y9W A;  3R96 A;  1PUA A;  4NCZ A;  2P0W A;  3GYA A;  4JD6 A;  3W6S A;  4MY0 A;  4QVT A;  1M4G A;  2CNT A;  2FCK A;  2VQY A;  4HNX B;  1TIQ A;  1Y9K A;  2Z11 A;  4R9M A;  2Z10 A;  3PZJ A;  4FD6 A;  5GCN A;  2GE3 A;  1S60 A;  1XE4 A;  4NSQ A;  2OZG A;  2VZY A;  1IYK A;  4E8O A;  2QEC A;  2OB0 A;  2G3T A;  4NEX A;  2PQ8 A;  2ATR A;  4ONU A;  1P0H A;  5KTD A;  3R9F A;  3R9G A;  1P4N A;  2OU2 A;  2BEI A;  4KVX A;  2FE7 A;  4E0A A;  1ON0 A;  3S6K A;  3OWC A;  4JLY A;  3EY5 A;  2IL4 A;  3CXP A;  1I21 A;  5DWN A;  3CXS A;  4UBR A;  2J8N A;  2K5T A;  3EC4 A;  1MJ9 A;  1QST A;  2RC4 A;  3FYN A;  3CXQ A;  2FIW A;  1Z9U A;  4AG7 A;  4MBU A;  2BUE A;  1IID A;  2DXQ A;  4II9 A;  2WPX A;  5HH1 A;  2O28 A;  2G0B A;  4F6A A;  4QBJ A;  4KOU A;  3SHP A;  2BL1 A;  4KOW A;  1YX0 A;  4K30 A;  4XPL A;  3TOA A;  4CRZ B;  3S6H A;  3TCV A;  2ZW7 A;  3P2H A;  4L8A A;  2J8R A;  2F5I A;  2PDO A;  4PK2 A;  2B3U A;  4NXY A;  2CNM A;  3BJ7 A;  4B5O A;  2REE A;  2Q04 A;  1B6B A;  2Q7B A;  2B58 A;  4KOT A;  2X7B A;  2R98 A;  4YFJ A;  5J8F A;  1LRZ A;  1GHE A;  3RYO A;  1S7N A;  5F47 A;  2PR8 A;  1N71 A;  1J4J A;  3TTH A;  3D3S A;  1YRE A;  1IB1 E;  1UFH A;  3TO7 A;  2QML A;  2R7H A;  3TO6 A;  4X5K A;  5JPH A;  4CRY B;  4MY3 A;  1S3Z A;  3DR6 A;  3B8G A;  2VBQ A;  3WR7 A;  4KZT A;  2HV2 A;  3I3G A;  3FNC A;  3VWD A;  3P2F A;  4CAW A;  4H6U A;  3LD2 A;  2ARH A;  2PRB A;  4R87 A;  4KLV A;  4OAE A;  4H6Z A;  5IB0 A;  2B4D A;  1YR0 A;  2D4P A;  3EXN A;  2P6G A;  2ZXV A;  3KKW A;  4FD7 A;  3EFA A;  5CNP A;  4HNW B;  1IYL A;  4CAV A;  2I00 A;  1YVK A;  4U9Y A;  4Y49 C;  1I1D A;  4MI4 A;  3W91 A;  3NE7 A;  4HNY B;  2B3V A;  4B5P A;  1WWZ A;  3JUW A;  1IIC A;  4F0Y A;  1Q2C A;  4KUA A;  4KOV A;  4M3S A;  1YLE A;  2ZPA A;  4KOY A;  3T90 A;  1XIX A;  3DDD A;  1Q2Y A;  1Z4E A;  3FIX A;  1KUX A;  1SQH A;  3N7Z A;  2JLM A;  4XPK A;  3FRM A;  2OZH A;  1YGH A;  2P6F A;  3S6F A;  4AVA A;  2FIA A;  4LX9 A;  5ISV A;  4EVY A;  3JVN A;  2P6E A;  1KUY A;  2OH1 A;  2R1I A;  4AVC A;  3H4Q A;  3S6G A;  4IUS A;  4PSX A;  3G3S A;  4OLL A;  1B87 A;  1R57 A;  4UWI A;  2FSR A;  4U5Y A;  3TO9 A;  3D2P A;  3V8I A;  4YRH A;  1RO5 A;  2VXK A;  1NE9 A;  3QB8 A;  4JJX A;  1M1D A;  2FT0 A;  2B5G A;  5EBV A;  4GS4 A;  1CJW A;  4UWJ A;  3R9E A;  2Q44 A;  4YGO A;  4KLW A;  4L89 A;  2HQY A;  4KUB A;  1XMT A;  1FY7 A;  2JDC A;  4FD4 A;  4Y49 B;  3DNS A;  2C27 A;  3I9S A;  5F48 A;  3TFY A;  3MGD A;  2PC1 A;  2H5M A;  4RI1 A;  2R8V A;  1XF8 A;  4R3L A;  2VI7 A;  1S7F A;  2Q0Y A;  1MJB A;  1WK4 A;  2ZW5 A;  5JQ4 A;  5FVJ A;  4R3K A;  2Q4V A;  3D2M A;  2ZW6 A;  2BSW A;  1M4I A;  4QUS A;  2FXF A;  4RS2 A;  1K4J A;  4JWP A;  3PGP A;  3R1K A;  4KOS A;  1VHS A;  2KCW A;  3G8W A;  3TT2 A;  1I12 A;  5DWM A;  5KTC A;  1OZP A;  2B4D B;  5I0C A;  2PSW A;  3IGR A;  3LOD A;  1M44 A;  4PSW A;  3PP9 A;  3GKR A;  3K9U A;  5F46 A;  1NMT A;  1XEB A;  2GAN A;  5H84 A;  5KTA A;  3DR8 A;  4J3G A;  4QB9 A;  1Z4R A;  1MJA A;  4B5P B;  2REF A;  4E2A A;  3E0K A;  3D8P A;  5IX3 A;  4UA3 A;  2AE6 A;  4PK3 A;  1QSN A;  4CAX A;  5C82 A;  4IF5 A;  5EC4 A;  2VEZ A;  1VKC A;  1MK4 A;  2B4B A;  1BO4 A;  2I79 A;  4I49 A;  4KVM E;  4XPD C;  4MJ8 A;  5C88 A;  3C26 A;  5E96 A;  3BLN A;  3R95 A;  2D4O A;  2ZW4 A;  3FBU A;  3W6X A;  1U6M A;  4FD5 A;  1M4D A;  4XNH C;  4ZBG A;  4R57 A;  1S7K A;  3VWE A;  1KUV A;  3BJ8 A;  3FXT A;  5HMN A; 
#chains in the Genus database with same CATH topology
 4OAD A;  4KVO E;  1TXR A;  3IFE A;  3LMS A;  2PR1 A;  2Z3O A;  3SI2 A;  1NSL A;  3IWG A;  2JDD A;  2EVN A;  2GIV A;  2CNS A;  2ZEN A;  4OC3 A;  3V7Z A;  2WPW A;  3TOB A;  4UFX A;  4AVB A;  3FEC A;  3FX6 A;  3PFO A;  2AFW A;  4NFR A;  4JXR A;  2B5G B;  3T8W A;  1HEE A;  2CY2 A;  4KOR A;  3ISZ A;  4EFD A;  3GIU A;  4KOX A;  2V8G A;  4JZ0 A;  5JM6 A;  1Q2D A;  2Q4Y A;  4AG9 A;  8CPA A;  3EO4 A;  4TNU A;  3ZZI A;  2VL1 A;  4LUA A;  4OKO A;  1S5K A;  3BI0 A;  3ZJ0 A;  3QAH A;  4M85 A;  4OC4 A;  4R8F A;  2EUI A;  2PRQ A;  2Q4Z A;  3GY9 A;  3DSB A;  5D8N A;  5F49 A;  1KZF A;  2CXA A;  4C2X A;  2OZU A;  4H89 A;  1LFW A;  4UIB A;  3F0A A;  1Z8T A;  4UF4 A;  4NGS A;  2ABZ A;  1ARM A;  4NGQ A;  2XEF A;  3SXO A;  2ZEG A;  3T9Y A;  4FWU A;  1CPX A;  3FJU A;  3CPX A;  3TE4 A;  1X10 A;  5J8C A;  4MHD A;  5LRG A;  3F5B A;  3F8K A;  4C2Z A;  3FEE A;  1Y7R A;  3SI0 A;  1QSM A;  2FS5 A;  2VZZ A;  4HKF A;  2A4N A;  2YND A;  2Z0Z A;  5EMI A;  4CYQ A;  1TKF A;  3JRU A;  2GLF A;  2AJ6 A;  4KS9 A;  2ZEH A;  1ZLI A;  2V8H A;  1BOB A;  3PBE A;  2PVW A;  2HUZ A;  1V0C A;  2Y0M A;  4PV6 A;  3RBU A;  2PIZ A;  1QSO A;  2IMO A;  2Q51 A;  4NF1 A;  4ORF A;  3GB0 A;  1VGY A;  3B3T A;  3KI9 A;  3WT4 A;  2JEV A;  1ZLH A;  2J8M A;  2Z3K A;  4XPD B;  1PU9 A;  4BBH A;  1Z8L A;  2G3A A;  2FL4 A;  1YK3 A;  1YVO A;  1LCP A;  2QIR A;  3N5F A;  5IV0 A;  5JGF A;  4C2Y A;  1Y7E A;  4DNC A;  5H86 A;  4BMH A;  2PJ6 A;  4M6I A;  5HVG A;  1QSR A;  4ZI6 A;  2BOA A;  1L0C A;  1CM0 A;  4MCS A;  3SI1 A;  5AG6 A;  4AB7 A;  4PXD A;  4JXQ A;  3FB3 A;  3UY5 A;  4P45 A;  4XNH B;  5THW A;  4QC6 A;  3SXN A;  2EK8 A;  3IIB A;  1RXT A;  7CPA A;  4RN7 A;  2NMT A;  4UCM A;  4CPA A;  4CS0 B;  4P4E A;  1S7L A;  4U9Z A;  1Y9W A;  5K8M A;  1ZG7 A;  2EBJ A;  2PIY A;  2JBJ A;  2ZEL A;  3D7D A;  1BPM A;  3R96 A;  1PUA A;  4NCZ A;  4OC5 A;  2P0W A;  3GYA A;  4JD6 A;  3W6S A;  4MY0 A;  4QVT A;  2NSM A;  1M4G A;  2CNT A;  5K8O A;  1Z8X A;  2FCK A;  2VQY A;  3NA6 A;  4ZX8 A;  4HNX B;  2QYV A;  1TIQ A;  5DS0 A;  4MMO A;  2PE3 A;  1Z2L A;  1NSA A;  5JH9 A;  4ZY2 A;  1Y9K A;  2Z11 A;  4R9M A;  2Z10 A;  2XEJ A;  3PZJ A;  4FD6 A;  5GCN A;  2GE3 A;  3QAY A;  1IGB A;  1S60 A;  3BI1 A;  3SJG A;  4DJL A;  1CPS A;  1XE4 A;  4NSQ A;  2OZG A;  4CYO A;  2VZY A;  3PBB A;  3RO0 A;  1IYK A;  4E8O A;  1TF8 A;  2QVP A;  2QEC A;  2WUU A;  4B6Z A;  3CDX A;  2DPT A;  3D67 A;  2OB0 A;  1YW4 A;  5ELY A;  2G3T A;  2AFZ A;  4NEX A;  2PQ8 A;  2ATR A;  4CGM A;  1IY7 A;  2EO8 A;  1P0H A;  4ONU A;  5G22 A;  5KTD A;  2ZEE A;  1QQ9 A;  4CGO A;  1KWM A;  3R9F A;  1P4N A;  3R9G A;  4F0X A;  2OU2 A;  2PJA A;  2ZEM A;  2BEI A;  2PCU A;  5AG5 A;  3VAR A;  4KVX A;  4X3R A;  2FE7 A;  4B12 A;  4E0A A;  1ON0 A;  4MHZ A;  3S6K A;  2PVV A;  3OWC A;  4PXE A;  4A33 A;  4JLY A;  3EY5 A;  2IL4 A;  3CXP A;  1IU8 A;  1I21 A;  5LYF A;  2PJ2 A;  5DWN A;  4F8Z A;  3PFE A;  2ZOF A;  4A30 A;  3CXS A;  1LAP A;  4NJR A;  4M6G A;  1Y0Y A;  4UBR A;  2J8N A;  1Z5R A;  2K5T A;  1AUG A;  2V8D A;  2Q7S A;  3EC4 A;  4MFZ A;  2PJ5 A;  3HUV A;  3MN8 A;  3WC7 A;  1MJ9 A;  4A94 A;  4HPS A;  1QST A;  2RC4 A;  2XEI A;  5BWA B;  3FYN A;  1DTD A;  2YNC C;  1A2Z A;  3IWW A;  3CXQ A;  3CPA A;  2NYQ A;  4ZYQ A;  2FIW A;  2I3C A;  1ZG8 A;  3PB8 X;  1Z9U A;  4MFP A;  4P4D A;  4AG7 A;  1ARL A;  4MBU A;  1JQG A;  1BAV A;  2BUE A;  1IID A;  4ZY0 A;  3NH5 A;  2DXQ A;  4II9 A;  2WPX A;  5D29 A;  5HH1 A;  1LAN A;  2O28 A;  2G0B A;  4F6A A;  4A39 A;  2AFO A;  4QBJ A;  3K2K A;  4KOU A;  4PPZ A;  3ISX A;  3SHP A;  2CTB A;  4P4B A;  2BL1 A;  1PCA A;  1VHO A;  1YX0 A;  1CG2 A;  4KOW A;  2RFH A;  4MHN A;  4K30 A;  4XPL A;  1LAM A;  2Z3P A;  3TOA A;  1ZG9 A;  2BO9 A;  2V77 A;  3S6H A;  4CAF A;  4CRZ B;  2IQ6 A;  2YNE A;  3BHX A;  3SJX A;  3TCV A;  3GUX A;  3WC5 A;  2ZW7 A;  3P2H A;  5HVF A;  4L8A A;  2FVG A;  2J8R A;  3KL9 A;  1QMU A;  4MXU A;  2F5I A;  2PDO A;  4P4I A;  1FT7 A;  1YSJ A;  3KGQ A;  3PB9 X;  4A31 A;  1Q7L A;  3HLP A;  4PK2 A;  4MFK A;  1XFO A;  2B3U A;  4GXH A;  4NXY A;  5K8P A;  2CNM A;  3BJ7 A;  4R76 A;  3QNV A;  4B5O A;  3PB4 X;  4RUH A;  2REE A;  2Q04 A;  1B6B A;  2GRE A;  4UEZ A;  2Q7B A;  2B58 A;  3KQZ A;  3SJF A;  2YGW A;  3H8G A;  4KOT A;  2X7B A;  2R98 A;  3NE8 A;  1M4L A;  4YFJ A;  1F2P A;  4UEE A;  1LRZ A;  1GHE A;  3H5Z A;  3RYO A;  1S7N A;  5F47 A;  4A95 A;  2PR8 A;  1N71 A;  4CGL A;  2PJ0 A;  4ZGY B;  4C68 A;  1J4J A;  3B3V A;  3TTH A;  3D3S A;  3FMC A;  1YRE A;  1OBR A;  1IB1 E;  4H2K A;  4G1P A;  1UFH A;  2ZOG A;  3TO7 A;  2ZEO A;  2QML A;  2R7H A;  3IU1 A;  3TO6 A;  4F9U A;  4X5K A;  2JEW A;  5A28 A;  5JPH A;  4CRY B;  4MY3 A;  1S3Z A;  3DR6 A;  4KSA A;  2VBQ A;  2Z3M A;  3B8G A;  4X2T A;  5CPA A;  5AG7 A;  3WR7 A;  4KZT A;  2HV2 A;  3I3G A;  3FNC A;  3VWD A;  2C6P A;  2RB7 A;  3P2F A;  2F8H A;  4OID A;  4H6U A;  4CAW A;  1X12 A;  2YNC A;  4MCP A;  4WJB A;  3LD2 A;  2ARH A;  2O4H A;  2PRB A;  4OC0 A;  3KR4 A;  3LWU A;  4R87 A;  4EME A;  4C7I A;  5LYD A;  3FED A;  4KLV A;  1RTQ A;  4OME A;  2C6C A;  4OAE A;  2ZED A;  4H6Z A;  3CT9 A;  3NH8 A;  4CGN A;  3PB6 X;  5IB0 A;  2PJC A;  2GFQ A;  2B4D A;  1YR0 A;  2F7V A;  2D4P A;  2IJZ A;  4DUK A;  3EXN A;  3IU2 A;  4PXC A;  2P6G A;  5K8N A;  1XRY A;  2PJB A;  2ZXV A;  2CF4 A;  3D7G A;  3KKW A;  3EFA A;  1TKJ A;  4FD7 A;  5AGE A;  5CNP A;  4ZX9 A;  3RNZ A;  4HNW B;  1IYL A;  4MHP A;  4CAV A;  2I00 A;  2Z3N A;  3LAC A;  1EE3 P;  1YVK A;  3VAT A;  4R7M A;  4U9Y A;  1ELM P;  4Y49 C;  1I1D A;  4IAV A;  4NGN A;  3GLJ A;  3PB7 X;  4MI4 A;  3KQX A;  3W91 A;  4MFQ A;  3NE7 A;  4HNY B;  2B3V A;  4B5P A;  1WWZ A;  3D7H A;  3JUW A;  1IIC A;  4F0Y A;  1Q2C A;  2PJ4 A;  1CP7 A;  4KUA A;  3PRT A;  4MCR A;  4BIN A;  4KOV A;  4M3S A;  2Z3L A;  1YLE A;  4UFV A;  2ZPA A;  2PJ1 A;  3B2Y A;  3B3S A;  4F9V A;  4PXB A;  4KOY A;  3T90 A;  1XIX A;  3A9L A;  2PJ3 A;  3B35 A;  1Q2Y A;  1Z4E A;  3DDD A;  3RAM A;  4B14 A;  1ELL P;  3FIX A;  1JWQ A;  1KUX A;  1DE4 C;  2G9D A;  1F2O A;  1XBU A;  4A2Z A;  3L2N A;  1PYT B;  4TWE A;  1SQH A;  3N7Z A;  2JLM A;  4XPK A;  4P6Y A;  3FRM A;  2OZH A;  1YGH A;  2P6F A;  3S6F A;  4AVA A;  1FNO A;  4B11 A;  2FIA A;  4LX9 A;  5ISV A;  4EVY A;  3JVN A;  2ODF A;  2P6E A;  1XMB A;  1R3N A;  4CYN A;  1KUY A;  4Q36 A;  2OH1 A;  2R1I A;  4PQA A;  4AVC A;  4UFW A;  1AMP A;  3H4Q A;  2EWB A;  5G1Z A;  3S6G A;  4GM5 A;  4WWV A;  4IUS A;  4AXV A;  4BD9 A;  4FBE A;  2QJ8 A;  4PSX A;  3G3S A;  4OLL A;  1B87 A;  1Y0R A;  3MRU A;  1R57 A;  4UWI A;  2FSR A;  4U5Y A;  3B3C A;  3TO9 A;  3D2P A;  2CTC A;  3CZX A;  1CBX A;  1TKH A;  4MRI A;  1ZO0 A;  4ONW A;  4UCN A;  3V8I A;  4FAI A;  4YRH A;  4NJQ A;  2J9A A;  5J8F A;  1RO5 A;  3TC8 A;  3IJ3 A;  4MFL A;  2O53 A;  4P44 A;  3NFZ A;  2VXK A;  1NE9 A;  2GU2 A;  1R43 A;  3QB8 A;  4JJX A;  1YME A;  2XEG A;  3KZW A;  1M1D A;  2FT0 A;  3S9M A;  4ZY1 A;  5HXD A;  1VIX A;  2B5G A;  5EBV A;  4GS4 A;  4EWT A;  1CJW A;  4UWJ A;  4FUU A;  3R9E A;  4DYO A;  2Q44 A;  1YLO A;  4O23 A;  4YGO A;  4KLW A;  4YWY A;  1IOF A;  4L89 A;  4UCP A;  2BCO A;  2HQY A;  4KUB A;  3WC6 A;  1XMT A;  4P10 A;  1FY7 A;  2OR4 A;  2JDC A;  4FD4 A;  4YU9 A;  4Y49 B;  5LRK A;  5J1Q A;  3DNS A;  2C27 A;  2PJ9 A;  1XJO A;  3D66 A;  2Q43 A;  3I9S A;  5F48 A;  3MGD A;  2PC1 A;  4UEF A;  3TFY A;  4KSI A;  2H5M A;  4RI1 A;  3BXM A;  2R8V A;  1AYE A;  1XF8 A;  3KR5 A;  1UWY A;  4R3L A;  2VI7 A;  1S7F A;  2AFS A;  2Q0Y A;  1MJB A;  2C6G A;  2POK A;  1WK4 A;  1CX8 A;  2ZW5 A;  4R6T A;  5HVH A;  5I4M A;  4NGP A;  4B13 A;  5JQ4 A;  4LQG A;  2AFM A;  3DLJ A;  1BLL E;  3JTK A;  5FVJ A;  4R3K A;  2Q4V A;  1IOI A;  3D2M A;  2ZW6 A;  2ANP A;  4A37 A;  2BSW A;  3KHX A;  2OOT A;  1CP6 A;  1M4I A;  4QUS A;  3IEH A;  4Q7A A;  2FXF A;  4LQ6 A;  4RS2 A;  1HDU A;  2AFX A;  5F09 A;  4CGP A;  4A32 A;  3B7I A;  3D68 A;  1BPN A;  2DEA A;  3FH4 A;  2WZN A;  4P4F A;  5AG4 A;  1K4J A;  3B3W A;  3PEI A;  4M6H A;  2CIJ A;  4JWP A;  3WAB A;  3PGP A;  3R1K A;  4IK2 A;  4K3N A;  4KOS A;  1VHS A;  5IB9 A;  3D7F A;  2AFU A;  5G20 A;  1XOV A;  2KCW A;  3G8W A;  3TT2 A;  1I12 A;  5DWM A;  5KTC A;  1OZP A;  2B4D B;  5A27 A;  4A38 A;  5I0C A;  2PSW A;  2EK9 A;  2PJ8 A;  3IGR A;  3LOD A;  1F57 A;  1M44 A;  1YW6 A;  2WYR A;  2ZEF A;  4X8I A;  4PSW A;  3PP9 A;  1H8L A;  3GKR A;  3V38 A;  3S9N A;  3K9U A;  5F46 A;  1GYT A;  1NMT A;  4Z65 A;  1XEB A;  2GAN A;  4Q38 A;  5H84 A;  5KTA A;  3DR8 A;  1Z8W A;  3K9T A;  4J3G A;  3SJE A;  5LYI A;  2C1C A;  1YQE A;  4QB9 A;  3IWE A;  1Z4R A;  4B10 A;  1MJA A;  5G21 A;  4B5P B;  2REF A;  4OC1 A;  4E2A A;  3E0K A;  4MFJ A;  3I1U A;  4KSF A;  3D8P A;  3VH9 A;  4MCQ A;  5IX3 A;  1VHE A;  1TF9 A;  4UA3 A;  4OC2 A;  2JBK A;  4CYP A;  3D4U A;  2DF5 A;  3RZA A;  4W9Y A;  2AE6 A;  4PK3 A;  1QSN A;  4CAX A;  2WSA A;  5C82 A;  4IF5 A;  4UIA A;  5EC4 A;  3TX8 A;  2VEZ A;  1VKC A;  4JYW A;  4NGT A;  3IC1 A;  2B4B A;  1LOK A;  1MK4 A;  3S9L A;  1BO4 A;  3KAS A;  4CAE A;  2I79 A;  4IHM A;  4I49 A;  5CBM A;  2HC9 A;  4KVM E;  4XPD C;  3DGV A;  4MJ8 A;  3NH4 A;  5C88 A;  5LYL A;  3C26 A;  5E96 A;  4C7H A;  2ZEP A;  3BLN A;  3IO1 A;  4NGM A;  2GLJ A;  3FVL A;  3R95 A;  2D4O A;  2ZW4 A;  6CPA A;  2PJ7 A;  3FBU A;  4NGR A;  3W6X A;  3H8F A;  1U6M A;  4MHY A;  4P4J A;  3FF3 A;  4FD5 A;  4OIW A;  2V8V A;  1M4D A;  3H8E A;  4OP4 A;  3KHZ A;  4XNH C;  2HB6 A;  4R57 A;  1S7K A;  2DPS A;  4ZBG A;  5LRJ A;  3VWE A;  1KUV A;  3BJ8 A;  3FXT A;  1HDQ A;  5HMN A; 
#chains in the Genus database with same CATH homology
 4OAD A;  4KVO E;  2PR1 A;  2Z3O A;  1NSL A;  3IWG A;  2JDD A;  2EVN A;  2GIV A;  2CNS A;  2WPW A;  3TOB A;  4UFX A;  4AVB A;  4JXR A;  2B5G B;  2CY2 A;  4KOR A;  4KOX A;  1Q2D A;  2Q4Y A;  4AG9 A;  3EO4 A;  3ZZI A;  4LUA A;  1S5K A;  3ZJ0 A;  3QAH A;  4M85 A;  2EUI A;  3GY9 A;  3DSB A;  5F49 A;  1KZF A;  2CXA A;  4C2X A;  2OZU A;  4H89 A;  3F0A A;  3SXO A;  3T9Y A;  3TE4 A;  5J8C A;  4MHD A;  4C2Z A;  3F5B A;  3F8K A;  1Y7R A;  1QSM A;  2FS5 A;  2VZZ A;  4HKF A;  2A4N A;  2YND A;  2Z0Z A;  4CYQ A;  4KS9 A;  2AJ6 A;  1BOB A;  2HUZ A;  1V0C A;  2Y0M A;  4PV6 A;  1QSO A;  4NF1 A;  4ORF A;  2JEV A;  2J8M A;  2Z3K A;  4XPD B;  1PU9 A;  4BBH A;  2G3A A;  2FL4 A;  1YK3 A;  1YVO A;  2QIR A;  5IV0 A;  4C2Y A;  4DNC A;  5H86 A;  4BMH A;  1QSR A;  1L0C A;  1CM0 A;  5AG6 A;  4AB7 A;  4JXQ A;  3FB3 A;  3UY5 A;  4XNH B;  4QC6 A;  3SXN A;  1RXT A;  2NMT A;  4UCM A;  4CS0 B;  4U9Z A;  1S7L A;  1Y9W A;  3R96 A;  1PUA A;  4NCZ A;  2P0W A;  3GYA A;  4JD6 A;  3W6S A;  4MY0 A;  4QVT A;  1M4G A;  2CNT A;  2FCK A;  2VQY A;  4HNX B;  1TIQ A;  1Y9K A;  2Z11 A;  4R9M A;  2Z10 A;  3PZJ A;  4FD6 A;  5GCN A;  2GE3 A;  1S60 A;  1XE4 A;  4NSQ A;  2OZG A;  4CYO A;  2VZY A;  1IYK A;  4E8O A;  2WUU A;  2QEC A;  2DPT A;  2OB0 A;  2G3T A;  4NEX A;  2PQ8 A;  2ATR A;  4CGM A;  4ONU A;  1P0H A;  5G22 A;  5KTD A;  4CGO A;  3R9F A;  3R9G A;  1P4N A;  4F0X A;  2OU2 A;  2BEI A;  5AG5 A;  4KVX A;  4B12 A;  2FE7 A;  4E0A A;  1ON0 A;  3S6K A;  3OWC A;  4A33 A;  4JLY A;  3EY5 A;  2IL4 A;  3CXP A;  1I21 A;  5DWN A;  4A30 A;  3CXS A;  4UBR A;  2J8N A;  2K5T A;  3EC4 A;  4MFZ A;  1MJ9 A;  1QST A;  2RC4 A;  5BWA B;  3FYN A;  2YNC C;  3CXQ A;  2FIW A;  1Z9U A;  4MFP A;  4AG7 A;  4MBU A;  2BUE A;  1IID A;  2DXQ A;  4II9 A;  2WPX A;  5HH1 A;  2O28 A;  2G0B A;  4F6A A;  4QBJ A;  4KOU A;  3SHP A;  2BL1 A;  4KOW A;  1YX0 A;  4K30 A;  4XPL A;  2Z3P A;  3TOA A;  4CRZ B;  4CAF A;  3S6H A;  2YNE A;  3TCV A;  2ZW7 A;  3P2H A;  4L8A A;  2J8R A;  2F5I A;  2PDO A;  4A31 A;  4PK2 A;  4MFK A;  2B3U A;  4NXY A;  2CNM A;  3BJ7 A;  4B5O A;  2REE A;  2Q04 A;  1B6B A;  2Q7B A;  2B58 A;  2YGW A;  4KOT A;  2X7B A;  2R98 A;  4YFJ A;  5J8F A;  1LRZ A;  1GHE A;  3H5Z A;  3RYO A;  1S7N A;  5F47 A;  4A95 A;  2PR8 A;  1N71 A;  4CGL A;  4ZGY B;  4C68 A;  1J4J A;  3TTH A;  3D3S A;  1YRE A;  1IB1 E;  1UFH A;  3TO7 A;  2QML A;  2R7H A;  3IU1 A;  3TO6 A;  4X5K A;  5A28 A;  5JPH A;  4CRY B;  4MY3 A;  1S3Z A;  3DR6 A;  4KSA A;  3B8G A;  2VBQ A;  2Z3M A;  5AG7 A;  3WR7 A;  4KZT A;  2HV2 A;  3I3G A;  3FNC A;  3VWD A;  3P2F A;  4CAW A;  4H6U A;  2YNC A;  3LD2 A;  2ARH A;  2PRB A;  4R87 A;  4C7I A;  4KLV A;  4OAE A;  4H6Z A;  4CGN A;  5IB0 A;  2B4D A;  1YR0 A;  2D4P A;  3EXN A;  3IU2 A;  2P6G A;  2ZXV A;  3KKW A;  4FD7 A;  5AGE A;  3EFA A;  5CNP A;  4HNW B;  1IYL A;  4CAV A;  2I00 A;  2Z3N A;  1YVK A;  4U9Y A;  4Y49 C;  1I1D A;  4MI4 A;  3W91 A;  4MFQ A;  3NE7 A;  4HNY B;  2B3V A;  4B5P A;  1WWZ A;  3JUW A;  1IIC A;  4F0Y A;  1Q2C A;  4KUA A;  4KOV A;  4M3S A;  2Z3L A;  1YLE A;  4UFV A;  2ZPA A;  4KOY A;  3T90 A;  1XIX A;  3A9L A;  4B14 A;  3DDD A;  1Q2Y A;  1Z4E A;  3FIX A;  1KUX A;  4A2Z A;  1SQH A;  3N7Z A;  2JLM A;  4XPK A;  3FRM A;  2OZH A;  1YGH A;  2P6F A;  3S6F A;  4AVA A;  4B11 A;  2FIA A;  4LX9 A;  5ISV A;  4EVY A;  3JVN A;  2P6E A;  4CYN A;  1KUY A;  4Q36 A;  2OH1 A;  2R1I A;  4AVC A;  4UFW A;  3H4Q A;  5G1Z A;  3S6G A;  4IUS A;  4PSX A;  3G3S A;  4OLL A;  1B87 A;  1R57 A;  4UWI A;  2FSR A;  4U5Y A;  3TO9 A;  3D2P A;  3V8I A;  1ZO0 A;  4UCN A;  4YRH A;  1RO5 A;  4MFL A;  2VXK A;  1NE9 A;  3QB8 A;  4JJX A;  1M1D A;  2FT0 A;  2B5G A;  5EBV A;  4GS4 A;  1CJW A;  4UWJ A;  3R9E A;  2Q44 A;  4YGO A;  4KLW A;  4L89 A;  4UCP A;  2HQY A;  4KUB A;  1XMT A;  1FY7 A;  2JDC A;  4FD4 A;  4Y49 B;  3DNS A;  2C27 A;  3I9S A;  5F48 A;  3TFY A;  3MGD A;  2PC1 A;  2H5M A;  4RI1 A;  2R8V A;  1XF8 A;  4R3L A;  2VI7 A;  1S7F A;  2Q0Y A;  1MJB A;  1WK4 A;  2ZW5 A;  4B13 A;  5JQ4 A;  3JTK A;  5FVJ A;  4R3K A;  2Q4V A;  3D2M A;  2ZW6 A;  2BSW A;  1M4I A;  4QUS A;  2FXF A;  4RS2 A;  4CGP A;  4A32 A;  5AG4 A;  1K4J A;  4JWP A;  3PGP A;  3R1K A;  4KOS A;  1VHS A;  5G20 A;  2KCW A;  3G8W A;  3TT2 A;  1I12 A;  5DWM A;  5KTC A;  1OZP A;  2B4D B;  5A27 A;  5I0C A;  2PSW A;  3IGR A;  3LOD A;  1M44 A;  4PSW A;  3PP9 A;  3GKR A;  3K9U A;  5F46 A;  1NMT A;  1XEB A;  2GAN A;  4Q38 A;  5H84 A;  5KTA A;  3DR8 A;  4J3G A;  4QB9 A;  3IWE A;  1Z4R A;  4B10 A;  1MJA A;  5G21 A;  4B5P B;  2REF A;  4E2A A;  3E0K A;  4MFJ A;  4KSF A;  3D8P A;  5IX3 A;  4UA3 A;  4CYP A;  2AE6 A;  4PK3 A;  1QSN A;  4CAX A;  2WSA A;  5C82 A;  4IF5 A;  5EC4 A;  2VEZ A;  1VKC A;  1MK4 A;  2B4B A;  1BO4 A;  4CAE A;  2I79 A;  4I49 A;  4KVM E;  4XPD C;  4MJ8 A;  5C88 A;  3C26 A;  5E96 A;  4C7H A;  3BLN A;  3R95 A;  2D4O A;  2ZW4 A;  3FBU A;  3W6X A;  1U6M A;  4FD5 A;  1M4D A;  4XNH C;  4ZBG A;  4R57 A;  1S7K A;  2DPS A;  3VWE A;  1KUV A;  3BJ8 A;  3FXT A;  5HMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...