2EO8A

Crystal structure of a mutant pyrrolidone carboxyl peptidase (a199p) from p. furiosus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMELEAVKVPIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Crystal structure of a mutant pyrrolidone carboxyl peptidase (A199P) from P. furiosus
rcsb
source organism Pyrococcus furiosus
total genus 66
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 2eo8A00
3RO0A 1X12A 1Z8WA 1Z8TA 2EBJA 1AUGA 2EO8A 1IOFA 3GIUA 1IOIA 3RNZA 1A2ZA 1IU8A 1X10A 2DF5A 4GXHA 4HPSA 1Z8XA 3LACA
chains in the Genus database with same CATH superfamily
2PCUA 1OZPA 3TO9A 4A32A 4DNCA 3CXSA 3V7ZA 1XE4A 4GM5A 4L8AA 3RZAA 1CBXA 4MFQA 4OP4A 2B4DA 4OC0A 1M44A 1TF8A 1R3NA 5JH9A 4JXRA 1Y9WA 3S6FA 4R3KA 2EWBA 3BJ7A 4UA3A 2JDCA 1DTDA 4JJXA 1YR0A 4UIBA 5HVGA 2PC1A 4P4DA 2AFWA 4IK2A 3DSBA 1BPMA 2PJ1A 1I12A 5F47A 4CAXA 4FBEA 1UWYA 1GYTA 4UIAA 3WC5A 1KUYA 1LANA 1LAMA 4U9YA 2HQYA 1XMBA 2GIVA 3EY5A 2FVGA 4Y49B 4HPSA 1LOKA 3KL9A 3PZJA 4YRHA 3WABA 4QB9A 1XOVA 2BUEA 1Y0YA 2REFA 2ZEOA 1QSNA 4MRIA 1U6MA 4U9ZA 4H6ZA 4CYPA 4KORA 4NGQA 4RUHA 2PJ6A 3IU2A 5K8NA 2QECA 2Z10A 1M4DA 4C7IA 3FIXA 2F5IA 4MJ8A 4B5OA 3GLJA 3BJ8A 1M1DA 3EFAA 1IB1E 1L0CA 4II9A 2I3CA 2AFZA 2JBJA 3D2MA 3KKWA 4IUSA 4CGMA 4PV6A 4OAEA 3LWUA 2OZUA 4JYWA 2PJAA 4W9YA 1GHEA 4MBUA 1XFOA 2AE6A 4GS4A 4KSIA 1IIDA 3NH5A 1S7KA 7CPAA 4E8OA 2Z11A 4KUBA 3PB9X 3KHXA 2CIJA 3IFEA 4MHYA 3NE8A 4R6TA 4WJBA 4CPAA 3IU1A 5AGEA 2PJCA 5F48A 4NF1A 2Q7BA 1BO4A 2EBJA 1YMEA 3FXTA 4FD6A 4UWJA 1ZLIA 1IOIA 5LYLA 4Z65A 4OKOA 2YNDA 2NSMA 4K3NA 1CM0A 5CBMA 2YGWA 3UY5A 3K9UA 5E96A 3FB3A 2VBQA 3R96A 1P0HA 3FJUA 4MXUA 4CRYB 2KCWA 4F8ZA 3FRMA 2B5GA 1MK4A 1YVOA 3R95A 3S9LA 5J8FA 1YVKA 2Q51A 2Z3LA 4CGLA 2ZXVA 2YNEA 4PK3A 1Z8LA 1R43A 1Z8XA 3TOBA 3EC4A 4F0YA 1DE4C 4A33A 4ZY1A 1Z8WA 1YW4A 1P4NA 3IWEA 5ISVA 1XEBA 3LODA 2EVNA 2CNMA 5D8NA 1Z5RA 2DEAA 4B6ZA 4KVME 2F7VA 2POKA 2HV2A 2C6CA 4MFLA 3ZZIA 1A2ZA 2VZZA 1NSAA 2PR1A 2A4NA 2PE3A 1VKCA 4P6YA 1TXRA 1YX0A 4OC5A 4QVTA 1Z2LA 4X3RA 1VHOA 3D7FA 3V38A 4B5PB 1WWZA 2GLJA 4NCZA 4EMEA 3FEEA 3PB7X 3IWGA 3R9FA 5LYFA 5H86A 2OB0A 3FBUA 4R8FA 5JPHA 5JM6A 1FY7A 2PSWA 2PJ7A 4P10A 3S6GA 1KUVA 4UFWA 4YGOA 3B8GA 1AYEA 4UCMA 1S3ZA 2CF4A 2R7HA 1QSOA 3H8EA 3IO1A 1TKFA 3JRUA 3QB8A 4P4IA 4ZI6A 1WK4A 4X8IA 4CGPA 2FS5A 3CZXA 5EC4A 5JQ4A 1IYKA 3RYOA 5K8MA 4UFXA 3TX8A 1BAVA 3I9SA 1M4IA 2DPTA 2QMLA 4NGRA 4MCPA 1TIQA 3T8WA 1NMTA 2J8RA 4NGSA 3SJGA 5HXDA 4KUAA 1CP6A 4C2XA 3VARA 1Q2YA 2G9DA 2P6EA 2PRBA 2Q44A 3D4UA 2ABZA 1QSRA 3TFYA 2ZW7A 4MFJA 2CNTA 3GUXA 2BOAA 1JWQA 4P4JA 1I21A 3S9NA 3DNSA 1HDUA 3NA6A 3SI0A 2PJ2A 4FD5A 1KWMA 2GANA 4C7HA 3HUVA 3L2NA 2I79A 4PXBA 4CAFA 1S5KA 2PR8A 3NH8A 4MFPA 4PSWA 3RAMA 3VH9A 4C68A 1QMUA 2EO8A 3GIUA 4ORFA 4E0AA 1CPSA 4AVAA 2PVVA 2B4BA 2G3TA 2Y0MA 2PRQA 5CNPA 2Z3MA 2AFOA 2V77A 1BPNA 2OZGA 4XNHB 4YU9A 1F2OA 4FAIA 1MJ9A 4EFDA 3KQXA 4LUAA 4MMOA 4K30A 2C27A 4OIDA 2AFMA 3JVNA 2C6PA 1LFWA 1JQGA 1XMTA 4P4FA 2JDDA 5IB9A 4TWEA 1KUXA 2V8DA 3BI0A 5IB0A 1PUAA 4NGNA 4OADA 4KOYA 1IICA 2AFUA 4L89A 4Y49C 1QQ9A 3R1KA 4LQGA 3ZJ0A 5HVHA 3CT9A 4H6UA 1Q7LA 2C1CA 1ZG9A 3BHXA 4QC6A 4UCPA 4F9UA 1Q2DA 2GLFA 1FT7A 4XPKA 2B4DB 2ZEMA 3B3CA 3FYNA 2H5MA 2QYVA 4F6AA 3LD2A 3N5FA 3PRTA 3CDXA 2EK9A 5KTDA 1AMPA 2Z3KA 3IWWA 5J8CA 3SHPA 5HH1A 2PIZA 3BLNA 5F09A 3K2KA 3H5ZA 3FNCA 1ZO0A 4PPZA 5DWNA 1ON0A 3QAYA 1IY7A 4R76A 2ARHA 5D29A 2WPWA 1EE3P 2OR4A 1PYTB 3IEHA 2ZEFA 3A9LA 4WWVA 1YW6A 3KR4A 2D4OA 2OH1A 4KOVA 2QVPA 2CY2A 2PJ9A 3KASA 4AB7A 3GKRA 1Y0RA 4MCQA 4IF5A 4KS9A 4A94A 2PDOA 4M85A 3K9TA 3IJ3A 2CXAA 5H84A 1F57A 4ONWA 2C6GA 3H8GA 1S7NA 1ZG7A 2FT0A 4CGNA 3WC7A 1VHEA 1R57A 2ZW5A 2Q4ZA 4UF4A 4FD7A 2PIYA 4OC3A 1YQEA 4KZTA 3H8FA 5G20A 4CYQA 2FSRA 1HEEA 4M6HA 5GCNA 2O28A 4F0XA 2AFSA 4QUSA 3TT2A 4P45A 2FIAA 3DLJA 4AXVA 2ZEEA 1Z9UA 4MHPA 1ZG8A 4UFVA 3PFEA 4FUUA 4RN7A 4DJLA 4JXQA 2FL4A 2X7BA 4M3SA 2GREA 1LRZA 3B2YA 2PJ5A 3WC6A 3NFZA 5C82A 5AG6A 2IL4A 2OZHA 3H4QA 4B14A 1NSLA 2FE7A 4CS0B 4R3LA 1XF8A 4CYNA 4RI1A 2OOTA 3D68A 4X5KA 4B5PA 3FMCA 4PSXA 3B3TA 4NGMA 3CPXA 2B5GB 3C26A 1RO5A 4CAVA 4MY0A 3HLPA 1F2PA 6CPAA 2ZOGA 3KZWA 2HC9A 4NFRA 4KVXA 2XEIA 5IV0A 1ARLA 2B3VA 4B11A 4NXYA 2EUIA 2ZENA 5HMNA 1CPXA 2J8MA 1Y7EA 3LACA 4MHDA 1PCAA 4OC4A 2HUZA 3WT4A 3RO0A 4C2ZA 4B13A 3TCVA 4KOSA 2J8NA 3E0KA 1ELLP 4OC2A 2IJZA 4I49A 2G0BA 3SI2A 4A38A 3PEIA 4NJRA 5AG5A 1SQHA 3DDDA 3FF3A 4RS2A 3W6XA 2CNSA 2NYQA 4KOTA 3SJFA 2GE3A 4QBJA 5G22A 4A2ZA 3P2HA 5AG7A 3RBUA 5I4MA 4A39A 2PJ3A 5G21A 1YGHA 3W91A 2PJBA 2F8HA 3FVLA 5BWAB 2P6GA 5I0CA 4H2KA 2BCOA 4GXHA 4O23A 3SJXA 4R9MA 3PB8X 1N71A 1TF9A 4BD9A 2DXQA 2Q0YA 3EO4A 3JTKA 2I00A 2G3AA 4OIWA 1X12A 3PBEA 4XPDB 4AVBA 5J1QA 1YLEA 5LYIA 2BO9A 1Z8TA 2PJ4A 4HNYB 1QSTA 3KR5A 5ELYA 2BSWA 3B7IA 3D8PA 2YNCA 4AG9A 3SJEA 3EXNA 4BBHA 4UWIA 4Q36A 1MJBA 2YNCC 5KTCA 2FCKA 5F46A 2PVWA 2JLMA 4JD6A 1LCPA 2BEIA 3D2PA 4MHNA 4UBRA 3D67A 3JUWA 2OU2A 2P6FA 4XNHC 1RXTA 1X10A 4X2TA 2AJ6A 3FEDA 1K4JA 2Q04A 2ZELA 3R9GA 3G8WA 5JGFA 4PXCA 3FH4A 4KSAA 5IX3A 3TO7A 4A37A 4MFZA 3CPAA 4HNXB 3D66A 1KZFA 4MCRA 1I1DA 2GFQA 1CP7A 3TTHA 3R9EA 3F0AA 4DUKA 2ZOFA 3GB0A 3LMSA 4HNWB 2RFHA 4OMEA 4B10A 4IHMA 2XEJA 4MY3A 1HDQA 2ANPA 3G3SA 5G1ZA 3B35A 1M4GA 2P0WA 1PU9A 3D3SA 1V0CA 2WPXA 3PP9A 3SXOA 4EWTA 1VGYA 2Z3OA 1ARMA 3QAHA 3BI1A 3CXPA 2B58A 1QSMA 5FVJA 3MN8A 2EK8A 3KI9A 2QJ8A 3MRUA 2V8HA 1XRYA 2R8VA 1H8LA 2VI7A 4LX9A 5DS0A 1IYLA 3T90A 3PB6X 3VWEA 2Q7SA 2JEVA 2O4HA 1CG2A 4MFKA 1S7FA 3T9YA 3ISZA 5DWMA 4P4BA 5THWA 4AG7A 4MHZA 5EBVA 1Y7RA 2JBKA 2XEFA 4FD4A 3SI1A 2ZPAA 2BL1A 2XEGA 2PJ0A 4KSFA 2DPSA 4HKFA 4AVCA 5CPAA 4NGPA 4PXDA 1BOBA 5KTAA 4H89A 4CRZB 3BXMA 1Z4EA 3D7HA 3F5BA 4NGTA 3I1UA 3V8IA 4YWYA 1Q2CA 2ZEGA 2FXFA 3NH4A 3PFOA 5LYDA 4A95A 5C88A 4R87A 3DR6A 2VL1A 5EMIA 3KGQA 2R1IA 1VHSA 3D7GA 5AG4A 2VQYA 2ZW6A 3PGPA 2JEWA 4CGOA 3GY9A 3FX6A 4U5YA 3S9MA 4OC1A 1B6BA 4A31A 1Z4RA 8CPAA 2WYRA 1IGBA 4F9VA 4B12A 2Z3PA 1AUGA 2VEZA 4P44A 2CTCA 2VXKA 3DGVA 3TO6A 4TNUA 1XBUA 2CTBA 4OLLA 2Z3NA 3ISXA 1TKHA 4C2YA 4KLWA 1S60A 2NMTA 4JZ0A 4KVOE 3PB4X 3VATA 2B3UA 2QIRA 1XJOA 4KOXA 2V8VA 2WSAA 3GYAA 4LQ6A 4PXEA 4R57A 1Y9KA 2Q43A 4JWPA 3S6HA 5K8OA 1MJAA 3IIBA 2Q4YA 5F49A 4IAVA 4ZX8A 2ZEHA 4KLVA 1J4JA 1TKJA 4ZY0A 4Q38A 3D7DA 1ZLHA 3PBBA 4ZX9A 3DR8A 4XPLA 3B3SA 1IOFA 1LAPA 1M4LA 1NE9A 2D4PA 4M6GA 4ZGYB 4EVYA 2R98A 1CJWA 2ZEPA 1YLOA 2WZNA 2ATRA 4P4EA 3F8KA 3TOAA 2ZW4A 4ZY2A 3S6KA 2J9AA 4UCNA 4ONUA 2FIWA 1IU8A 4J3GA 5K8PA 5A28A 4UEEA 2ZEDA 4BINA 4PQAA 4NJQA 4BMHA 3NE7A 4KOWA 2RC4A 3MGDA 3QNVA 2K5TA 1RTQA 4A30A 4CAEA 3KQZA 3SXNA 4CAWA 1ELMP 2IQ6A 3WR7A 4M6IA 5LRJA 3B3WA 4UEZA 3CXQA 1FNOA 2O53A 3TE4A 1UFHA 5LRGA 4ZYQA 1OBRA 2VZYA 4CYOA 4XPDC 2GU2A 3OWCA 4Q7AA 2REEA 1XIXA 1YREA 2WUUA 3RNZA 4G1PA 2PQ8A 3VWDA 2V8GA 3TC8A 3KHZA 1YSJA 2PJ8A 5A27A 3I3GA 3IGRA 2IMOA 5HVFA 4DYOA 1BLLE 4NEXA 2HB6A 4MI4A 3N7ZA 4YFJA 4MCSA 4E2AA 5LRKA 3P2FA 2Q4VA 4KOUA 4R7MA 1YK3A 4JLYA 4PK2A 2ODFA 3W6SA 3FECA 4FWUA 4ZBGA 1B87A 2DF5A 3IC1A 2RB7A 3B3VA 1VIXA 4UEFA 4NSQA 2AFXA 1CX8A 2Z0ZA 1S7LA
chains in the Genus database with same CATH topology
3RO0A 1X12A 1Z8WA 1Z8TA 2EBJA 1AUGA 2EO8A 1IOFA 3GIUA 1IOIA 3RNZA 1A2ZA 1IU8A 1X10A 2DF5A 4GXHA 4HPSA 1Z8XA 3LACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RO0 A;  1X12 A;  1Z8W A;  1Z8T A;  2EBJ A;  1AUG A;  2EO8 A;  1IOF A;  3GIU A;  1IOI A;  3RNZ A;  1A2Z A;  1IU8 A;  1X10 A;  2DF5 A;  4GXH A;  4HPS A;  1Z8X A;  3LAC A; 
#chains in the Genus database with same CATH topology
 2PCU A;  1OZP A;  3TO9 A;  4A32 A;  4DNC A;  3CXS A;  3V7Z A;  1XE4 A;  4GM5 A;  4L8A A;  3RZA A;  1CBX A;  4MFQ A;  4OP4 A;  2B4D A;  4OC0 A;  1M44 A;  1TF8 A;  1R3N A;  5JH9 A;  4JXR A;  1Y9W A;  3S6F A;  4R3K A;  2EWB A;  3BJ7 A;  4UA3 A;  2JDC A;  1DTD A;  4JJX A;  1YR0 A;  4UIB A;  5HVG A;  2PC1 A;  4P4D A;  2AFW A;  4IK2 A;  3DSB A;  1BPM A;  2PJ1 A;  1I12 A;  5F47 A;  4CAX A;  4FBE A;  1UWY A;  1GYT A;  4UIA A;  3WC5 A;  1KUY A;  1LAN A;  1LAM A;  4U9Y A;  2HQY A;  1XMB A;  2GIV A;  3EY5 A;  2FVG A;  4Y49 B;  4HPS A;  1LOK A;  3KL9 A;  3PZJ A;  4YRH A;  3WAB A;  4QB9 A;  1XOV A;  2BUE A;  1Y0Y A;  2REF A;  2ZEO A;  1QSN A;  4MRI A;  1U6M A;  4U9Z A;  4H6Z A;  4CYP A;  4KOR A;  4NGQ A;  4RUH A;  2PJ6 A;  3IU2 A;  5K8N A;  2QEC A;  2Z10 A;  1M4D A;  4C7I A;  3FIX A;  2F5I A;  4MJ8 A;  4B5O A;  3GLJ A;  3BJ8 A;  1M1D A;  3EFA A;  1IB1 E;  1L0C A;  4II9 A;  2I3C A;  2AFZ A;  2JBJ A;  3D2M A;  3KKW A;  4IUS A;  4CGM A;  4PV6 A;  4OAE A;  3LWU A;  2OZU A;  4JYW A;  2PJA A;  4W9Y A;  1GHE A;  4MBU A;  1XFO A;  2AE6 A;  4GS4 A;  4KSI A;  1IID A;  3NH5 A;  1S7K A;  7CPA A;  4E8O A;  2Z11 A;  4KUB A;  3PB9 X;  3KHX A;  2CIJ A;  3IFE A;  4MHY A;  3NE8 A;  4R6T A;  4WJB A;  4CPA A;  3IU1 A;  5AGE A;  2PJC A;  5F48 A;  4NF1 A;  2Q7B A;  1BO4 A;  2EBJ A;  1YME A;  3FXT A;  4FD6 A;  4UWJ A;  1ZLI A;  1IOI A;  5LYL A;  4Z65 A;  4OKO A;  2YND A;  2NSM A;  4K3N A;  1CM0 A;  5CBM A;  2YGW A;  3UY5 A;  3K9U A;  5E96 A;  3FB3 A;  2VBQ A;  3R96 A;  1P0H A;  3FJU A;  4MXU A;  4CRY B;  2KCW A;  4F8Z A;  3FRM A;  2B5G A;  1MK4 A;  1YVO A;  3R95 A;  3S9L A;  5J8F A;  1YVK A;  2Q51 A;  2Z3L A;  4CGL A;  2ZXV A;  2YNE A;  4PK3 A;  1Z8L A;  1R43 A;  1Z8X A;  3TOB A;  3EC4 A;  4F0Y A;  1DE4 C;  4A33 A;  4ZY1 A;  1Z8W A;  1YW4 A;  1P4N A;  3IWE A;  5ISV A;  1XEB A;  3LOD A;  2EVN A;  2CNM A;  5D8N A;  1Z5R A;  2DEA A;  4B6Z A;  4KVM E;  2F7V A;  2POK A;  2HV2 A;  2C6C A;  4MFL A;  3ZZI A;  1A2Z A;  2VZZ A;  1NSA A;  2PR1 A;  2A4N A;  2PE3 A;  1VKC A;  4P6Y A;  1TXR A;  1YX0 A;  4OC5 A;  4QVT A;  1Z2L A;  4X3R A;  1VHO A;  3D7F A;  3V38 A;  4B5P B;  1WWZ A;  2GLJ A;  4NCZ A;  4EME A;  3FEE A;  3PB7 X;  3IWG A;  3R9F A;  5LYF A;  5H86 A;  2OB0 A;  3FBU A;  4R8F A;  5JPH A;  5JM6 A;  1FY7 A;  2PSW A;  2PJ7 A;  4P10 A;  3S6G A;  1KUV A;  4UFW A;  4YGO A;  3B8G A;  1AYE A;  4UCM A;  1S3Z A;  2CF4 A;  2R7H A;  1QSO A;  3H8E A;  3IO1 A;  1TKF A;  3JRU A;  3QB8 A;  4P4I A;  4ZI6 A;  1WK4 A;  4X8I A;  4CGP A;  2FS5 A;  3CZX A;  5EC4 A;  5JQ4 A;  1IYK A;  3RYO A;  5K8M A;  4UFX A;  3TX8 A;  1BAV A;  3I9S A;  1M4I A;  2DPT A;  2QML A;  4NGR A;  4MCP A;  1TIQ A;  3T8W A;  1NMT A;  2J8R A;  4NGS A;  3SJG A;  5HXD A;  4KUA A;  1CP6 A;  4C2X A;  3VAR A;  1Q2Y A;  2G9D A;  2P6E A;  2PRB A;  2Q44 A;  3D4U A;  2ABZ A;  1QSR A;  3TFY A;  2ZW7 A;  4MFJ A;  2CNT A;  3GUX A;  2BOA A;  1JWQ A;  4P4J A;  1I21 A;  3S9N A;  3DNS A;  1HDU A;  3NA6 A;  3SI0 A;  2PJ2 A;  4FD5 A;  1KWM A;  2GAN A;  4C7H A;  3HUV A;  3L2N A;  2I79 A;  4PXB A;  4CAF A;  1S5K A;  2PR8 A;  3NH8 A;  4MFP A;  4PSW A;  3RAM A;  3VH9 A;  4C68 A;  1QMU A;  2EO8 A;  3GIU A;  4ORF A;  4E0A A;  1CPS A;  4AVA A;  2PVV A;  2B4B A;  2G3T A;  2Y0M A;  2PRQ A;  5CNP A;  2Z3M A;  2AFO A;  2V77 A;  1BPN A;  2OZG A;  4XNH B;  4YU9 A;  1F2O A;  4FAI A;  1MJ9 A;  4EFD A;  3KQX A;  4LUA A;  4MMO A;  4K30 A;  2C27 A;  4OID A;  2AFM A;  3JVN A;  2C6P A;  1LFW A;  1JQG A;  1XMT A;  4P4F A;  2JDD A;  5IB9 A;  4TWE A;  1KUX A;  2V8D A;  3BI0 A;  5IB0 A;  1PUA A;  4NGN A;  4OAD A;  4KOY A;  1IIC A;  2AFU A;  4L89 A;  4Y49 C;  1QQ9 A;  3R1K A;  4LQG A;  3ZJ0 A;  5HVH A;  3CT9 A;  4H6U A;  1Q7L A;  2C1C A;  1ZG9 A;  3BHX A;  4QC6 A;  4UCP A;  4F9U A;  1Q2D A;  2GLF A;  1FT7 A;  4XPK A;  2B4D B;  2ZEM A;  3B3C A;  3FYN A;  2H5M A;  2QYV A;  4F6A A;  3LD2 A;  3N5F A;  3PRT A;  3CDX A;  2EK9 A;  5KTD A;  1AMP A;  2Z3K A;  3IWW A;  5J8C A;  3SHP A;  5HH1 A;  2PIZ A;  3BLN A;  5F09 A;  3K2K A;  3H5Z A;  3FNC A;  1ZO0 A;  4PPZ A;  5DWN A;  1ON0 A;  3QAY A;  1IY7 A;  4R76 A;  2ARH A;  5D29 A;  2WPW A;  1EE3 P;  2OR4 A;  1PYT B;  3IEH A;  2ZEF A;  3A9L A;  4WWV A;  1YW6 A;  3KR4 A;  2D4O A;  2OH1 A;  4KOV A;  2QVP A;  2CY2 A;  2PJ9 A;  3KAS A;  4AB7 A;  3GKR A;  1Y0R A;  4MCQ A;  4IF5 A;  4KS9 A;  4A94 A;  2PDO A;  4M85 A;  3K9T A;  3IJ3 A;  2CXA A;  5H84 A;  1F57 A;  4ONW A;  2C6G A;  3H8G A;  1S7N A;  1ZG7 A;  2FT0 A;  4CGN A;  3WC7 A;  1VHE A;  1R57 A;  2ZW5 A;  2Q4Z A;  4UF4 A;  4FD7 A;  2PIY A;  4OC3 A;  1YQE A;  4KZT A;  3H8F A;  5G20 A;  4CYQ A;  2FSR A;  1HEE A;  4M6H A;  5GCN A;  2O28 A;  4F0X A;  2AFS A;  4QUS A;  3TT2 A;  4P45 A;  2FIA A;  3DLJ A;  4AXV A;  2ZEE A;  1Z9U A;  4MHP A;  1ZG8 A;  4UFV A;  3PFE A;  4FUU A;  4RN7 A;  4DJL A;  4JXQ A;  2FL4 A;  2X7B A;  4M3S A;  2GRE A;  1LRZ A;  3B2Y A;  2PJ5 A;  3WC6 A;  3NFZ A;  5C82 A;  5AG6 A;  2IL4 A;  2OZH A;  3H4Q A;  4B14 A;  1NSL A;  2FE7 A;  4CS0 B;  4R3L A;  1XF8 A;  4CYN A;  4RI1 A;  2OOT A;  3D68 A;  4X5K A;  4B5P A;  3FMC A;  4PSX A;  3B3T A;  4NGM A;  3CPX A;  2B5G B;  3C26 A;  1RO5 A;  4CAV A;  4MY0 A;  3HLP A;  1F2P A;  6CPA A;  2ZOG A;  3KZW A;  2HC9 A;  4NFR A;  4KVX A;  2XEI A;  5IV0 A;  1ARL A;  2B3V A;  4B11 A;  4NXY A;  2EUI A;  2ZEN A;  5HMN A;  1CPX A;  2J8M A;  1Y7E A;  3LAC A;  4MHD A;  1PCA A;  4OC4 A;  2HUZ A;  3WT4 A;  3RO0 A;  4C2Z A;  4B13 A;  3TCV A;  4KOS A;  2J8N A;  3E0K A;  1ELL P;  4OC2 A;  2IJZ A;  4I49 A;  2G0B A;  3SI2 A;  4A38 A;  3PEI A;  4NJR A;  5AG5 A;  1SQH A;  3DDD A;  3FF3 A;  4RS2 A;  3W6X A;  2CNS A;  2NYQ A;  4KOT A;  3SJF A;  2GE3 A;  4QBJ A;  5G22 A;  4A2Z A;  3P2H A;  5AG7 A;  3RBU A;  5I4M A;  4A39 A;  2PJ3 A;  5G21 A;  1YGH A;  3W91 A;  2PJB A;  2F8H A;  3FVL A;  5BWA B;  2P6G A;  5I0C A;  4H2K A;  2BCO A;  4GXH A;  4O23 A;  3SJX A;  4R9M A;  3PB8 X;  1N71 A;  1TF9 A;  4BD9 A;  2DXQ A;  2Q0Y A;  3EO4 A;  3JTK A;  2I00 A;  2G3A A;  4OIW A;  1X12 A;  3PBE A;  4XPD B;  4AVB A;  5J1Q A;  1YLE A;  5LYI A;  2BO9 A;  1Z8T A;  2PJ4 A;  4HNY B;  1QST A;  3KR5 A;  5ELY A;  2BSW A;  3B7I A;  3D8P A;  2YNC A;  4AG9 A;  3SJE A;  3EXN A;  4BBH A;  4UWI A;  4Q36 A;  1MJB A;  2YNC C;  5KTC A;  2FCK A;  5F46 A;  2PVW A;  2JLM A;  4JD6 A;  1LCP A;  2BEI A;  3D2P A;  4MHN A;  4UBR A;  3D67 A;  3JUW A;  2OU2 A;  2P6F A;  4XNH C;  1RXT A;  1X10 A;  4X2T A;  2AJ6 A;  3FED A;  1K4J A;  2Q04 A;  2ZEL A;  3R9G A;  3G8W A;  5JGF A;  4PXC A;  3FH4 A;  4KSA A;  5IX3 A;  3TO7 A;  4A37 A;  4MFZ A;  3CPA A;  4HNX B;  3D66 A;  1KZF A;  4MCR A;  1I1D A;  2GFQ A;  1CP7 A;  3TTH A;  3R9E A;  3F0A A;  4DUK A;  2ZOF A;  3GB0 A;  3LMS A;  4HNW B;  2RFH A;  4OME A;  4B10 A;  4IHM A;  2XEJ A;  4MY3 A;  1HDQ A;  2ANP A;  3G3S A;  5G1Z A;  3B35 A;  1M4G A;  2P0W A;  1PU9 A;  3D3S A;  1V0C A;  2WPX A;  3PP9 A;  3SXO A;  4EWT A;  1VGY A;  2Z3O A;  1ARM A;  3QAH A;  3BI1 A;  3CXP A;  2B58 A;  1QSM A;  5FVJ A;  3MN8 A;  2EK8 A;  3KI9 A;  2QJ8 A;  3MRU A;  2V8H A;  1XRY A;  2R8V A;  1H8L A;  2VI7 A;  4LX9 A;  5DS0 A;  1IYL A;  3T90 A;  3PB6 X;  3VWE A;  2Q7S A;  2JEV A;  2O4H A;  1CG2 A;  4MFK A;  1S7F A;  3T9Y A;  3ISZ A;  5DWM A;  4P4B A;  5THW A;  4AG7 A;  4MHZ A;  5EBV A;  1Y7R A;  2JBK A;  2XEF A;  4FD4 A;  3SI1 A;  2ZPA A;  2BL1 A;  2XEG A;  2PJ0 A;  4KSF A;  2DPS A;  4HKF A;  4AVC A;  5CPA A;  4NGP A;  4PXD A;  1BOB A;  5KTA A;  4H89 A;  4CRZ B;  3BXM A;  1Z4E A;  3D7H A;  3F5B A;  4NGT A;  3I1U A;  3V8I A;  4YWY A;  1Q2C A;  2ZEG A;  2FXF A;  3NH4 A;  3PFO A;  5LYD A;  4A95 A;  5C88 A;  4R87 A;  3DR6 A;  2VL1 A;  5EMI A;  3KGQ A;  2R1I A;  1VHS A;  3D7G A;  5AG4 A;  2VQY A;  2ZW6 A;  3PGP A;  2JEW A;  4CGO A;  3GY9 A;  3FX6 A;  4U5Y A;  3S9M A;  4OC1 A;  1B6B A;  4A31 A;  1Z4R A;  8CPA A;  2WYR A;  1IGB A;  4F9V A;  4B12 A;  2Z3P A;  1AUG A;  2VEZ A;  4P44 A;  2CTC A;  2VXK A;  3DGV A;  3TO6 A;  4TNU A;  1XBU A;  2CTB A;  4OLL A;  2Z3N A;  3ISX A;  1TKH A;  4C2Y A;  4KLW A;  1S60 A;  2NMT A;  4JZ0 A;  4KVO E;  3PB4 X;  3VAT A;  2B3U A;  2QIR A;  1XJO A;  4KOX A;  2V8V A;  2WSA A;  3GYA A;  4LQ6 A;  4PXE A;  4R57 A;  1Y9K A;  2Q43 A;  4JWP A;  3S6H A;  5K8O A;  1MJA A;  3IIB A;  2Q4Y A;  5F49 A;  4IAV A;  4ZX8 A;  2ZEH A;  4KLV A;  1J4J A;  1TKJ A;  4ZY0 A;  4Q38 A;  3D7D A;  1ZLH A;  3PBB A;  4ZX9 A;  3DR8 A;  4XPL A;  3B3S A;  1IOF A;  1LAP A;  1M4L A;  1NE9 A;  2D4P A;  4M6G A;  4ZGY B;  4EVY A;  2R98 A;  1CJW A;  2ZEP A;  1YLO A;  2WZN A;  2ATR A;  4P4E A;  3F8K A;  3TOA A;  2ZW4 A;  4ZY2 A;  3S6K A;  2J9A A;  4UCN A;  4ONU A;  2FIW A;  1IU8 A;  4J3G A;  5K8P A;  5A28 A;  4UEE A;  2ZED A;  4BIN A;  4PQA A;  4NJQ A;  4BMH A;  3NE7 A;  4KOW A;  2RC4 A;  3MGD A;  3QNV A;  2K5T A;  1RTQ A;  4A30 A;  4CAE A;  3KQZ A;  3SXN A;  4CAW A;  1ELM P;  2IQ6 A;  3WR7 A;  4M6I A;  5LRJ A;  3B3W A;  4UEZ A;  3CXQ A;  1FNO A;  2O53 A;  3TE4 A;  1UFH A;  5LRG A;  4ZYQ A;  1OBR A;  2VZY A;  4CYO A;  4XPD C;  2GU2 A;  3OWC A;  4Q7A A;  2REE A;  1XIX A;  1YRE A;  2WUU A;  3RNZ A;  4G1P A;  2PQ8 A;  3VWD A;  2V8G A;  3TC8 A;  3KHZ A;  1YSJ A;  2PJ8 A;  5A27 A;  3I3G A;  3IGR A;  2IMO A;  5HVF A;  4DYO A;  1BLL E;  4NEX A;  2HB6 A;  4MI4 A;  3N7Z A;  4YFJ A;  4MCS A;  4E2A A;  5LRK A;  3P2F A;  2Q4V A;  4KOU A;  4R7M A;  1YK3 A;  4JLY A;  4PK2 A;  2ODF A;  3W6S A;  3FEC A;  4FWU A;  4ZBG A;  1B87 A;  2DF5 A;  3IC1 A;  2RB7 A;  3B3V A;  1VIX A;  4UEF A;  4NSQ A;  2AFX A;  1CX8 A;  2Z0Z A;  1S7L A; 
#chains in the Genus database with same CATH homology
 3RO0 A;  1X12 A;  1Z8W A;  1Z8T A;  2EBJ A;  1AUG A;  2EO8 A;  1IOF A;  3GIU A;  1IOI A;  3RNZ A;  1A2Z A;  1IU8 A;  1X10 A;  2DF5 A;  4GXH A;  4HPS A;  1Z8X A;  3LAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...