1IICA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound myristoylcoa
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PEPTIDE N-myristoyltransferase
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 128
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA02
3DSBA 1YLEA 2CNTA 4NCZA 2FE7A 1VHSA 1YX0A 4L89A 4EVYA 4AVBA 2VBQA 4F0YA 2D4PA 1Z4EA 4Y49C 1Q2YA 3JVNA 4UBRA 4E0AA 4AVCA 4XPDC 1L0CA 2BSWA 2JDCA 4KOUA 3EFAA 4KUAA 3TOAA 3FB3A 2X7BA 2OZGA 4E8OA 3LODA 2QECA 3RYOA 4PSWA 2B4DA 4J3GA 2FS5A 3DR8A 5CNPA 3TCVA 2AE6A 4CAXA 1MJAA 3EC4A 4LUAA 3WR7A 3DDDA 2CY2A 2ZW5A 3VWDA 4XPLA 3FBUA 4I49A 3W6SA 1QSOA 2CNSA 3FRMA 1B87A 3FYNA 3T90A 4PV6A 2ZW6A 4M85A 1FY7A 1YGHA 4ZBGA 1PUAA 4CAVA 4F6AA 1S3ZA 4HNYB 2OZHA 3E0KA 2O28A 3TO7A 5F47A 2J8MA 3TO9A 1KUVA 1NMTA 1KUYA 1Q2DA 4R3LA 5IB0A 4KLVA 1P0HA 4HNXB 2Z10A 3FNCA 3N7ZA 1IYKA 2Q04A 3EO4A 3TT2A 3D3SA 2WPXA 1KZFA 2R7HA 2G0BA 3F5BA 4R9MA 3BJ7A 4ORFA 1CM0A 4QB9A 3TFYA 2NMTA 3QAHA 3I9SA 4UA3A 4NEXA 5F49A 1M4GA 4UWJA 2JDDA 4QC6A 2P6FA 1XMTA 1S5KA 3PGPA 2B5GB 2VZYA 1YVKA 3F0AA 4JLYA 4QBJA 4NF1A 3D2MA 1Y9KA 5KTDA 1M4DA 2PQ8A 2PR1A 4KOWA 4QVTA 4B5OA 2ARHA 5DWNA 1IIDA 1I21A 4OLLA 4E2AA 4B5PB 3G8WA 2R1IA 5HH1A 4H89A 2OU2A 1UFHA 3TE4A 4Y49B 2K5TA 4JXQA 1VKCA 3R95A 4XPDB 2F5IA 1I1DA 3TTHA 2VI7A 4U9YA 1K4JA 2ZPAA 2IL4A 3GYAA 2Q0YA 3D8PA 2PRBA 3OWCA 3TOBA 5HMNA 4MI4A 3PP9A 2DXQA 4FD7A 4JXRA 1M44A 1M1DA 2R8VA 4HNWB 2C27A 5E96A 4KZTA 5JQ4A 2VQYA 2HUZA 4JWPA 2B4DB 4HKFA 2EVNA 5KTCA 3ZJ0A 1YVOA 5DWMA 3W6XA 2B58A 2B3VA 2R98A 2PSWA 5H86A 2H5MA 1QSRA 4KLWA 2B4BA 5EBVA 2OZUA 3S6GA 4CRYB 1OZPA 4KORA 1S60A 2JLMA 3JUWA 2WPWA 1XE4A 3S6FA 4XPKA 2ZW4A 3R1KA 5KTAA 4H6ZA 2P6GA 3R9GA 2Q4YA 3FXTA 4FD5A 1Y7RA 3SXOA 3EXNA 2ATRA 1SQHA 2D4OA 1R57A 1CJWA 2QMLA 4KOSA 4H6UA 2CNMA 3TO6A 4KOYA 1MJ9A 4PK3A 1LRZA 4YRHA 3UY5A 2PDOA 1RO5A 1BOBA 3LD2A 3K9UA 1QSNA 1J4JA 4YFJA 4LX9A 5F46A 2FSRA 2Q4VA 3MGDA 2QIRA 3G3SA 1S7NA 1YREA 4NXYA 4KOVA 1ON0A 4X5KA 3BJ8A 1Z9UA 5ISVA 4FD6A 2Z0ZA 2GE3A 2BL1A 3ZZIA 1XF8A 2FIWA 4M3SA 3R9EA 4QUSA 4XNHC 2P6EA 4CRZB 5J8CA 2Q7BA 4U9ZA 3GKRA 4R57A 1MK4A 1PU9A 3F8KA 1S7KA 3R96A 4IF5A 2BEIA 4JD6A 1XEBA 3CXPA 4OADA 4PK2A 4IUSA 3BLNA 3DNSA 2Z11A 2JEVA 2RC4A 2VZZA 2AJ6A 5EC4A 4CAWA 5I0CA 3B8GA 3R9FA 1I12A 4KOTA 3CXSA 2HV2A 1Z4RA 4OAEA 5J8FA 2PC1A 2Y0MA 2VEZA 1BO4A 5JPHA 4L8AA 4MHDA 2REEA 4KVXA 1TIQA 3QB8A 2KCWA 4R3KA 3VWEA 3SXNA 4AG9A 3P2HA 1KUXA 2B3UA 3SHPA 2GIVA 1V0CA 1B6BA 4AVAA 1P4NA 1NE9A 5FVJA 3T9YA 4KVOE 1Q2CA 4KOXA 5IV0A 4KUBA 1WWZA 2I00A 1YK3A 1QSTA 4JJXA 2PR8A 4YGOA 2OH1A 4DNCA 4MY0A 2ZXVA 3GY9A 4GS4A 2FXFA 1NSLA 3KKWA 4RI1A 2I79A 2FT0A 3S6HA 5IX3A 1IICA 3PZJA 4BMHA 4NSQA 1S7LA 4MBUA 1YR0A 5C82A 1Y9WA 3CXQA 3C26A 1WK4A 1U6MA 3IWGA 2A4NA 4FD4A 4RS2A 3D2PA 4AB7A 3IGRA 5GCNA 1GHEA 2BUEA 2OB0A 3H4QA 4UWIA 1S7FA 2FIAA 2ZW7A 3S6KA 2REFA 1IB1E 1N71A 1RXTA 1MJBA 3FIXA 5H84A 2J8NA 3EY5A 4KVME 2G3TA 1M4IA 3DR6A 2HQYA 4II9A 3NE7A 4MY3A 2GANA 2B5GA 4MJ8A 3I3GA 2FL4A 5F48A 4XNHB 2G3AA 2EUIA 4ONUA 3P2FA 2J8RA 4PSXA 4U5YA 4R87A 2Q44A 5C88A 1XIXA 4K30A 3V8IA 3W91A 4B5PA 2VXKA 4CS0B 4AG7A 1IYLA 1QSMA 2P0WA 2FCKA
chains in the Genus database with same CATH superfamily
3DSBA 4X8IA 1Z5RA 4UCNA 2ZEPA 1YLEA 2CNTA 4NCZA 1XBUA 3KQZA 2FE7A 4C68A 1VHSA 1YX0A 2XEJA 2YNCC 2Q4ZA 4L89A 4UIBA 3H8GA 4AVBA 4EVYA 2ZOFA 2VBQA 2PJCA 1LAMA 4EFDA 4F0YA 1A2ZA 5BWAB 4OIWA 2D4PA 1FNOA 1Z4EA 4R7MA 1FT7A 4M6IA 4Y49C 3SJXA 1Q2YA 4TNUA 1YLOA 3JVNA 4UBRA 7CPAA 4E0AA 4BBHA 3D4UA 4AVCA 4NJQA 4XPDC 1L0CA 2WUUA 1ZLHA 2BSWA 2JDCA 3CPAA 4KOUA 3EFAA 4KUAA 4MHPA 3VARA 3ISXA 1NSAA 3TOAA 2F8HA 1Q7LA 4OC2A 1DE4C 3FB3A 2X7BA 2OZGA 4E8OA 3LODA 2QECA 4P4BA 3RYOA 3PB9X 4PSWA 4B6ZA 2ANPA 2HB6A 1X10A 2Z3MA 2B4DA 4J3GA 2EWBA 2FS5A 2PE3A 3DR8A 4PPZA 5CNPA 4X2TA 4NGNA 4ZX8A 3TCVA 3RBUA 4NGRA 2AE6A 4K3NA 4CAXA 4EMEA 1MJAA 3FVLA 3PB4X 5LRJA 1AUGA 3EC4A 2AFZA 3IWWA 1XJOA 3BHXA 3B3WA 4LUAA 4PXCA 3WR7A 2Q7SA 4CPAA 4UEZA 3DDDA 1HEEA 2CY2A 2ZW5A 4MCQA 4Z65A 3VWDA 4F9UA 4XPLA 3FBUA 4I49A 3W6SA 3B7IA 4IAVA 3WC5A 2G9DA 4ZY0A 5JGFA 3D66A 1QSOA 2IMOA 2CNSA 5LYLA 3FRMA 1B87A 3FYNA 3T90A 2GLFA 4PV6A 1BAVA 5A27A 1CG2A 2ZW6A 4M85A 4NFRA 1FY7A 4P45A 1YGHA 3PRTA 4G1PA 4ZBGA 5I4MA 1PUAA 4C7IA 4CAVA 4F6AA 1S3ZA 4HNYB 2OZHA 3E0KA 4OC3A 3ISZA 2O28A 3TO7A 3IC1A 5F47A 2J8MA 2WYRA 3TO9A 5IB9A 2O4HA 1KUVA 1NMTA 2Q51A 3H8FA 1KUYA 1Q2DA 3N5FA 4IK2A 4P4JA 4R3LA 4A32A 3JTKA 4A38A 3LWUA 5IB0A 3B3TA 1P0HA 4HNXB 4KLVA 1M4LA 2Z10A 3HUVA 4UIAA 2CF4A 3FNCA 2XEIA 2EK9A 3N7ZA 3LACA 1IYKA 2Q04A 4M6GA 3EO4A 1ARMA 4UEFA 1DTDA 1TKFA 3TT2A 5CBMA 3IIBA 2ODFA 3D3SA 1XFOA 1ARLA 2WPXA 1KZFA 2R7HA 2G0BA 3F5BA 1BLLE 4R9MA 4NGMA 4B13A 4CAFA 4BINA 2GREA 3BJ7A 3GLJA 4ORFA 1CM0A 4QB9A 3TFYA 2NMTA 1ZG8A 3D7DA 3QAHA 3I9SA 1R3NA 3K2KA 3GIUA 4DYOA 4UA3A 4NEXA 4A94A 5F49A 4R8FA 4CYPA 3D7FA 1M4GA 4NGQA 4LQGA 4UWJA 2JDDA 4M6HA 4ZY1A 4QC6A 2P6FA 1XMTA 2C1CA 4MHNA 1S5KA 4P6YA 2JBJA 4KSAA 3SJEA 4MHZA 3HLPA 3NH8A 1X12A 2B5GB 2C6PA 3CZXA 3PB7X 2VZYA 3PGPA 1YVKA 3F0AA 3PFOA 3D7GA 4MCPA 2Z3OA 4OC1A 4JLYA 4QBJA 4NF1A 4MRIA 3D2MA 3IJ3A 1HDUA 1RTQA 2IJZA 4A2ZA 4MXUA 3RNZA 1LOKA 1Y9KA 1PYTB 4CYQA 5KTDA 1M4DA 2PQ8A 1EE3P 2PR1A 4KOWA 4QVTA 2ARHA 3D67A 4UFXA 5DWNA 4B5OA 1IIDA 1I21A 4OLLA 4E2AA 5JM6A 3SI1A 4B10A 4B5PB 3G8WA 5D29A 1F57A 2QYVA 2R1IA 4MMOA 4OC5A 5HH1A 4H89A 2OU2A 1UFHA 4ZY2A 2DPTA 4P4FA 4Y49B 2PJ5A 3MN8A 1Z8TA 4A95A 2K5TA 3WC7A 3TE4A 4NGTA 4JXQA 1LFWA 1VKCA 3R95A 4C7HA 4Q7AA 4XPDB 2ZENA 2HC9A 5D8NA 2AFMA 2F5IA 1I1DA 4UFVA 2BCOA 3TTHA 2VI7A 3K9TA 3V7ZA 3LMSA 1LCPA 1Z8LA 2GFQA 1TKHA 4U9YA 1HDQA 1YW4A 1K4JA 4NGPA 2AFUA 1XOVA 4RN7A 4C2YA 2PJBA 2ZPAA 4KSFA 2IL4A 3GYAA 4IHMA 2Q0YA 2C6CA 2JBKA 3D8PA 2PRBA 3OWCA 4CGPA 3TOBA 4ZYQA 1LANA 4UFWA 5HMNA 4MI4A 2XEFA 4FWUA 2V8DA 3PP9A 3SJFA 4DUKA 3KHXA 2DXQA 4BD9A 4CGLA 4FD7A 2WSAA 1M44A 1M1DA 2R8VA 3D68A 4HNWB 2C27A 2XEGA 3PB8X 5E96A 2PJ3A 2PJ4A 5HVFA 3BI1A 2PJ9A 5LRGA 1IOFA 2YNDA 2YGWA 5LYFA 4KZTA 4R76A 1AYEA 5JQ4A 5HVHA 4PQAA 3BXMA 5AG6A 4P10A 2VQYA 2PVWA 5ELYA 2HUZA 4CYOA 8CPAA 2PJ1A 1ELMP 2AFXA 2Q43A 2PCUA 1H8LA 1BPMA 1YQEA 2V8HA 2V8VA 2B4DB 4JWPA 5AG5A 2ZEHA 4HKFA 2EVNA 3S9MA 5KTCA 5DS0A 1TF9A 4ZI6A 3ZJ0A 3KR4A 3WT4A 4CGOA 4UCMA 3RZAA 1YVOA 5DWMA 3W6XA 5A28A 4GM5A 2B58A 3GB0A 3B2YA 2B3VA 2R98A 1VIXA 2PSWA 3SI0A 3B3VA 2H5MA 5H86A 1QSRA 2GU2A 3IO1A 2GLJA 4KLWA 5THWA 5G1ZA 2B4BA 5EBVA 4FUUA 2VL1A 2OZUA 3S6GA 2EBJA 4CRYB 3WABA 1OZPA 4KORA 1S60A 2JLMA 4GXHA 3PBBA 3FX6A 3JUWA 2WPWA 1XE4A 4P4IA 3S6FA 3NH5A 4FAIA 1VHEA 3KI9A 1OBRA 4XPKA 2ZW4A 2ZEFA 3R1KA 5KTAA 1ZG9A 2PJ7A 2ZEOA 2RB7A 2BOAA 3NE8A 2QJ8A 4P4EA 3WC6A 5K8NA 2POKA 2JEWA 3TC8A 4H6ZA 4MFLA 2P6GA 3R9GA 2NSMA 2Q4YA 3FXTA 2AFOA 4FD5A 1YSJA 4A39A 1Y7RA 3IEHA 4MFKA 3SXOA 3EXNA 4MFJA 2ATRA 1R43A 1SQHA 2I3CA 2NYQA 2D4OA 3CDXA 4Q36A 1TKJA 1R57A 1CJWA 3SJGA 5G21A 3PB6X 2QMLA 3IFEA 1IGBA 4KOSA 4A30A 4H6UA 3GUXA 2PIYA 1CBXA 4F0XA 2CNMA 3D7HA 4NGSA 3TO6A 4KOYA 5K8PA 1MJ9A 4PK3A 1LRZA 3CT9A 4O23A 2PJ8A 4YRHA 3PEIA 2PDOA 1IY7A 1CP6A 1RO5A 1BOBA 3UY5A 3LD2A 3K9UA 5HVGA 1AMPA 3H8EA 2ABZA 4EWTA 1QSNA 3RAMA 1J4JA 4YFJA 2PJAA 4UF4A 4LX9A 5F46A 2FSRA 2Q4VA 3MGDA 4R6TA 4C2XA 4OIDA 2QIRA 3G3SA 1S7NA 1YREA 4NXYA 2ZELA 4KOVA 1ON0A 4CYNA 5J1QA 4X5KA 3IU2A 3H5ZA 3BJ8A 1Z9UA 4C2ZA 3QAYA 5ISVA 4FD6A 2DEAA 2Z0ZA 4KSIA 5JH9A 2GE3A 4RUHA 4OC4A 1Y7EA 4F9VA 2BL1A 2C6GA 1YMEA 5AG7A 4MFQA 3ZZIA 1XF8A 2FIWA 4M3SA 3R9EA 1CPXA 3V38A 1ZG7A 4CGNA 4JXRA 4QUSA 4XNHC 2P6EA 5LYDA 4CRZB 2YNCA 5J8CA 1LAPA 2Q7BA 4U9ZA 3GKRA 1KWMA 1XMBA 4R57A 1MK4A 3KQXA 1PU9A 3F8KA 1S7KA 1TF8A 5G20A 4IF5A 2BEIA 3R96A 4KS9A 2CTBA 3DLJA 2Z3LA 4JD6A 3BI0A 2DPSA 1XEBA 3CXPA 4MHYA 4OADA 4PK2A 1Y0YA 4MFPA 4ONWA 4OMEA 4IUSA 4JZ0A 2CXAA 3B35A 3BLNA 3DNSA 2YNEA 2JEVA 2Z11A 2RC4A 3KASA 3NA6A 1CP7A 2VZZA 2AJ6A 5EC4A 4CAWA 5I0CA 2Z3KA 1YW6A 3B8GA 2V77A 1I12A 2AFSA 3FMCA 3CXSA 4KOTA 3R9FA 2HV2A 3KHZA 1Z4RA 1BPNA 4OAEA 5J8FA 1CPSA 1QQ9A 2PC1A 3VATA 2Y0MA 2VEZA 1BO4A 5JPHA 4YU9A 3FEDA 3RO0A 4L8AA 4MHDA 2REEA 4KVXA 2OOTA 1TIQA 2KCWA 2AFWA 3QB8A 1ELLP 4TWEA 4R3KA 3VWEA 3SXNA 3QNVA 4AG9A 4YWYA 4A31A 3P2HA 3PBEA 1KUXA 2OR4A 2B3UA 3SHPA 1TXRA 2QVPA 3DGVA 3FF3A 2GIVA 4ZX9A 4B11A 5CPAA 4PXEA 1ZO0A 3FH4A 1F2PA 2J9AA 2ZOGA 1V0CA 1B6BA 4AVAA 1P4NA 1NE9A 5FVJA 3T9YA 1Z2LA 3PFEA 1GYTA 1Q2CA 3KL9A 4KVOE 2Z3NA 2BO9A 4KOXA 4CAEA 4UCPA 4OC0A 5IV0A 3JRUA 3TX8A 2PJ6A 1WWZA 4KUBA 4JYWA 2I00A 1IOIA 1QSTA 1YK3A 4JJXA 5K8OA 2PR8A 4LQ6A 4YGOA 2OH1A 4DNCA 4MY0A 4OP4A 2ZXVA 3GY9A 4X3RA 3S9NA 4GS4A 1CX8A 3I1UA 2FXFA 3VH9A 4A33A 1NSLA 3KKWA 1Y0RA 4RI1A 2I79A 2ZEDA 2FT0A 3S6HA 5IX3A 1IICA 1Z8XA 2IQ6A 4Q38A 1PCAA 1IU8A 3PZJA 4BMHA 5LRKA 4NSQA 1S7LA 3KZWA 1JQGA 2WZNA 2PJ0A 4MBUA 1YR0A 3T8WA 5C82A 4P4DA 1Y9WA 3CXQA 3C26A 2ZEGA 3B3SA 3S9LA 1WK4A 2DF5A 1U6MA 3IWGA 4NJRA 2CIJA 2EK8A 2FVGA 2A4NA 3FEEA 3B3CA 3D2PA 3KGQA 3KR5A 4FD4A 4RS2A 4A37A 4AB7A 3IGRA 5GCNA 1GHEA 1Z8WA 2BUEA 2OB0A 3H4QA 4UWIA 1S7FA 2FIAA 2ZW7A 4MCRA 3S6KA 3SI2A 2REFA 1IB1E 4UEEA 4ZGYB 5HXDA 1N71A 3FJUA 4DJLA 1RXTA 2O53A 1MJBA 3FIXA 5H84A 3IU1A 4P44A 1QMUA 2J8NA 3EY5A 4WWVA 4KVME 2G3TA 2PRQA 3MRUA 5AGEA 1M4IA 1JWQA 2PVVA 3DR6A 2HQYA 5AG4A 4II9A 4WJBA 3NE7A 4MY3A 4PXDA 2V8GA 2GANA 2B5GA 4MJ8A 4PXBA 3I3GA 4H2KA 2FL4A 3CPXA 3NFZA 4MFZA 4XNHB 5EMIA 5F48A 2F7VA 2G3AA 2EUIA 3L2NA 5G22A 4ONUA 3A9LA 3P2FA 4W9YA 2J8RA 4OKOA 4PSXA 4U5YA 4AXVA 4R87A 1F2OA 2RFHA 4F8ZA 2Q44A 2ZEEA 5C88A 1ZLIA 2PJ2A 4CGMA 1VHOA 1XIXA 2EO8A 2PIZA 4K30A 3V8IA 3W91A 1XRYA 3IWEA 4B5PA 3FECA 4MCSA 2VXKA 2Z3PA 4FBEA 4CS0B 5F09A 2CTCA 4AG7A 4B14A 5LYIA 1UWYA 5K8MA 1IYLA 3NH4A 4HPSA 4B12A 1QSMA 1VGYA 2ZEMA 6CPAA 2P0WA 2FCKA
chains in the Genus database with same CATH topology
3DSBA 4UCNA 1YLEA 2CNTA 4NCZA 4C68A 2FE7A 1VHSA 1YX0A 2YNCC 4L89A 4EVYA 4AVBA 2VBQA 4F0YA 5BWAB 2D4PA 1Z4EA 4Y49C 1Q2YA 3JVNA 4UBRA 4E0AA 4AVCA 4XPDC 1L0CA 2WUUA 2BSWA 2JDCA 4KOUA 3EFAA 4KUAA 3TOAA 3FB3A 2X7BA 2OZGA 4E8OA 3LODA 2QECA 3RYOA 4PSWA 2Z3MA 2B4DA 4J3GA 2FS5A 3DR8A 5CNPA 3TCVA 2AE6A 4CAXA 1MJAA 3EC4A 4LUAA 3WR7A 3DDDA 2CY2A 2ZW5A 3VWDA 4XPLA 3FBUA 4I49A 3W6SA 1QSOA 2CNSA 3FRMA 1B87A 3FYNA 3T90A 4PV6A 5A27A 2ZW6A 4M85A 1FY7A 1YGHA 4ZBGA 1PUAA 4C7IA 4CAVA 4F6AA 1S3ZA 4HNYB 2OZHA 3E0KA 2O28A 3TO7A 5F47A 2J8MA 3TO9A 1KUVA 1NMTA 4A32A 4CAFA 1KUYA 1Q2DA 4R3LA 3JTKA 5IB0A 4KLVA 1P0HA 4HNXB 2Z10A 3FNCA 3N7ZA 1IYKA 2Q04A 3EO4A 3TT2A 3D3SA 2WPXA 1KZFA 2R7HA 2G0BA 3F5BA 4R9MA 4B13A 3BJ7A 4ORFA 1CM0A 4QB9A 3TFYA 2NMTA 3QAHA 3I9SA 4UA3A 4NEXA 5F49A 4CYPA 1M4GA 4UWJA 2JDDA 4QC6A 2P6FA 1XMTA 1S5KA 4KSAA 3PGPA 2B5GB 2VZYA 1YVKA 3F0AA 2Z3OA 4JLYA 4QBJA 4NF1A 3D2MA 4A2ZA 1Y9KA 4CYQA 5KTDA 1M4DA 2PQ8A 2PR1A 4KOWA 4QVTA 4B5OA 2ARHA 4UFXA 5DWNA 1IIDA 1I21A 4OLLA 4E2AA 4B10A 4B5PB 3G8WA 2R1IA 5HH1A 4H89A 2OU2A 1UFHA 2DPTA 3TE4A 4Y49B 4A95A 2K5TA 4JXQA 1VKCA 4C7HA 3R95A 4XPDB 2F5IA 1I1DA 4UFVA 3TTHA 2VI7A 4U9YA 1K4JA 4C2YA 2ZPAA 4KSFA 2IL4A 3GYAA 2Q0YA 3D8PA 2PRBA 3OWCA 4CGPA 3TOBA 4UFWA 5HMNA 4MI4A 3PP9A 2DXQA 4CGLA 4FD7A 2WSAA 1M44A 1M1DA 2R8VA 4HNWB 4JXRA 2C27A 5E96A 2YNDA 2YGWA 4KZTA 5JQ4A 5AG6A 2VQYA 2HUZA 4CYOA 5AG5A 4JWPA 2B4DB 4HKFA 2EVNA 5KTCA 3ZJ0A 4CGOA 4UCMA 5A28A 1YVOA 5DWMA 3W6XA 2B58A 2B3VA 2R98A 2PSWA 5H86A 2H5MA 1QSRA 4KLWA 5G1ZA 2B4BA 5EBVA 2OZUA 3S6GA 4CRYB 1OZPA 4KORA 1S60A 2JLMA 3JUWA 2WPWA 1XE4A 3S6FA 4XPKA 2ZW4A 3R1KA 5KTAA 4H6ZA 4MFLA 2P6GA 3R9GA 2Q4YA 3FXTA 4FD5A 1Y7RA 3SXOA 4MFKA 3EXNA 4MFJA 2ATRA 1SQHA 2D4OA 4Q36A 1R57A 1CJWA 5G21A 2QMLA 4KOSA 4A30A 4H6UA 4F0XA 2CNMA 3TO6A 4KOYA 1MJ9A 4PK3A 1LRZA 4YRHA 4BBHA 3UY5A 2PDOA 1RO5A 1BOBA 3LD2A 3K9UA 1QSNA 1J4JA 4YFJA 4LX9A 5F46A 2FSRA 2Q4VA 3MGDA 4C2XA 2QIRA 3G3SA 1S7NA 1YREA 4NXYA 4KOVA 1ON0A 4CYNA 4X5KA 3IU2A 3H5ZA 3BJ8A 1Z9UA 4C2ZA 5ISVA 4FD6A 2Z0ZA 2GE3A 2BL1A 5AG7A 4MFQA 3ZZIA 1XF8A 2FIWA 4M3SA 3R9EA 4CGNA 4QUSA 4XNHC 2P6EA 4CRZB 5J8CA 2YNCA 2Q7BA 4U9ZA 3GKRA 4R57A 1MK4A 1PU9A 3F8KA 1S7KA 3R96A 5G20A 4IF5A 2BEIA 4KS9A 2Z3LA 4JD6A 2DPSA 1XEBA 3CXPA 4OADA 4PK2A 4MFPA 4IUSA 2CXAA 3BLNA 3DNSA 2YNEA 2JEVA 2Z11A 2RC4A 2VZZA 2AJ6A 5EC4A 4CAWA 5I0CA 2Z3KA 3B8GA 3R9FA 1I12A 4KOTA 3CXSA 2HV2A 1Z4RA 4OAEA 5J8FA 2PC1A 2Y0MA 2VEZA 1BO4A 5JPHA 4L8AA 4MHDA 2REEA 4KVXA 1TIQA 3QB8A 2KCWA 4R3KA 3VWEA 3SXNA 4AG9A 4A31A 3P2HA 1KUXA 2B3UA 3SHPA 2GIVA 4B11A 1ZO0A 1V0CA 1B6BA 4AVAA 1P4NA 1NE9A 5FVJA 3T9YA 4KVOE 1Q2CA 2Z3NA 4KOXA 4CAEA 4UCPA 5IV0A 4KUBA 1WWZA 2I00A 1YK3A 1QSTA 4JJXA 2PR8A 4YGOA 2OH1A 4DNCA 4MY0A 2ZXVA 3GY9A 4GS4A 2FXFA 4A33A 1NSLA 3KKWA 4RI1A 2I79A 2FT0A 3S6HA 5IX3A 1IICA 4Q38A 3PZJA 4BMHA 4NSQA 1S7LA 4MBUA 1YR0A 5C82A 1Y9WA 3CXQA 3C26A 1WK4A 1U6MA 3IWGA 2A4NA 4FD4A 4RS2A 3D2PA 4AB7A 3IGRA 5GCNA 1GHEA 2BUEA 2OB0A 3H4QA 4UWIA 1S7FA 2FIAA 2ZW7A 3S6KA 2REFA 1IB1E 4ZGYB 1N71A 1RXTA 1MJBA 3FIXA 5H84A 3IU1A 2J8NA 3EY5A 4KVME 2G3TA 5AGEA 1M4IA 3DR6A 2HQYA 5AG4A 4II9A 3NE7A 4MY3A 2GANA 2B5GA 4MJ8A 3I3GA 2FL4A 4MFZA 4XNHB 5F48A 2G3AA 2EUIA 5G22A 4ONUA 3A9LA 3P2FA 2J8RA 4PSXA 4U5YA 4R87A 2Q44A 5C88A 4CGMA 1XIXA 4K30A 3V8IA 3W91A 4B5PA 3IWEA 2VXKA 2Z3PA 4CS0B 4AG7A 4B14A 1IYLA 4B12A 1QSMA 2P0WA 2FCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSB A;  1YLE A;  2CNT A;  4NCZ A;  2FE7 A;  1VHS A;  1YX0 A;  4L89 A;  4EVY A;  4AVB A;  2VBQ A;  4F0Y A;  2D4P A;  1Z4E A;  4Y49 C;  1Q2Y A;  3JVN A;  4UBR A;  4E0A A;  4AVC A;  4XPD C;  1L0C A;  2BSW A;  2JDC A;  4KOU A;  3EFA A;  4KUA A;  3TOA A;  3FB3 A;  2X7B A;  2OZG A;  4E8O A;  3LOD A;  2QEC A;  3RYO A;  4PSW A;  2B4D A;  4J3G A;  2FS5 A;  3DR8 A;  5CNP A;  3TCV A;  2AE6 A;  4CAX A;  1MJA A;  3EC4 A;  4LUA A;  3WR7 A;  3DDD A;  2CY2 A;  2ZW5 A;  3VWD A;  4XPL A;  3FBU A;  4I49 A;  3W6S A;  1QSO A;  2CNS A;  3FRM A;  1B87 A;  3FYN A;  3T90 A;  4PV6 A;  2ZW6 A;  4M85 A;  1FY7 A;  1YGH A;  4ZBG A;  1PUA A;  4CAV A;  4F6A A;  1S3Z A;  4HNY B;  2OZH A;  3E0K A;  2O28 A;  3TO7 A;  5F47 A;  2J8M A;  3TO9 A;  1KUV A;  1NMT A;  1KUY A;  1Q2D A;  4R3L A;  5IB0 A;  4KLV A;  1P0H A;  4HNX B;  2Z10 A;  3FNC A;  3N7Z A;  1IYK A;  2Q04 A;  3EO4 A;  3TT2 A;  3D3S A;  2WPX A;  1KZF A;  2R7H A;  2G0B A;  3F5B A;  4R9M A;  3BJ7 A;  4ORF A;  1CM0 A;  4QB9 A;  3TFY A;  2NMT A;  3QAH A;  3I9S A;  4UA3 A;  4NEX A;  5F49 A;  1M4G A;  4UWJ A;  2JDD A;  4QC6 A;  2P6F A;  1XMT A;  1S5K A;  3PGP A;  2B5G B;  2VZY A;  1YVK A;  3F0A A;  4JLY A;  4QBJ A;  4NF1 A;  3D2M A;  1Y9K A;  5KTD A;  1M4D A;  2PQ8 A;  2PR1 A;  4KOW A;  4QVT A;  4B5O A;  2ARH A;  5DWN A;  1IID A;  1I21 A;  4OLL A;  4E2A A;  4B5P B;  3G8W A;  2R1I A;  5HH1 A;  4H89 A;  2OU2 A;  1UFH A;  3TE4 A;  4Y49 B;  2K5T A;  4JXQ A;  1VKC A;  3R95 A;  4XPD B;  2F5I A;  1I1D A;  3TTH A;  2VI7 A;  4U9Y A;  1K4J A;  2ZPA A;  2IL4 A;  3GYA A;  2Q0Y A;  3D8P A;  2PRB A;  3OWC A;  3TOB A;  5HMN A;  4MI4 A;  3PP9 A;  2DXQ A;  4FD7 A;  4JXR A;  1M44 A;  1M1D A;  2R8V A;  4HNW B;  2C27 A;  5E96 A;  4KZT A;  5JQ4 A;  2VQY A;  2HUZ A;  4JWP A;  2B4D B;  4HKF A;  2EVN A;  5KTC A;  3ZJ0 A;  1YVO A;  5DWM A;  3W6X A;  2B58 A;  2B3V A;  2R98 A;  2PSW A;  5H86 A;  2H5M A;  1QSR A;  4KLW A;  2B4B A;  5EBV A;  2OZU A;  3S6G A;  4CRY B;  1OZP A;  4KOR A;  1S60 A;  2JLM A;  3JUW A;  2WPW A;  1XE4 A;  3S6F A;  4XPK A;  2ZW4 A;  3R1K A;  5KTA A;  4H6Z A;  2P6G A;  3R9G A;  2Q4Y A;  3FXT A;  4FD5 A;  1Y7R A;  3SXO A;  3EXN A;  2ATR A;  1SQH A;  2D4O A;  1R57 A;  1CJW A;  2QML A;  4KOS A;  4H6U A;  2CNM A;  3TO6 A;  4KOY A;  1MJ9 A;  4PK3 A;  1LRZ A;  4YRH A;  3UY5 A;  2PDO A;  1RO5 A;  1BOB A;  3LD2 A;  3K9U A;  1QSN A;  1J4J A;  4YFJ A;  4LX9 A;  5F46 A;  2FSR A;  2Q4V A;  3MGD A;  2QIR A;  3G3S A;  1S7N A;  1YRE A;  4NXY A;  4KOV A;  1ON0 A;  4X5K A;  3BJ8 A;  1Z9U A;  5ISV A;  4FD6 A;  2Z0Z A;  2GE3 A;  2BL1 A;  3ZZI A;  1XF8 A;  2FIW A;  4M3S A;  3R9E A;  4QUS A;  4XNH C;  2P6E A;  4CRZ B;  5J8C A;  2Q7B A;  4U9Z A;  3GKR A;  4R57 A;  1MK4 A;  1PU9 A;  3F8K A;  1S7K A;  3R96 A;  4IF5 A;  2BEI A;  4JD6 A;  1XEB A;  3CXP A;  4OAD A;  4PK2 A;  4IUS A;  3BLN A;  3DNS A;  2Z11 A;  2JEV A;  2RC4 A;  2VZZ A;  2AJ6 A;  5EC4 A;  4CAW A;  5I0C A;  3B8G A;  3R9F A;  1I12 A;  4KOT A;  3CXS A;  2HV2 A;  1Z4R A;  4OAE A;  5J8F A;  2PC1 A;  2Y0M A;  2VEZ A;  1BO4 A;  5JPH A;  4L8A A;  4MHD A;  2REE A;  4KVX A;  1TIQ A;  3QB8 A;  2KCW A;  4R3K A;  3VWE A;  3SXN A;  4AG9 A;  3P2H A;  1KUX A;  2B3U A;  3SHP A;  2GIV A;  1V0C A;  1B6B A;  4AVA A;  1P4N A;  1NE9 A;  5FVJ A;  3T9Y A;  4KVO E;  1Q2C A;  4KOX A;  5IV0 A;  4KUB A;  1WWZ A;  2I00 A;  1YK3 A;  1QST A;  4JJX A;  2PR8 A;  4YGO A;  2OH1 A;  4DNC A;  4MY0 A;  2ZXV A;  3GY9 A;  4GS4 A;  2FXF A;  1NSL A;  3KKW A;  4RI1 A;  2I79 A;  2FT0 A;  3S6H A;  5IX3 A;  1IIC A;  3PZJ A;  4BMH A;  4NSQ A;  1S7L A;  4MBU A;  1YR0 A;  5C82 A;  1Y9W A;  3CXQ A;  3C26 A;  1WK4 A;  1U6M A;  3IWG A;  2A4N A;  4FD4 A;  4RS2 A;  3D2P A;  4AB7 A;  3IGR A;  5GCN A;  1GHE A;  2BUE A;  2OB0 A;  3H4Q A;  4UWI A;  1S7F A;  2FIA A;  2ZW7 A;  3S6K A;  2REF A;  1IB1 E;  1N71 A;  1RXT A;  1MJB A;  3FIX A;  5H84 A;  2J8N A;  3EY5 A;  4KVM E;  2G3T A;  1M4I A;  3DR6 A;  2HQY A;  4II9 A;  3NE7 A;  4MY3 A;  2GAN A;  2B5G A;  4MJ8 A;  3I3G A;  2FL4 A;  5F48 A;  4XNH B;  2G3A A;  2EUI A;  4ONU A;  3P2F A;  2J8R A;  4PSX A;  4U5Y A;  4R87 A;  2Q44 A;  5C88 A;  1XIX A;  4K30 A;  3V8I A;  3W91 A;  4B5P A;  2VXK A;  4CS0 B;  4AG7 A;  1IYL A;  1QSM A;  2P0W A;  2FCK A; 
#chains in the Genus database with same CATH topology
 3DSB A;  4X8I A;  1Z5R A;  4UCN A;  2ZEP A;  1YLE A;  2CNT A;  4NCZ A;  1XBU A;  3KQZ A;  2FE7 A;  4C68 A;  1VHS A;  1YX0 A;  2XEJ A;  2YNC C;  2Q4Z A;  4L89 A;  4UIB A;  3H8G A;  4AVB A;  4EVY A;  2ZOF A;  2VBQ A;  2PJC A;  1LAM A;  4EFD A;  4F0Y A;  1A2Z A;  5BWA B;  4OIW A;  2D4P A;  1FNO A;  1Z4E A;  4R7M A;  1FT7 A;  4M6I A;  4Y49 C;  3SJX A;  1Q2Y A;  4TNU A;  1YLO A;  3JVN A;  4UBR A;  7CPA A;  4E0A A;  4BBH A;  3D4U A;  4AVC A;  4NJQ A;  4XPD C;  1L0C A;  2WUU A;  1ZLH A;  2BSW A;  2JDC A;  3CPA A;  4KOU A;  3EFA A;  4KUA A;  4MHP A;  3VAR A;  3ISX A;  1NSA A;  3TOA A;  2F8H A;  1Q7L A;  4OC2 A;  1DE4 C;  3FB3 A;  2X7B A;  2OZG A;  4E8O A;  3LOD A;  2QEC A;  4P4B A;  3RYO A;  3PB9 X;  4PSW A;  4B6Z A;  2ANP A;  2HB6 A;  1X10 A;  2Z3M A;  2B4D A;  4J3G A;  2EWB A;  2FS5 A;  2PE3 A;  3DR8 A;  4PPZ A;  5CNP A;  4X2T A;  4NGN A;  4ZX8 A;  3TCV A;  3RBU A;  4NGR A;  2AE6 A;  4K3N A;  4CAX A;  4EME A;  1MJA A;  3FVL A;  3PB4 X;  5LRJ A;  1AUG A;  3EC4 A;  2AFZ A;  3IWW A;  1XJO A;  3BHX A;  3B3W A;  4LUA A;  4PXC A;  3WR7 A;  2Q7S A;  4CPA A;  4UEZ A;  3DDD A;  1HEE A;  2CY2 A;  2ZW5 A;  4MCQ A;  4Z65 A;  3VWD A;  4F9U A;  4XPL A;  3FBU A;  4I49 A;  3W6S A;  3B7I A;  4IAV A;  3WC5 A;  2G9D A;  4ZY0 A;  5JGF A;  3D66 A;  1QSO A;  2IMO A;  2CNS A;  5LYL A;  3FRM A;  1B87 A;  3FYN A;  3T90 A;  2GLF A;  4PV6 A;  1BAV A;  5A27 A;  1CG2 A;  2ZW6 A;  4M85 A;  4NFR A;  1FY7 A;  4P45 A;  1YGH A;  3PRT A;  4G1P A;  4ZBG A;  5I4M A;  1PUA A;  4C7I A;  4CAV A;  4F6A A;  1S3Z A;  4HNY B;  2OZH A;  3E0K A;  4OC3 A;  3ISZ A;  2O28 A;  3TO7 A;  3IC1 A;  5F47 A;  2J8M A;  2WYR A;  3TO9 A;  5IB9 A;  2O4H A;  1KUV A;  1NMT A;  2Q51 A;  3H8F A;  1KUY A;  1Q2D A;  3N5F A;  4IK2 A;  4P4J A;  4R3L A;  4A32 A;  3JTK A;  4A38 A;  3LWU A;  5IB0 A;  3B3T A;  1P0H A;  4HNX B;  4KLV A;  1M4L A;  2Z10 A;  3HUV A;  4UIA A;  2CF4 A;  3FNC A;  2XEI A;  2EK9 A;  3N7Z A;  3LAC A;  1IYK A;  2Q04 A;  4M6G A;  3EO4 A;  1ARM A;  4UEF A;  1DTD A;  1TKF A;  3TT2 A;  5CBM A;  3IIB A;  2ODF A;  3D3S A;  1XFO A;  1ARL A;  2WPX A;  1KZF A;  2R7H A;  2G0B A;  3F5B A;  1BLL E;  4R9M A;  4NGM A;  4B13 A;  4CAF A;  4BIN A;  2GRE A;  3BJ7 A;  3GLJ A;  4ORF A;  1CM0 A;  4QB9 A;  3TFY A;  2NMT A;  1ZG8 A;  3D7D A;  3QAH A;  3I9S A;  1R3N A;  3K2K A;  3GIU A;  4DYO A;  4UA3 A;  4NEX A;  4A94 A;  5F49 A;  4R8F A;  4CYP A;  3D7F A;  1M4G A;  4NGQ A;  4LQG A;  4UWJ A;  2JDD A;  4M6H A;  4ZY1 A;  4QC6 A;  2P6F A;  1XMT A;  2C1C A;  4MHN A;  1S5K A;  4P6Y A;  2JBJ A;  4KSA A;  3SJE A;  4MHZ A;  3HLP A;  3NH8 A;  1X12 A;  2B5G B;  2C6P A;  3CZX A;  3PB7 X;  2VZY A;  3PGP A;  1YVK A;  3F0A A;  3PFO A;  3D7G A;  4MCP A;  2Z3O A;  4OC1 A;  4JLY A;  4QBJ A;  4NF1 A;  4MRI A;  3D2M A;  3IJ3 A;  1HDU A;  1RTQ A;  2IJZ A;  4A2Z A;  4MXU A;  3RNZ A;  1LOK A;  1Y9K A;  1PYT B;  4CYQ A;  5KTD A;  1M4D A;  2PQ8 A;  1EE3 P;  2PR1 A;  4KOW A;  4QVT A;  2ARH A;  3D67 A;  4UFX A;  5DWN A;  4B5O A;  1IID A;  1I21 A;  4OLL A;  4E2A A;  5JM6 A;  3SI1 A;  4B10 A;  4B5P B;  3G8W A;  5D29 A;  1F57 A;  2QYV A;  2R1I A;  4MMO A;  4OC5 A;  5HH1 A;  4H89 A;  2OU2 A;  1UFH A;  4ZY2 A;  2DPT A;  4P4F A;  4Y49 B;  2PJ5 A;  3MN8 A;  1Z8T A;  4A95 A;  2K5T A;  3WC7 A;  3TE4 A;  4NGT A;  4JXQ A;  1LFW A;  1VKC A;  3R95 A;  4C7H A;  4Q7A A;  4XPD B;  2ZEN A;  2HC9 A;  5D8N A;  2AFM A;  2F5I A;  1I1D A;  4UFV A;  2BCO A;  3TTH A;  2VI7 A;  3K9T A;  3V7Z A;  3LMS A;  1LCP A;  1Z8L A;  2GFQ A;  1TKH A;  4U9Y A;  1HDQ A;  1YW4 A;  1K4J A;  4NGP A;  2AFU A;  1XOV A;  4RN7 A;  4C2Y A;  2PJB A;  2ZPA A;  4KSF A;  2IL4 A;  3GYA A;  4IHM A;  2Q0Y A;  2C6C A;  2JBK A;  3D8P A;  2PRB A;  3OWC A;  4CGP A;  3TOB A;  4ZYQ A;  1LAN A;  4UFW A;  5HMN A;  4MI4 A;  2XEF A;  4FWU A;  2V8D A;  3PP9 A;  3SJF A;  4DUK A;  3KHX A;  2DXQ A;  4BD9 A;  4CGL A;  4FD7 A;  2WSA A;  1M44 A;  1M1D A;  2R8V A;  3D68 A;  4HNW B;  2C27 A;  2XEG A;  3PB8 X;  5E96 A;  2PJ3 A;  2PJ4 A;  5HVF A;  3BI1 A;  2PJ9 A;  5LRG A;  1IOF A;  2YND A;  2YGW A;  5LYF A;  4KZT A;  4R76 A;  1AYE A;  5JQ4 A;  5HVH A;  4PQA A;  3BXM A;  5AG6 A;  4P10 A;  2VQY A;  2PVW A;  5ELY A;  2HUZ A;  4CYO A;  8CPA A;  2PJ1 A;  1ELM P;  2AFX A;  2Q43 A;  2PCU A;  1H8L A;  1BPM A;  1YQE A;  2V8H A;  2V8V A;  2B4D B;  4JWP A;  5AG5 A;  2ZEH A;  4HKF A;  2EVN A;  3S9M A;  5KTC A;  5DS0 A;  1TF9 A;  4ZI6 A;  3ZJ0 A;  3KR4 A;  3WT4 A;  4CGO A;  4UCM A;  3RZA A;  1YVO A;  5DWM A;  3W6X A;  5A28 A;  4GM5 A;  2B58 A;  3GB0 A;  3B2Y A;  2B3V A;  2R98 A;  1VIX A;  2PSW A;  3SI0 A;  3B3V A;  2H5M A;  5H86 A;  1QSR A;  2GU2 A;  3IO1 A;  2GLJ A;  4KLW A;  5THW A;  5G1Z A;  2B4B A;  5EBV A;  4FUU A;  2VL1 A;  2OZU A;  3S6G A;  2EBJ A;  4CRY B;  3WAB A;  1OZP A;  4KOR A;  1S60 A;  2JLM A;  4GXH A;  3PBB A;  3FX6 A;  3JUW A;  2WPW A;  1XE4 A;  4P4I A;  3S6F A;  3NH5 A;  4FAI A;  1VHE A;  3KI9 A;  1OBR A;  4XPK A;  2ZW4 A;  2ZEF A;  3R1K A;  5KTA A;  1ZG9 A;  2PJ7 A;  2ZEO A;  2RB7 A;  2BOA A;  3NE8 A;  2QJ8 A;  4P4E A;  3WC6 A;  5K8N A;  2POK A;  2JEW A;  3TC8 A;  4H6Z A;  4MFL A;  2P6G A;  3R9G A;  2NSM A;  2Q4Y A;  3FXT A;  2AFO A;  4FD5 A;  1YSJ A;  4A39 A;  1Y7R A;  3IEH A;  4MFK A;  3SXO A;  3EXN A;  4MFJ A;  2ATR A;  1R43 A;  1SQH A;  2I3C A;  2NYQ A;  2D4O A;  3CDX A;  4Q36 A;  1TKJ A;  1R57 A;  1CJW A;  3SJG A;  5G21 A;  3PB6 X;  2QML A;  3IFE A;  1IGB A;  4KOS A;  4A30 A;  4H6U A;  3GUX A;  2PIY A;  1CBX A;  4F0X A;  2CNM A;  3D7H A;  4NGS A;  3TO6 A;  4KOY A;  5K8P A;  1MJ9 A;  4PK3 A;  1LRZ A;  3CT9 A;  4O23 A;  2PJ8 A;  4YRH A;  3PEI A;  2PDO A;  1IY7 A;  1CP6 A;  1RO5 A;  1BOB A;  3UY5 A;  3LD2 A;  3K9U A;  5HVG A;  1AMP A;  3H8E A;  2ABZ A;  4EWT A;  1QSN A;  3RAM A;  1J4J A;  4YFJ A;  2PJA A;  4UF4 A;  4LX9 A;  5F46 A;  2FSR A;  2Q4V A;  3MGD A;  4R6T A;  4C2X A;  4OID A;  2QIR A;  3G3S A;  1S7N A;  1YRE A;  4NXY A;  2ZEL A;  4KOV A;  1ON0 A;  4CYN A;  5J1Q A;  4X5K A;  3IU2 A;  3H5Z A;  3BJ8 A;  1Z9U A;  4C2Z A;  3QAY A;  5ISV A;  4FD6 A;  2DEA A;  2Z0Z A;  4KSI A;  5JH9 A;  2GE3 A;  4RUH A;  4OC4 A;  1Y7E A;  4F9V A;  2BL1 A;  2C6G A;  1YME A;  5AG7 A;  4MFQ A;  3ZZI A;  1XF8 A;  2FIW A;  4M3S A;  3R9E A;  1CPX A;  3V38 A;  1ZG7 A;  4CGN A;  4JXR A;  4QUS A;  4XNH C;  2P6E A;  5LYD A;  4CRZ B;  2YNC A;  5J8C A;  1LAP A;  2Q7B A;  4U9Z A;  3GKR A;  1KWM A;  1XMB A;  4R57 A;  1MK4 A;  3KQX A;  1PU9 A;  3F8K A;  1S7K A;  1TF8 A;  5G20 A;  4IF5 A;  2BEI A;  3R96 A;  4KS9 A;  2CTB A;  3DLJ A;  2Z3L A;  4JD6 A;  3BI0 A;  2DPS A;  1XEB A;  3CXP A;  4MHY A;  4OAD A;  4PK2 A;  1Y0Y A;  4MFP A;  4ONW A;  4OME A;  4IUS A;  4JZ0 A;  2CXA A;  3B35 A;  3BLN A;  3DNS A;  2YNE A;  2JEV A;  2Z11 A;  2RC4 A;  3KAS A;  3NA6 A;  1CP7 A;  2VZZ A;  2AJ6 A;  5EC4 A;  4CAW A;  5I0C A;  2Z3K A;  1YW6 A;  3B8G A;  2V77 A;  1I12 A;  2AFS A;  3FMC A;  3CXS A;  4KOT A;  3R9F A;  2HV2 A;  3KHZ A;  1Z4R A;  1BPN A;  4OAE A;  5J8F A;  1CPS A;  1QQ9 A;  2PC1 A;  3VAT A;  2Y0M A;  2VEZ A;  1BO4 A;  5JPH A;  4YU9 A;  3FED A;  3RO0 A;  4L8A A;  4MHD A;  2REE A;  4KVX A;  2OOT A;  1TIQ A;  2KCW A;  2AFW A;  3QB8 A;  1ELL P;  4TWE A;  4R3K A;  3VWE A;  3SXN A;  3QNV A;  4AG9 A;  4YWY A;  4A31 A;  3P2H A;  3PBE A;  1KUX A;  2OR4 A;  2B3U A;  3SHP A;  1TXR A;  2QVP A;  3DGV A;  3FF3 A;  2GIV A;  4ZX9 A;  4B11 A;  5CPA A;  4PXE A;  1ZO0 A;  3FH4 A;  1F2P A;  2J9A A;  2ZOG A;  1V0C A;  1B6B A;  4AVA A;  1P4N A;  1NE9 A;  5FVJ A;  3T9Y A;  1Z2L A;  3PFE A;  1GYT A;  1Q2C A;  3KL9 A;  4KVO E;  2Z3N A;  2BO9 A;  4KOX A;  4CAE A;  4UCP A;  4OC0 A;  5IV0 A;  3JRU A;  3TX8 A;  2PJ6 A;  1WWZ A;  4KUB A;  4JYW A;  2I00 A;  1IOI A;  1QST A;  1YK3 A;  4JJX A;  5K8O A;  2PR8 A;  4LQ6 A;  4YGO A;  2OH1 A;  4DNC A;  4MY0 A;  4OP4 A;  2ZXV A;  3GY9 A;  4X3R A;  3S9N A;  4GS4 A;  1CX8 A;  3I1U A;  2FXF A;  3VH9 A;  4A33 A;  1NSL A;  3KKW A;  1Y0R A;  4RI1 A;  2I79 A;  2ZED A;  2FT0 A;  3S6H A;  5IX3 A;  1IIC A;  1Z8X A;  2IQ6 A;  4Q38 A;  1PCA A;  1IU8 A;  3PZJ A;  4BMH A;  5LRK A;  4NSQ A;  1S7L A;  3KZW A;  1JQG A;  2WZN A;  2PJ0 A;  4MBU A;  1YR0 A;  3T8W A;  5C82 A;  4P4D A;  1Y9W A;  3CXQ A;  3C26 A;  2ZEG A;  3B3S A;  3S9L A;  1WK4 A;  2DF5 A;  1U6M A;  3IWG A;  4NJR A;  2CIJ A;  2EK8 A;  2FVG A;  2A4N A;  3FEE A;  3B3C A;  3D2P A;  3KGQ A;  3KR5 A;  4FD4 A;  4RS2 A;  4A37 A;  4AB7 A;  3IGR A;  5GCN A;  1GHE A;  1Z8W A;  2BUE A;  2OB0 A;  3H4Q A;  4UWI A;  1S7F A;  2FIA A;  2ZW7 A;  4MCR A;  3S6K A;  3SI2 A;  2REF A;  1IB1 E;  4UEE A;  4ZGY B;  5HXD A;  1N71 A;  3FJU A;  4DJL A;  1RXT A;  2O53 A;  1MJB A;  3FIX A;  5H84 A;  3IU1 A;  4P44 A;  1QMU A;  2J8N A;  3EY5 A;  4WWV A;  4KVM E;  2G3T A;  2PRQ A;  3MRU A;  5AGE A;  1M4I A;  1JWQ A;  2PVV A;  3DR6 A;  2HQY A;  5AG4 A;  4II9 A;  4WJB A;  3NE7 A;  4MY3 A;  4PXD A;  2V8G A;  2GAN A;  2B5G A;  4MJ8 A;  4PXB A;  3I3G A;  4H2K A;  2FL4 A;  3CPX A;  3NFZ A;  4MFZ A;  4XNH B;  5EMI A;  5F48 A;  2F7V A;  2G3A A;  2EUI A;  3L2N A;  5G22 A;  4ONU A;  3A9L A;  3P2F A;  4W9Y A;  2J8R A;  4OKO A;  4PSX A;  4U5Y A;  4AXV A;  4R87 A;  1F2O A;  2RFH A;  4F8Z A;  2Q44 A;  2ZEE A;  5C88 A;  1ZLI A;  2PJ2 A;  4CGM A;  1VHO A;  1XIX A;  2EO8 A;  2PIZ A;  4K30 A;  3V8I A;  3W91 A;  1XRY A;  3IWE A;  4B5P A;  3FEC A;  4MCS A;  2VXK A;  2Z3P A;  4FBE A;  4CS0 B;  5F09 A;  2CTC A;  4AG7 A;  4B14 A;  5LYI A;  1UWY A;  5K8M A;  1IYL A;  3NH4 A;  4HPS A;  4B12 A;  1QSM A;  1VGY A;  2ZEM A;  6CPA A;  2P0W A;  2FCK A; 
#chains in the Genus database with same CATH homology
 3DSB A;  4UCN A;  1YLE A;  2CNT A;  4NCZ A;  4C68 A;  2FE7 A;  1VHS A;  1YX0 A;  2YNC C;  4L89 A;  4EVY A;  4AVB A;  2VBQ A;  4F0Y A;  5BWA B;  2D4P A;  1Z4E A;  4Y49 C;  1Q2Y A;  3JVN A;  4UBR A;  4E0A A;  4AVC A;  4XPD C;  1L0C A;  2WUU A;  2BSW A;  2JDC A;  4KOU A;  3EFA A;  4KUA A;  3TOA A;  3FB3 A;  2X7B A;  2OZG A;  4E8O A;  3LOD A;  2QEC A;  3RYO A;  4PSW A;  2Z3M A;  2B4D A;  4J3G A;  2FS5 A;  3DR8 A;  5CNP A;  3TCV A;  2AE6 A;  4CAX A;  1MJA A;  3EC4 A;  4LUA A;  3WR7 A;  3DDD A;  2CY2 A;  2ZW5 A;  3VWD A;  4XPL A;  3FBU A;  4I49 A;  3W6S A;  1QSO A;  2CNS A;  3FRM A;  1B87 A;  3FYN A;  3T90 A;  4PV6 A;  5A27 A;  2ZW6 A;  4M85 A;  1FY7 A;  1YGH A;  4ZBG A;  1PUA A;  4C7I A;  4CAV A;  4F6A A;  1S3Z A;  4HNY B;  2OZH A;  3E0K A;  2O28 A;  3TO7 A;  5F47 A;  2J8M A;  3TO9 A;  1KUV A;  1NMT A;  4A32 A;  4CAF A;  1KUY A;  1Q2D A;  4R3L A;  3JTK A;  5IB0 A;  4KLV A;  1P0H A;  4HNX B;  2Z10 A;  3FNC A;  3N7Z A;  1IYK A;  2Q04 A;  3EO4 A;  3TT2 A;  3D3S A;  2WPX A;  1KZF A;  2R7H A;  2G0B A;  3F5B A;  4R9M A;  4B13 A;  3BJ7 A;  4ORF A;  1CM0 A;  4QB9 A;  3TFY A;  2NMT A;  3QAH A;  3I9S A;  4UA3 A;  4NEX A;  5F49 A;  4CYP A;  1M4G A;  4UWJ A;  2JDD A;  4QC6 A;  2P6F A;  1XMT A;  1S5K A;  4KSA A;  3PGP A;  2B5G B;  2VZY A;  1YVK A;  3F0A A;  2Z3O A;  4JLY A;  4QBJ A;  4NF1 A;  3D2M A;  4A2Z A;  1Y9K A;  4CYQ A;  5KTD A;  1M4D A;  2PQ8 A;  2PR1 A;  4KOW A;  4QVT A;  4B5O A;  2ARH A;  4UFX A;  5DWN A;  1IID A;  1I21 A;  4OLL A;  4E2A A;  4B10 A;  4B5P B;  3G8W A;  2R1I A;  5HH1 A;  4H89 A;  2OU2 A;  1UFH A;  2DPT A;  3TE4 A;  4Y49 B;  4A95 A;  2K5T A;  4JXQ A;  1VKC A;  4C7H A;  3R95 A;  4XPD B;  2F5I A;  1I1D A;  4UFV A;  3TTH A;  2VI7 A;  4U9Y A;  1K4J A;  4C2Y A;  2ZPA A;  4KSF A;  2IL4 A;  3GYA A;  2Q0Y A;  3D8P A;  2PRB A;  3OWC A;  4CGP A;  3TOB A;  4UFW A;  5HMN A;  4MI4 A;  3PP9 A;  2DXQ A;  4CGL A;  4FD7 A;  2WSA A;  1M44 A;  1M1D A;  2R8V A;  4HNW B;  4JXR A;  2C27 A;  5E96 A;  2YND A;  2YGW A;  4KZT A;  5JQ4 A;  5AG6 A;  2VQY A;  2HUZ A;  4CYO A;  5AG5 A;  4JWP A;  2B4D B;  4HKF A;  2EVN A;  5KTC A;  3ZJ0 A;  4CGO A;  4UCM A;  5A28 A;  1YVO A;  5DWM A;  3W6X A;  2B58 A;  2B3V A;  2R98 A;  2PSW A;  5H86 A;  2H5M A;  1QSR A;  4KLW A;  5G1Z A;  2B4B A;  5EBV A;  2OZU A;  3S6G A;  4CRY B;  1OZP A;  4KOR A;  1S60 A;  2JLM A;  3JUW A;  2WPW A;  1XE4 A;  3S6F A;  4XPK A;  2ZW4 A;  3R1K A;  5KTA A;  4H6Z A;  4MFL A;  2P6G A;  3R9G A;  2Q4Y A;  3FXT A;  4FD5 A;  1Y7R A;  3SXO A;  4MFK A;  3EXN A;  4MFJ A;  2ATR A;  1SQH A;  2D4O A;  4Q36 A;  1R57 A;  1CJW A;  5G21 A;  2QML A;  4KOS A;  4A30 A;  4H6U A;  4F0X A;  2CNM A;  3TO6 A;  4KOY A;  1MJ9 A;  4PK3 A;  1LRZ A;  4YRH A;  4BBH A;  3UY5 A;  2PDO A;  1RO5 A;  1BOB A;  3LD2 A;  3K9U A;  1QSN A;  1J4J A;  4YFJ A;  4LX9 A;  5F46 A;  2FSR A;  2Q4V A;  3MGD A;  4C2X A;  2QIR A;  3G3S A;  1S7N A;  1YRE A;  4NXY A;  4KOV A;  1ON0 A;  4CYN A;  4X5K A;  3IU2 A;  3H5Z A;  3BJ8 A;  1Z9U A;  4C2Z A;  5ISV A;  4FD6 A;  2Z0Z A;  2GE3 A;  2BL1 A;  5AG7 A;  4MFQ A;  3ZZI A;  1XF8 A;  2FIW A;  4M3S A;  3R9E A;  4CGN A;  4QUS A;  4XNH C;  2P6E A;  4CRZ B;  5J8C A;  2YNC A;  2Q7B A;  4U9Z A;  3GKR A;  4R57 A;  1MK4 A;  1PU9 A;  3F8K A;  1S7K A;  3R96 A;  5G20 A;  4IF5 A;  2BEI A;  4KS9 A;  2Z3L A;  4JD6 A;  2DPS A;  1XEB A;  3CXP A;  4OAD A;  4PK2 A;  4MFP A;  4IUS A;  2CXA A;  3BLN A;  3DNS A;  2YNE A;  2JEV A;  2Z11 A;  2RC4 A;  2VZZ A;  2AJ6 A;  5EC4 A;  4CAW A;  5I0C A;  2Z3K A;  3B8G A;  3R9F A;  1I12 A;  4KOT A;  3CXS A;  2HV2 A;  1Z4R A;  4OAE A;  5J8F A;  2PC1 A;  2Y0M A;  2VEZ A;  1BO4 A;  5JPH A;  4L8A A;  4MHD A;  2REE A;  4KVX A;  1TIQ A;  3QB8 A;  2KCW A;  4R3K A;  3VWE A;  3SXN A;  4AG9 A;  4A31 A;  3P2H A;  1KUX A;  2B3U A;  3SHP A;  2GIV A;  4B11 A;  1ZO0 A;  1V0C A;  1B6B A;  4AVA A;  1P4N A;  1NE9 A;  5FVJ A;  3T9Y A;  4KVO E;  1Q2C A;  2Z3N A;  4KOX A;  4CAE A;  4UCP A;  5IV0 A;  4KUB A;  1WWZ A;  2I00 A;  1YK3 A;  1QST A;  4JJX A;  2PR8 A;  4YGO A;  2OH1 A;  4DNC A;  4MY0 A;  2ZXV A;  3GY9 A;  4GS4 A;  2FXF A;  4A33 A;  1NSL A;  3KKW A;  4RI1 A;  2I79 A;  2FT0 A;  3S6H A;  5IX3 A;  1IIC A;  4Q38 A;  3PZJ A;  4BMH A;  4NSQ A;  1S7L A;  4MBU A;  1YR0 A;  5C82 A;  1Y9W A;  3CXQ A;  3C26 A;  1WK4 A;  1U6M A;  3IWG A;  2A4N A;  4FD4 A;  4RS2 A;  3D2P A;  4AB7 A;  3IGR A;  5GCN A;  1GHE A;  2BUE A;  2OB0 A;  3H4Q A;  4UWI A;  1S7F A;  2FIA A;  2ZW7 A;  3S6K A;  2REF A;  1IB1 E;  4ZGY B;  1N71 A;  1RXT A;  1MJB A;  3FIX A;  5H84 A;  3IU1 A;  2J8N A;  3EY5 A;  4KVM E;  2G3T A;  5AGE A;  1M4I A;  3DR6 A;  2HQY A;  5AG4 A;  4II9 A;  3NE7 A;  4MY3 A;  2GAN A;  2B5G A;  4MJ8 A;  3I3G A;  2FL4 A;  4MFZ A;  4XNH B;  5F48 A;  2G3A A;  2EUI A;  5G22 A;  4ONU A;  3A9L A;  3P2F A;  2J8R A;  4PSX A;  4U5Y A;  4R87 A;  2Q44 A;  5C88 A;  4CGM A;  1XIX A;  4K30 A;  3V8I A;  3W91 A;  4B5P A;  3IWE A;  2VXK A;  2Z3P A;  4CS0 B;  4AG7 A;  4B14 A;  1IYL A;  4B12 A;  1QSM A;  2P0W A;  2FCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...