1IICA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound myristoylcoa
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE N-myristoyltransferase
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 128
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA02
2FE7A 2QIRA 4ZBGA 2P6EA 4CAWA 4L89A 4KVXA 4HKFA 2Y0MA 1I12A 4R9MA 2ZXVA 2ZW7A 1VKCA 1S7NA 5ISVA 2ATRA 4II9A 4CRYB 3FRMA 3QAHA 4RI1A 2WPXA 4FD7A 4KOYA 3FNCA 2DXQA 2VQYA 1P4NA 1NE9A 4AVAA 3R96A 3WR7A 2NMTA 1XE4A 2KCWA 2R8VA 3E0KA 4B5PA 2B58A 2JEVA 2Z11A 3FYNA 1BO4A 2VZYA 3EY5A 5I0CA 4UBRA 4QC6A 1YVKA 4NF1A 1KZFA 3RYOA 1MJ9A 3TO9A 2D4OA 4BMHA 4R3LA 4QVTA 4XNHB 4KOTA 4ORFA 5EBVA 2Q7BA 4KLVA 2B3VA 1Y7RA 4H6UA 2REEA 4NEXA 4JWPA 2CNTA 4KUBA 4DNCA 1IYLA 4UWIA 4E0AA 5JPHA 2PRBA 3TE4A 4UA3A 2OZUA 2ZW4A 4M3SA 4YRHA 4YGOA 4OAEA 2B5GB 4HNWB 1S7LA 2BEIA 2FIAA 1MJBA 2C27A 4FD5A 3S6FA 3TO6A 4B5OA 3P2FA 1YR0A 2VZZA 3QB8A 4JXRA 4R87A 2AJ6A 3G8WA 3EFAA 4K30A 5JQ4A 5DWMA 1XF8A 1QSRA 3BJ8A 4PK2A 5IX3A 2FL4A 4KLWA 2H5MA 1KUYA 2ARHA 4XPDB 4KOSA 2K5TA 4FD4A 5J8FA 4AB7A 1WWZA 3B8GA 4NCZA 1K4JA 4UWJA 4F6AA 2PC1A 1LRZA 4MHDA 3W91A 3VWDA 2VXKA 2CY2A 1BOBA 4HNYB 1B6BA 3D2MA 2QECA 3KKWA 3FBUA 3R9EA 2B4DA 2P6GA 4KORA 3DR6A 2Z10A 1N71A 3DSBA 3R9FA 4X5KA 5GCNA 2OZHA 2EUIA 3T9YA 3IGRA 4U5YA 1MK4A 4PK3A 1S7FA 4MY0A 3FB3A 5KTDA 1Y9WA 2PQ8A 1R57A 2JLMA 1Q2DA 1Q2YA 3DNSA 4XPDC 4B5PB 4GS4A 2AE6A 4M85A 4PSWA 2QMLA 4J3GA 1XMTA 3TFYA 4E8OA 2G3TA 2R98A 3CXSA 2IL4A 1VHSA 1M44A 3CXPA 1QSTA 1PUAA 1QSMA 4H89A 3G3SA 4MI4A 2PR1A 4PSXA 5F49A 1L0CA 4KZTA 3W6XA 3TO7A 1IICA 4LUAA 1YX0A 2JDDA 3LODA 3S6KA 4FD6A 3TOBA 3CXQA 4NXYA 2D4PA 4KVME 4AVCA 2VEZA 4CAXA 2CNMA 3IWGA 1UFHA 2OH1A 1P0HA 3SHPA 4KUAA 4XPKA 2I79A 2R1IA 3GY9A 3D3SA 3ZZIA 5C88A 4JXQA 2P6FA 3H4QA 4JJXA 5J8CA 4PV6A 3R95A 4LX9A 3S6HA 1IB1E 2Q04A 1KUVA 1S7KA 2FT0A 3VWEA 5EC4A 3T90A 5HMNA 5F48A 1YGHA 3LD2A 4CAVA 4E2AA 4R57A 2PR8A 3SXNA 2B5GA 5IB0A 4OLLA 2J8NA 4CS0B 2OB0A 1TIQA 1V0CA 1RO5A 2GE3A 2J8MA 2FIWA 3I9SA 2HQYA 4IUSA 2HUZA 1XEBA 5F47A 2Q4YA 4MJ8A 2Z0ZA 4XPLA 1Q2CA 1S5KA 2B4DB 2OU2A 3JUWA 1U6MA 3FIXA 4AVBA 1QSNA 4ONUA 2G3AA 3NE7A 4F0YA 1RXTA 2B4BA 1ON0A 1YK3A 2CNSA 2Q4VA 3GKRA 2FXFA 5H86A 4KOUA 1YREA 3P2HA 4AG9A 3PP9A 5IV0A 1MJAA 1SQHA 2HV2A 3EXNA 1IIDA 3F0AA 4JLYA 2X7BA 3V8IA 3TOAA 1KUXA 3OWCA 3BLNA 2I00A 3R9GA 4RS2A 2GANA 2OZGA 5E96A 1FY7A 3TTHA 3GYAA 4U9ZA 4KOXA 3I3GA 1Z4EA 4EVYA 1S3ZA 3TCVA 3DDDA 3F5BA 4CRZB 2FSRA 1I1DA 1CM0A 2JDCA 3DR8A 2Q44A 5KTCA 2EVNA 2GIVA 2VI7A 2B3UA 5C82A 1M4DA 2Q0YA 4KOVA 3JVNA 2ZW6A 4HNXB 2BSWA 1Z9UA 1I21A 4R3KA 1IYKA 5FVJA 5H84A 1WK4A 1Y9KA 3UY5A 1XIXA 4AG7A 2G0BA 1NMTA 1OZPA 2F5IA 3EO4A 2BUEA 5CNPA 4NSQA 4QUSA 1QSOA 2FS5A 2PSWA 1YVOA 3BJ7A 5KTAA 2REFA 4Y49B 1M4IA 2O28A 1B87A 3D8PA 3FXTA 2PDOA 1GHEA 2WPWA 3MGDA 4U9YA 2ZPAA 4OADA 3C26A 3PGPA 4IF5A 1YLEA 4JD6A 4QBJA 1J4JA 3TT2A 3W6SA 4KVOE 4QB9A 4YFJA 3N7ZA 1Z4RA 4MY3A 4L8AA 4KOWA 2J8RA 3K9UA 1PU9A 5HH1A 2A4NA 2P0WA 2RC4A 4MBUA 3D2PA 1S60A 1M4GA 2FCKA 4H6ZA 3F8KA 4I49A 3S6GA 3EC4A 1NSLA 1M1DA 3SXOA 5F46A 1CJWA 4XNHC 2R7HA 3ZJ0A 2ZW5A 5DWNA 3PZJA 2BL1A 4Y49C 3R1KA 2VBQA
chains in the Genus database with same CATH superfamily
2AFXA 2FE7A 2QIRA 4ZBGA 3SJEA 2P6EA 1CP7A 1JQGA 4CAWA 4NGPA 2ZEHA 4BBHA 7CPAA 5AG7A 5D8NA 5HXDA 2CF4A 4MMOA 3ISXA 3N5FA 4L89A 4KVXA 5K8MA 4HKFA 2Y0MA 2Q51A 3NH5A 1I12A 4MFKA 4C7HA 4R9MA 2ZXVA 2ZW7A 4Q38A 1VKCA 2PJ8A 3VH9A 5G22A 3RBUA 5K8NA 1S7NA 4MHPA 4ZY0A 5ISVA 5G1ZA 3IWEA 2CTBA 2ATRA 4II9A 4CRYB 2PJAA 1Z8TA 3FRMA 3NFZA 3QAHA 4RI1A 4R8FA 4B14A 4B10A 4A32A 1LFWA 3H8FA 1Y0RA 4IAVA 4FWUA 2AFOA 2WPXA 5K8PA 4FD7A 4KOYA 3FF3A 3FNCA 1TKHA 2DXQA 2VQYA 1P4NA 4CYOA 1LAMA 1NE9A 4ZI6A 4AVAA 3SJGA 3R96A 2ZEPA 2Z3KA 2AFSA 4TWEA 4NGMA 5G20A 5A28A 1AMPA 4C68A 2PE3A 1OBRA 2J9AA 3CDXA 3WC6A 3WR7A 4P4JA 3FH4A 4YU9A 2NMTA 4A39A 1XE4A 2KCWA 2R8VA 3E0KA 4UEEA 4A31A 2C6PA 4B5PA 1XFOA 2B58A 4KS9A 2EO8A 4R76A 2JEVA 3PB8X 2Z11A 4X8IA 3CPAA 2WZNA 3FYNA 4P4IA 4NGQA 1BO4A 1Z8WA 4IK2A 2VZYA 4MFPA 3EY5A 4P44A 3JRUA 3SI1A 3WABA 5I0CA 4UBRA 2GU2A 4QC6A 1HEEA 4P4DA 5LYLA 4CYNA 4DYOA 1YVKA 1IY7A 4GXHA 4NF1A 2YGWA 1KZFA 3RYOA 1ELLP 1MJ9A 4B13A 4F9UA 1BAVA 3TO9A 1IGBA 2D4OA 4OC4A 4BMHA 4O23A 4QVTA 4R3LA 3D67A 3HLPA 2NYQA 1IOIA 4XNHB 3CT9A 1ZG8A 4KOTA 4ORFA 5EBVA 2Q7BA 1A2ZA 2B3VA 1Y7RA 4H6UA 4KLVA 2REEA 2ZENA 4NEXA 4JWPA 4KSIA 4A37A 5EMIA 2CNTA 1QMUA 4KUBA 4DNCA 2QJ8A 1IYLA 1R3NA 4UWIA 4E0AA 3KGQA 1ZLIA 5HVGA 3KZWA 5JPHA 1PCAA 2PRBA 3FECA 3SI2A 3TX8A 4ZGYB 4CYPA 3TE4A 4UA3A 2OZUA 3WC7A 2ZW4A 4M3SA 4YRHA 4NGNA 4C7IA 4YGOA 4CGNA 2PVWA 3LACA 4OAEA 2PIYA 3PBEA 1BPMA 4ZYQA 2B5GB 4HNWB 3T8WA 1S7LA 2BEIA 2FIAA 1LOKA 1MJBA 2C27A 5F09A 2V8DA 4A2ZA 4FD5A 3S6FA 3TO6A 4B5OA 4X3RA 4FAIA 2IQ6A 3P2FA 1YR0A 2VZZA 3QB8A 4JXRA 3PB9X 4R87A 1KWMA 4YWYA 5CBMA 2AJ6A 3G8WA 5THWA 2GFQA 3EFAA 2PJ7A 3D7FA 2CIJA 2EK8A 2AFWA 4K30A 5JQ4A 5DWMA 2PJ4A 2AFUA 1Q7LA 1XF8A 2OR4A 3SJFA 1QSRA 2YNCC 3BJ8A 4PK2A 2G9DA 2JBJA 5IX3A 2FL4A 2XEJA 4OP4A 2RFHA 4KLWA 2H5MA 3HUVA 2ODFA 1KUYA 2ARHA 4XPDB 4KOSA 2K5TA 3PB6X 4FD4A 5J8FA 5HVFA 3NE8A 2YNDA 4AB7A 1AYEA 1WWZA 3B8GA 3PEIA 5LYDA 4NCZA 1K4JA 4UWJA 1Y0YA 4F6AA 1VHOA 2PC1A 2QVPA 1LRZA 2O4HA 2DPSA 3H8GA 3B3TA 4MHDA 4MHNA 1HDQA 2CTCA 1YMEA 3PFEA 1F2PA 1YQEA 3W91A 3VWDA 2VXKA 2CY2A 2Q7SA 1BOBA 4HNYB 4LQ6A 1B6BA 4CGPA 5DS0A 4ZY1A 3NH8A 3D2MA 3KR5A 4MFLA 2YNEA 2QECA 2C6GA 4OC3A 5AGEA 3KKWA 3FBUA 3R9EA 2B4DA 2P6GA 4KORA 4MHZA 3DR6A 2Z10A 1N71A 3DSBA 3R9FA 4X5KA 3PB7X 3LMSA 2CXAA 5GCNA 2OZHA 2ZEFA 2EUIA 4Z65A 5LRJA 3T9YA 4EMEA 2PCUA 3IWWA 3IGRA 4U5YA 1MK4A 4PK3A 1S7FA 3V38A 4P10A 4KSAA 3K9TA 3WT4A 5AG6A 2DF5A 4MY0A 1CPSA 5CPAA 3FB3A 4M6IA 1XOVA 1Y9WA 2Z3MA 3A9LA 2PQ8A 4WWVA 1R57A 2JLMA 4CPAA 1Q2DA 3IIBA 1Q2YA 3BI1A 4JZ0A 3DNSA 4XPDC 4A33A 4A94A 1R43A 2V8VA 4PPZA 4B5PB 4GS4A 2AE6A 4PXBA 1FNOA 5BWAB 2AFZA 4WJBA 3S9MA 1DE4C 3GUXA 4M85A 4OC5A 1ELMP 2V77A 1TKFA 2ZELA 4PSWA 1UWYA 2QMLA 3MRUA 4J3GA 1XMTA 3TFYA 2HC9A 4E8OA 5LRGA 2G3TA 2R98A 3FVLA 3CXSA 2IL4A 3FEEA 1VHSA 3B35A 3JTKA 1M44A 3PRTA 3IFEA 2JBKA 1YLOA 3CXPA 1QSTA 1HDUA 1XRYA 4B11A 3KR4A 1IOFA 1DTDA 1F57A 1PUAA 2Z3PA 2V8HA 3RZAA 4W9YA 1QSMA 4UEZA 4P4BA 4B12A 1XJOA 3G3SA 3ISZA 4H89A 4MI4A 2PR1A 8CPAA 3IJ3A 4PSXA 3RNZA 3IEHA 5F49A 1L0CA 3B2YA 4KZTA 3TO7A 3W6XA 1IICA 2EBJA 1YW6A 1TKJA 2C1CA 2PJBA 1TXRA 3BXMA 2IJZA 1YX0A 4LUAA 2JDDA 4UCMA 1XBUA 3LODA 3WC5A 4UCNA 3S6KA 4FD6A 3TOBA 3CXQA 4NXYA 2ANPA 3GLJA 2D4PA 3PFOA 4KVME 4OC2A 4AVCA 2VEZA 4CAXA 2CNMA 3IWGA 2AFMA 3DLJA 1UFHA 1VGYA 2OH1A 5HVHA 4R6TA 2PIZA 3LWUA 1P0HA 1F2OA 1Y7EA 4X2TA 3SHPA 4KUAA 4ONWA 3DGVA 3B3SA 4XPKA 2I79A 2R1IA 2VL1A 3GY9A 3D3SA 3FX6A 1YW4A 2Z3OA 3ZZIA 5C88A 4P45A 4Q36A 2Z3NA 1H8LA 4JXQA 4A95A 2Q4ZA 2P6FA 4P4EA 5K8OA 5AG4A 3B3CA 3H4QA 1Z8LA 4JJXA 5IB9A 1QQ9A 5J8CA 4PV6A 3R95A 4LX9A 3KL9A 1PYTB 2PJ6A 3D7DA 3S6HA 1IB1E 4LQGA 4CGMA 1TF8A 2Q04A 1KUVA 1S7KA 3RAMA 4NJQA 4P4FA 2FT0A 3VWEA 1ARLA 2PJ3A 5EC4A 5LYIA 3CPXA 2F8HA 5J1QA 2PJ0A 4PXCA 3T90A 5HMNA 5F48A 1YGHA 4CGOA 4C2XA 1ZO0A 4MXUA 3LD2A 4CAVA 1VHEA 4E2AA 4R57A 2PR8A 3IU2A 3SXNA 2B5GA 5IB0A 4OLLA 4OC1A 3D7GA 3MN8A 2J8NA 3D7HA 4CS0B 2OB0A 4NJRA 4CGLA 1TIQA 4CAFA 1CG2A 3B7IA 1V0CA 1RO5A 2GE3A 2J8MA 2FIWA 3I9SA 2HQYA 1Z5RA 4IUSA 2HB6A 2HUZA 1ARMA 1XEBA 4MCRA 5F47A 2Q4YA 1IU8A 3B3VA 4MJ8A 1LANA 2Z0ZA 1CX8A 3FMCA 4NGTA 4XPLA 5JH9A 2GLJA 1Q2CA 4FBEA 1S5KA 3S9LA 5AG5A 2B4DB 2OU2A 4UEFA 2ABZA 1AUGA 4OMEA 1BLLE 1BPNA 3JUWA 3PBBA 2JEWA 1U6MA 3FIXA 4AVBA 3GB0A 1QSNA 4ONUA 4UFVA 2G3AA 2WSAA 3D4UA 2NSMA 3QNVA 2PJCA 4PQAA 4UCPA 3NE7A 4F0YA 3NA6A 1RXTA 4ZX8A 4A38A 1VIXA 2B4BA 1ON0A 3D66A 1YK3A 2CNSA 4RN7A 2Q4VA 2ZEGA 3GKRA 2FXFA 3L2NA 5H86A 2FVGA 4KOUA 4MHYA 1XMBA 2PJ2A 4MFZA 1YREA 3P2HA 4AG9A 3H5ZA 1YSJA 3PP9A 5IV0A 4RUHA 2GLFA 1MJAA 5JM6A 1SQHA 2HV2A 3EXNA 3IC1A 1IIDA 3IO1A 4AXVA 3F0AA 4EWTA 2PRQA 4JLYA 2I3CA 2X7BA 4PXDA 3V8IA 2PJ9A 4MRIA 4K3NA 3KQXA 3TOAA 1KUXA 3NH4A 3BLNA 3OWCA 5LRKA 2I00A 4PXEA 3R9GA 4RS2A 2GANA 2OZGA 3PB4X 3KHXA 2ZOFA 5E96A 3H8EA 3CZXA 4MCSA 1CPXA 4MCPA 4EFDA 1FY7A 1M4LA 3RO0A 3TTHA 3GYAA 3S9NA 4U9ZA 1CBXA 3KQZA 3KI9A 4A30A 4KOXA 4F0XA 2PVVA 2Z3LA 2DPTA 3I3GA 3KASA 1GYTA 1ZG9A 3I1UA 4MCQA 1Z4EA 3V7ZA 4EVYA 2EWBA 4OC0A 1S3ZA 4H2KA 4M6GA 3SI0A 3TCVA 3DDDA 3F5BA 4UFXA 2ZEOA 2FSRA 1I1DA 4CRZB 1CM0A 3VATA 2JDCA 1ZLHA 3DR8A 2Q44A 5KTCA 2QYVA 2EVNA 2GIVA 2VI7A 3FJUA 2B3UA 5C82A 1M4DA 4TNUA 2Q0YA 4KOVA 3JVNA 2ZW6A 3B3WA 4NGRA 2XEFA 4HNXB 2BSWA 1Z9UA 1I21A 2RB7A 4R3KA 1IYKA 5FVJA 5H84A 4UFWA 1WK4A 2PJ1A 3QAYA 1Y9KA 2XEIA 1XIXA 3UY5A 2EK9A 3K2KA 6CPAA 4AG7A 2G0BA 1NMTA 4IHMA 4KSFA 2PJ5A 3GIUA 1OZPA 2F5IA 2C6CA 4C2YA 2YNCA 3EO4A 2BUEA 5CNPA 4B6ZA 4G1PA 1X12A 5ELYA 4NSQA 4F8ZA 4QUSA 1QSOA 4M6HA 2FS5A 4JYWA 2PSWA 1YVOA 2WYRA 3BJ7A 1EE3P 4ZX9A 4BD9A 5KTAA 2REFA 4NFRA 4Y49B 1M4IA 2O28A 3D68A 4FUUA 3VARA 2BO9A 3FEDA 4OIDA 1B87A 3D8PA 2O53A 2DEAA 3FXTA 2ZEDA 5D29A 2PDOA 4C2ZA 1RTQA 1GHEA 2ZEEA 4MFJA 2WPWA 3MGDA 4U9YA 2ZPAA 3SJXA 2OOTA 4OADA 4Q7AA 4BINA 2ZEMA 4ZY2A 4DJLA 3C26A 1LCPA 3PGPA 2V8GA 4IF5A 5G21A 4GM5A 2POKA 1YLEA 2BOAA 4JD6A 4F9VA 4QBJA 1J4JA 1TF9A 1LAPA 4DUKA 5LYFA 3TT2A 3IU1A 4MFQA 3W6SA 3TC8A 4KVOE 4QB9A 4YFJA 3N7ZA 1Z4RA 4UIAA 4MY3A 4CYQA 4L8AA 1X10A 2WUUA 5JGFA 4KOWA 2Q43A 2J8RA 3KHZA 4UIBA 4UF4A 1CP6A 3K9UA 1PU9A 5A27A 1ZG7A 5HH1A 2A4NA 2P0WA 2RC4A 1NSAA 3D2PA 4MBUA 1S60A 1M4GA 2F7VA 1JWQA 1FT7A 2FCKA 4H6ZA 2IMOA 3F8KA 4I49A 3S6GA 3EC4A 4OIWA 4P6YA 3BI0A 5KTDA 1NSLA 1M1DA 4NGSA 3BHXA 4HPSA 2XEGA 3SXOA 1Z8XA 2BCOA 5F46A 5I4MA 1CJWA 1Z2LA 2R7HA 4XNHC 3ZJ0A 2GREA 2ZW5A 3PZJA 2BL1A 4OKOA 5DWNA 4Y49C 4CAEA 3R1KA 2ZOGA 2VBQA 4R7MA
chains in the Genus database with same CATH topology
2FE7A 2QIRA 4ZBGA 2P6EA 4CAWA 4BBHA 5AG7A 4L89A 4KVXA 4HKFA 2Y0MA 1I12A 4MFKA 4C7HA 4R9MA 2ZXVA 2ZW7A 4Q38A 1VKCA 5G22A 1S7NA 5ISVA 5G1ZA 3IWEA 2ATRA 4II9A 4CRYB 3FRMA 3QAHA 4RI1A 4B14A 4B10A 4A32A 2WPXA 4FD7A 4KOYA 3FNCA 2DXQA 2VQYA 1P4NA 4CYOA 1NE9A 4AVAA 3R96A 2Z3KA 5G20A 5A28A 4C68A 3WR7A 2NMTA 1XE4A 2KCWA 2R8VA 3E0KA 4A31A 4B5PA 2B58A 4KS9A 2JEVA 2Z11A 3FYNA 1BO4A 2VZYA 4MFPA 3EY5A 5I0CA 4UBRA 4QC6A 4CYNA 1YVKA 4NF1A 2YGWA 1KZFA 3RYOA 4B13A 1MJ9A 3TO9A 2D4OA 4BMHA 4R3LA 4QVTA 4XNHB 4KOTA 4ORFA 5EBVA 2Q7BA 4KLVA 2B3VA 1Y7RA 4H6UA 2REEA 4NEXA 4JWPA 2CNTA 4KUBA 4DNCA 1IYLA 4UWIA 4E0AA 5JPHA 2PRBA 4ZGYB 4CYPA 3TE4A 4UA3A 2OZUA 2ZW4A 4M3SA 4YRHA 4C7IA 4YGOA 4CGNA 4OAEA 2B5GB 4HNWB 1S7LA 2BEIA 2FIAA 1MJBA 2C27A 4A2ZA 4FD5A 3S6FA 3TO6A 4B5OA 3P2FA 1YR0A 2VZZA 3QB8A 4JXRA 4R87A 2AJ6A 3G8WA 3EFAA 4K30A 5JQ4A 5DWMA 1XF8A 1QSRA 2YNCC 3BJ8A 4PK2A 5IX3A 2FL4A 4KLWA 2H5MA 1KUYA 2ARHA 4XPDB 4KOSA 2K5TA 4FD4A 5J8FA 2YNDA 4AB7A 1WWZA 3B8GA 4NCZA 1K4JA 4UWJA 4F6AA 2PC1A 1LRZA 2DPSA 4MHDA 3W91A 3VWDA 2VXKA 2CY2A 1BOBA 4HNYB 1B6BA 4CGPA 3D2MA 4MFLA 2YNEA 2QECA 5AGEA 3KKWA 3FBUA 3R9EA 2B4DA 2P6GA 4KORA 3DR6A 2Z10A 1N71A 3DSBA 3R9FA 4X5KA 2CXAA 5GCNA 2OZHA 2EUIA 3T9YA 3IGRA 4U5YA 1MK4A 4PK3A 1S7FA 4KSAA 5AG6A 4MY0A 3FB3A 5KTDA 1Y9WA 2Z3MA 3A9LA 2PQ8A 1R57A 2JLMA 1Q2DA 1Q2YA 3DNSA 4XPDC 4A33A 4B5PB 4GS4A 2AE6A 5BWAB 4M85A 4PSWA 2QMLA 4J3GA 1XMTA 3TFYA 4E8OA 2G3TA 2R98A 3CXSA 2IL4A 1VHSA 3JTKA 1M44A 3CXPA 1QSTA 4B11A 1PUAA 2Z3PA 1QSMA 4B12A 4H89A 3G3SA 4MI4A 2PR1A 4PSXA 5F49A 1L0CA 4KZTA 3W6XA 3TO7A 1IICA 4LUAA 1YX0A 2JDDA 4UCMA 3LODA 4UCNA 3S6KA 4FD6A 3TOBA 3CXQA 4NXYA 2D4PA 4KVME 4AVCA 2VEZA 4CAXA 2CNMA 3IWGA 1UFHA 2OH1A 1P0HA 3SHPA 4KUAA 4XPKA 2I79A 2R1IA 3GY9A 3D3SA 2Z3OA 3ZZIA 5C88A 4Q36A 2Z3NA 4A95A 4JXQA 2P6FA 5AG4A 3H4QA 4JJXA 5J8CA 4PV6A 3R95A 4LX9A 3S6HA 1IB1E 4CGMA 2Q04A 1KUVA 1S7KA 2FT0A 3VWEA 5EC4A 3T90A 5HMNA 5F48A 1YGHA 4CGOA 4C2XA 1ZO0A 3LD2A 4CAVA 4E2AA 4R57A 2PR8A 3IU2A 3SXNA 2B5GA 5IB0A 4OLLA 2J8NA 4CS0B 2OB0A 4CGLA 1TIQA 4CAFA 1V0CA 1RO5A 2GE3A 2J8MA 2FIWA 3I9SA 2HQYA 4IUSA 2HUZA 1XEBA 5F47A 2Q4YA 4MJ8A 2Z0ZA 4XPLA 1Q2CA 1S5KA 5AG5A 2B4DB 2OU2A 3JUWA 1U6MA 3FIXA 4AVBA 1QSNA 4ONUA 4UFVA 2G3AA 2WSAA 4UCPA 3NE7A 4F0YA 1RXTA 2B4BA 1ON0A 1YK3A 2CNSA 2Q4VA 3GKRA 2FXFA 5H86A 4KOUA 4MFZA 1YREA 3P2HA 4AG9A 3H5ZA 3PP9A 5IV0A 1MJAA 1SQHA 2HV2A 3EXNA 1IIDA 3F0AA 4JLYA 2X7BA 3V8IA 3TOAA 1KUXA 3OWCA 3BLNA 2I00A 3R9GA 4RS2A 2GANA 2OZGA 5E96A 1FY7A 3TTHA 3GYAA 4U9ZA 4A30A 4KOXA 4F0XA 2Z3LA 2DPTA 3I3GA 1Z4EA 4EVYA 1S3ZA 3TCVA 3DDDA 3F5BA 4UFXA 4CRZB 2FSRA 1I1DA 1CM0A 2JDCA 3DR8A 2Q44A 5KTCA 2EVNA 2GIVA 2VI7A 2B3UA 5C82A 1M4DA 2Q0YA 4KOVA 3JVNA 2ZW6A 4HNXB 2BSWA 1Z9UA 1I21A 4R3KA 1IYKA 5FVJA 5H84A 4UFWA 1WK4A 1Y9KA 3UY5A 1XIXA 4AG7A 2G0BA 1NMTA 4KSFA 1OZPA 2F5IA 4C2YA 2YNCA 3EO4A 2BUEA 5CNPA 4NSQA 4QUSA 1QSOA 2FS5A 2PSWA 1YVOA 3BJ7A 5KTAA 2REFA 4Y49B 1M4IA 2O28A 1B87A 3D8PA 3FXTA 4C2ZA 2PDOA 1GHEA 4MFJA 2WPWA 3MGDA 4U9YA 2ZPAA 4OADA 3C26A 3PGPA 4IF5A 5G21A 1YLEA 4JD6A 4QBJA 1J4JA 3TT2A 3IU1A 4MFQA 3W6SA 4KVOE 4QB9A 4YFJA 3N7ZA 1Z4RA 4MY3A 4CYQA 4L8AA 2WUUA 4KOWA 2J8RA 3K9UA 1PU9A 5A27A 5HH1A 2A4NA 2P0WA 2RC4A 4MBUA 3D2PA 1S60A 1M4GA 2FCKA 4H6ZA 3F8KA 4I49A 3S6GA 3EC4A 1NSLA 1M1DA 3SXOA 5F46A 1CJWA 4XNHC 2R7HA 3ZJ0A 2ZW5A 5DWNA 3PZJA 2BL1A 4Y49C 4CAEA 3R1KA 2VBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE7 A;  2QIR A;  4ZBG A;  2P6E A;  4CAW A;  4L89 A;  4KVX A;  4HKF A;  2Y0M A;  1I12 A;  4R9M A;  2ZXV A;  2ZW7 A;  1VKC A;  1S7N A;  5ISV A;  2ATR A;  4II9 A;  4CRY B;  3FRM A;  3QAH A;  4RI1 A;  2WPX A;  4FD7 A;  4KOY A;  3FNC A;  2DXQ A;  2VQY A;  1P4N A;  1NE9 A;  4AVA A;  3R96 A;  3WR7 A;  2NMT A;  1XE4 A;  2KCW A;  2R8V A;  3E0K A;  4B5P A;  2B58 A;  2JEV A;  2Z11 A;  3FYN A;  1BO4 A;  2VZY A;  3EY5 A;  5I0C A;  4UBR A;  4QC6 A;  1YVK A;  4NF1 A;  1KZF A;  3RYO A;  1MJ9 A;  3TO9 A;  2D4O A;  4BMH A;  4R3L A;  4QVT A;  4XNH B;  4KOT A;  4ORF A;  5EBV A;  2Q7B A;  4KLV A;  2B3V A;  1Y7R A;  4H6U A;  2REE A;  4NEX A;  4JWP A;  2CNT A;  4KUB A;  4DNC A;  1IYL A;  4UWI A;  4E0A A;  5JPH A;  2PRB A;  3TE4 A;  4UA3 A;  2OZU A;  2ZW4 A;  4M3S A;  4YRH A;  4YGO A;  4OAE A;  2B5G B;  4HNW B;  1S7L A;  2BEI A;  2FIA A;  1MJB A;  2C27 A;  4FD5 A;  3S6F A;  3TO6 A;  4B5O A;  3P2F A;  1YR0 A;  2VZZ A;  3QB8 A;  4JXR A;  4R87 A;  2AJ6 A;  3G8W A;  3EFA A;  4K30 A;  5JQ4 A;  5DWM A;  1XF8 A;  1QSR A;  3BJ8 A;  4PK2 A;  5IX3 A;  2FL4 A;  4KLW A;  2H5M A;  1KUY A;  2ARH A;  4XPD B;  4KOS A;  2K5T A;  4FD4 A;  5J8F A;  4AB7 A;  1WWZ A;  3B8G A;  4NCZ A;  1K4J A;  4UWJ A;  4F6A A;  2PC1 A;  1LRZ A;  4MHD A;  3W91 A;  3VWD A;  2VXK A;  2CY2 A;  1BOB A;  4HNY B;  1B6B A;  3D2M A;  2QEC A;  3KKW A;  3FBU A;  3R9E A;  2B4D A;  2P6G A;  4KOR A;  3DR6 A;  2Z10 A;  1N71 A;  3DSB A;  3R9F A;  4X5K A;  5GCN A;  2OZH A;  2EUI A;  3T9Y A;  3IGR A;  4U5Y A;  1MK4 A;  4PK3 A;  1S7F A;  4MY0 A;  3FB3 A;  5KTD A;  1Y9W A;  2PQ8 A;  1R57 A;  2JLM A;  1Q2D A;  1Q2Y A;  3DNS A;  4XPD C;  4B5P B;  4GS4 A;  2AE6 A;  4M85 A;  4PSW A;  2QML A;  4J3G A;  1XMT A;  3TFY A;  4E8O A;  2G3T A;  2R98 A;  3CXS A;  2IL4 A;  1VHS A;  1M44 A;  3CXP A;  1QST A;  1PUA A;  1QSM A;  4H89 A;  3G3S A;  4MI4 A;  2PR1 A;  4PSX A;  5F49 A;  1L0C A;  4KZT A;  3W6X A;  3TO7 A;  1IIC A;  4LUA A;  1YX0 A;  2JDD A;  3LOD A;  3S6K A;  4FD6 A;  3TOB A;  3CXQ A;  4NXY A;  2D4P A;  4KVM E;  4AVC A;  2VEZ A;  4CAX A;  2CNM A;  3IWG A;  1UFH A;  2OH1 A;  1P0H A;  3SHP A;  4KUA A;  4XPK A;  2I79 A;  2R1I A;  3GY9 A;  3D3S A;  3ZZI A;  5C88 A;  4JXQ A;  2P6F A;  3H4Q A;  4JJX A;  5J8C A;  4PV6 A;  3R95 A;  4LX9 A;  3S6H A;  1IB1 E;  2Q04 A;  1KUV A;  1S7K A;  2FT0 A;  3VWE A;  5EC4 A;  3T90 A;  5HMN A;  5F48 A;  1YGH A;  3LD2 A;  4CAV A;  4E2A A;  4R57 A;  2PR8 A;  3SXN A;  2B5G A;  5IB0 A;  4OLL A;  2J8N A;  4CS0 B;  2OB0 A;  1TIQ A;  1V0C A;  1RO5 A;  2GE3 A;  2J8M A;  2FIW A;  3I9S A;  2HQY A;  4IUS A;  2HUZ A;  1XEB A;  5F47 A;  2Q4Y A;  4MJ8 A;  2Z0Z A;  4XPL A;  1Q2C A;  1S5K A;  2B4D B;  2OU2 A;  3JUW A;  1U6M A;  3FIX A;  4AVB A;  1QSN A;  4ONU A;  2G3A A;  3NE7 A;  4F0Y A;  1RXT A;  2B4B A;  1ON0 A;  1YK3 A;  2CNS A;  2Q4V A;  3GKR A;  2FXF A;  5H86 A;  4KOU A;  1YRE A;  3P2H A;  4AG9 A;  3PP9 A;  5IV0 A;  1MJA A;  1SQH A;  2HV2 A;  3EXN A;  1IID A;  3F0A A;  4JLY A;  2X7B A;  3V8I A;  3TOA A;  1KUX A;  3OWC A;  3BLN A;  2I00 A;  3R9G A;  4RS2 A;  2GAN A;  2OZG A;  5E96 A;  1FY7 A;  3TTH A;  3GYA A;  4U9Z A;  4KOX A;  3I3G A;  1Z4E A;  4EVY A;  1S3Z A;  3TCV A;  3DDD A;  3F5B A;  4CRZ B;  2FSR A;  1I1D A;  1CM0 A;  2JDC A;  3DR8 A;  2Q44 A;  5KTC A;  2EVN A;  2GIV A;  2VI7 A;  2B3U A;  5C82 A;  1M4D A;  2Q0Y A;  4KOV A;  3JVN A;  2ZW6 A;  4HNX B;  2BSW A;  1Z9U A;  1I21 A;  4R3K A;  1IYK A;  5FVJ A;  5H84 A;  1WK4 A;  1Y9K A;  3UY5 A;  1XIX A;  4AG7 A;  2G0B A;  1NMT A;  1OZP A;  2F5I A;  3EO4 A;  2BUE A;  5CNP A;  4NSQ A;  4QUS A;  1QSO A;  2FS5 A;  2PSW A;  1YVO A;  3BJ7 A;  5KTA A;  2REF A;  4Y49 B;  1M4I A;  2O28 A;  1B87 A;  3D8P A;  3FXT A;  2PDO A;  1GHE A;  2WPW A;  3MGD A;  4U9Y A;  2ZPA A;  4OAD A;  3C26 A;  3PGP A;  4IF5 A;  1YLE A;  4JD6 A;  4QBJ A;  1J4J A;  3TT2 A;  3W6S A;  4KVO E;  4QB9 A;  4YFJ A;  3N7Z A;  1Z4R A;  4MY3 A;  4L8A A;  4KOW A;  2J8R A;  3K9U A;  1PU9 A;  5HH1 A;  2A4N A;  2P0W A;  2RC4 A;  4MBU A;  3D2P A;  1S60 A;  1M4G A;  2FCK A;  4H6Z A;  3F8K A;  4I49 A;  3S6G A;  3EC4 A;  1NSL A;  1M1D A;  3SXO A;  5F46 A;  1CJW A;  4XNH C;  2R7H A;  3ZJ0 A;  2ZW5 A;  5DWN A;  3PZJ A;  2BL1 A;  4Y49 C;  3R1K A;  2VBQ A; 
#chains in the Genus database with same CATH topology
 2AFX A;  2FE7 A;  2QIR A;  4ZBG A;  3SJE A;  2P6E A;  1CP7 A;  1JQG A;  4CAW A;  4NGP A;  2ZEH A;  4BBH A;  7CPA A;  5AG7 A;  5D8N A;  5HXD A;  2CF4 A;  4MMO A;  3ISX A;  3N5F A;  4L89 A;  4KVX A;  5K8M A;  4HKF A;  2Y0M A;  2Q51 A;  3NH5 A;  1I12 A;  4MFK A;  4C7H A;  4R9M A;  2ZXV A;  2ZW7 A;  4Q38 A;  1VKC A;  2PJ8 A;  3VH9 A;  5G22 A;  3RBU A;  5K8N A;  1S7N A;  4MHP A;  4ZY0 A;  5ISV A;  5G1Z A;  3IWE A;  2CTB A;  2ATR A;  4II9 A;  4CRY B;  2PJA A;  1Z8T A;  3FRM A;  3NFZ A;  3QAH A;  4RI1 A;  4R8F A;  4B14 A;  4B10 A;  4A32 A;  1LFW A;  3H8F A;  1Y0R A;  4IAV A;  4FWU A;  2AFO A;  2WPX A;  5K8P A;  4FD7 A;  4KOY A;  3FF3 A;  3FNC A;  1TKH A;  2DXQ A;  2VQY A;  1P4N A;  4CYO A;  1LAM A;  1NE9 A;  4ZI6 A;  4AVA A;  3SJG A;  3R96 A;  2ZEP A;  2Z3K A;  2AFS A;  4TWE A;  4NGM A;  5G20 A;  5A28 A;  1AMP A;  4C68 A;  2PE3 A;  1OBR A;  2J9A A;  3CDX A;  3WC6 A;  3WR7 A;  4P4J A;  3FH4 A;  4YU9 A;  2NMT A;  4A39 A;  1XE4 A;  2KCW A;  2R8V A;  3E0K A;  4UEE A;  4A31 A;  2C6P A;  4B5P A;  1XFO A;  2B58 A;  4KS9 A;  2EO8 A;  4R76 A;  2JEV A;  3PB8 X;  2Z11 A;  4X8I A;  3CPA A;  2WZN A;  3FYN A;  4P4I A;  4NGQ A;  1BO4 A;  1Z8W A;  4IK2 A;  2VZY A;  4MFP A;  3EY5 A;  4P44 A;  3JRU A;  3SI1 A;  3WAB A;  5I0C A;  4UBR A;  2GU2 A;  4QC6 A;  1HEE A;  4P4D A;  5LYL A;  4CYN A;  4DYO A;  1YVK A;  1IY7 A;  4GXH A;  4NF1 A;  2YGW A;  1KZF A;  3RYO A;  1ELL P;  1MJ9 A;  4B13 A;  4F9U A;  1BAV A;  3TO9 A;  1IGB A;  2D4O A;  4OC4 A;  4BMH A;  4O23 A;  4QVT A;  4R3L A;  3D67 A;  3HLP A;  2NYQ A;  1IOI A;  4XNH B;  3CT9 A;  1ZG8 A;  4KOT A;  4ORF A;  5EBV A;  2Q7B A;  1A2Z A;  2B3V A;  1Y7R A;  4H6U A;  4KLV A;  2REE A;  2ZEN A;  4NEX A;  4JWP A;  4KSI A;  4A37 A;  5EMI A;  2CNT A;  1QMU A;  4KUB A;  4DNC A;  2QJ8 A;  1IYL A;  1R3N A;  4UWI A;  4E0A A;  3KGQ A;  1ZLI A;  5HVG A;  3KZW A;  5JPH A;  1PCA A;  2PRB A;  3FEC A;  3SI2 A;  3TX8 A;  4ZGY B;  4CYP A;  3TE4 A;  4UA3 A;  2OZU A;  3WC7 A;  2ZW4 A;  4M3S A;  4YRH A;  4NGN A;  4C7I A;  4YGO A;  4CGN A;  2PVW A;  3LAC A;  4OAE A;  2PIY A;  3PBE A;  1BPM A;  4ZYQ A;  2B5G B;  4HNW B;  3T8W A;  1S7L A;  2BEI A;  2FIA A;  1LOK A;  1MJB A;  2C27 A;  5F09 A;  2V8D A;  4A2Z A;  4FD5 A;  3S6F A;  3TO6 A;  4B5O A;  4X3R A;  4FAI A;  2IQ6 A;  3P2F A;  1YR0 A;  2VZZ A;  3QB8 A;  4JXR A;  3PB9 X;  4R87 A;  1KWM A;  4YWY A;  5CBM A;  2AJ6 A;  3G8W A;  5THW A;  2GFQ A;  3EFA A;  2PJ7 A;  3D7F A;  2CIJ A;  2EK8 A;  2AFW A;  4K30 A;  5JQ4 A;  5DWM A;  2PJ4 A;  2AFU A;  1Q7L A;  1XF8 A;  2OR4 A;  3SJF A;  1QSR A;  2YNC C;  3BJ8 A;  4PK2 A;  2G9D A;  2JBJ A;  5IX3 A;  2FL4 A;  2XEJ A;  4OP4 A;  2RFH A;  4KLW A;  2H5M A;  3HUV A;  2ODF A;  1KUY A;  2ARH A;  4XPD B;  4KOS A;  2K5T A;  3PB6 X;  4FD4 A;  5J8F A;  5HVF A;  3NE8 A;  2YND A;  4AB7 A;  1AYE A;  1WWZ A;  3B8G A;  3PEI A;  5LYD A;  4NCZ A;  1K4J A;  4UWJ A;  1Y0Y A;  4F6A A;  1VHO A;  2PC1 A;  2QVP A;  1LRZ A;  2O4H A;  2DPS A;  3H8G A;  3B3T A;  4MHD A;  4MHN A;  1HDQ A;  2CTC A;  1YME A;  3PFE A;  1F2P A;  1YQE A;  3W91 A;  3VWD A;  2VXK A;  2CY2 A;  2Q7S A;  1BOB A;  4HNY B;  4LQ6 A;  1B6B A;  4CGP A;  5DS0 A;  4ZY1 A;  3NH8 A;  3D2M A;  3KR5 A;  4MFL A;  2YNE A;  2QEC A;  2C6G A;  4OC3 A;  5AGE A;  3KKW A;  3FBU A;  3R9E A;  2B4D A;  2P6G A;  4KOR A;  4MHZ A;  3DR6 A;  2Z10 A;  1N71 A;  3DSB A;  3R9F A;  4X5K A;  3PB7 X;  3LMS A;  2CXA A;  5GCN A;  2OZH A;  2ZEF A;  2EUI A;  4Z65 A;  5LRJ A;  3T9Y A;  4EME A;  2PCU A;  3IWW A;  3IGR A;  4U5Y A;  1MK4 A;  4PK3 A;  1S7F A;  3V38 A;  4P10 A;  4KSA A;  3K9T A;  3WT4 A;  5AG6 A;  2DF5 A;  4MY0 A;  1CPS A;  5CPA A;  3FB3 A;  4M6I A;  1XOV A;  1Y9W A;  2Z3M A;  3A9L A;  2PQ8 A;  4WWV A;  1R57 A;  2JLM A;  4CPA A;  1Q2D A;  3IIB A;  1Q2Y A;  3BI1 A;  4JZ0 A;  3DNS A;  4XPD C;  4A33 A;  4A94 A;  1R43 A;  2V8V A;  4PPZ A;  4B5P B;  4GS4 A;  2AE6 A;  4PXB A;  1FNO A;  5BWA B;  2AFZ A;  4WJB A;  3S9M A;  1DE4 C;  3GUX A;  4M85 A;  4OC5 A;  1ELM P;  2V77 A;  1TKF A;  2ZEL A;  4PSW A;  1UWY A;  2QML A;  3MRU A;  4J3G A;  1XMT A;  3TFY A;  2HC9 A;  4E8O A;  5LRG A;  2G3T A;  2R98 A;  3FVL A;  3CXS A;  2IL4 A;  3FEE A;  1VHS A;  3B35 A;  3JTK A;  1M44 A;  3PRT A;  3IFE A;  2JBK A;  1YLO A;  3CXP A;  1QST A;  1HDU A;  1XRY A;  4B11 A;  3KR4 A;  1IOF A;  1DTD A;  1F57 A;  1PUA A;  2Z3P A;  2V8H A;  3RZA A;  4W9Y A;  1QSM A;  4UEZ A;  4P4B A;  4B12 A;  1XJO A;  3G3S A;  3ISZ A;  4H89 A;  4MI4 A;  2PR1 A;  8CPA A;  3IJ3 A;  4PSX A;  3RNZ A;  3IEH A;  5F49 A;  1L0C A;  3B2Y A;  4KZT A;  3TO7 A;  3W6X A;  1IIC A;  2EBJ A;  1YW6 A;  1TKJ A;  2C1C A;  2PJB A;  1TXR A;  3BXM A;  2IJZ A;  1YX0 A;  4LUA A;  2JDD A;  4UCM A;  1XBU A;  3LOD A;  3WC5 A;  4UCN A;  3S6K A;  4FD6 A;  3TOB A;  3CXQ A;  4NXY A;  2ANP A;  3GLJ A;  2D4P A;  3PFO A;  4KVM E;  4OC2 A;  4AVC A;  2VEZ A;  4CAX A;  2CNM A;  3IWG A;  2AFM A;  3DLJ A;  1UFH A;  1VGY A;  2OH1 A;  5HVH A;  4R6T A;  2PIZ A;  3LWU A;  1P0H A;  1F2O A;  1Y7E A;  4X2T A;  3SHP A;  4KUA A;  4ONW A;  3DGV A;  3B3S A;  4XPK A;  2I79 A;  2R1I A;  2VL1 A;  3GY9 A;  3D3S A;  3FX6 A;  1YW4 A;  2Z3O A;  3ZZI A;  5C88 A;  4P45 A;  4Q36 A;  2Z3N A;  1H8L A;  4JXQ A;  4A95 A;  2Q4Z A;  2P6F A;  4P4E A;  5K8O A;  5AG4 A;  3B3C A;  3H4Q A;  1Z8L A;  4JJX A;  5IB9 A;  1QQ9 A;  5J8C A;  4PV6 A;  3R95 A;  4LX9 A;  3KL9 A;  1PYT B;  2PJ6 A;  3D7D A;  3S6H A;  1IB1 E;  4LQG A;  4CGM A;  1TF8 A;  2Q04 A;  1KUV A;  1S7K A;  3RAM A;  4NJQ A;  4P4F A;  2FT0 A;  3VWE A;  1ARL A;  2PJ3 A;  5EC4 A;  5LYI A;  3CPX A;  2F8H A;  5J1Q A;  2PJ0 A;  4PXC A;  3T90 A;  5HMN A;  5F48 A;  1YGH A;  4CGO A;  4C2X A;  1ZO0 A;  4MXU A;  3LD2 A;  4CAV A;  1VHE A;  4E2A A;  4R57 A;  2PR8 A;  3IU2 A;  3SXN A;  2B5G A;  5IB0 A;  4OLL A;  4OC1 A;  3D7G A;  3MN8 A;  2J8N A;  3D7H A;  4CS0 B;  2OB0 A;  4NJR A;  4CGL A;  1TIQ A;  4CAF A;  1CG2 A;  3B7I A;  1V0C A;  1RO5 A;  2GE3 A;  2J8M A;  2FIW A;  3I9S A;  2HQY A;  1Z5R A;  4IUS A;  2HB6 A;  2HUZ A;  1ARM A;  1XEB A;  4MCR A;  5F47 A;  2Q4Y A;  1IU8 A;  3B3V A;  4MJ8 A;  1LAN A;  2Z0Z A;  1CX8 A;  3FMC A;  4NGT A;  4XPL A;  5JH9 A;  2GLJ A;  1Q2C A;  4FBE A;  1S5K A;  3S9L A;  5AG5 A;  2B4D B;  2OU2 A;  4UEF A;  2ABZ A;  1AUG A;  4OME A;  1BLL E;  1BPN A;  3JUW A;  3PBB A;  2JEW A;  1U6M A;  3FIX A;  4AVB A;  3GB0 A;  1QSN A;  4ONU A;  4UFV A;  2G3A A;  2WSA A;  3D4U A;  2NSM A;  3QNV A;  2PJC A;  4PQA A;  4UCP A;  3NE7 A;  4F0Y A;  3NA6 A;  1RXT A;  4ZX8 A;  4A38 A;  1VIX A;  2B4B A;  1ON0 A;  3D66 A;  1YK3 A;  2CNS A;  4RN7 A;  2Q4V A;  2ZEG A;  3GKR A;  2FXF A;  3L2N A;  5H86 A;  2FVG A;  4KOU A;  4MHY A;  1XMB A;  2PJ2 A;  4MFZ A;  1YRE A;  3P2H A;  4AG9 A;  3H5Z A;  1YSJ A;  3PP9 A;  5IV0 A;  4RUH A;  2GLF A;  1MJA A;  5JM6 A;  1SQH A;  2HV2 A;  3EXN A;  3IC1 A;  1IID A;  3IO1 A;  4AXV A;  3F0A A;  4EWT A;  2PRQ A;  4JLY A;  2I3C A;  2X7B A;  4PXD A;  3V8I A;  2PJ9 A;  4MRI A;  4K3N A;  3KQX A;  3TOA A;  1KUX A;  3NH4 A;  3BLN A;  3OWC A;  5LRK A;  2I00 A;  4PXE A;  3R9G A;  4RS2 A;  2GAN A;  2OZG A;  3PB4 X;  3KHX A;  2ZOF A;  5E96 A;  3H8E A;  3CZX A;  4MCS A;  1CPX A;  4MCP A;  4EFD A;  1FY7 A;  1M4L A;  3RO0 A;  3TTH A;  3GYA A;  3S9N A;  4U9Z A;  1CBX A;  3KQZ A;  3KI9 A;  4A30 A;  4KOX A;  4F0X A;  2PVV A;  2Z3L A;  2DPT A;  3I3G A;  3KAS A;  1GYT A;  1ZG9 A;  3I1U A;  4MCQ A;  1Z4E A;  3V7Z A;  4EVY A;  2EWB A;  4OC0 A;  1S3Z A;  4H2K A;  4M6G A;  3SI0 A;  3TCV A;  3DDD A;  3F5B A;  4UFX A;  2ZEO A;  2FSR A;  1I1D A;  4CRZ B;  1CM0 A;  3VAT A;  2JDC A;  1ZLH A;  3DR8 A;  2Q44 A;  5KTC A;  2QYV A;  2EVN A;  2GIV A;  2VI7 A;  3FJU A;  2B3U A;  5C82 A;  1M4D A;  4TNU A;  2Q0Y A;  4KOV A;  3JVN A;  2ZW6 A;  3B3W A;  4NGR A;  2XEF A;  4HNX B;  2BSW A;  1Z9U A;  1I21 A;  2RB7 A;  4R3K A;  1IYK A;  5FVJ A;  5H84 A;  4UFW A;  1WK4 A;  2PJ1 A;  3QAY A;  1Y9K A;  2XEI A;  1XIX A;  3UY5 A;  2EK9 A;  3K2K A;  6CPA A;  4AG7 A;  2G0B A;  1NMT A;  4IHM A;  4KSF A;  2PJ5 A;  3GIU A;  1OZP A;  2F5I A;  2C6C A;  4C2Y A;  2YNC A;  3EO4 A;  2BUE A;  5CNP A;  4B6Z A;  4G1P A;  1X12 A;  5ELY A;  4NSQ A;  4F8Z A;  4QUS A;  1QSO A;  4M6H A;  2FS5 A;  4JYW A;  2PSW A;  1YVO A;  2WYR A;  3BJ7 A;  1EE3 P;  4ZX9 A;  4BD9 A;  5KTA A;  2REF A;  4NFR A;  4Y49 B;  1M4I A;  2O28 A;  3D68 A;  4FUU A;  3VAR A;  2BO9 A;  3FED A;  4OID A;  1B87 A;  3D8P A;  2O53 A;  2DEA A;  3FXT A;  2ZED A;  5D29 A;  2PDO A;  4C2Z A;  1RTQ A;  1GHE A;  2ZEE A;  4MFJ A;  2WPW A;  3MGD A;  4U9Y A;  2ZPA A;  3SJX A;  2OOT A;  4OAD A;  4Q7A A;  4BIN A;  2ZEM A;  4ZY2 A;  4DJL A;  3C26 A;  1LCP A;  3PGP A;  2V8G A;  4IF5 A;  5G21 A;  4GM5 A;  2POK A;  1YLE A;  2BOA A;  4JD6 A;  4F9V A;  4QBJ A;  1J4J A;  1TF9 A;  1LAP A;  4DUK A;  5LYF A;  3TT2 A;  3IU1 A;  4MFQ A;  3W6S A;  3TC8 A;  4KVO E;  4QB9 A;  4YFJ A;  3N7Z A;  1Z4R A;  4UIA A;  4MY3 A;  4CYQ A;  4L8A A;  1X10 A;  2WUU A;  5JGF A;  4KOW A;  2Q43 A;  2J8R A;  3KHZ A;  4UIB A;  4UF4 A;  1CP6 A;  3K9U A;  1PU9 A;  5A27 A;  1ZG7 A;  5HH1 A;  2A4N A;  2P0W A;  2RC4 A;  1NSA A;  3D2P A;  4MBU A;  1S60 A;  1M4G A;  2F7V A;  1JWQ A;  1FT7 A;  2FCK A;  4H6Z A;  2IMO A;  3F8K A;  4I49 A;  3S6G A;  3EC4 A;  4OIW A;  4P6Y A;  3BI0 A;  5KTD A;  1NSL A;  1M1D A;  4NGS A;  3BHX A;  4HPS A;  2XEG A;  3SXO A;  1Z8X A;  2BCO A;  5F46 A;  5I4M A;  1CJW A;  1Z2L A;  2R7H A;  4XNH C;  3ZJ0 A;  2GRE A;  2ZW5 A;  3PZJ A;  2BL1 A;  4OKO A;  5DWN A;  4Y49 C;  4CAE A;  3R1K A;  2ZOG A;  2VBQ A;  4R7M A; 
#chains in the Genus database with same CATH homology
 2FE7 A;  2QIR A;  4ZBG A;  2P6E A;  4CAW A;  4BBH A;  5AG7 A;  4L89 A;  4KVX A;  4HKF A;  2Y0M A;  1I12 A;  4MFK A;  4C7H A;  4R9M A;  2ZXV A;  2ZW7 A;  4Q38 A;  1VKC A;  5G22 A;  1S7N A;  5ISV A;  5G1Z A;  3IWE A;  2ATR A;  4II9 A;  4CRY B;  3FRM A;  3QAH A;  4RI1 A;  4B14 A;  4B10 A;  4A32 A;  2WPX A;  4FD7 A;  4KOY A;  3FNC A;  2DXQ A;  2VQY A;  1P4N A;  4CYO A;  1NE9 A;  4AVA A;  3R96 A;  2Z3K A;  5G20 A;  5A28 A;  4C68 A;  3WR7 A;  2NMT A;  1XE4 A;  2KCW A;  2R8V A;  3E0K A;  4A31 A;  4B5P A;  2B58 A;  4KS9 A;  2JEV A;  2Z11 A;  3FYN A;  1BO4 A;  2VZY A;  4MFP A;  3EY5 A;  5I0C A;  4UBR A;  4QC6 A;  4CYN A;  1YVK A;  4NF1 A;  2YGW A;  1KZF A;  3RYO A;  4B13 A;  1MJ9 A;  3TO9 A;  2D4O A;  4BMH A;  4R3L A;  4QVT A;  4XNH B;  4KOT A;  4ORF A;  5EBV A;  2Q7B A;  4KLV A;  2B3V A;  1Y7R A;  4H6U A;  2REE A;  4NEX A;  4JWP A;  2CNT A;  4KUB A;  4DNC A;  1IYL A;  4UWI A;  4E0A A;  5JPH A;  2PRB A;  4ZGY B;  4CYP A;  3TE4 A;  4UA3 A;  2OZU A;  2ZW4 A;  4M3S A;  4YRH A;  4C7I A;  4YGO A;  4CGN A;  4OAE A;  2B5G B;  4HNW B;  1S7L A;  2BEI A;  2FIA A;  1MJB A;  2C27 A;  4A2Z A;  4FD5 A;  3S6F A;  3TO6 A;  4B5O A;  3P2F A;  1YR0 A;  2VZZ A;  3QB8 A;  4JXR A;  4R87 A;  2AJ6 A;  3G8W A;  3EFA A;  4K30 A;  5JQ4 A;  5DWM A;  1XF8 A;  1QSR A;  2YNC C;  3BJ8 A;  4PK2 A;  5IX3 A;  2FL4 A;  4KLW A;  2H5M A;  1KUY A;  2ARH A;  4XPD B;  4KOS A;  2K5T A;  4FD4 A;  5J8F A;  2YND A;  4AB7 A;  1WWZ A;  3B8G A;  4NCZ A;  1K4J A;  4UWJ A;  4F6A A;  2PC1 A;  1LRZ A;  2DPS A;  4MHD A;  3W91 A;  3VWD A;  2VXK A;  2CY2 A;  1BOB A;  4HNY B;  1B6B A;  4CGP A;  3D2M A;  4MFL A;  2YNE A;  2QEC A;  5AGE A;  3KKW A;  3FBU A;  3R9E A;  2B4D A;  2P6G A;  4KOR A;  3DR6 A;  2Z10 A;  1N71 A;  3DSB A;  3R9F A;  4X5K A;  2CXA A;  5GCN A;  2OZH A;  2EUI A;  3T9Y A;  3IGR A;  4U5Y A;  1MK4 A;  4PK3 A;  1S7F A;  4KSA A;  5AG6 A;  4MY0 A;  3FB3 A;  5KTD A;  1Y9W A;  2Z3M A;  3A9L A;  2PQ8 A;  1R57 A;  2JLM A;  1Q2D A;  1Q2Y A;  3DNS A;  4XPD C;  4A33 A;  4B5P B;  4GS4 A;  2AE6 A;  5BWA B;  4M85 A;  4PSW A;  2QML A;  4J3G A;  1XMT A;  3TFY A;  4E8O A;  2G3T A;  2R98 A;  3CXS A;  2IL4 A;  1VHS A;  3JTK A;  1M44 A;  3CXP A;  1QST A;  4B11 A;  1PUA A;  2Z3P A;  1QSM A;  4B12 A;  4H89 A;  3G3S A;  4MI4 A;  2PR1 A;  4PSX A;  5F49 A;  1L0C A;  4KZT A;  3W6X A;  3TO7 A;  1IIC A;  4LUA A;  1YX0 A;  2JDD A;  4UCM A;  3LOD A;  4UCN A;  3S6K A;  4FD6 A;  3TOB A;  3CXQ A;  4NXY A;  2D4P A;  4KVM E;  4AVC A;  2VEZ A;  4CAX A;  2CNM A;  3IWG A;  1UFH A;  2OH1 A;  1P0H A;  3SHP A;  4KUA A;  4XPK A;  2I79 A;  2R1I A;  3GY9 A;  3D3S A;  2Z3O A;  3ZZI A;  5C88 A;  4Q36 A;  2Z3N A;  4A95 A;  4JXQ A;  2P6F A;  5AG4 A;  3H4Q A;  4JJX A;  5J8C A;  4PV6 A;  3R95 A;  4LX9 A;  3S6H A;  1IB1 E;  4CGM A;  2Q04 A;  1KUV A;  1S7K A;  2FT0 A;  3VWE A;  5EC4 A;  3T90 A;  5HMN A;  5F48 A;  1YGH A;  4CGO A;  4C2X A;  1ZO0 A;  3LD2 A;  4CAV A;  4E2A A;  4R57 A;  2PR8 A;  3IU2 A;  3SXN A;  2B5G A;  5IB0 A;  4OLL A;  2J8N A;  4CS0 B;  2OB0 A;  4CGL A;  1TIQ A;  4CAF A;  1V0C A;  1RO5 A;  2GE3 A;  2J8M A;  2FIW A;  3I9S A;  2HQY A;  4IUS A;  2HUZ A;  1XEB A;  5F47 A;  2Q4Y A;  4MJ8 A;  2Z0Z A;  4XPL A;  1Q2C A;  1S5K A;  5AG5 A;  2B4D B;  2OU2 A;  3JUW A;  1U6M A;  3FIX A;  4AVB A;  1QSN A;  4ONU A;  4UFV A;  2G3A A;  2WSA A;  4UCP A;  3NE7 A;  4F0Y A;  1RXT A;  2B4B A;  1ON0 A;  1YK3 A;  2CNS A;  2Q4V A;  3GKR A;  2FXF A;  5H86 A;  4KOU A;  4MFZ A;  1YRE A;  3P2H A;  4AG9 A;  3H5Z A;  3PP9 A;  5IV0 A;  1MJA A;  1SQH A;  2HV2 A;  3EXN A;  1IID A;  3F0A A;  4JLY A;  2X7B A;  3V8I A;  3TOA A;  1KUX A;  3OWC A;  3BLN A;  2I00 A;  3R9G A;  4RS2 A;  2GAN A;  2OZG A;  5E96 A;  1FY7 A;  3TTH A;  3GYA A;  4U9Z A;  4A30 A;  4KOX A;  4F0X A;  2Z3L A;  2DPT A;  3I3G A;  1Z4E A;  4EVY A;  1S3Z A;  3TCV A;  3DDD A;  3F5B A;  4UFX A;  4CRZ B;  2FSR A;  1I1D A;  1CM0 A;  2JDC A;  3DR8 A;  2Q44 A;  5KTC A;  2EVN A;  2GIV A;  2VI7 A;  2B3U A;  5C82 A;  1M4D A;  2Q0Y A;  4KOV A;  3JVN A;  2ZW6 A;  4HNX B;  2BSW A;  1Z9U A;  1I21 A;  4R3K A;  1IYK A;  5FVJ A;  5H84 A;  4UFW A;  1WK4 A;  1Y9K A;  3UY5 A;  1XIX A;  4AG7 A;  2G0B A;  1NMT A;  4KSF A;  1OZP A;  2F5I A;  4C2Y A;  2YNC A;  3EO4 A;  2BUE A;  5CNP A;  4NSQ A;  4QUS A;  1QSO A;  2FS5 A;  2PSW A;  1YVO A;  3BJ7 A;  5KTA A;  2REF A;  4Y49 B;  1M4I A;  2O28 A;  1B87 A;  3D8P A;  3FXT A;  4C2Z A;  2PDO A;  1GHE A;  4MFJ A;  2WPW A;  3MGD A;  4U9Y A;  2ZPA A;  4OAD A;  3C26 A;  3PGP A;  4IF5 A;  5G21 A;  1YLE A;  4JD6 A;  4QBJ A;  1J4J A;  3TT2 A;  3IU1 A;  4MFQ A;  3W6S A;  4KVO E;  4QB9 A;  4YFJ A;  3N7Z A;  1Z4R A;  4MY3 A;  4CYQ A;  4L8A A;  2WUU A;  4KOW A;  2J8R A;  3K9U A;  1PU9 A;  5A27 A;  5HH1 A;  2A4N A;  2P0W A;  2RC4 A;  4MBU A;  3D2P A;  1S60 A;  1M4G A;  2FCK A;  4H6Z A;  3F8K A;  4I49 A;  3S6G A;  3EC4 A;  1NSL A;  1M1D A;  3SXO A;  5F46 A;  1CJW A;  4XNH C;  2R7H A;  3ZJ0 A;  2ZW5 A;  5DWN A;  3PZJ A;  2BL1 A;  4Y49 C;  4CAE A;  3R1K A;  2VBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...