1IICA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound myristoylcoa
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE N-myristoyltransferase
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 128
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA02
1CM0A 2Y0MA 2GIVA 2B4DA 4XPDC 2OU2A 4E2AA 2JLMA 4FD4A 5F49A 2BEIA 2R98A 4NCZA 2I00A 2ZXVA 1YR0A 2HQYA 2FIWA 3FXTA 2VZYA 1MJ9A 1QSTA 2VBQA 4L89A 3V8IA 4CAWA 2PC1A 2CNSA 4CRZB 5JQ4A 1M44A 3LD2A 4PSWA 5GCNA 4QB9A 3S6KA 3G3SA 4CS0B 3SHPA 1PUAA 4KOWA 2A4NA 2J8NA 2R8VA 2R1IA 3BLNA 1K4JA 3R1KA 2VXKA 2JDDA 1V0CA 3MGDA 2PDOA 2JDCA 4UWJA 1FY7A 1M4GA 4NF1A 3WR7A 4MI4A 4M85A 1LRZA 2J8RA 2P6GA 4ONUA 4NSQA 3FBUA 3R9FA 4U9ZA 4GS4A 5KTCA 3TO9A 4PSXA 4UA3A 4Y49B 3VWEA 1YK3A 4PK2A 2BUEA 4KUAA 4U5YA 4YRHA 1RO5A 4YFJA 3CXSA 3IWGA 2D4PA 3P2HA 2FS5A 2REEA 4Y49C 3T9YA 3EO4A 1MK4A 2NMTA 3ZJ0A 2J8MA 5H84A 3S6HA 4NXYA 3S6GA 1Y9WA 1CJWA 4K30A 4E0AA 1S3ZA 3F0AA 1PU9A 2AE6A 5F46A 4JXRA 1KUVA 4MY3A 3W6SA 4KVME 1BO4A 1YREA 2FE7A 1I21A 3P2FA 1TIQA 5DWNA 1IIDA 3CXQA 1Z4RA 4UBRA 4CAXA 5F47A 3IGRA 1Q2YA 3RYOA 3LODA 2OZGA 4RS2A 1XEBA 1L0CA 2P6FA 2PSWA 2FCKA 3B8GA 2B5GA 4ORFA 2GE3A 1QSOA 4KORA 2Q44A 2VI7A 2Q7BA 3GKRA 2Z0ZA 1NMTA 3S6FA 3DDDA 2ZW7A 2BSWA 1QSNA 2KCWA 4KOUA 4KLVA 4XNHB 4HNXB 1VHSA 2B58A 3T90A 1B6BA 4R3LA 3R9GA 1QSRA 4H6ZA 1S60A 1KUYA 4NEXA 4ZBGA 4AVAA 3TE4A 3NE7A 4XNHC 1YVOA 1P0HA 3R95A 4JJXA 4MHDA 1S7FA 2QIRA 2P0WA 1BOBA 3PZJA 3TTHA 2Q0YA 1Q2CA 4I49A 4OADA 2G0BA 4YGOA 4L8AA 1J4JA 4MBUA 4LUAA 3E0KA 2WPWA 3D2PA 1YX0A 1M4IA 4BMHA 5C82A 3EXNA 4KOSA 1RXTA 4LX9A 5IV0A 2FSRA 2G3AA 4KVOE 4FD6A 1MJAA 5FVJA 2OB0A 2F5IA 4HNYB 1Z4EA 4XPLA 1VKCA 2Z11A 5IX3A 2K5TA 2OZHA 4X5KA 3UY5A 3F5BA 2D4OA 3PP9A 2H5MA 5C88A 3W6XA 4KOTA 5KTAA 1XIXA 4H89A 4JWPA 4EVYA 5I0CA 1IICA 5JPHA 5HH1A 2QECA 4OLLA 4B5PB 2PR8A 3R9EA 4JXQA 2HUZA 2ZW5A 4MY0A 4F0YA 2VZZA 3TCVA 4QBJA 2PR1A 5CNPA 3TOAA 2B3VA 3GY9A 4HKFA 4E8OA 1P4NA 2ATRA 1OZPA 3OWCA 4IUSA 1IYLA 1ON0A 3I9SA 2REFA 2BL1A 3TT2A 5J8FA 3CXPA 2FXFA 5J8CA 4H6UA 2B5GB 3JUWA 3FNCA 4PK3A 4R9MA 3DSBA 3N7ZA 2B4DB 1WWZA 4QUSA 4KOYA 4KOXA 2PRBA 2WPXA 4R87A 1GHEA 4KZTA 1Y9KA 4XPKA 1B87A 2Q4VA 2EUIA 4OAEA 4KLWA 3DNSA 3PGPA 4J3GA 4R3KA 1NSLA 2QMLA 3F8KA 2CNMA 1R57A 2Q04A 3EC4A 1SQHA 1UFHA 2PQ8A 4QC6A 2I79A 3FIXA 3I3GA 4FD7A 3FRMA 2VQYA 4RI1A 5HMNA 2G3TA 4KUBA 2DXQA 1MJBA 1XMTA 2Q4YA 3K9UA 1Z9UA 4AVCA 4HNWB 3W91A 3KKWA 3D3SA 2HV2A 2IL4A 1Y7RA 2O28A 4U9YA 4DNCA 4UWIA 2ARHA 3VWDA 2Z10A 2C27A 1YVKA 3JVNA 4PV6A 4AVBA 3SXNA 2VEZA 3EY5A 3TOBA 1I12A 2JEVA 4KOVA 4AB7A 4JLYA 3D2MA 1S5KA 5EBVA 1Q2DA 1WK4A 2P6EA 3D8PA 5DWMA 1KZFA 4M3SA 1S7KA 1M1DA 5ISVA 4JD6A 2GANA 2OZUA 3TO7A 1S7NA 3QAHA 4QVTA 2ZW4A 3G8WA 2CNTA 1XF8A 4AG7A 4CRYB 3H4QA 5KTDA 2ZW6A 1M4DA 1N71A 2FT0A 4MJ8A 2R7HA 4AG9A 2AJ6A 1S7LA 1KUXA 5IB0A 4IF5A 4KVXA 4B5PA 2EVNA 1IB1E 3BJ7A 4R57A 2ZPAA 5E96A 1YLEA 3BJ8A 2X7BA 5H86A 4II9A 4CAVA 1QSMA 2CY2A 2B3UA 1NE9A 3ZZIA 4FD5A 3EFAA 5F48A 3QB8A 5EC4A 3SXOA 3R96A 2FL4A 1YGHA 2OH1A 3FB3A 1XE4A 2FIAA 4B5OA 3TFYA 4XPDB 3DR8A 1I1DA 2RC4A 3DR6A 3C26A 3GYAA 4F6AA 3FYNA 2B4BA 1IYKA 3TO6A 1U6MA
chains in the Genus database with same CATH superfamily
1CM0A 2Y0MA 3LWUA 4B6ZA 4MFQA 1LCPA 4AG9A 2GIVA 2B4DA 2OR4A 4XPDC 2OU2A 4E2AA 4KS9A 2JLMA 4FD4A 5F49A 4B10A 4FWUA 4HPSA 4OC5A 4UF4A 2XEFA 4MCRA 3MRUA 3B3WA 3KR5A 2BEIA 2R98A 4NCZA 1JQGA 2I00A 3H5ZA 4PPZA 2ZXVA 2PJ3A 1YR0A 2HQYA 1YW4A 2FIWA 3FXTA 2ZENA 2VZYA 1MJ9A 1QSTA 2VBQA 4L89A 3V8IA 3KGQA 4ZX8A 4CAWA 2PC1A 2PE3A 4X2TA 3B3VA 1R43A 2CNSA 3CPXA 4CRZB 5CBMA 4DYOA 5JQ4A 1M44A 3D67A 5A28A 3LD2A 4PSWA 4FUUA 5GCNA 1DE4C 4Q7AA 2YNCC 4QB9A 3KL9A 4CPAA 3S6KA 4CGMA 3G3SA 4P4FA 2ZEPA 1ARMA 1CPXA 1PUAA 2A4NA 2J8NA 2R8VA 4KOWA 3SHPA 2R1IA 3DGVA 3BLNA 1K4JA 5AG7A 4CGLA 3R1KA 4Q36A 3WABA 1KWMA 1X10A 2VXKA 3KZWA 2JDDA 4FAIA 4FBEA 1V0CA 2XEIA 1ZLHA 8CPAA 2BOAA 2F7VA 2JBJA 4KSFA 1Q7LA 1VIXA 3IU2A 3MGDA 3T8WA 2PDOA 2JDCA 4UWJA 4W9YA 1FY7A 1M4GA 4NF1A 3WR7A 3FECA 3B3TA 1ELLP 5F09A 4MI4A 1LFWA 3A9LA 2C6GA 1LRZA 2J8RA 2P6GA 4M85A 4ONUA 4NSQA 3FBUA 2AFZA 1NSAA 1IOFA 3PB4X 4UFWA 1DTDA 3R9FA 4U9ZA 4GS4A 1OBRA 4UIAA 3RAMA 3TO9A 4A38A 3HUVA 4BBHA 5KTCA 4MCPA 1YSJA 4G1PA 2BCOA 4RUHA 4PSXA 4UFVA 4UA3A 4Y49B 2ZEGA 3VWEA 1ZG9A 1Z8XA 2Q4ZA 1YK3A 2HC9A 2BUEA 4KUAA 1FNOA 4PK2A 2NYQA 4U5YA 5CPAA 4YRHA 5AGEA 1JWQA 4IHMA 5IB9A 1RO5A 2V8VA 4EWTA 4YFJA 5G1ZA 1F2PA 3CXSA 4BD9A 2PJ8A 3IWGA 1BLLE 2D4PA 4MFKA 3SJXA 6CPAA 5JM6A 3NH8A 2FS5A 3P2HA 2C1CA 2PJ9A 2PJ6A 2REEA 4Y49C 3BHXA 3BXMA 3EO4A 3T9YA 1QQ9A 1MK4A 2EO8A 2NMTA 4MHPA 1H8LA 3RZAA 3V38A 4UCPA 3ZJ0A 4RN7A 2J8MA 3H8FA 3SJGA 1BPMA 3N5FA 5H84A 3S6HA 1A2ZA 2PJ4A 4OC4A 4NXYA 1PCAA 3S6GA 4WJBA 3BI0A 1Y9WA 1CJWA 4K30A 1TF9A 4E0AA 1S3ZA 3F0AA 1BAVA 1PU9A 5EMIA 2Z3KA 2AE6A 2EK9A 3FH4A 4MCSA 5F46A 1LAPA 3VH9A 4JXRA 1KUVA 4MY3A 3W6SA 2PJBA 1Z8LA 1BO4A 4KVME 4B13A 1YREA 2FE7A 3FEEA 3H8GA 5JH9A 1I21A 3FEDA 4PXDA 3PEIA 3P2FA 2RB7A 1TIQA 4GXHA 3V7ZA 2GLJA 4YU9A 1IIDA 3CXQA 1Z4RA 3FX6A 4UBRA 5DWNA 4CAXA 5F47A 3IGRA 1Q2YA 5AG5A 2ZEHA 3RYOA 3K2KA 3LODA 4LQGA 1Z8WA 4CYQA 2PJAA 2OZGA 4PXEA 2DEAA 4RS2A 4CAFA 2DF5A 2YGWA 2ZOFA 1XEBA 1L0CA 1AUGA 4R6TA 2P6FA 2PSWA 2FVGA 2FCKA 3IEHA 5K8OA 3B8GA 2B5GA 4A39A 3PFEA 3B3SA 4ORFA 2GE3A 1QSOA 4KORA 2QJ8A 2Q44A 1LAMA 2VI7A 2PJ1A 4PXBA 2Q7BA 2OOTA 2CIJA 2Z0ZA 3GKRA 4MMOA 1NMTA 4PXCA 3S6FA 1Z8TA 3DDDA 2ZW7A 2Z3PA 2BSWA 1QSNA 4GM5A 2V8HA 1VHOA 2KCWA 7CPAA 2V8GA 5LYFA 4WWVA 4KOUA 5J1QA 4KLVA 4JZ0A 2Q7SA 4XNHB 4HNXB 2XEJA 1VHSA 2B58A 3PB7X 3T90A 1B6BA 4R3LA 3R9GA 1QSRA 4H6ZA 1S60A 5LYDA 1YQEA 4UFXA 1KUYA 4NEXA 2PJCA 5ELYA 4M6HA 2Z3MA 3CT9A 4ZBGA 3B2YA 4OIDA 1CBXA 2Z3LA 4AVAA 3TE4A 4UEZA 3NE7A 4XNHC 4ZX9A 5LRJA 1YVOA 4UCMA 1P0HA 3R95A 1YLOA 1ZO0A 2PIYA 4CYPA 4JJXA 4NJQA 4MHDA 2EBJA 1S7FA 4CS0B 2QIRA 4A2ZA 2P0WA 3TC8A 4P45A 5HVHA 1BOBA 2CF4A 3DLJA 3PZJA 2POKA 3TTHA 3FVLA 1XRYA 1Q2CA 2Q0YA 3GUXA 4DJLA 3HLPA 4I49A 4OADA 4A37A 1XJOA 2G0BA 1ZG7A 3QAYA 3NH5A 5G21A 3K9TA 4YGOA 4L8AA 1J4JA 3RBUA 2NSMA 3PBBA 4MBUA 4OC3A 1IY7A 4LUAA 3E0KA 2WPWA 5D29A 4ZGYB 3D2PA 1YX0A 2WUUA 1Y7EA 2EWBA 1M4IA 2YNCA 4BMHA 5C82A 1FT7A 3WC5A 3EXNA 3S9MA 4KOSA 1RXTA 4LX9A 2GFQA 4B14A 5IV0A 2FSRA 2G3AA 2C6PA 3D7GA 4KVOE 4FD6A 1MJAA 3IU1A 1XMBA 2PIZA 5FVJA 2OB0A 4C7HA 2F5IA 4HNYB 1Z4EA 4XPLA 4MFLA 3ISZA 4F9VA 2O4HA 1VKCA 3PB6X 3LMSA 2Z11A 5IX3A 4ZY1A 1X12A 2AFOA 4P4EA 4C2ZA 3JTKA 1VGYA 5BWAB 2K5TA 2OZHA 4X5KA 3UY5A 3F5BA 2D4OA 3PP9A 4Q38A 2H5MA 1CPSA 2ODFA 5C88A 4MFPA 3W6XA 4OKOA 2YNDA 4KOTA 5KTAA 3KQZA 4A32A 1XIXA 4O23A 4IAVA 4H89A 4JWPA 4EVYA 5I0CA 1IICA 5JPHA 4P44A 2GREA 4NGSA 5HH1A 1YW6A 2QECA 1EE3P 4OLLA 1Y0RA 5HVFA 3BI1A 4B5PB 4DUKA 4YWYA 4P10A 4R7MA 2PR8A 4MFZA 4JXQA 4OC1A 3R9EA 4C2YA 2HUZA 4R8FA 2ZW5A 4MY0A 4F0YA 2VZZA 3TCVA 1CG2A 4QBJA 1Y0YA 4NFRA 2PR1A 1XBUA 5CNPA 2B3VA 3GY9A 3TOAA 4HKFA 2AFXA 4E8OA 1P4NA 1PYTB 2ATRA 5HXDA 2QVPA 5LYLA 1CP6A 1OZPA 2AFUA 2CTCA 1TKHA 4LQ6A 4OP4A 3OWCA 4NGRA 1HEEA 4IUSA 4C68A 5K8MA 2ANPA 1IYLA 1ON0A 3I9SA 4NGQA 2REFA 2BL1A 3TT2A 1LOKA 3PRTA 5J8FA 4EFDA 3NFZA 3CXPA 3IWEA 4R76A 2FXFA 4F0XA 5AG6A 5J8CA 4H6UA 2B5GB 2BO9A 4CYOA 3JRUA 4ONWA 3JUWA 4A94A 3QNVA 3FNCA 4PK3A 4R9MA 3DSBA 2V77A 2C6CA 2EK8A 4P6YA 4OIWA 2DPSA 4UIBA 3IJ3A 3N7ZA 2B4DB 3PB8X 1WWZA 4ZI6A 3L2NA 1ZLIA 4MHZA 5HVGA 2JBKA 2ZOGA 4QUSA 4C2XA 4KOYA 1TXRA 4KOXA 3TX8A 4K3NA 2PRBA 2WPXA 3KHXA 4H2KA 3SJFA 4R87A 3SI0A 5DS0A 2PRQA 1GHEA 4KZTA 1Z2LA 1Y9KA 4Z65A 4XPKA 1B87A 1IYKA 3KR4A 2Q4VA 2EUIA 3CPAA 4OAEA 1HDQA 3DNSA 4KLWA 4X8IA 4P4IA 1AMPA 1XFOA 3PGPA 3CZXA 1F57A 4J3GA 1CX8A 4R3KA 3RO0A 1NSLA 3VATA 3WC7A 2QMLA 3D4UA 3F8KA 2CNMA 2XEGA 3NH4A 3VARA 4P4JA 1R57A 2Q04A 3EC4A 3PFOA 1SQHA 4MHYA 1UFHA 1IOIA 2PQ8A 4QC6A 2I79A 3FIXA 3I3GA 4OC2A 4FD7A 4MXUA 2JEWA 3FRMA 2VQYA 4RI1A 1BPNA 3KQXA 5HMNA 1UWYA 2PCUA 2G3TA 4KUBA 3FJUA 4MCQA 2DXQA 2GLFA 1Z5RA 2O53A 2G9DA 1R3NA 1MJBA 1XMTA 5G22A 3S9NA 1IGBA 2Q4YA 3K9UA 1Z9UA 2WZNA 4KSAA 2IJZA 4AVCA 4BINA 4NGNA 4HNWB 4CGOA 3W91A 3WT4A 2Q51A 2PVWA 3KKWA 3B35A 2F8HA 3D3SA 2HV2A 2IL4A 3FMCA 1ARLA 1Y7RA 2V8DA 4A33A 2O28A 2J9AA 4U9YA 4MRIA 4OC0A 4P4BA 4DNCA 5AG4A 4UWIA 4M6IA 1IU8A 3S9LA 4X3RA 2ARHA 2Z3NA 3D66A 3WC6A 2ABZA 2ZELA 3VWDA 2YNEA 2Z10A 1M4LA 2C27A 1YVKA 3FF3A 3JVNA 4PV6A 4AVBA 2GU2A 4C7IA 3SXNA 5LRGA 2VEZA 5A27A 3EY5A 2AFSA 4CGPA 2VL1A 3TOBA 1I12A 1VHEA 2JEVA 4EMEA 3H8EA 4KOVA 4AB7A 5K8PA 1YMEA 3D2MA 1CP7A 4JLYA 1S5KA 5EBVA 1Q2DA 1WK4A 2P6EA 2Q43A 3D8PA 4ZY2A 2PJ2A 5DWMA 4PQAA 1KZFA 1ZG8A 3PB9X 4M3SA 1S7KA 1M1DA 4A95A 3GIUA 5ISVA 2CTBA 3SI1A 3PBEA 4CAEA 4JD6A 4MHNA 2GANA 5LYIA 4AXVA 2OZUA 4TNUA 3TO7A 3KI9A 5K8NA 1TKFA 3IC1A 1S7NA 3SJEA 4NGTA 3QAHA 2DPTA 3D68A 4QVTA 3SI2A 2ZW4A 3G8WA 1LANA 3NE8A 2CNTA 1XF8A 4AG7A 2ZEFA 3MN8A 3RNZA 4F8ZA 4NJRA 2QYVA 4CRYB 3H4QA 5KTDA 2ZW6A 1M4DA 1N71A 2FT0A 3D7FA 2R7HA 4MJ8A 2AJ6A 2ZEMA 1XOVA 4A31A 3KHZA 3IIBA 2AFMA 3NA6A 2PJ0A 4B11A 1S7LA 1KUXA 5IB0A 2HB6A 4IF5A 3GLJA 2WYRA 4IK2A 4ZYQA 4KVXA 4B5PA 2EVNA 1IB1E 3BJ7A 4R57A 4ZY0A 4UEEA 2PVVA 2ZPAA 5E96A 1YLEA 1RTQA 2AFWA 3IFEA 2ZEEA 3BJ8A 4NGMA 2X7BA 5H86A 5G20A 5JGFA 3LACA 4II9A 4CAVA 3ISXA 1QSMA 2CY2A 2ZEOA 1QMUA 2B3UA 1NE9A 3ZZIA 3I1UA 4FD5A 3EFAA 5I4MA 1HDUA 2Z3OA 4F9UA 5F48A 1ELMP 3D7DA 3QB8A 5D8NA 4KSIA 2RFHA 5EC4A 3SXOA 4NGPA 4CYNA 3R96A 3B3CA 4TWEA 3GB0A 2CXAA 2FL4A 2IQ6A 1YGHA 4CGNA 2OH1A 3D7HA 3FB3A 1TF8A 3KASA 4UEFA 1XE4A 2PJ7A 5THWA 4UCNA 4A30A 2FIAA 2I3CA 4JYWA 4B5OA 3IWWA 4B12A 3TFYA 2PJ5A 4M6GA 4P4DA 4XPDB 5LRKA 1TKJA 3CDXA 3DR8A 1I1DA 1GYTA 4MFJA 2RC4A 3DR6A 1F2OA 3C26A 3B7IA 3GYAA 3IO1A 4F6AA 3FYNA 4OMEA 2B4BA 2IMOA 1AYEA 3TO6A 2WSAA 1U6MA 2ZEDA
chains in the Genus database with same CATH topology
1CM0A 2Y0MA 4MFQA 2GIVA 2B4DA 4XPDC 2OU2A 4E2AA 4KS9A 2JLMA 4FD4A 5F49A 4B10A 2BEIA 2R98A 4NCZA 2I00A 3H5ZA 2ZXVA 1YR0A 2HQYA 2FIWA 3FXTA 2VZYA 1MJ9A 1QSTA 2VBQA 4L89A 3V8IA 4CAWA 2PC1A 2CNSA 4CRZB 5JQ4A 1M44A 5A28A 3LD2A 4PSWA 5GCNA 2YNCC 4QB9A 3S6KA 4CGMA 3G3SA 4CS0B 3SHPA 1PUAA 4KOWA 2A4NA 2J8NA 2R8VA 4CGLA 2R1IA 3BLNA 1K4JA 5AG7A 3R1KA 4Q36A 2VXKA 2JDDA 1V0CA 4KSFA 3IU2A 3MGDA 2PDOA 2JDCA 4UWJA 1FY7A 1M4GA 4NF1A 3WR7A 4MI4A 3A9LA 1LRZA 2J8RA 2P6GA 4M85A 4ONUA 4NSQA 3FBUA 4UFWA 3R9FA 4U9ZA 4GS4A 5KTCA 3TO9A 4BBHA 4PSXA 4UFVA 4UA3A 4Y49B 3VWEA 1YK3A 4PK2A 2BUEA 4KUAA 4U5YA 4YRHA 5AGEA 1RO5A 4YFJA 5G1ZA 3CXSA 3IWGA 4MFKA 2D4PA 3P2HA 2FS5A 2REEA 4Y49C 3T9YA 3EO4A 1MK4A 2NMTA 4UCPA 3ZJ0A 2J8MA 5H84A 3S6HA 4NXYA 3S6GA 1Y9WA 1CJWA 4K30A 4E0AA 1S3ZA 3F0AA 1PU9A 2Z3KA 2AE6A 5F46A 4JXRA 1KUVA 4MY3A 3W6SA 4KVME 1BO4A 4B13A 1YREA 2FE7A 1I21A 3P2FA 1TIQA 5DWNA 1IIDA 3CXQA 1Z4RA 4UBRA 4CAXA 5F47A 3IGRA 1Q2YA 5AG5A 3RYOA 3LODA 4CYQA 2OZGA 4RS2A 4CAFA 2YGWA 1XEBA 1L0CA 2P6FA 2PSWA 2FCKA 3B8GA 2B5GA 4ORFA 2GE3A 1QSOA 4KORA 2Q44A 2VI7A 2Q7BA 3GKRA 2Z0ZA 1NMTA 3S6FA 3DDDA 2ZW7A 2Z3PA 2BSWA 1QSNA 2KCWA 4KOUA 4KLVA 4XNHB 4HNXB 1VHSA 2B58A 3T90A 1B6BA 4R3LA 3R9GA 1QSRA 4H6ZA 1S60A 4UFXA 1KUYA 4NEXA 2Z3MA 4ZBGA 2Z3LA 4AVAA 3TE4A 3NE7A 4XNHC 1YVOA 4UCMA 1P0HA 3R95A 1ZO0A 4CYPA 4JJXA 4MHDA 1S7FA 2QIRA 4A2ZA 2P0WA 1BOBA 3PZJA 3TTHA 2Q0YA 1Q2CA 4I49A 4OADA 2G0BA 5G21A 4YGOA 4L8AA 1J4JA 4MBUA 4LUAA 3E0KA 2WPWA 4ZGYB 3D2PA 1YX0A 2WUUA 2YNCA 1M4IA 4BMHA 5C82A 3EXNA 4KOSA 1RXTA 4LX9A 4B14A 5IV0A 2FSRA 2G3AA 4KVOE 4FD6A 1MJAA 3IU1A 5FVJA 2OB0A 4C7HA 2F5IA 4HNYB 1Z4EA 4XPLA 4MFLA 1VKCA 2Z11A 5IX3A 4C2ZA 3JTKA 5BWAB 2K5TA 2OZHA 4X5KA 3UY5A 3F5BA 2D4OA 3PP9A 4Q38A 2H5MA 5C88A 4MFPA 3W6XA 2YNDA 4KOTA 5KTAA 4A32A 1XIXA 4H89A 4JWPA 4EVYA 5I0CA 1IICA 5JPHA 5HH1A 2QECA 4OLLA 4B5PB 2PR8A 4MFZA 4JXQA 3R9EA 4C2YA 2HUZA 2ZW5A 4MY0A 4F0YA 2VZZA 3TCVA 4QBJA 2PR1A 5CNPA 3TOAA 2B3VA 3GY9A 4HKFA 4E8OA 1P4NA 2ATRA 1OZPA 3OWCA 4IUSA 4C68A 1IYLA 1ON0A 3I9SA 2REFA 2BL1A 3TT2A 5J8FA 3CXPA 3IWEA 2FXFA 4F0XA 5AG6A 5J8CA 4H6UA 2B5GB 4CYOA 3JUWA 3FNCA 4PK3A 4R9MA 3DSBA 2DPSA 3N7ZA 2B4DB 1WWZA 4QUSA 4C2XA 4KOYA 4KOXA 2PRBA 2WPXA 4R87A 1GHEA 4KZTA 1Y9KA 4XPKA 1B87A 2Q4VA 2EUIA 4OAEA 4KLWA 3DNSA 3PGPA 4J3GA 4R3KA 1NSLA 2QMLA 3F8KA 2CNMA 1R57A 2Q04A 3EC4A 1SQHA 1UFHA 2PQ8A 4QC6A 2I79A 3FIXA 3I3GA 4FD7A 3FRMA 2VQYA 4RI1A 5HMNA 2G3TA 4KUBA 2DXQA 1MJBA 1XMTA 5G22A 2Q4YA 3K9UA 1Z9UA 4KSAA 4AVCA 4HNWB 4CGOA 3W91A 3KKWA 3D3SA 2HV2A 2IL4A 1Y7RA 4A33A 2O28A 4U9YA 4DNCA 5AG4A 4UWIA 2ARHA 2Z3NA 3VWDA 2YNEA 2Z10A 2C27A 1YVKA 3JVNA 4PV6A 4AVBA 4C7IA 3SXNA 2VEZA 5A27A 3EY5A 4CGPA 3TOBA 1I12A 2JEVA 4KOVA 4AB7A 4JLYA 3D2MA 1S5KA 5EBVA 1Q2DA 1WK4A 2P6EA 3D8PA 5DWMA 1KZFA 4M3SA 1S7KA 1M1DA 4A95A 5ISVA 4CAEA 4JD6A 2GANA 2OZUA 3TO7A 1S7NA 3QAHA 2DPTA 4QVTA 2ZW4A 3G8WA 2CNTA 1XF8A 4AG7A 4CRYB 3H4QA 5KTDA 2ZW6A 1M4DA 1N71A 2FT0A 4MJ8A 2R7HA 4A31A 2AJ6A 4AG9A 4B11A 1S7LA 1KUXA 5IB0A 4IF5A 4KVXA 4B5PA 2EVNA 1IB1E 3BJ7A 4R57A 2ZPAA 5E96A 1YLEA 3BJ8A 2X7BA 5H86A 5G20A 4II9A 4CAVA 1QSMA 2CY2A 2B3UA 1NE9A 3ZZIA 4FD5A 3EFAA 2Z3OA 5F48A 3QB8A 5EC4A 3SXOA 4CYNA 3R96A 2CXAA 2FL4A 1YGHA 4CGNA 2OH1A 3FB3A 1XE4A 4UCNA 4A30A 2FIAA 4B5OA 4B12A 3TFYA 4XPDB 3DR8A 1I1DA 4MFJA 2RC4A 3DR6A 3C26A 3GYAA 4F6AA 3FYNA 2B4BA 1IYKA 3TO6A 2WSAA 1U6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM0 A;  2Y0M A;  2GIV A;  2B4D A;  4XPD C;  2OU2 A;  4E2A A;  2JLM A;  4FD4 A;  5F49 A;  2BEI A;  2R98 A;  4NCZ A;  2I00 A;  2ZXV A;  1YR0 A;  2HQY A;  2FIW A;  3FXT A;  2VZY A;  1MJ9 A;  1QST A;  2VBQ A;  4L89 A;  3V8I A;  4CAW A;  2PC1 A;  2CNS A;  4CRZ B;  5JQ4 A;  1M44 A;  3LD2 A;  4PSW A;  5GCN A;  4QB9 A;  3S6K A;  3G3S A;  4CS0 B;  3SHP A;  1PUA A;  4KOW A;  2A4N A;  2J8N A;  2R8V A;  2R1I A;  3BLN A;  1K4J A;  3R1K A;  2VXK A;  2JDD A;  1V0C A;  3MGD A;  2PDO A;  2JDC A;  4UWJ A;  1FY7 A;  1M4G A;  4NF1 A;  3WR7 A;  4MI4 A;  4M85 A;  1LRZ A;  2J8R A;  2P6G A;  4ONU A;  4NSQ A;  3FBU A;  3R9F A;  4U9Z A;  4GS4 A;  5KTC A;  3TO9 A;  4PSX A;  4UA3 A;  4Y49 B;  3VWE A;  1YK3 A;  4PK2 A;  2BUE A;  4KUA A;  4U5Y A;  4YRH A;  1RO5 A;  4YFJ A;  3CXS A;  3IWG A;  2D4P A;  3P2H A;  2FS5 A;  2REE A;  4Y49 C;  3T9Y A;  3EO4 A;  1MK4 A;  2NMT A;  3ZJ0 A;  2J8M A;  5H84 A;  3S6H A;  4NXY A;  3S6G A;  1Y9W A;  1CJW A;  4K30 A;  4E0A A;  1S3Z A;  3F0A A;  1PU9 A;  2AE6 A;  5F46 A;  4JXR A;  1KUV A;  4MY3 A;  3W6S A;  4KVM E;  1BO4 A;  1YRE A;  2FE7 A;  1I21 A;  3P2F A;  1TIQ A;  5DWN A;  1IID A;  3CXQ A;  1Z4R A;  4UBR A;  4CAX A;  5F47 A;  3IGR A;  1Q2Y A;  3RYO A;  3LOD A;  2OZG A;  4RS2 A;  1XEB A;  1L0C A;  2P6F A;  2PSW A;  2FCK A;  3B8G A;  2B5G A;  4ORF A;  2GE3 A;  1QSO A;  4KOR A;  2Q44 A;  2VI7 A;  2Q7B A;  3GKR A;  2Z0Z A;  1NMT A;  3S6F A;  3DDD A;  2ZW7 A;  2BSW A;  1QSN A;  2KCW A;  4KOU A;  4KLV A;  4XNH B;  4HNX B;  1VHS A;  2B58 A;  3T90 A;  1B6B A;  4R3L A;  3R9G A;  1QSR A;  4H6Z A;  1S60 A;  1KUY A;  4NEX A;  4ZBG A;  4AVA A;  3TE4 A;  3NE7 A;  4XNH C;  1YVO A;  1P0H A;  3R95 A;  4JJX A;  4MHD A;  1S7F A;  2QIR A;  2P0W A;  1BOB A;  3PZJ A;  3TTH A;  2Q0Y A;  1Q2C A;  4I49 A;  4OAD A;  2G0B A;  4YGO A;  4L8A A;  1J4J A;  4MBU A;  4LUA A;  3E0K A;  2WPW A;  3D2P A;  1YX0 A;  1M4I A;  4BMH A;  5C82 A;  3EXN A;  4KOS A;  1RXT A;  4LX9 A;  5IV0 A;  2FSR A;  2G3A A;  4KVO E;  4FD6 A;  1MJA A;  5FVJ A;  2OB0 A;  2F5I A;  4HNY B;  1Z4E A;  4XPL A;  1VKC A;  2Z11 A;  5IX3 A;  2K5T A;  2OZH A;  4X5K A;  3UY5 A;  3F5B A;  2D4O A;  3PP9 A;  2H5M A;  5C88 A;  3W6X A;  4KOT A;  5KTA A;  1XIX A;  4H89 A;  4JWP A;  4EVY A;  5I0C A;  1IIC A;  5JPH A;  5HH1 A;  2QEC A;  4OLL A;  4B5P B;  2PR8 A;  3R9E A;  4JXQ A;  2HUZ A;  2ZW5 A;  4MY0 A;  4F0Y A;  2VZZ A;  3TCV A;  4QBJ A;  2PR1 A;  5CNP A;  3TOA A;  2B3V A;  3GY9 A;  4HKF A;  4E8O A;  1P4N A;  2ATR A;  1OZP A;  3OWC A;  4IUS A;  1IYL A;  1ON0 A;  3I9S A;  2REF A;  2BL1 A;  3TT2 A;  5J8F A;  3CXP A;  2FXF A;  5J8C A;  4H6U A;  2B5G B;  3JUW A;  3FNC A;  4PK3 A;  4R9M A;  3DSB A;  3N7Z A;  2B4D B;  1WWZ A;  4QUS A;  4KOY A;  4KOX A;  2PRB A;  2WPX A;  4R87 A;  1GHE A;  4KZT A;  1Y9K A;  4XPK A;  1B87 A;  2Q4V A;  2EUI A;  4OAE A;  4KLW A;  3DNS A;  3PGP A;  4J3G A;  4R3K A;  1NSL A;  2QML A;  3F8K A;  2CNM A;  1R57 A;  2Q04 A;  3EC4 A;  1SQH A;  1UFH A;  2PQ8 A;  4QC6 A;  2I79 A;  3FIX A;  3I3G A;  4FD7 A;  3FRM A;  2VQY A;  4RI1 A;  5HMN A;  2G3T A;  4KUB A;  2DXQ A;  1MJB A;  1XMT A;  2Q4Y A;  3K9U A;  1Z9U A;  4AVC A;  4HNW B;  3W91 A;  3KKW A;  3D3S A;  2HV2 A;  2IL4 A;  1Y7R A;  2O28 A;  4U9Y A;  4DNC A;  4UWI A;  2ARH A;  3VWD A;  2Z10 A;  2C27 A;  1YVK A;  3JVN A;  4PV6 A;  4AVB A;  3SXN A;  2VEZ A;  3EY5 A;  3TOB A;  1I12 A;  2JEV A;  4KOV A;  4AB7 A;  4JLY A;  3D2M A;  1S5K A;  5EBV A;  1Q2D A;  1WK4 A;  2P6E A;  3D8P A;  5DWM A;  1KZF A;  4M3S A;  1S7K A;  1M1D A;  5ISV A;  4JD6 A;  2GAN A;  2OZU A;  3TO7 A;  1S7N A;  3QAH A;  4QVT A;  2ZW4 A;  3G8W A;  2CNT A;  1XF8 A;  4AG7 A;  4CRY B;  3H4Q A;  5KTD A;  2ZW6 A;  1M4D A;  1N71 A;  2FT0 A;  4MJ8 A;  2R7H A;  4AG9 A;  2AJ6 A;  1S7L A;  1KUX A;  5IB0 A;  4IF5 A;  4KVX A;  4B5P A;  2EVN A;  1IB1 E;  3BJ7 A;  4R57 A;  2ZPA A;  5E96 A;  1YLE A;  3BJ8 A;  2X7B A;  5H86 A;  4II9 A;  4CAV A;  1QSM A;  2CY2 A;  2B3U A;  1NE9 A;  3ZZI A;  4FD5 A;  3EFA A;  5F48 A;  3QB8 A;  5EC4 A;  3SXO A;  3R96 A;  2FL4 A;  1YGH A;  2OH1 A;  3FB3 A;  1XE4 A;  2FIA A;  4B5O A;  3TFY A;  4XPD B;  3DR8 A;  1I1D A;  2RC4 A;  3DR6 A;  3C26 A;  3GYA A;  4F6A A;  3FYN A;  2B4B A;  1IYK A;  3TO6 A;  1U6M A; 
#chains in the Genus database with same CATH topology
 1CM0 A;  2Y0M A;  3LWU A;  4B6Z A;  4MFQ A;  1LCP A;  4AG9 A;  2GIV A;  2B4D A;  2OR4 A;  4XPD C;  2OU2 A;  4E2A A;  4KS9 A;  2JLM A;  4FD4 A;  5F49 A;  4B10 A;  4FWU A;  4HPS A;  4OC5 A;  4UF4 A;  2XEF A;  4MCR A;  3MRU A;  3B3W A;  3KR5 A;  2BEI A;  2R98 A;  4NCZ A;  1JQG A;  2I00 A;  3H5Z A;  4PPZ A;  2ZXV A;  2PJ3 A;  1YR0 A;  2HQY A;  1YW4 A;  2FIW A;  3FXT A;  2ZEN A;  2VZY A;  1MJ9 A;  1QST A;  2VBQ A;  4L89 A;  3V8I A;  3KGQ A;  4ZX8 A;  4CAW A;  2PC1 A;  2PE3 A;  4X2T A;  3B3V A;  1R43 A;  2CNS A;  3CPX A;  4CRZ B;  5CBM A;  4DYO A;  5JQ4 A;  1M44 A;  3D67 A;  5A28 A;  3LD2 A;  4PSW A;  4FUU A;  5GCN A;  1DE4 C;  4Q7A A;  2YNC C;  4QB9 A;  3KL9 A;  4CPA A;  3S6K A;  4CGM A;  3G3S A;  4P4F A;  2ZEP A;  1ARM A;  1CPX A;  1PUA A;  2A4N A;  2J8N A;  2R8V A;  4KOW A;  3SHP A;  2R1I A;  3DGV A;  3BLN A;  1K4J A;  5AG7 A;  4CGL A;  3R1K A;  4Q36 A;  3WAB A;  1KWM A;  1X10 A;  2VXK A;  3KZW A;  2JDD A;  4FAI A;  4FBE A;  1V0C A;  2XEI A;  1ZLH A;  8CPA A;  2BOA A;  2F7V A;  2JBJ A;  4KSF A;  1Q7L A;  1VIX A;  3IU2 A;  3MGD A;  3T8W A;  2PDO A;  2JDC A;  4UWJ A;  4W9Y A;  1FY7 A;  1M4G A;  4NF1 A;  3WR7 A;  3FEC A;  3B3T A;  1ELL P;  5F09 A;  4MI4 A;  1LFW A;  3A9L A;  2C6G A;  1LRZ A;  2J8R A;  2P6G A;  4M85 A;  4ONU A;  4NSQ A;  3FBU A;  2AFZ A;  1NSA A;  1IOF A;  3PB4 X;  4UFW A;  1DTD A;  3R9F A;  4U9Z A;  4GS4 A;  1OBR A;  4UIA A;  3RAM A;  3TO9 A;  4A38 A;  3HUV A;  4BBH A;  5KTC A;  4MCP A;  1YSJ A;  4G1P A;  2BCO A;  4RUH A;  4PSX A;  4UFV A;  4UA3 A;  4Y49 B;  2ZEG A;  3VWE A;  1ZG9 A;  1Z8X A;  2Q4Z A;  1YK3 A;  2HC9 A;  2BUE A;  4KUA A;  1FNO A;  4PK2 A;  2NYQ A;  4U5Y A;  5CPA A;  4YRH A;  5AGE A;  1JWQ A;  4IHM A;  5IB9 A;  1RO5 A;  2V8V A;  4EWT A;  4YFJ A;  5G1Z A;  1F2P A;  3CXS A;  4BD9 A;  2PJ8 A;  3IWG A;  1BLL E;  2D4P A;  4MFK A;  3SJX A;  6CPA A;  5JM6 A;  3NH8 A;  2FS5 A;  3P2H A;  2C1C A;  2PJ9 A;  2PJ6 A;  2REE A;  4Y49 C;  3BHX A;  3BXM A;  3EO4 A;  3T9Y A;  1QQ9 A;  1MK4 A;  2EO8 A;  2NMT A;  4MHP A;  1H8L A;  3RZA A;  3V38 A;  4UCP A;  3ZJ0 A;  4RN7 A;  2J8M A;  3H8F A;  3SJG A;  1BPM A;  3N5F A;  5H84 A;  3S6H A;  1A2Z A;  2PJ4 A;  4OC4 A;  4NXY A;  1PCA A;  3S6G A;  4WJB A;  3BI0 A;  1Y9W A;  1CJW A;  4K30 A;  1TF9 A;  4E0A A;  1S3Z A;  3F0A A;  1BAV A;  1PU9 A;  5EMI A;  2Z3K A;  2AE6 A;  2EK9 A;  3FH4 A;  4MCS A;  5F46 A;  1LAP A;  3VH9 A;  4JXR A;  1KUV A;  4MY3 A;  3W6S A;  2PJB A;  1Z8L A;  1BO4 A;  4KVM E;  4B13 A;  1YRE A;  2FE7 A;  3FEE A;  3H8G A;  5JH9 A;  1I21 A;  3FED A;  4PXD A;  3PEI A;  3P2F A;  2RB7 A;  1TIQ A;  4GXH A;  3V7Z A;  2GLJ A;  4YU9 A;  1IID A;  3CXQ A;  1Z4R A;  3FX6 A;  4UBR A;  5DWN A;  4CAX A;  5F47 A;  3IGR A;  1Q2Y A;  5AG5 A;  2ZEH A;  3RYO A;  3K2K A;  3LOD A;  4LQG A;  1Z8W A;  4CYQ A;  2PJA A;  2OZG A;  4PXE A;  2DEA A;  4RS2 A;  4CAF A;  2DF5 A;  2YGW A;  2ZOF A;  1XEB A;  1L0C A;  1AUG A;  4R6T A;  2P6F A;  2PSW A;  2FVG A;  2FCK A;  3IEH A;  5K8O A;  3B8G A;  2B5G A;  4A39 A;  3PFE A;  3B3S A;  4ORF A;  2GE3 A;  1QSO A;  4KOR A;  2QJ8 A;  2Q44 A;  1LAM A;  2VI7 A;  2PJ1 A;  4PXB A;  2Q7B A;  2OOT A;  2CIJ A;  2Z0Z A;  3GKR A;  4MMO A;  1NMT A;  4PXC A;  3S6F A;  1Z8T A;  3DDD A;  2ZW7 A;  2Z3P A;  2BSW A;  1QSN A;  4GM5 A;  2V8H A;  1VHO A;  2KCW A;  7CPA A;  2V8G A;  5LYF A;  4WWV A;  4KOU A;  5J1Q A;  4KLV A;  4JZ0 A;  2Q7S A;  4XNH B;  4HNX B;  2XEJ A;  1VHS A;  2B58 A;  3PB7 X;  3T90 A;  1B6B A;  4R3L A;  3R9G A;  1QSR A;  4H6Z A;  1S60 A;  5LYD A;  1YQE A;  4UFX A;  1KUY A;  4NEX A;  2PJC A;  5ELY A;  4M6H A;  2Z3M A;  3CT9 A;  4ZBG A;  3B2Y A;  4OID A;  1CBX A;  2Z3L A;  4AVA A;  3TE4 A;  4UEZ A;  3NE7 A;  4XNH C;  4ZX9 A;  5LRJ A;  1YVO A;  4UCM A;  1P0H A;  3R95 A;  1YLO A;  1ZO0 A;  2PIY A;  4CYP A;  4JJX A;  4NJQ A;  4MHD A;  2EBJ A;  1S7F A;  4CS0 B;  2QIR A;  4A2Z A;  2P0W A;  3TC8 A;  4P45 A;  5HVH A;  1BOB A;  2CF4 A;  3DLJ A;  3PZJ A;  2POK A;  3TTH A;  3FVL A;  1XRY A;  1Q2C A;  2Q0Y A;  3GUX A;  4DJL A;  3HLP A;  4I49 A;  4OAD A;  4A37 A;  1XJO A;  2G0B A;  1ZG7 A;  3QAY A;  3NH5 A;  5G21 A;  3K9T A;  4YGO A;  4L8A A;  1J4J A;  3RBU A;  2NSM A;  3PBB A;  4MBU A;  4OC3 A;  1IY7 A;  4LUA A;  3E0K A;  2WPW A;  5D29 A;  4ZGY B;  3D2P A;  1YX0 A;  2WUU A;  1Y7E A;  2EWB A;  1M4I A;  2YNC A;  4BMH A;  5C82 A;  1FT7 A;  3WC5 A;  3EXN A;  3S9M A;  4KOS A;  1RXT A;  4LX9 A;  2GFQ A;  4B14 A;  5IV0 A;  2FSR A;  2G3A A;  2C6P A;  3D7G A;  4KVO E;  4FD6 A;  1MJA A;  3IU1 A;  1XMB A;  2PIZ A;  5FVJ A;  2OB0 A;  4C7H A;  2F5I A;  4HNY B;  1Z4E A;  4XPL A;  4MFL A;  3ISZ A;  4F9V A;  2O4H A;  1VKC A;  3PB6 X;  3LMS A;  2Z11 A;  5IX3 A;  4ZY1 A;  1X12 A;  2AFO A;  4P4E A;  4C2Z A;  3JTK A;  1VGY A;  5BWA B;  2K5T A;  2OZH A;  4X5K A;  3UY5 A;  3F5B A;  2D4O A;  3PP9 A;  4Q38 A;  2H5M A;  1CPS A;  2ODF A;  5C88 A;  4MFP A;  3W6X A;  4OKO A;  2YND A;  4KOT A;  5KTA A;  3KQZ A;  4A32 A;  1XIX A;  4O23 A;  4IAV A;  4H89 A;  4JWP A;  4EVY A;  5I0C A;  1IIC A;  5JPH A;  4P44 A;  2GRE A;  4NGS A;  5HH1 A;  1YW6 A;  2QEC A;  1EE3 P;  4OLL A;  1Y0R A;  5HVF A;  3BI1 A;  4B5P B;  4DUK A;  4YWY A;  4P10 A;  4R7M A;  2PR8 A;  4MFZ A;  4JXQ A;  4OC1 A;  3R9E A;  4C2Y A;  2HUZ A;  4R8F A;  2ZW5 A;  4MY0 A;  4F0Y A;  2VZZ A;  3TCV A;  1CG2 A;  4QBJ A;  1Y0Y A;  4NFR A;  2PR1 A;  1XBU A;  5CNP A;  2B3V A;  3GY9 A;  3TOA A;  4HKF A;  2AFX A;  4E8O A;  1P4N A;  1PYT B;  2ATR A;  5HXD A;  2QVP A;  5LYL A;  1CP6 A;  1OZP A;  2AFU A;  2CTC A;  1TKH A;  4LQ6 A;  4OP4 A;  3OWC A;  4NGR A;  1HEE A;  4IUS A;  4C68 A;  5K8M A;  2ANP A;  1IYL A;  1ON0 A;  3I9S A;  4NGQ A;  2REF A;  2BL1 A;  3TT2 A;  1LOK A;  3PRT A;  5J8F A;  4EFD A;  3NFZ A;  3CXP A;  3IWE A;  4R76 A;  2FXF A;  4F0X A;  5AG6 A;  5J8C A;  4H6U A;  2B5G B;  2BO9 A;  4CYO A;  3JRU A;  4ONW A;  3JUW A;  4A94 A;  3QNV A;  3FNC A;  4PK3 A;  4R9M A;  3DSB A;  2V77 A;  2C6C A;  2EK8 A;  4P6Y A;  4OIW A;  2DPS A;  4UIB A;  3IJ3 A;  3N7Z A;  2B4D B;  3PB8 X;  1WWZ A;  4ZI6 A;  3L2N A;  1ZLI A;  4MHZ A;  5HVG A;  2JBK A;  2ZOG A;  4QUS A;  4C2X A;  4KOY A;  1TXR A;  4KOX A;  3TX8 A;  4K3N A;  2PRB A;  2WPX A;  3KHX A;  4H2K A;  3SJF A;  4R87 A;  3SI0 A;  5DS0 A;  2PRQ A;  1GHE A;  4KZT A;  1Z2L A;  1Y9K A;  4Z65 A;  4XPK A;  1B87 A;  1IYK A;  3KR4 A;  2Q4V A;  2EUI A;  3CPA A;  4OAE A;  1HDQ A;  3DNS A;  4KLW A;  4X8I A;  4P4I A;  1AMP A;  1XFO A;  3PGP A;  3CZX A;  1F57 A;  4J3G A;  1CX8 A;  4R3K A;  3RO0 A;  1NSL A;  3VAT A;  3WC7 A;  2QML A;  3D4U A;  3F8K A;  2CNM A;  2XEG A;  3NH4 A;  3VAR A;  4P4J A;  1R57 A;  2Q04 A;  3EC4 A;  3PFO A;  1SQH A;  4MHY A;  1UFH A;  1IOI A;  2PQ8 A;  4QC6 A;  2I79 A;  3FIX A;  3I3G A;  4OC2 A;  4FD7 A;  4MXU A;  2JEW A;  3FRM A;  2VQY A;  4RI1 A;  1BPN A;  3KQX A;  5HMN A;  1UWY A;  2PCU A;  2G3T A;  4KUB A;  3FJU A;  4MCQ A;  2DXQ A;  2GLF A;  1Z5R A;  2O53 A;  2G9D A;  1R3N A;  1MJB A;  1XMT A;  5G22 A;  3S9N A;  1IGB A;  2Q4Y A;  3K9U A;  1Z9U A;  2WZN A;  4KSA A;  2IJZ A;  4AVC A;  4BIN A;  4NGN A;  4HNW B;  4CGO A;  3W91 A;  3WT4 A;  2Q51 A;  2PVW A;  3KKW A;  3B35 A;  2F8H A;  3D3S A;  2HV2 A;  2IL4 A;  3FMC A;  1ARL A;  1Y7R A;  2V8D A;  4A33 A;  2O28 A;  2J9A A;  4U9Y A;  4MRI A;  4OC0 A;  4P4B A;  4DNC A;  5AG4 A;  4UWI A;  4M6I A;  1IU8 A;  3S9L A;  4X3R A;  2ARH A;  2Z3N A;  3D66 A;  3WC6 A;  2ABZ A;  2ZEL A;  3VWD A;  2YNE A;  2Z10 A;  1M4L A;  2C27 A;  1YVK A;  3FF3 A;  3JVN A;  4PV6 A;  4AVB A;  2GU2 A;  4C7I A;  3SXN A;  5LRG A;  2VEZ A;  5A27 A;  3EY5 A;  2AFS A;  4CGP A;  2VL1 A;  3TOB A;  1I12 A;  1VHE A;  2JEV A;  4EME A;  3H8E A;  4KOV A;  4AB7 A;  5K8P A;  1YME A;  3D2M A;  1CP7 A;  4JLY A;  1S5K A;  5EBV A;  1Q2D A;  1WK4 A;  2P6E A;  2Q43 A;  3D8P A;  4ZY2 A;  2PJ2 A;  5DWM A;  4PQA A;  1KZF A;  1ZG8 A;  3PB9 X;  4M3S A;  1S7K A;  1M1D A;  4A95 A;  3GIU A;  5ISV A;  2CTB A;  3SI1 A;  3PBE A;  4CAE A;  4JD6 A;  4MHN A;  2GAN A;  5LYI A;  4AXV A;  2OZU A;  4TNU A;  3TO7 A;  3KI9 A;  5K8N A;  1TKF A;  3IC1 A;  1S7N A;  3SJE A;  4NGT A;  3QAH A;  2DPT A;  3D68 A;  4QVT A;  3SI2 A;  2ZW4 A;  3G8W A;  1LAN A;  3NE8 A;  2CNT A;  1XF8 A;  4AG7 A;  2ZEF A;  3MN8 A;  3RNZ A;  4F8Z A;  4NJR A;  2QYV A;  4CRY B;  3H4Q A;  5KTD A;  2ZW6 A;  1M4D A;  1N71 A;  2FT0 A;  3D7F A;  2R7H A;  4MJ8 A;  2AJ6 A;  2ZEM A;  1XOV A;  4A31 A;  3KHZ A;  3IIB A;  2AFM A;  3NA6 A;  2PJ0 A;  4B11 A;  1S7L A;  1KUX A;  5IB0 A;  2HB6 A;  4IF5 A;  3GLJ A;  2WYR A;  4IK2 A;  4ZYQ A;  4KVX A;  4B5P A;  2EVN A;  1IB1 E;  3BJ7 A;  4R57 A;  4ZY0 A;  4UEE A;  2PVV A;  2ZPA A;  5E96 A;  1YLE A;  1RTQ A;  2AFW A;  3IFE A;  2ZEE A;  3BJ8 A;  4NGM A;  2X7B A;  5H86 A;  5G20 A;  5JGF A;  3LAC A;  4II9 A;  4CAV A;  3ISX A;  1QSM A;  2CY2 A;  2ZEO A;  1QMU A;  2B3U A;  1NE9 A;  3ZZI A;  3I1U A;  4FD5 A;  3EFA A;  5I4M A;  1HDU A;  2Z3O A;  4F9U A;  5F48 A;  1ELM P;  3D7D A;  3QB8 A;  5D8N A;  4KSI A;  2RFH A;  5EC4 A;  3SXO A;  4NGP A;  4CYN A;  3R96 A;  3B3C A;  4TWE A;  3GB0 A;  2CXA A;  2FL4 A;  2IQ6 A;  1YGH A;  4CGN A;  2OH1 A;  3D7H A;  3FB3 A;  1TF8 A;  3KAS A;  4UEF A;  1XE4 A;  2PJ7 A;  5THW A;  4UCN A;  4A30 A;  2FIA A;  2I3C A;  4JYW A;  4B5O A;  3IWW A;  4B12 A;  3TFY A;  2PJ5 A;  4M6G A;  4P4D A;  4XPD B;  5LRK A;  1TKJ A;  3CDX A;  3DR8 A;  1I1D A;  1GYT A;  4MFJ A;  2RC4 A;  3DR6 A;  1F2O A;  3C26 A;  3B7I A;  3GYA A;  3IO1 A;  4F6A A;  3FYN A;  4OME A;  2B4B A;  2IMO A;  1AYE A;  3TO6 A;  2WSA A;  1U6M A;  2ZED A; 
#chains in the Genus database with same CATH homology
 1CM0 A;  2Y0M A;  4MFQ A;  2GIV A;  2B4D A;  4XPD C;  2OU2 A;  4E2A A;  4KS9 A;  2JLM A;  4FD4 A;  5F49 A;  4B10 A;  2BEI A;  2R98 A;  4NCZ A;  2I00 A;  3H5Z A;  2ZXV A;  1YR0 A;  2HQY A;  2FIW A;  3FXT A;  2VZY A;  1MJ9 A;  1QST A;  2VBQ A;  4L89 A;  3V8I A;  4CAW A;  2PC1 A;  2CNS A;  4CRZ B;  5JQ4 A;  1M44 A;  5A28 A;  3LD2 A;  4PSW A;  5GCN A;  2YNC C;  4QB9 A;  3S6K A;  4CGM A;  3G3S A;  4CS0 B;  3SHP A;  1PUA A;  4KOW A;  2A4N A;  2J8N A;  2R8V A;  4CGL A;  2R1I A;  3BLN A;  1K4J A;  5AG7 A;  3R1K A;  4Q36 A;  2VXK A;  2JDD A;  1V0C A;  4KSF A;  3IU2 A;  3MGD A;  2PDO A;  2JDC A;  4UWJ A;  1FY7 A;  1M4G A;  4NF1 A;  3WR7 A;  4MI4 A;  3A9L A;  1LRZ A;  2J8R A;  2P6G A;  4M85 A;  4ONU A;  4NSQ A;  3FBU A;  4UFW A;  3R9F A;  4U9Z A;  4GS4 A;  5KTC A;  3TO9 A;  4BBH A;  4PSX A;  4UFV A;  4UA3 A;  4Y49 B;  3VWE A;  1YK3 A;  4PK2 A;  2BUE A;  4KUA A;  4U5Y A;  4YRH A;  5AGE A;  1RO5 A;  4YFJ A;  5G1Z A;  3CXS A;  3IWG A;  4MFK A;  2D4P A;  3P2H A;  2FS5 A;  2REE A;  4Y49 C;  3T9Y A;  3EO4 A;  1MK4 A;  2NMT A;  4UCP A;  3ZJ0 A;  2J8M A;  5H84 A;  3S6H A;  4NXY A;  3S6G A;  1Y9W A;  1CJW A;  4K30 A;  4E0A A;  1S3Z A;  3F0A A;  1PU9 A;  2Z3K A;  2AE6 A;  5F46 A;  4JXR A;  1KUV A;  4MY3 A;  3W6S A;  4KVM E;  1BO4 A;  4B13 A;  1YRE A;  2FE7 A;  1I21 A;  3P2F A;  1TIQ A;  5DWN A;  1IID A;  3CXQ A;  1Z4R A;  4UBR A;  4CAX A;  5F47 A;  3IGR A;  1Q2Y A;  5AG5 A;  3RYO A;  3LOD A;  4CYQ A;  2OZG A;  4RS2 A;  4CAF A;  2YGW A;  1XEB A;  1L0C A;  2P6F A;  2PSW A;  2FCK A;  3B8G A;  2B5G A;  4ORF A;  2GE3 A;  1QSO A;  4KOR A;  2Q44 A;  2VI7 A;  2Q7B A;  3GKR A;  2Z0Z A;  1NMT A;  3S6F A;  3DDD A;  2ZW7 A;  2Z3P A;  2BSW A;  1QSN A;  2KCW A;  4KOU A;  4KLV A;  4XNH B;  4HNX B;  1VHS A;  2B58 A;  3T90 A;  1B6B A;  4R3L A;  3R9G A;  1QSR A;  4H6Z A;  1S60 A;  4UFX A;  1KUY A;  4NEX A;  2Z3M A;  4ZBG A;  2Z3L A;  4AVA A;  3TE4 A;  3NE7 A;  4XNH C;  1YVO A;  4UCM A;  1P0H A;  3R95 A;  1ZO0 A;  4CYP A;  4JJX A;  4MHD A;  1S7F A;  2QIR A;  4A2Z A;  2P0W A;  1BOB A;  3PZJ A;  3TTH A;  2Q0Y A;  1Q2C A;  4I49 A;  4OAD A;  2G0B A;  5G21 A;  4YGO A;  4L8A A;  1J4J A;  4MBU A;  4LUA A;  3E0K A;  2WPW A;  4ZGY B;  3D2P A;  1YX0 A;  2WUU A;  2YNC A;  1M4I A;  4BMH A;  5C82 A;  3EXN A;  4KOS A;  1RXT A;  4LX9 A;  4B14 A;  5IV0 A;  2FSR A;  2G3A A;  4KVO E;  4FD6 A;  1MJA A;  3IU1 A;  5FVJ A;  2OB0 A;  4C7H A;  2F5I A;  4HNY B;  1Z4E A;  4XPL A;  4MFL A;  1VKC A;  2Z11 A;  5IX3 A;  4C2Z A;  3JTK A;  5BWA B;  2K5T A;  2OZH A;  4X5K A;  3UY5 A;  3F5B A;  2D4O A;  3PP9 A;  4Q38 A;  2H5M A;  5C88 A;  4MFP A;  3W6X A;  2YND A;  4KOT A;  5KTA A;  4A32 A;  1XIX A;  4H89 A;  4JWP A;  4EVY A;  5I0C A;  1IIC A;  5JPH A;  5HH1 A;  2QEC A;  4OLL A;  4B5P B;  2PR8 A;  4MFZ A;  4JXQ A;  3R9E A;  4C2Y A;  2HUZ A;  2ZW5 A;  4MY0 A;  4F0Y A;  2VZZ A;  3TCV A;  4QBJ A;  2PR1 A;  5CNP A;  3TOA A;  2B3V A;  3GY9 A;  4HKF A;  4E8O A;  1P4N A;  2ATR A;  1OZP A;  3OWC A;  4IUS A;  4C68 A;  1IYL A;  1ON0 A;  3I9S A;  2REF A;  2BL1 A;  3TT2 A;  5J8F A;  3CXP A;  3IWE A;  2FXF A;  4F0X A;  5AG6 A;  5J8C A;  4H6U A;  2B5G B;  4CYO A;  3JUW A;  3FNC A;  4PK3 A;  4R9M A;  3DSB A;  2DPS A;  3N7Z A;  2B4D B;  1WWZ A;  4QUS A;  4C2X A;  4KOY A;  4KOX A;  2PRB A;  2WPX A;  4R87 A;  1GHE A;  4KZT A;  1Y9K A;  4XPK A;  1B87 A;  2Q4V A;  2EUI A;  4OAE A;  4KLW A;  3DNS A;  3PGP A;  4J3G A;  4R3K A;  1NSL A;  2QML A;  3F8K A;  2CNM A;  1R57 A;  2Q04 A;  3EC4 A;  1SQH A;  1UFH A;  2PQ8 A;  4QC6 A;  2I79 A;  3FIX A;  3I3G A;  4FD7 A;  3FRM A;  2VQY A;  4RI1 A;  5HMN A;  2G3T A;  4KUB A;  2DXQ A;  1MJB A;  1XMT A;  5G22 A;  2Q4Y A;  3K9U A;  1Z9U A;  4KSA A;  4AVC A;  4HNW B;  4CGO A;  3W91 A;  3KKW A;  3D3S A;  2HV2 A;  2IL4 A;  1Y7R A;  4A33 A;  2O28 A;  4U9Y A;  4DNC A;  5AG4 A;  4UWI A;  2ARH A;  2Z3N A;  3VWD A;  2YNE A;  2Z10 A;  2C27 A;  1YVK A;  3JVN A;  4PV6 A;  4AVB A;  4C7I A;  3SXN A;  2VEZ A;  5A27 A;  3EY5 A;  4CGP A;  3TOB A;  1I12 A;  2JEV A;  4KOV A;  4AB7 A;  4JLY A;  3D2M A;  1S5K A;  5EBV A;  1Q2D A;  1WK4 A;  2P6E A;  3D8P A;  5DWM A;  1KZF A;  4M3S A;  1S7K A;  1M1D A;  4A95 A;  5ISV A;  4CAE A;  4JD6 A;  2GAN A;  2OZU A;  3TO7 A;  1S7N A;  3QAH A;  2DPT A;  4QVT A;  2ZW4 A;  3G8W A;  2CNT A;  1XF8 A;  4AG7 A;  4CRY B;  3H4Q A;  5KTD A;  2ZW6 A;  1M4D A;  1N71 A;  2FT0 A;  4MJ8 A;  2R7H A;  4A31 A;  2AJ6 A;  4AG9 A;  4B11 A;  1S7L A;  1KUX A;  5IB0 A;  4IF5 A;  4KVX A;  4B5P A;  2EVN A;  1IB1 E;  3BJ7 A;  4R57 A;  2ZPA A;  5E96 A;  1YLE A;  3BJ8 A;  2X7B A;  5H86 A;  5G20 A;  4II9 A;  4CAV A;  1QSM A;  2CY2 A;  2B3U A;  1NE9 A;  3ZZI A;  4FD5 A;  3EFA A;  2Z3O A;  5F48 A;  3QB8 A;  5EC4 A;  3SXO A;  4CYN A;  3R96 A;  2CXA A;  2FL4 A;  1YGH A;  4CGN A;  2OH1 A;  3FB3 A;  1XE4 A;  4UCN A;  4A30 A;  2FIA A;  4B5O A;  4B12 A;  3TFY A;  4XPD B;  3DR8 A;  1I1D A;  4MFJ A;  2RC4 A;  3DR6 A;  3C26 A;  3GYA A;  4F6A A;  3FYN A;  2B4B A;  1IYK A;  3TO6 A;  2WSA A;  1U6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...