1IICA

Crystal structure of saccharomyces cerevisiae n-myristoyltransferase with bound myristoylcoa
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoylCoA and peptide provide insights about substrate recognition and catalysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords PEPTIDE N-myristoyltransferase
total genus 128
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2001-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iicA02
2ATRA 4MHDA 3FYNA 2HUZA 1MK4A 3EO4A 4B5OA 4HNYB 2FIWA 4AVBA 4OAEA 4QC6A 1U6MA 2B5GA 3R9EA 4AB7A 4LX9A 4GS4A 2Q44A 5HH1A 1VHSA 3KKWA 5F49A 4PK2A 3TTHA 1QSTA 1P0HA 3FRMA 2JLMA 3UY5A 4XNHC 1XF8A 3G3SA 3W6XA 4I49A 4CAVA 5IX3A 2B3VA 3G8WA 4CAXA 1Q2DA 2P6FA 3JVNA 4ONUA 1XE4A 4UWIA 3OWCA 1MJAA 3TE4A 4MY0A 4JWPA 2CY2A 1YX0A 2EVNA 3D2MA 1YK3A 2FIAA 3SXOA 1FY7A 4IF5A 3DDDA 4NF1A 3K9UA 4II9A 3DNSA 2RC4A 3CXSA 1S7KA 3RYOA 4KVXA 3F5BA 4XNHB 4NCZA 3SXNA 5I0CA 5EC4A 5KTCA 2FT0A 1M4IA 3GY9A 1S7NA 1M44A 3NE7A 3FB3A 4JLYA 5IV0A 2X7BA 1N71A 4U9YA 2PRBA 3PGPA 2ZW6A 3ZZIA 4UWJA 4NSQA 4LUAA 3QB8A 4B5PB 5GCNA 5CNPA 4E2AA 4FD7A 4L89A 2FS5A 4E0AA 2I79A 4HKFA 2GE3A 3S6FA 1PU9A 2O28A 2ZW4A 2PDOA 2B5GB 3GYAA 3JUWA 4NXYA 1M4GA 5JPHA 4MJ8A 4L8AA 4BMHA 4PSXA 4F0YA 4CS0B 2Q4YA 4JJXA 1S60A 3W6SA 2Z0ZA 4U5YA 1I1DA 2Q0YA 4OLLA 1S5KA 5ISVA 3R1KA 1S3ZA 2FCKA 2PQ8A 4J3GA 3F0AA 4K30A 4KOYA 4ORFA 2Q7BA 2HQYA 4EVYA 1CJWA 2B4DA 2JEVA 3MGDA 3TO9A 1MJBA 2B58A 5DWNA 2B4DB 3D3SA 4XPLA 1NSLA 4HNWB 4CRYB 1QSRA 4H6ZA 2OZHA 1Q2YA 5JQ4A 3LODA 3P2HA 5HMNA 2WPWA 4KLVA 3VWDA 1KUXA 4DNCA 2AE6A 3TT2A 2QIRA 3DR6A 1I21A 1QSOA 3ZJ0A 4H6UA 1NMTA 4U9ZA 4R3LA 3TOBA 3QAHA 3BJ7A 4YRHA 2ARHA 2K5TA 5IB0A 4AG7A 1IYLA 4KORA 1IB1E 2P6EA 3T90A 4MY3A 1NE9A 2HV2A 2WPXA 4JXQA 1K4JA 4KOXA 5H84A 2REFA 3R95A 2QMLA 1WK4A 1KUVA 2OB0A 3I9SA 1YLEA 2JDCA 3DSBA 4Y49B 3BLNA 2CNTA 4CRZB 1BO4A 4KOTA 4QBJA 2FE7A 2PC1A 1TIQA 4X5KA 1LRZA 1BOBA 1YVKA 4RI1A 2ZPAA 5F48A 3SHPA 2GIVA 3EXNA 1B87A 1UFHA 1QSMA 2FL4A 4F6AA 3FXTA 1QSNA 3P2FA 3W91A 2A4NA 4PV6A 1GHEA 3D8PA 2EUIA 3S6HA 1SQHA 3FIXA 2REEA 2CNSA 4ZBGA 2VI7A 3S6GA 2P0WA 4UA3A 1V0CA 1KUYA 5J8CA 1ON0A 2CNMA 2C27A 1IICA 2R7HA 1YR0A 3IWGA 2VBQA 4JXRA 4R9MA 4KLWA 3DR8A 2P6GA 3S6KA 2KCWA 2OZUA 4R3KA 2FXFA 5FVJA 4R87A 1YREA 3N7ZA 4QB9A 3CXPA 3V8IA 4YFJA 1XIXA 4MBUA 4AVAA 1IYKA 2NMTA 1J4JA 4HNXB 3TCVA 2VQYA 2QECA 1RXTA 3TFYA 1OZPA 3VWEA 1Y9KA 3EFAA 1Y7RA 4XPKA 1M4DA 2Y0MA 2OZGA 2VXKA 4PSWA 4KOUA 3H4QA 5DWMA 3TO7A 2R8VA 2B3UA 1I12A 4IUSA 2AJ6A 3BJ8A 4PK3A 5C82A 3B8GA 3EC4A 4H89A 4B5PA 4KUBA 1Z9UA 4MI4A 1R57A 1CM0A 2VEZA 5E96A 2G0BA 1S7FA 4R57A 2Q04A 4CAWA 4KVOE 4JD6A 3IGRA 2D4PA 2ZW7A 3TOAA 3T9YA 5EBVA 3R9FA 4QUSA 5H86A 4FD4A 5F46A 3E0KA 2VZYA 1XEBA 4FD6A 1Z4RA 4RS2A 3LD2A 2BL1A 1YVOA 4OADA 3PP9A 5KTDA 2FSRA 2ZW5A 5C88A 5J8FA 2R1IA 1S7LA 1YGHA 3I3GA 2F5IA 2BEIA 2PSWA 2D4OA 2ZXVA 3R96A 5KTAA 2BSWA 2JDDA 1B6BA 1PUAA 4KOVA 2PR1A 4KVME 1M1DA 1L0CA 2PR8A 2DXQA 4KOSA 4E8OA 4UBRA 4XPDB 3D2PA 4KOWA 2Z10A 4M3SA 2B4BA 2J8MA 3WR7A 4QVTA 1Q2CA 4M85A 1WWZA 1Y9WA 1MJ9A 4AG9A 2J8NA 2OH1A 2I00A 2J8RA 2Q4VA 2BUEA 1IIDA 2Z11A 3PZJA 2R98A 4NEXA 1VKCA 2G3AA 1Z4EA 2H5MA 4XPDC 3C26A 1KZFA 4YGOA 3F8KA 5F47A 1XMTA 3GKRA 3FNCA 3FBUA 2GANA 1RO5A 4KUAA 1P4NA 2VZZA 4Y49C 3CXQA 2G3TA 2IL4A 3R9GA 4AVCA 4KZTA 2OU2A 3EY5A 4FD5A 3TO6A
chains in the Genus database with same CATH superfamily
3I1UA 2ATRA 2ZEHA 4MHDA 3FYNA 2HUZA 4B14A 1YLOA 4FWUA 4X3RA 1MK4A 1LANA 1YSJA 3EO4A 5CPAA 4UIBA 4EMEA 2PJ1A 4B5OA 3S9MA 1ZG9A 2V8DA 4HNYB 2FIWA 2NYQA 3RZAA 2AFMA 4AVBA 4OAEA 4QC6A 1U6MA 1VHEA 1IOIA 2B5GA 1FNOA 3R9EA 1QQ9A 4AB7A 3JRUA 4LX9A 4GS4A 4UF4A 2Q44A 5HH1A 1VHSA 3KKWA 5F49A 1ZG7A 4PK2A 3TTHA 3IWEA 1QSTA 2CF4A 4MFZA 1P0HA 3ISZA 4MCSA 3FRMA 4UFWA 4C7HA 2JLMA 1F2OA 3D66A 4XNHC 3UY5A 1XF8A 3G3SA 3V7ZA 2PIYA 2PJ6A 4I49A 4P6YA 1UWYA 2PJ3A 3W6XA 4CAVA 1Z8XA 3D67A 2B3VA 3G8WA 3KQZA 2AFZA 4CAXA 4CYNA 1Q2DA 2P6FA 3JVNA 4MXUA 3WC5A 2CIJA 4ONUA 1XE4A 2EBJA 1ZG8A 3OWCA 1MJAA 1PYTB 4KSAA 4UWIA 1FT7A 3TE4A 4MY0A 4A31A 4F9VA 3B2YA 5IX3A 4JWPA 2CY2A 4GXHA 5K8PA 1YX0A 3WABA 1ZLHA 2EVNA 3D2MA 1YK3A 2FIAA 3SXOA 1FY7A 4A39A 4IF5A 3SJFA 7CPAA 3DDDA 4NF1A 3K9UA 1Z8TA 4II9A 1Z8LA 3DNSA 3KGQA 2RC4A 3KHZA 4PXCA 5LYLA 3CXSA 1S7KA 3RYOA 2GFQA 2ZEMA 4KVXA 3F5BA 2PJ7A 1CP7A 4XNHB 2Z3MA 4NCZA 5G1ZA 3SXNA 5I0CA 5EC4A 5KTCA 4HPSA 2FT0A 1M4IA 2ZEOA 2CTCA 3GY9A 3SI0A 3CZXA 4EFDA 1S7NA 1M44A 3NE7A 3FB3A 4JLYA 4OIDA 5IV0A 2EK9A 2POKA 3KR5A 2AFXA 2X7BA 2DPTA 4B11A 2ZELA 4IK2A 4CAFA 3WT4A 3T8WA 1N71A 4P44A 3B7IA 4U9YA 4OC4A 3VATA 4A33A 2O4HA 4OC0A 4ZX8A 2PRBA 5THWA 5I4MA 4M6IA 3PGPA 2ZW6A 3ZZIA 4O23A 3VH9A 3BXMA 4UWJA 2QJ8A 4NSQA 1EE3P 4DYOA 1KWMA 4LUAA 2V8VA 4A95A 5JM6A 1YMEA 3QB8A 3B3CA 2GU2A 4B5PB 4DJLA 2BCOA 5GCNA 5CNPA 2PJBA 2PRQA 4E2AA 4MHNA 2Q43A 4FD7A 4NFRA 4L89A 1CPXA 2Z3KA 2FS5A 4E0AA 2I79A 1LCPA 4HKFA 2GE3A 3S6FA 1PU9A 2O28A 2ZW4A 1GYTA 4KSIA 2PDOA 2ZEPA 3NH4A 4GM5A 2B5GB 2YNCA 3GYAA 3JUWA 2ZENA 4NXYA 5ELYA 1M4GA 5JPHA 4NGTA 2PJ4A 2RB7A 4MJ8A 1VHOA 1TXRA 2C6GA 5G20A 3PBEA 4NJQA 2Q7SA 4PXEA 4L8AA 4Q38A 4BMHA 4PSXA 4F0YA 3CPXA 3FEEA 4NJRA 3RAMA 4FUUA 4CS0B 3FF3A 4YU9A 2Q4YA 4JJXA 3A9LA 1S60A 2ANPA 2Z0ZA 3W6SA 4U5YA 2JEWA 1I1DA 2Q0YA 1YW6A 5LYFA 4OLLA 1S5KA 5ISVA 3R1KA 6CPAA 1XMBA 2GLJA 4FAIA 2ZEGA 1S3ZA 3PB6X 2FCKA 2PQ8A 1HEEA 4CYQA 4CAEA 3BI1A 1ARMA 4J3GA 3F0AA 4K30A 4KOYA 2JBKA 4ORFA 2Q7BA 4C2YA 1R43A 3QAYA 4ZYQA 2HQYA 2WZNA 4LQGA 1CJWA 4EVYA 2B4DA 2JEVA 3MGDA 4NGMA 3RNZA 3TO9A 1TF8A 1MJBA 4OC3A 2B58A 4P4EA 5DWNA 4B13A 2B4DB 2J9AA 3D3SA 4P45A 4XPLA 4HNWB 1NSLA 3WC6A 4B10A 4W9YA 5G22A 3S9NA 1M4LA 4CRYB 1QSRA 3IU1A 3SJEA 3KR4A 3PBBA 3HUVA 2G9DA 4A30A 4H6ZA 4CYOA 2BOAA 2OZHA 3B3SA 4H2KA 5HVHA 2AFOA 2FVGA 4UEEA 2WSAA 1Q2YA 5EMIA 3GB0A 5JQ4A 2EWBA 3PB8X 3LODA 3P2HA 5HMNA 4DUKA 1CX8A 2WPWA 4CPAA 4ZX9A 4KLVA 2PJ9A 2XEFA 1KUXA 3VWDA 4C68A 3KASA 4MRIA 3B3WA 4DNCA 2AE6A 3TT2A 4UIAA 2WYRA 2F7VA 4ONWA 2QIRA 3DR6A 1I21A 4K3NA 3KHXA 2VL1A 1QSOA 4LQ6A 2WUUA 3ZJ0A 3NFZA 4OIWA 4R7MA 1IY7A 4H6UA 1LAPA 2HB6A 4MFQA 5DS0A 1BPNA 1NMTA 4U9ZA 2C6PA 3FMCA 4MCPA 4R3LA 1F2PA 3MN8A 2AFUA 2AFSA 3BJ7A 3QAHA 5AG5A 3TOBA 4YRHA 1HDUA 2ARHA 2K5TA 2ZOGA 5IB0A 1Y7EA 1QMUA 3FEDA 4OC1A 4A37A 4AG7A 1IYLA 1HDQA 4KORA 4C2XA 2Z3OA 4ZY2A 1IGBA 5K8OA 1IB1E 2P6EA 3T90A 4MY3A 1NE9A 5BWAB 2HV2A 2WPXA 2Z3PA 3D7DA 4JXQA 1K4JA 4OC2A 3TX8A 3PB9X 2PJAA 2XEJA 4KOXA 4RN7A 5H84A 4MFKA 2REFA 3R95A 2QMLA 3RBUA 5J1QA 1WK4A 2GLFA 1KUVA 2OB0A 3I9SA 4JYWA 1YLEA 3TC8A 2JDCA 1CP6A 3DSBA 4Y49B 3BLNA 1DE4C 2CNTA 5AG7A 3SJXA 3LWUA 4CRZB 1BO4A 4KOTA 4R8FA 4QBJA 2JBJA 3D68A 2QYVA 2FE7A 2PC1A 1LFWA 1RTQA 1TIQA 3GUXA 2GREA 4MFJA 4X5KA 4B6ZA 1LRZA 2ZOFA 2AFWA 1ARLA 1YVKA 1BOBA 5A27A 4RI1A 2ZPAA 3H8GA 4A94A 3PEIA 5F48A 1YQEA 5D29A 3JTKA 4NGPA 3SHPA 2GIVA 3KQXA 3EXNA 5JH9A 3MRUA 1B87A 1UFHA 1QSMA 2FL4A 4F6AA 3FXTA 3LMSA 1AMPA 2Q4ZA 3CT9A 1QSNA 3DGVA 3WC7A 2ABZA 8CPAA 3P2FA 3SI1A 3W91A 5G21A 2A4NA 4G1PA 4PV6A 1GHEA 3D8PA 2EUIA 3CPAA 1Y0YA 3K2KA 3S6HA 4CGNA 1JWQA 5D8NA 1SQHA 3FIXA 2REEA 4PXBA 1AYEA 2CNSA 4ZBGA 5F09A 4X8IA 2VI7A 3S6GA 2OOTA 2P0WA 4UA3A 1V0CA 2PJ5A 1KUYA 2EO8A 5J8CA 5A28A 4X2TA 4B12A 2PIZA 1ON0A 2CNMA 2YNDA 5AGEA 2C27A 4A2ZA 4MCQA 1IICA 2R7HA 3PB7X 1YR0A 2I3CA 2YNEA 3IWGA 2VBQA 4JXRA 4R9MA 4KLWA 3DR8A 2P6GA 5K8NA 2DF5A 1XJOA 1ELMP 3BI0A 3S6KA 4CGOA 2KCWA 2OZUA 4UEFA 2PJ0A 4R3KA 1ZO0A 1X10A 1Z5RA 2FXFA 3SI2A 5AG4A 1BAVA 5FVJA 5HXDA 1ZLIA 4CGLA 4A38A 5CBMA 4R87A 1YREA 3N7ZA 4QB9A 3CXPA 4UFXA 4WWVA 4Q36A 3V8IA 1XIXA 3KI9A 4YFJA 3N5FA 1OBRA 4MBUA 4OKOA 1IYKA 4AVAA 4BBHA 3CDXA 2IQ6A 3IEHA 2NMTA 1J4JA 3NA6A 2HC9A 4HNXB 1XBUA 1Z2LA 3TCVA 3D7FA 2VQYA 2ZEDA 2QECA 1PCAA 1RXTA 2IMOA 3TFYA 3PFEA 3FVLA 1OZPA 2O53A 3D7GA 3VWEA 1Y9KA 2F8HA 3SJGA 3EFAA 4P4BA 5JGFA 4Q7AA 2PJ8A 1Y7RA 3D7HA 4MMOA 4P4JA 4NGRA 4PXDA 1M4DA 4MFLA 4R6TA 4XPKA 5LYDA 2V77A 2Y0MA 2CXAA 4IHMA 2OZGA 4BINA 1Y0RA 2IJZA 2YNCC 4F0XA 2DEAA 1BLLE 4PQAA 2BO9A 2VXKA 3H5ZA 2ODFA 2CTBA 3H4QA 4KOUA 4PSWA 3RO0A 4ZGYB 2PVVA 2RFHA 3FX6A 5DWMA 3PRTA 1TKFA 3PB4X 1TKJA 4YWYA 1Q7LA 4F8ZA 1VIXA 1ELLP 4ZY0A 3TO7A 1LAMA 2B3UA 1I12A 2R8VA 4IUSA 2AJ6A 3BJ8A 4UCPA 4PK3A 3B3VA 3IFEA 5C82A 3D4UA 4NGNA 3B8GA 3FH4A 3EC4A 4H89A 4MHPA 4B5PA 1DTDA 1A2ZA 4KUBA 1Z9UA 3FECA 4MI4A 3HLPA 1R57A 1CM0A 1XOVA 3VARA 3S9LA 2VEZA 1JQGA 5E96A 4TWEA 1TF9A 5LRGA 4CYPA 2G0BA 1S7FA 3IU2A 1IOFA 1XRYA 2Q04A 4R57A 4CAWA 4KVOE 4JD6A 4CGMA 2ZEFA 3IGRA 3NH5A 2D4PA 2ZW7A 3NE8A 4MHYA 4KSFA 5EBVA 3R9FA 3T9YA 4KS9A 4QUSA 3TOAA 2XEGA 5LYIA 4BD9A 3IC1A 5K8MA 4EWTA 3NH8A 5H86A 4FD4A 5F46A 3E0KA 2VZYA 3B3TA 4JZ0A 1XEBA 4FD6A 1Z4RA 3PFOA 4UFVA 4RS2A 3LD2A 4UCMA 2BL1A 1YVOA 4OADA 4M6GA 4RUHA 2V8GA 3PP9A 4ZY1A 5KTDA 2FSRA 2ZW5A 5C88A 5HVFA 1H8LA 5J8FA 2R1IA 1S7LA 1YGHA 4MCRA 3I3GA 2EK8A 2F5IA 2BEIA 3L2NA 2PSWA 4MFPA 1YW4A 1Z8WA 2D4OA 2C6CA 2ZXVA 3GLJA 4MHZA 4NGSA 4Z65A 3R96A 5KTAA 4P4DA 4CGPA 2BSWA 2JDDA 1B6BA 1PUAA 4A32A 2V8HA 1VGYA 3KL9A 4KOVA 4P4FA 2PR1A 4KVME 1M1DA 3ISXA 1L0CA 2PR8A 5HVGA 3BHXA 2DXQA 4KOSA 2OR4A 4E8OA 4UBRA 4XPDB 4NGQA 3B35A 4OP4A 3D2PA 4KOWA 4PPZA 2Z10A 1NSAA 4M3SA 4OC5A 4UCNA 2B4BA 2J8MA 3WR7A 4QVTA 1Q2CA 1TKHA 1BPMA 3KZWA 3V38A 1AUGA 4M85A 1WWZA 1Y9WA 2PCUA 3FJUA 1CBXA 5IB9A 1MJ9A 2PJ2A 4ZI6A 4AG9A 4C2ZA 2Q51A 4R76A 2J8NA 2OH1A 2PJCA 3LACA 2I00A 4AXVA 5AG6A 4UEZA 2J8RA 2YGWA 4WJBA 2XEIA 2Z3NA 2Q4VA 5LRJA 2BUEA 3IIBA 3IWWA 1IIDA 2Z11A 3PZJA 5LRKA 1CG2A 2R98A 4NEXA 1VKCA 2G3AA 2ZEEA 1X12A 1Z4EA 2H5MA 4XPDC 3C26A 1KZFA 3DLJA 3F8KA 4M6HA 4YGOA 2QVPA 5F47A 1XMTA 3GKRA 2C1CA 3H8EA 2PVWA 4C7IA 2DPSA 1R3NA 2GANA 3FBUA 3FNCA 4OMEA 1LOKA 3QNVA 4P4IA 1RO5A 4KUAA 2NSMA 1P4NA 2VZZA 4Y49C 4FBEA 1IU8A 3K9TA 3CXQA 3IO1A 2G3TA 4TNUA 3IJ3A 2IL4A 3H8FA 1F57A 4IAVA 3R9GA 4AVCA 4KZTA 4F9UA 2OU2A 3EY5A 4P10A 1CPSA 1XFOA 4FD5A 2PE3A 3GIUA 3TO6A 2Z3LA
chains in the Genus database with same CATH topology
2ATRA 4MHDA 3FYNA 2HUZA 4B14A 1MK4A 3EO4A 4B5OA 4HNYB 2FIWA 4AVBA 4OAEA 4QC6A 1U6MA 2B5GA 3R9EA 4AB7A 4LX9A 4GS4A 2Q44A 5HH1A 1VHSA 3KKWA 5F49A 4PK2A 3TTHA 3IWEA 1QSTA 4MFZA 1P0HA 3FRMA 4UFWA 4C7HA 2JLMA 3UY5A 4XNHC 1XF8A 3G3SA 3W6XA 4I49A 4CAVA 5IX3A 2B3VA 3G8WA 4CAXA 4CYNA 1Q2DA 2P6FA 3JVNA 4ONUA 1XE4A 4KSAA 4UWIA 3OWCA 1MJAA 3TE4A 4MY0A 4A31A 4JWPA 2CY2A 1YX0A 2EVNA 3D2MA 1YK3A 2FIAA 3SXOA 1FY7A 4IF5A 3DDDA 4NF1A 3K9UA 4II9A 3DNSA 2RC4A 3CXSA 1S7KA 3RYOA 4KVXA 3F5BA 4XNHB 2Z3MA 4NCZA 5G1ZA 3SXNA 5I0CA 5EC4A 5KTCA 2FT0A 1M4IA 3GY9A 1S7NA 1M44A 3NE7A 3FB3A 4JLYA 5IV0A 4B11A 2X7BA 2DPTA 4CAFA 1N71A 4U9YA 4A33A 2PRBA 3PGPA 2ZW6A 3ZZIA 4UWJA 4NSQA 4LUAA 4A95A 3QB8A 4B5PB 5GCNA 5CNPA 4E2AA 4FD7A 4L89A 2Z3KA 2FS5A 4E0AA 2I79A 4HKFA 2GE3A 3S6FA 1PU9A 2O28A 2ZW4A 2PDOA 2B5GB 2YNCA 3GYAA 3JUWA 4NXYA 1M4GA 5JPHA 4MJ8A 5G20A 4L8AA 4Q38A 4BMHA 4PSXA 4F0YA 4CS0B 2Q4YA 4JJXA 3A9LA 1S60A 3W6SA 2Z0ZA 4U5YA 1I1DA 2Q0YA 4OLLA 1S5KA 5ISVA 3R1KA 1S3ZA 2FCKA 2PQ8A 4CYQA 4CAEA 4J3GA 3F0AA 4K30A 4KOYA 4ORFA 2Q7BA 4C2YA 2HQYA 4EVYA 1CJWA 2B4DA 2JEVA 3MGDA 3TO9A 1MJBA 2B58A 5DWNA 4B13A 2B4DB 3D3SA 4XPLA 1NSLA 4HNWB 4B10A 5G22A 4CRYB 1QSRA 3IU1A 4A30A 4H6ZA 4CYOA 2OZHA 2WSAA 1Q2YA 5JQ4A 3LODA 3P2HA 5HMNA 2WPWA 4KLVA 3VWDA 1KUXA 4C68A 4DNCA 2AE6A 3TT2A 2QIRA 3DR6A 1I21A 1QSOA 2WUUA 3ZJ0A 4H6UA 4MFQA 1NMTA 4U9ZA 4R3LA 3TOBA 3QAHA 3BJ7A 5AG5A 4YRHA 2ARHA 2K5TA 5IB0A 4AG7A 1IYLA 4KORA 4C2XA 2Z3OA 1IB1E 2P6EA 3T90A 4MY3A 1NE9A 5BWAB 2HV2A 2WPXA 2Z3PA 4JXQA 1K4JA 4KOXA 5H84A 4MFKA 2REFA 3R95A 2QMLA 1WK4A 1KUVA 2OB0A 3I9SA 1YLEA 2JDCA 3DSBA 4Y49B 3BLNA 2CNTA 5AG7A 4CRZB 1BO4A 4KOTA 4QBJA 2FE7A 2PC1A 4MFJA 1TIQA 4X5KA 1LRZA 1BOBA 1YVKA 5A27A 4RI1A 2ZPAA 5F48A 3JTKA 3SHPA 2GIVA 3EXNA 1B87A 1UFHA 1QSMA 2FL4A 4F6AA 3FXTA 1QSNA 3P2FA 3W91A 5G21A 2A4NA 4PV6A 1GHEA 3D8PA 2EUIA 3S6HA 4CGNA 1SQHA 3FIXA 2REEA 2CNSA 4ZBGA 2VI7A 3S6GA 2P0WA 4UA3A 1V0CA 1KUYA 5J8CA 5A28A 4B12A 1ON0A 2CNMA 2YNDA 5AGEA 2C27A 4A2ZA 1IICA 2R7HA 1YR0A 2YNEA 3IWGA 2VBQA 4JXRA 4R9MA 4KLWA 3DR8A 2P6GA 4CGOA 3S6KA 2KCWA 2OZUA 4R3KA 1ZO0A 5AG4A 2FXFA 5FVJA 4CGLA 4R87A 1YREA 3N7ZA 4QB9A 3CXPA 4UFXA 3V8IA 4Q36A 4YFJA 1XIXA 4MBUA 4AVAA 1IYKA 4BBHA 2NMTA 1J4JA 4HNXB 3TCVA 2VQYA 2QECA 1RXTA 3TFYA 1OZPA 3VWEA 1Y9KA 3EFAA 1Y7RA 4XPKA 1M4DA 4MFLA 2Y0MA 2CXAA 2OZGA 2YNCC 4F0XA 2VXKA 3H5ZA 4KOUA 4PSWA 3H4QA 4ZGYB 5DWMA 3TO7A 2R8VA 2B3UA 1I12A 4IUSA 2AJ6A 3BJ8A 4UCPA 4PK3A 5C82A 3B8GA 3EC4A 4H89A 4B5PA 4KUBA 1Z9UA 4MI4A 1R57A 1CM0A 2VEZA 4CYPA 5E96A 2G0BA 1S7FA 3IU2A 4R57A 2Q04A 4CAWA 4KVOE 4JD6A 4CGMA 3IGRA 2D4PA 2ZW7A 3TOAA 4KSFA 5EBVA 3R9FA 3T9YA 4KS9A 4QUSA 5H86A 4FD4A 5F46A 3E0KA 2VZYA 1XEBA 4FD6A 1Z4RA 4UFVA 4RS2A 3LD2A 4UCMA 2BL1A 1YVOA 4OADA 3PP9A 5KTDA 2FSRA 2ZW5A 5C88A 5J8FA 2R1IA 1S7LA 1YGHA 3I3GA 2F5IA 2BEIA 2PSWA 4MFPA 2D4OA 2ZXVA 3R96A 5KTAA 4CGPA 2BSWA 2JDDA 1B6BA 1PUAA 4A32A 4KOVA 2PR1A 4KVME 1M1DA 1L0CA 2PR8A 2DXQA 4KOSA 4E8OA 4UBRA 4XPDB 3D2PA 4KOWA 2Z10A 4M3SA 4UCNA 2B4BA 2J8MA 3WR7A 4QVTA 1Q2CA 4M85A 1WWZA 1Y9WA 1MJ9A 4AG9A 4C2ZA 2J8NA 2OH1A 2I00A 5AG6A 2J8RA 2YGWA 2Z3NA 2Q4VA 2BUEA 1IIDA 2Z11A 3PZJA 2R98A 4NEXA 1VKCA 2G3AA 1Z4EA 2H5MA 4XPDC 3C26A 1KZFA 4YGOA 3F8KA 5F47A 1XMTA 3GKRA 4C7IA 2DPSA 3FBUA 2GANA 3FNCA 1RO5A 4KUAA 1P4NA 2VZZA 4Y49C 3CXQA 2G3TA 2IL4A 3R9GA 4AVCA 4KZTA 2OU2A 3EY5A 4FD5A 3TO6A 2Z3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATR A;  4MHD A;  3FYN A;  2HUZ A;  1MK4 A;  3EO4 A;  4B5O A;  4HNY B;  2FIW A;  4AVB A;  4OAE A;  4QC6 A;  1U6M A;  2B5G A;  3R9E A;  4AB7 A;  4LX9 A;  4GS4 A;  2Q44 A;  5HH1 A;  1VHS A;  3KKW A;  5F49 A;  4PK2 A;  3TTH A;  1QST A;  1P0H A;  3FRM A;  2JLM A;  3UY5 A;  4XNH C;  1XF8 A;  3G3S A;  3W6X A;  4I49 A;  4CAV A;  5IX3 A;  2B3V A;  3G8W A;  4CAX A;  1Q2D A;  2P6F A;  3JVN A;  4ONU A;  1XE4 A;  4UWI A;  3OWC A;  1MJA A;  3TE4 A;  4MY0 A;  4JWP A;  2CY2 A;  1YX0 A;  2EVN A;  3D2M A;  1YK3 A;  2FIA A;  3SXO A;  1FY7 A;  4IF5 A;  3DDD A;  4NF1 A;  3K9U A;  4II9 A;  3DNS A;  2RC4 A;  3CXS A;  1S7K A;  3RYO A;  4KVX A;  3F5B A;  4XNH B;  4NCZ A;  3SXN A;  5I0C A;  5EC4 A;  5KTC A;  2FT0 A;  1M4I A;  3GY9 A;  1S7N A;  1M44 A;  3NE7 A;  3FB3 A;  4JLY A;  5IV0 A;  2X7B A;  1N71 A;  4U9Y A;  2PRB A;  3PGP A;  2ZW6 A;  3ZZI A;  4UWJ A;  4NSQ A;  4LUA A;  3QB8 A;  4B5P B;  5GCN A;  5CNP A;  4E2A A;  4FD7 A;  4L89 A;  2FS5 A;  4E0A A;  2I79 A;  4HKF A;  2GE3 A;  3S6F A;  1PU9 A;  2O28 A;  2ZW4 A;  2PDO A;  2B5G B;  3GYA A;  3JUW A;  4NXY A;  1M4G A;  5JPH A;  4MJ8 A;  4L8A A;  4BMH A;  4PSX A;  4F0Y A;  4CS0 B;  2Q4Y A;  4JJX A;  1S60 A;  3W6S A;  2Z0Z A;  4U5Y A;  1I1D A;  2Q0Y A;  4OLL A;  1S5K A;  5ISV A;  3R1K A;  1S3Z A;  2FCK A;  2PQ8 A;  4J3G A;  3F0A A;  4K30 A;  4KOY A;  4ORF A;  2Q7B A;  2HQY A;  4EVY A;  1CJW A;  2B4D A;  2JEV A;  3MGD A;  3TO9 A;  1MJB A;  2B58 A;  5DWN A;  2B4D B;  3D3S A;  4XPL A;  1NSL A;  4HNW B;  4CRY B;  1QSR A;  4H6Z A;  2OZH A;  1Q2Y A;  5JQ4 A;  3LOD A;  3P2H A;  5HMN A;  2WPW A;  4KLV A;  3VWD A;  1KUX A;  4DNC A;  2AE6 A;  3TT2 A;  2QIR A;  3DR6 A;  1I21 A;  1QSO A;  3ZJ0 A;  4H6U A;  1NMT A;  4U9Z A;  4R3L A;  3TOB A;  3QAH A;  3BJ7 A;  4YRH A;  2ARH A;  2K5T A;  5IB0 A;  4AG7 A;  1IYL A;  4KOR A;  1IB1 E;  2P6E A;  3T90 A;  4MY3 A;  1NE9 A;  2HV2 A;  2WPX A;  4JXQ A;  1K4J A;  4KOX A;  5H84 A;  2REF A;  3R95 A;  2QML A;  1WK4 A;  1KUV A;  2OB0 A;  3I9S A;  1YLE A;  2JDC A;  3DSB A;  4Y49 B;  3BLN A;  2CNT A;  4CRZ B;  1BO4 A;  4KOT A;  4QBJ A;  2FE7 A;  2PC1 A;  1TIQ A;  4X5K A;  1LRZ A;  1BOB A;  1YVK A;  4RI1 A;  2ZPA A;  5F48 A;  3SHP A;  2GIV A;  3EXN A;  1B87 A;  1UFH A;  1QSM A;  2FL4 A;  4F6A A;  3FXT A;  1QSN A;  3P2F A;  3W91 A;  2A4N A;  4PV6 A;  1GHE A;  3D8P A;  2EUI A;  3S6H A;  1SQH A;  3FIX A;  2REE A;  2CNS A;  4ZBG A;  2VI7 A;  3S6G A;  2P0W A;  4UA3 A;  1V0C A;  1KUY A;  5J8C A;  1ON0 A;  2CNM A;  2C27 A;  1IIC A;  2R7H A;  1YR0 A;  3IWG A;  2VBQ A;  4JXR A;  4R9M A;  4KLW A;  3DR8 A;  2P6G A;  3S6K A;  2KCW A;  2OZU A;  4R3K A;  2FXF A;  5FVJ A;  4R87 A;  1YRE A;  3N7Z A;  4QB9 A;  3CXP A;  3V8I A;  4YFJ A;  1XIX A;  4MBU A;  4AVA A;  1IYK A;  2NMT A;  1J4J A;  4HNX B;  3TCV A;  2VQY A;  2QEC A;  1RXT A;  3TFY A;  1OZP A;  3VWE A;  1Y9K A;  3EFA A;  1Y7R A;  4XPK A;  1M4D A;  2Y0M A;  2OZG A;  2VXK A;  4PSW A;  4KOU A;  3H4Q A;  5DWM A;  3TO7 A;  2R8V A;  2B3U A;  1I12 A;  4IUS A;  2AJ6 A;  3BJ8 A;  4PK3 A;  5C82 A;  3B8G A;  3EC4 A;  4H89 A;  4B5P A;  4KUB A;  1Z9U A;  4MI4 A;  1R57 A;  1CM0 A;  2VEZ A;  5E96 A;  2G0B A;  1S7F A;  4R57 A;  2Q04 A;  4CAW A;  4KVO E;  4JD6 A;  3IGR A;  2D4P A;  2ZW7 A;  3TOA A;  3T9Y A;  5EBV A;  3R9F A;  4QUS A;  5H86 A;  4FD4 A;  5F46 A;  3E0K A;  2VZY A;  1XEB A;  4FD6 A;  1Z4R A;  4RS2 A;  3LD2 A;  2BL1 A;  1YVO A;  4OAD A;  3PP9 A;  5KTD A;  2FSR A;  2ZW5 A;  5C88 A;  5J8F A;  2R1I A;  1S7L A;  1YGH A;  3I3G A;  2F5I A;  2BEI A;  2PSW A;  2D4O A;  2ZXV A;  3R96 A;  5KTA A;  2BSW A;  2JDD A;  1B6B A;  1PUA A;  4KOV A;  2PR1 A;  4KVM E;  1M1D A;  1L0C A;  2PR8 A;  2DXQ A;  4KOS A;  4E8O A;  4UBR A;  4XPD B;  3D2P A;  4KOW A;  2Z10 A;  4M3S A;  2B4B A;  2J8M A;  3WR7 A;  4QVT A;  1Q2C A;  4M85 A;  1WWZ A;  1Y9W A;  1MJ9 A;  4AG9 A;  2J8N A;  2OH1 A;  2I00 A;  2J8R A;  2Q4V A;  2BUE A;  1IID A;  2Z11 A;  3PZJ A;  2R98 A;  4NEX A;  1VKC A;  2G3A A;  1Z4E A;  2H5M A;  4XPD C;  3C26 A;  1KZF A;  4YGO A;  3F8K A;  5F47 A;  1XMT A;  3GKR A;  3FNC A;  3FBU A;  2GAN A;  1RO5 A;  4KUA A;  1P4N A;  2VZZ A;  4Y49 C;  3CXQ A;  2G3T A;  2IL4 A;  3R9G A;  4AVC A;  4KZT A;  2OU2 A;  3EY5 A;  4FD5 A;  3TO6 A; 
#chains in the Genus database with same CATH topology
 3I1U A;  2ATR A;  2ZEH A;  4MHD A;  3FYN A;  2HUZ A;  4B14 A;  1YLO A;  4FWU A;  4X3R A;  1MK4 A;  1LAN A;  1YSJ A;  3EO4 A;  5CPA A;  4UIB A;  4EME A;  2PJ1 A;  4B5O A;  3S9M A;  1ZG9 A;  2V8D A;  4HNY B;  2FIW A;  2NYQ A;  3RZA A;  2AFM A;  4AVB A;  4OAE A;  4QC6 A;  1U6M A;  1VHE A;  1IOI A;  2B5G A;  1FNO A;  3R9E A;  1QQ9 A;  4AB7 A;  3JRU A;  4LX9 A;  4GS4 A;  4UF4 A;  2Q44 A;  5HH1 A;  1VHS A;  3KKW A;  5F49 A;  1ZG7 A;  4PK2 A;  3TTH A;  3IWE A;  1QST A;  2CF4 A;  4MFZ A;  1P0H A;  3ISZ A;  4MCS A;  3FRM A;  4UFW A;  4C7H A;  2JLM A;  1F2O A;  3D66 A;  4XNH C;  3UY5 A;  1XF8 A;  3G3S A;  3V7Z A;  2PIY A;  2PJ6 A;  4I49 A;  4P6Y A;  1UWY A;  2PJ3 A;  3W6X A;  4CAV A;  1Z8X A;  3D67 A;  2B3V A;  3G8W A;  3KQZ A;  2AFZ A;  4CAX A;  4CYN A;  1Q2D A;  2P6F A;  3JVN A;  4MXU A;  3WC5 A;  2CIJ A;  4ONU A;  1XE4 A;  2EBJ A;  1ZG8 A;  3OWC A;  1MJA A;  1PYT B;  4KSA A;  4UWI A;  1FT7 A;  3TE4 A;  4MY0 A;  4A31 A;  4F9V A;  3B2Y A;  5IX3 A;  4JWP A;  2CY2 A;  4GXH A;  5K8P A;  1YX0 A;  3WAB A;  1ZLH A;  2EVN A;  3D2M A;  1YK3 A;  2FIA A;  3SXO A;  1FY7 A;  4A39 A;  4IF5 A;  3SJF A;  7CPA A;  3DDD A;  4NF1 A;  3K9U A;  1Z8T A;  4II9 A;  1Z8L A;  3DNS A;  3KGQ A;  2RC4 A;  3KHZ A;  4PXC A;  5LYL A;  3CXS A;  1S7K A;  3RYO A;  2GFQ A;  2ZEM A;  4KVX A;  3F5B A;  2PJ7 A;  1CP7 A;  4XNH B;  2Z3M A;  4NCZ A;  5G1Z A;  3SXN A;  5I0C A;  5EC4 A;  5KTC A;  4HPS A;  2FT0 A;  1M4I A;  2ZEO A;  2CTC A;  3GY9 A;  3SI0 A;  3CZX A;  4EFD A;  1S7N A;  1M44 A;  3NE7 A;  3FB3 A;  4JLY A;  4OID A;  5IV0 A;  2EK9 A;  2POK A;  3KR5 A;  2AFX A;  2X7B A;  2DPT A;  4B11 A;  2ZEL A;  4IK2 A;  4CAF A;  3WT4 A;  3T8W A;  1N71 A;  4P44 A;  3B7I A;  4U9Y A;  4OC4 A;  3VAT A;  4A33 A;  2O4H A;  4OC0 A;  4ZX8 A;  2PRB A;  5THW A;  5I4M A;  4M6I A;  3PGP A;  2ZW6 A;  3ZZI A;  4O23 A;  3VH9 A;  3BXM A;  4UWJ A;  2QJ8 A;  4NSQ A;  1EE3 P;  4DYO A;  1KWM A;  4LUA A;  2V8V A;  4A95 A;  5JM6 A;  1YME A;  3QB8 A;  3B3C A;  2GU2 A;  4B5P B;  4DJL A;  2BCO A;  5GCN A;  5CNP A;  2PJB A;  2PRQ A;  4E2A A;  4MHN A;  2Q43 A;  4FD7 A;  4NFR A;  4L89 A;  1CPX A;  2Z3K A;  2FS5 A;  4E0A A;  2I79 A;  1LCP A;  4HKF A;  2GE3 A;  3S6F A;  1PU9 A;  2O28 A;  2ZW4 A;  1GYT A;  4KSI A;  2PDO A;  2ZEP A;  3NH4 A;  4GM5 A;  2B5G B;  2YNC A;  3GYA A;  3JUW A;  2ZEN A;  4NXY A;  5ELY A;  1M4G A;  5JPH A;  4NGT A;  2PJ4 A;  2RB7 A;  4MJ8 A;  1VHO A;  1TXR A;  2C6G A;  5G20 A;  3PBE A;  4NJQ A;  2Q7S A;  4PXE A;  4L8A A;  4Q38 A;  4BMH A;  4PSX A;  4F0Y A;  3CPX A;  3FEE A;  4NJR A;  3RAM A;  4FUU A;  4CS0 B;  3FF3 A;  4YU9 A;  2Q4Y A;  4JJX A;  3A9L A;  1S60 A;  2ANP A;  2Z0Z A;  3W6S A;  4U5Y A;  2JEW A;  1I1D A;  2Q0Y A;  1YW6 A;  5LYF A;  4OLL A;  1S5K A;  5ISV A;  3R1K A;  6CPA A;  1XMB A;  2GLJ A;  4FAI A;  2ZEG A;  1S3Z A;  3PB6 X;  2FCK A;  2PQ8 A;  1HEE A;  4CYQ A;  4CAE A;  3BI1 A;  1ARM A;  4J3G A;  3F0A A;  4K30 A;  4KOY A;  2JBK A;  4ORF A;  2Q7B A;  4C2Y A;  1R43 A;  3QAY A;  4ZYQ A;  2HQY A;  2WZN A;  4LQG A;  1CJW A;  4EVY A;  2B4D A;  2JEV A;  3MGD A;  4NGM A;  3RNZ A;  3TO9 A;  1TF8 A;  1MJB A;  4OC3 A;  2B58 A;  4P4E A;  5DWN A;  4B13 A;  2B4D B;  2J9A A;  3D3S A;  4P45 A;  4XPL A;  4HNW B;  1NSL A;  3WC6 A;  4B10 A;  4W9Y A;  5G22 A;  3S9N A;  1M4L A;  4CRY B;  1QSR A;  3IU1 A;  3SJE A;  3KR4 A;  3PBB A;  3HUV A;  2G9D A;  4A30 A;  4H6Z A;  4CYO A;  2BOA A;  2OZH A;  3B3S A;  4H2K A;  5HVH A;  2AFO A;  2FVG A;  4UEE A;  2WSA A;  1Q2Y A;  5EMI A;  3GB0 A;  5JQ4 A;  2EWB A;  3PB8 X;  3LOD A;  3P2H A;  5HMN A;  4DUK A;  1CX8 A;  2WPW A;  4CPA A;  4ZX9 A;  4KLV A;  2PJ9 A;  2XEF A;  1KUX A;  3VWD A;  4C68 A;  3KAS A;  4MRI A;  3B3W A;  4DNC A;  2AE6 A;  3TT2 A;  4UIA A;  2WYR A;  2F7V A;  4ONW A;  2QIR A;  3DR6 A;  1I21 A;  4K3N A;  3KHX A;  2VL1 A;  1QSO A;  4LQ6 A;  2WUU A;  3ZJ0 A;  3NFZ A;  4OIW A;  4R7M A;  1IY7 A;  4H6U A;  1LAP A;  2HB6 A;  4MFQ A;  5DS0 A;  1BPN A;  1NMT A;  4U9Z A;  2C6P A;  3FMC A;  4MCP A;  4R3L A;  1F2P A;  3MN8 A;  2AFU A;  2AFS A;  3BJ7 A;  3QAH A;  5AG5 A;  3TOB A;  4YRH A;  1HDU A;  2ARH A;  2K5T A;  2ZOG A;  5IB0 A;  1Y7E A;  1QMU A;  3FED A;  4OC1 A;  4A37 A;  4AG7 A;  1IYL A;  1HDQ A;  4KOR A;  4C2X A;  2Z3O A;  4ZY2 A;  1IGB A;  5K8O A;  1IB1 E;  2P6E A;  3T90 A;  4MY3 A;  1NE9 A;  5BWA B;  2HV2 A;  2WPX A;  2Z3P A;  3D7D A;  4JXQ A;  1K4J A;  4OC2 A;  3TX8 A;  3PB9 X;  2PJA A;  2XEJ A;  4KOX A;  4RN7 A;  5H84 A;  4MFK A;  2REF A;  3R95 A;  2QML A;  3RBU A;  5J1Q A;  1WK4 A;  2GLF A;  1KUV A;  2OB0 A;  3I9S A;  4JYW A;  1YLE A;  3TC8 A;  2JDC A;  1CP6 A;  3DSB A;  4Y49 B;  3BLN A;  1DE4 C;  2CNT A;  5AG7 A;  3SJX A;  3LWU A;  4CRZ B;  1BO4 A;  4KOT A;  4R8F A;  4QBJ A;  2JBJ A;  3D68 A;  2QYV A;  2FE7 A;  2PC1 A;  1LFW A;  1RTQ A;  1TIQ A;  3GUX A;  2GRE A;  4MFJ A;  4X5K A;  4B6Z A;  1LRZ A;  2ZOF A;  2AFW A;  1ARL A;  1YVK A;  1BOB A;  5A27 A;  4RI1 A;  2ZPA A;  3H8G A;  4A94 A;  3PEI A;  5F48 A;  1YQE A;  5D29 A;  3JTK A;  4NGP A;  3SHP A;  2GIV A;  3KQX A;  3EXN A;  5JH9 A;  3MRU A;  1B87 A;  1UFH A;  1QSM A;  2FL4 A;  4F6A A;  3FXT A;  3LMS A;  1AMP A;  2Q4Z A;  3CT9 A;  1QSN A;  3DGV A;  3WC7 A;  2ABZ A;  8CPA A;  3P2F A;  3SI1 A;  3W91 A;  5G21 A;  2A4N A;  4G1P A;  4PV6 A;  1GHE A;  3D8P A;  2EUI A;  3CPA A;  1Y0Y A;  3K2K A;  3S6H A;  4CGN A;  1JWQ A;  5D8N A;  1SQH A;  3FIX A;  2REE A;  4PXB A;  1AYE A;  2CNS A;  4ZBG A;  5F09 A;  4X8I A;  2VI7 A;  3S6G A;  2OOT A;  2P0W A;  4UA3 A;  1V0C A;  2PJ5 A;  1KUY A;  2EO8 A;  5J8C A;  5A28 A;  4X2T A;  4B12 A;  2PIZ A;  1ON0 A;  2CNM A;  2YND A;  5AGE A;  2C27 A;  4A2Z A;  4MCQ A;  1IIC A;  2R7H A;  3PB7 X;  1YR0 A;  2I3C A;  2YNE A;  3IWG A;  2VBQ A;  4JXR A;  4R9M A;  4KLW A;  3DR8 A;  2P6G A;  5K8N A;  2DF5 A;  1XJO A;  1ELM P;  3BI0 A;  3S6K A;  4CGO A;  2KCW A;  2OZU A;  4UEF A;  2PJ0 A;  4R3K A;  1ZO0 A;  1X10 A;  1Z5R A;  2FXF A;  3SI2 A;  5AG4 A;  1BAV A;  5FVJ A;  5HXD A;  1ZLI A;  4CGL A;  4A38 A;  5CBM A;  4R87 A;  1YRE A;  3N7Z A;  4QB9 A;  3CXP A;  4UFX A;  4WWV A;  4Q36 A;  3V8I A;  1XIX A;  3KI9 A;  4YFJ A;  3N5F A;  1OBR A;  4MBU A;  4OKO A;  1IYK A;  4AVA A;  4BBH A;  3CDX A;  2IQ6 A;  3IEH A;  2NMT A;  1J4J A;  3NA6 A;  2HC9 A;  4HNX B;  1XBU A;  1Z2L A;  3TCV A;  3D7F A;  2VQY A;  2ZED A;  2QEC A;  1PCA A;  1RXT A;  2IMO A;  3TFY A;  3PFE A;  3FVL A;  1OZP A;  2O53 A;  3D7G A;  3VWE A;  1Y9K A;  2F8H A;  3SJG A;  3EFA A;  4P4B A;  5JGF A;  4Q7A A;  2PJ8 A;  1Y7R A;  3D7H A;  4MMO A;  4P4J A;  4NGR A;  4PXD A;  1M4D A;  4MFL A;  4R6T A;  4XPK A;  5LYD A;  2V77 A;  2Y0M A;  2CXA A;  4IHM A;  2OZG A;  4BIN A;  1Y0R A;  2IJZ A;  2YNC C;  4F0X A;  2DEA A;  1BLL E;  4PQA A;  2BO9 A;  2VXK A;  3H5Z A;  2ODF A;  2CTB A;  3H4Q A;  4KOU A;  4PSW A;  3RO0 A;  4ZGY B;  2PVV A;  2RFH A;  3FX6 A;  5DWM A;  3PRT A;  1TKF A;  3PB4 X;  1TKJ A;  4YWY A;  1Q7L A;  4F8Z A;  1VIX A;  1ELL P;  4ZY0 A;  3TO7 A;  1LAM A;  2B3U A;  1I12 A;  2R8V A;  4IUS A;  2AJ6 A;  3BJ8 A;  4UCP A;  4PK3 A;  3B3V A;  3IFE A;  5C82 A;  3D4U A;  4NGN A;  3B8G A;  3FH4 A;  3EC4 A;  4H89 A;  4MHP A;  4B5P A;  1DTD A;  1A2Z A;  4KUB A;  1Z9U A;  3FEC A;  4MI4 A;  3HLP A;  1R57 A;  1CM0 A;  1XOV A;  3VAR A;  3S9L A;  2VEZ A;  1JQG A;  5E96 A;  4TWE A;  1TF9 A;  5LRG A;  4CYP A;  2G0B A;  1S7F A;  3IU2 A;  1IOF A;  1XRY A;  2Q04 A;  4R57 A;  4CAW A;  4KVO E;  4JD6 A;  4CGM A;  2ZEF A;  3IGR A;  3NH5 A;  2D4P A;  2ZW7 A;  3NE8 A;  4MHY A;  4KSF A;  5EBV A;  3R9F A;  3T9Y A;  4KS9 A;  4QUS A;  3TOA A;  2XEG A;  5LYI A;  4BD9 A;  3IC1 A;  5K8M A;  4EWT A;  3NH8 A;  5H86 A;  4FD4 A;  5F46 A;  3E0K A;  2VZY A;  3B3T A;  4JZ0 A;  1XEB A;  4FD6 A;  1Z4R A;  3PFO A;  4UFV A;  4RS2 A;  3LD2 A;  4UCM A;  2BL1 A;  1YVO A;  4OAD A;  4M6G A;  4RUH A;  2V8G A;  3PP9 A;  4ZY1 A;  5KTD A;  2FSR A;  2ZW5 A;  5C88 A;  5HVF A;  1H8L A;  5J8F A;  2R1I A;  1S7L A;  1YGH A;  4MCR A;  3I3G A;  2EK8 A;  2F5I A;  2BEI A;  3L2N A;  2PSW A;  4MFP A;  1YW4 A;  1Z8W A;  2D4O A;  2C6C A;  2ZXV A;  3GLJ A;  4MHZ A;  4NGS A;  4Z65 A;  3R96 A;  5KTA A;  4P4D A;  4CGP A;  2BSW A;  2JDD A;  1B6B A;  1PUA A;  4A32 A;  2V8H A;  1VGY A;  3KL9 A;  4KOV A;  4P4F A;  2PR1 A;  4KVM E;  1M1D A;  3ISX A;  1L0C A;  2PR8 A;  5HVG A;  3BHX A;  2DXQ A;  4KOS A;  2OR4 A;  4E8O A;  4UBR A;  4XPD B;  4NGQ A;  3B35 A;  4OP4 A;  3D2P A;  4KOW A;  4PPZ A;  2Z10 A;  1NSA A;  4M3S A;  4OC5 A;  4UCN A;  2B4B A;  2J8M A;  3WR7 A;  4QVT A;  1Q2C A;  1TKH A;  1BPM A;  3KZW A;  3V38 A;  1AUG A;  4M85 A;  1WWZ A;  1Y9W A;  2PCU A;  3FJU A;  1CBX A;  5IB9 A;  1MJ9 A;  2PJ2 A;  4ZI6 A;  4AG9 A;  4C2Z A;  2Q51 A;  4R76 A;  2J8N A;  2OH1 A;  2PJC A;  3LAC A;  2I00 A;  4AXV A;  5AG6 A;  4UEZ A;  2J8R A;  2YGW A;  4WJB A;  2XEI A;  2Z3N A;  2Q4V A;  5LRJ A;  2BUE A;  3IIB A;  3IWW A;  1IID A;  2Z11 A;  3PZJ A;  5LRK A;  1CG2 A;  2R98 A;  4NEX A;  1VKC A;  2G3A A;  2ZEE A;  1X12 A;  1Z4E A;  2H5M A;  4XPD C;  3C26 A;  1KZF A;  3DLJ A;  3F8K A;  4M6H A;  4YGO A;  2QVP A;  5F47 A;  1XMT A;  3GKR A;  2C1C A;  3H8E A;  2PVW A;  4C7I A;  2DPS A;  1R3N A;  2GAN A;  3FBU A;  3FNC A;  4OME A;  1LOK A;  3QNV A;  4P4I A;  1RO5 A;  4KUA A;  2NSM A;  1P4N A;  2VZZ A;  4Y49 C;  4FBE A;  1IU8 A;  3K9T A;  3CXQ A;  3IO1 A;  2G3T A;  4TNU A;  3IJ3 A;  2IL4 A;  3H8F A;  1F57 A;  4IAV A;  3R9G A;  4AVC A;  4KZT A;  4F9U A;  2OU2 A;  3EY5 A;  4P10 A;  1CPS A;  1XFO A;  4FD5 A;  2PE3 A;  3GIU A;  3TO6 A;  2Z3L A; 
#chains in the Genus database with same CATH homology
 2ATR A;  4MHD A;  3FYN A;  2HUZ A;  4B14 A;  1MK4 A;  3EO4 A;  4B5O A;  4HNY B;  2FIW A;  4AVB A;  4OAE A;  4QC6 A;  1U6M A;  2B5G A;  3R9E A;  4AB7 A;  4LX9 A;  4GS4 A;  2Q44 A;  5HH1 A;  1VHS A;  3KKW A;  5F49 A;  4PK2 A;  3TTH A;  3IWE A;  1QST A;  4MFZ A;  1P0H A;  3FRM A;  4UFW A;  4C7H A;  2JLM A;  3UY5 A;  4XNH C;  1XF8 A;  3G3S A;  3W6X A;  4I49 A;  4CAV A;  5IX3 A;  2B3V A;  3G8W A;  4CAX A;  4CYN A;  1Q2D A;  2P6F A;  3JVN A;  4ONU A;  1XE4 A;  4KSA A;  4UWI A;  3OWC A;  1MJA A;  3TE4 A;  4MY0 A;  4A31 A;  4JWP A;  2CY2 A;  1YX0 A;  2EVN A;  3D2M A;  1YK3 A;  2FIA A;  3SXO A;  1FY7 A;  4IF5 A;  3DDD A;  4NF1 A;  3K9U A;  4II9 A;  3DNS A;  2RC4 A;  3CXS A;  1S7K A;  3RYO A;  4KVX A;  3F5B A;  4XNH B;  2Z3M A;  4NCZ A;  5G1Z A;  3SXN A;  5I0C A;  5EC4 A;  5KTC A;  2FT0 A;  1M4I A;  3GY9 A;  1S7N A;  1M44 A;  3NE7 A;  3FB3 A;  4JLY A;  5IV0 A;  4B11 A;  2X7B A;  2DPT A;  4CAF A;  1N71 A;  4U9Y A;  4A33 A;  2PRB A;  3PGP A;  2ZW6 A;  3ZZI A;  4UWJ A;  4NSQ A;  4LUA A;  4A95 A;  3QB8 A;  4B5P B;  5GCN A;  5CNP A;  4E2A A;  4FD7 A;  4L89 A;  2Z3K A;  2FS5 A;  4E0A A;  2I79 A;  4HKF A;  2GE3 A;  3S6F A;  1PU9 A;  2O28 A;  2ZW4 A;  2PDO A;  2B5G B;  2YNC A;  3GYA A;  3JUW A;  4NXY A;  1M4G A;  5JPH A;  4MJ8 A;  5G20 A;  4L8A A;  4Q38 A;  4BMH A;  4PSX A;  4F0Y A;  4CS0 B;  2Q4Y A;  4JJX A;  3A9L A;  1S60 A;  3W6S A;  2Z0Z A;  4U5Y A;  1I1D A;  2Q0Y A;  4OLL A;  1S5K A;  5ISV A;  3R1K A;  1S3Z A;  2FCK A;  2PQ8 A;  4CYQ A;  4CAE A;  4J3G A;  3F0A A;  4K30 A;  4KOY A;  4ORF A;  2Q7B A;  4C2Y A;  2HQY A;  4EVY A;  1CJW A;  2B4D A;  2JEV A;  3MGD A;  3TO9 A;  1MJB A;  2B58 A;  5DWN A;  4B13 A;  2B4D B;  3D3S A;  4XPL A;  1NSL A;  4HNW B;  4B10 A;  5G22 A;  4CRY B;  1QSR A;  3IU1 A;  4A30 A;  4H6Z A;  4CYO A;  2OZH A;  2WSA A;  1Q2Y A;  5JQ4 A;  3LOD A;  3P2H A;  5HMN A;  2WPW A;  4KLV A;  3VWD A;  1KUX A;  4C68 A;  4DNC A;  2AE6 A;  3TT2 A;  2QIR A;  3DR6 A;  1I21 A;  1QSO A;  2WUU A;  3ZJ0 A;  4H6U A;  4MFQ A;  1NMT A;  4U9Z A;  4R3L A;  3TOB A;  3QAH A;  3BJ7 A;  5AG5 A;  4YRH A;  2ARH A;  2K5T A;  5IB0 A;  4AG7 A;  1IYL A;  4KOR A;  4C2X A;  2Z3O A;  1IB1 E;  2P6E A;  3T90 A;  4MY3 A;  1NE9 A;  5BWA B;  2HV2 A;  2WPX A;  2Z3P A;  4JXQ A;  1K4J A;  4KOX A;  5H84 A;  4MFK A;  2REF A;  3R95 A;  2QML A;  1WK4 A;  1KUV A;  2OB0 A;  3I9S A;  1YLE A;  2JDC A;  3DSB A;  4Y49 B;  3BLN A;  2CNT A;  5AG7 A;  4CRZ B;  1BO4 A;  4KOT A;  4QBJ A;  2FE7 A;  2PC1 A;  4MFJ A;  1TIQ A;  4X5K A;  1LRZ A;  1BOB A;  1YVK A;  5A27 A;  4RI1 A;  2ZPA A;  5F48 A;  3JTK A;  3SHP A;  2GIV A;  3EXN A;  1B87 A;  1UFH A;  1QSM A;  2FL4 A;  4F6A A;  3FXT A;  1QSN A;  3P2F A;  3W91 A;  5G21 A;  2A4N A;  4PV6 A;  1GHE A;  3D8P A;  2EUI A;  3S6H A;  4CGN A;  1SQH A;  3FIX A;  2REE A;  2CNS A;  4ZBG A;  2VI7 A;  3S6G A;  2P0W A;  4UA3 A;  1V0C A;  1KUY A;  5J8C A;  5A28 A;  4B12 A;  1ON0 A;  2CNM A;  2YND A;  5AGE A;  2C27 A;  4A2Z A;  1IIC A;  2R7H A;  1YR0 A;  2YNE A;  3IWG A;  2VBQ A;  4JXR A;  4R9M A;  4KLW A;  3DR8 A;  2P6G A;  4CGO A;  3S6K A;  2KCW A;  2OZU A;  4R3K A;  1ZO0 A;  5AG4 A;  2FXF A;  5FVJ A;  4CGL A;  4R87 A;  1YRE A;  3N7Z A;  4QB9 A;  3CXP A;  4UFX A;  3V8I A;  4Q36 A;  4YFJ A;  1XIX A;  4MBU A;  4AVA A;  1IYK A;  4BBH A;  2NMT A;  1J4J A;  4HNX B;  3TCV A;  2VQY A;  2QEC A;  1RXT A;  3TFY A;  1OZP A;  3VWE A;  1Y9K A;  3EFA A;  1Y7R A;  4XPK A;  1M4D A;  4MFL A;  2Y0M A;  2CXA A;  2OZG A;  2YNC C;  4F0X A;  2VXK A;  3H5Z A;  4KOU A;  4PSW A;  3H4Q A;  4ZGY B;  5DWM A;  3TO7 A;  2R8V A;  2B3U A;  1I12 A;  4IUS A;  2AJ6 A;  3BJ8 A;  4UCP A;  4PK3 A;  5C82 A;  3B8G A;  3EC4 A;  4H89 A;  4B5P A;  4KUB A;  1Z9U A;  4MI4 A;  1R57 A;  1CM0 A;  2VEZ A;  4CYP A;  5E96 A;  2G0B A;  1S7F A;  3IU2 A;  4R57 A;  2Q04 A;  4CAW A;  4KVO E;  4JD6 A;  4CGM A;  3IGR A;  2D4P A;  2ZW7 A;  3TOA A;  4KSF A;  5EBV A;  3R9F A;  3T9Y A;  4KS9 A;  4QUS A;  5H86 A;  4FD4 A;  5F46 A;  3E0K A;  2VZY A;  1XEB A;  4FD6 A;  1Z4R A;  4UFV A;  4RS2 A;  3LD2 A;  4UCM A;  2BL1 A;  1YVO A;  4OAD A;  3PP9 A;  5KTD A;  2FSR A;  2ZW5 A;  5C88 A;  5J8F A;  2R1I A;  1S7L A;  1YGH A;  3I3G A;  2F5I A;  2BEI A;  2PSW A;  4MFP A;  2D4O A;  2ZXV A;  3R96 A;  5KTA A;  4CGP A;  2BSW A;  2JDD A;  1B6B A;  1PUA A;  4A32 A;  4KOV A;  2PR1 A;  4KVM E;  1M1D A;  1L0C A;  2PR8 A;  2DXQ A;  4KOS A;  4E8O A;  4UBR A;  4XPD B;  3D2P A;  4KOW A;  2Z10 A;  4M3S A;  4UCN A;  2B4B A;  2J8M A;  3WR7 A;  4QVT A;  1Q2C A;  4M85 A;  1WWZ A;  1Y9W A;  1MJ9 A;  4AG9 A;  4C2Z A;  2J8N A;  2OH1 A;  2I00 A;  5AG6 A;  2J8R A;  2YGW A;  2Z3N A;  2Q4V A;  2BUE A;  1IID A;  2Z11 A;  3PZJ A;  2R98 A;  4NEX A;  1VKC A;  2G3A A;  1Z4E A;  2H5M A;  4XPD C;  3C26 A;  1KZF A;  4YGO A;  3F8K A;  5F47 A;  1XMT A;  3GKR A;  4C7I A;  2DPS A;  3FBU A;  2GAN A;  3FNC A;  1RO5 A;  4KUA A;  1P4N A;  2VZZ A;  4Y49 C;  3CXQ A;  2G3T A;  2IL4 A;  3R9G A;  4AVC A;  4KZT A;  2OU2 A;  3EY5 A;  4FD5 A;  3TO6 A;  2Z3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...