3W6SA

Yeast n-acetyltransferase mpr1 involved in oxidative stress tolerance via proline metabolism
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
225
structure length
225
Chain Sequence
SIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAFPVFDTKYIPDSLINYLFKLFNLEIESGKTYPQLHSLTKQGFLNYWFHSFAVVVLQTDEKFIQDNQDWNSVLLGTFYIKPNYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPLLGYKYSIFNLVFVTNQASWKIWDKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIEPEFLSME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPR1 protein
publication title Structural and functional analysis of the yeast N-acetyltransferase Mpr1 involved in oxidative stress tolerance via proline metabolism
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 59
structure length 225
sequence length 225
chains with identical sequence B, C
ec nomenclature ec 2.3.1.271: L-glutamate-5-semialdehyde N-acetyltransferase.
pdb deposition date 2013-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3w6sA00
5F47A 4KLWA 1MJBA 1YVKA 2B4DA 5DWNA 1YK3A 2Z11A 1PUAA 2JDDA 2Q4VA 5C82A 2BEIA 1ON0A 1B87A 3SXOA 5KTCA 3TE4A 3EFAA 1QSOA 1CM0A 1SQHA 4KVME 2Z10A 4KLVA 2ZW7A 4KOXA 5IX3A 2VEZA 2R7HA 4Y49C 4XPDC 4PSXA 1QSMA 1KUVA 4EVYA 2B5GB 1QSTA 4HKFA 3ZJ0A 5GCNA 1KZFA 5I0CA 2X7BA 3H4QA 3EY5A 4AG7A 4CS0B 2GANA 2C27A 4BMHA 4KVXA 2FSRA 4JWPA 4NF1A 2FS5A 1S7LA 3K9UA 1PU9A 1P0HA 2A4NA 3R9FA 1GHEA 5HH1A 3S6HA 2PDOA 1MJAA 2B4BA 2OU2A 1BOBA 4HNYB 4KOUA 3G3SA 2KCWA 4FD4A 4DNCA 4F6AA 5IB0A 2Y0MA 4MY0A 5FVJA 1S7NA 3S6GA 3WR7A 2GIVA 3TO7A 2BL1A 2CNSA 4XNHB 3PGPA 2Q4YA 1U6MA 4UWIA 5EC4A 2QMLA 2J8NA 2JEVA 1BO4A 4KOYA 1YX0A 1CJWA 4E0AA 4YGOA 1MJ9A 2VZYA 2B3VA 4U9ZA 3E0KA 1S7FA 2FE7A 3FRMA 3EXNA 4NEXA 4R9MA 4OLLA 5ISVA 2JLMA 4AVAA 4KZTA 3TTHA 3RYOA 3ZZIA 2OZHA 1MK4A 3FIXA 4PK2A 3FXTA 2Z0ZA 1XIXA 4LX9A 4HNXB 3DDDA 4CAVA 3PP9A 3S6FA 4M85A 3GY9A 4FD7A 4JLYA 1Q2DA 1Z9UA 1YREA 4I49A 2ATRA 4KOSA 2B5GA 3R96A 3S6KA 1IIDA 2HV2A 4KUAA 4UWJA 3FB3A 4QC6A 1Z4EA 4YFJA 4H6ZA 4GS4A 2HQYA 1TIQA 4CRYB 4OADA 2I00A 1QSRA 2ARHA 4MI4A 3UY5A 2Q44A 3TOBA 4NXYA 3FNCA 2FIWA 5HMNA 1S3ZA 1VHSA 4MHDA 4J3GA 2Q7BA 3GKRA 3TO9A 1M4GA 3JVNA 1YLEA 4Y49B 4XPDB 4FD6A 2WPWA 1YVOA 3TOAA 4NCZA 1NMTA 1YR0A 2PSWA 2OH1A 2K5TA 4AG9A 2B4DB 1Y9WA 4R57A 1Y7RA 2R8VA 2EUIA 3OWCA 2ZW4A 2G3TA 3EC4A 2DXQA 1NE9A 4B5OA 4MBUA 2WPXA 4U5YA 1IYKA 4KUBA 3B8GA 3W6XA 2PC1A 2REEA 2PR8A 1IICA 4B5PB 4R3KA 2BSWA 3IGRA 4CRZB 1XMTA 4KOTA 3I9SA 2B3UA 3BJ8A 2Q0YA 2CNTA 4U9YA 3TO6A 3NE7A 4JXRA 2ZW6A 1KUYA 1N71A 4IF5A 5DWMA 2ZW5A 2ZXVA 1P4NA 4XNHC 4MJ8A 1S60A 2I79A 3QB8A 1Y9KA 2VZZA 4KOVA 2G3AA 2CNMA 4QUSA 3CXQA 1M4IA 4AVCA 1Q2YA 3TFYA 1IYLA 3QAHA 4L89A 4X5KA 2FCKA 3DSBA 3P2HA 3D8PA 4AVBA 3R9EA 2OZGA 1XF8A 3V8IA 4F0YA 4ORFA 3FYNA 5J8FA 1XE4A 5CNPA 4II9A 1UFHA 2PR1A 5F48A 5F46A 2FXFA 3IWGA 4PV6A 4PSWA 2P6EA 2PQ8A 2FIAA 1I12A 3LODA 3CXSA 3T90A 2O28A 4UA3A 4RS2A 1QSNA 3DNSA 4ONUA 2QIRA 2F5IA 1M1DA 3F8KA 2RC4A 5H86A 1YGHA 4KOWA 2EVNA 2R98A 3D2MA 2AJ6A 4RI1A 3SXNA 5IV0A 3VWEA 4UBRA 2H5MA 3BLNA 1FY7A 2REFA 4QBJA 3KKWA 4R3LA 3BJ7A 3W6SA 1S5KA 5EBVA 3PZJA 2ZPAA 4H6UA 4JD6A 1WK4A 2G0BA 4H89A 3I3GA 2VBQA 3C26A 1NSLA 2OZUA 3W91A 5JQ4A 5KTDA 4QB9A 3EO4A 3VWDA 2IL4A 4B5PA 4XPLA 3F0AA 2J8RA 4FD5A 1S7KA 2VI7A 4OAEA 3DR6A 4XPKA 2P0WA 4L8AA 5J8CA 3TT2A 5H84A 4YRHA 1R57A 1XEBA 2QECA 1M4DA 2OB0A 4CAXA 1IB1E 4M3SA 4E2AA 5E96A 3MGDA 5C88A 3D2PA 2P6GA 3LD2A 1RXTA 4R87A 5KTAA 3N7ZA 4PK3A 2Q04A 2BUEA 2R1IA 3DR8A 2JDCA 1Q2CA 3GYAA 1K4JA 1J4JA 3JUWA 2VXKA 3R95A 4K30A 2D4PA 5F49A 1WWZA 4KORA 3T9YA 2D4OA 1B6BA 3R1KA 4ZBGA 3R9GA 4JXQA 3FBUA 4MY3A 1LRZA 2PRBA 3G8WA 4E8OA 3SHPA 3TCVA 1I1DA 2J8MA 1M44A 2VQYA 2B58A 4KVOE 4LUAA 3D3SA 2FL4A 4AB7A 3P2FA 3CXPA 4CAWA 1I21A 1OZPA 1VKCA 4QVTA 4JJXA 4NSQA 2CY2A 2P6FA 1RO5A 4IUSA 5JPHA 2AE6A 1Z4RA 2NMTA 3F5BA 2FT0A 1KUXA 1V0CA 1L0CA 4HNWB 2HUZA 2GE3A
chains in the Genus database with same CATH superfamily
1ZLIA 1Z8TA 3FX6A 1KWMA 4OKOA 5F47A 4ZX8A 3IWEA 4CGMA 4KLWA 2CIJA 3S9NA 3KHXA 1MJBA 1FNOA 1YVKA 4B6ZA 2JBJA 2YGWA 3IEHA 3PFEA 2B4DA 4TWEA 5DWNA 2Q51A 1YK3A 2ZEPA 2Z11A 1Z8WA 1PUAA 2JDDA 2AFUA 2Q4VA 4ZGYB 5HXDA 4KSAA 2EK8A 5C82A 2BEIA 1ON0A 1IOFA 1B87A 3SXOA 5KTCA 3TE4A 4P4EA 2CTCA 3EFAA 1H8LA 1QSOA 4Q7AA 2XEIA 1CM0A 3FH4A 1SQHA 2PJ8A 4NFRA 4KVME 2Z10A 3SI2A 4KLVA 2DPSA 2PIZA 2ZW7A 1Z2LA 4C68A 4EMEA 5AG6A 4KOXA 4P44A 5IX3A 4NGNA 2VEZA 4F8ZA 3S9LA 2R7HA 4DUKA 4Y49C 4XPDC 2ZELA 1LOKA 1QSMA 4PSXA 4RN7A 1KUVA 2WZNA 2AFZA 4EVYA 2B5GB 2Z3PA 4P4IA 4NGPA 3VH9A 4MFQA 4PXDA 1QSTA 4HKFA 4IK2A 4ZY0A 3ZJ0A 5GCNA 1KZFA 5I0CA 1CX8A 3GB0A 3PB6X 2X7BA 3H4QA 2WUUA 4FWUA 3EY5A 3H8FA 2ZOGA 3N5FA 4AG7A 2V8GA 3JRUA 1X10A 3PB9X 2GANA 2C27A 3RZAA 4CS0B 2O4HA 4MCPA 4UCPA 4KVXA 2FVGA 4BMHA 2FSRA 3WC6A 1PCAA 4M6HA 5AG5A 4A39A 4JWPA 4PXEA 4NF1A 3JTKA 2FS5A 1S7LA 4MCSA 3K9UA 3B3VA 1PU9A 4CYQA 1P0HA 2A4NA 2QVPA 3CPXA 3R9FA 4CYPA 1TF8A 2AFXA 1F2PA 1GHEA 1CPSA 3IC1A 5HH1A 3S6HA 3KL9A 2PDOA 1MJAA 5CBMA 2B4BA 2ZEOA 3B2YA 2OU2A 1BOBA 4HNYB 4KOUA 3FMCA 2KCWA 3G3SA 4FD4A 4DNCA 4F6AA 5IB0A 3IO1A 2Y0MA 2DF5A 4P45A 4MHPA 4MY0A 2HB6A 5FVJA 4CAEA 2PJ7A 1S7NA 4FBEA 1ARMA 3MRUA 3S6GA 3WR7A 2GIVA 3TO7A 2WSAA 3CT9A 5BWAB 3B3TA 4EWTA 2BL1A 2CNSA 2C6PA 4XNHB 3PGPA 2Q4YA 2PIYA 5EMIA 4CYOA 1U6MA 4UWIA 1YLOA 2O53A 3PB7X 2QMLA 5EC4A 2J8NA 2JEVA 3NH8A 3KZWA 1BO4A 1YX0A 3KQXA 1CJWA 4KOYA 4MHNA 4NGTA 2PCUA 3FJUA 5LYDA 2C6GA 4E0AA 4OC5A 4YGOA 2HC9A 1MJ9A 2AFSA 2VZYA 4B13A 5A27A 5D29A 2ZEDA 1JQGA 1DE4C 1Z5RA 4BD9A 2B3VA 4U9ZA 3SI1A 3E0KA 2PVVA 1UWYA 3GUXA 3NA6A 4C2ZA 1S7FA 2FE7A 3FRMA 3EXNA 4OC4A 1AYEA 4Q36A 4JZ0A 1CPXA 1DTDA 3FVLA 1ZG7A 1IY7A 4CPAA 1Y0RA 5ELYA 4NEXA 2Z3KA 4R9MA 5A28A 4OLLA 5HVFA 5ISVA 1YMEA 2JLMA 3K2KA 4KZTA 4NGSA 4H2KA 3RYOA 3TTHA 4AVAA 4RUHA 3ZZIA 1ARLA 2OZHA 1MK4A 3FIXA 4PK2A 3FXTA 2IQ6A 2Z0ZA 1XIXA 4UIAA 4LX9A 4HNXB 4CYNA 3DDDA 4CAVA 3MN8A 1QQ9A 4IAVA 5IV0A 1TF9A 3PP9A 3S6FA 4GXHA 4M85A 1R3NA 3GY9A 1YQEA 1CP7A 4FD7A 5G21A 1M4LA 2C1CA 3NH5A 4JLYA 1HEEA 4LQGA 3FEEA 2JBKA 1Q2DA 1F57A 4C7IA 4UFWA 1Z9UA 1YREA 4I49A 1TKFA 4P4FA 2ATRA 3KHZA 4KOSA 5LYFA 2B5GA 3PBBA 4NGRA 3R96A 3S6KA 1IIDA 2HV2A 4KUAA 4KSFA 4UWJA 2OR4A 3FB3A 4TNUA 4F9VA 1LCPA 4QC6A 2POKA 4CAFA 1Z4EA 2Q4ZA 2PE3A 2XEJA 3DGVA 4YFJA 4H6ZA 4GS4A 2HQYA 1BPNA 1PYTB 1TIQA 4OADA 4CRYB 2I00A 1QSRA 3T8WA 2ARHA 1NSAA 2QYVA 4MI4A 4P4DA 3GIUA 3UY5A 5LYLA 2YNEA 2Q44A 5THWA 4PXBA 2Z3OA 2Z3MA 3TOBA 4NXYA 2EWBA 3FNCA 1YW6A 2FIWA 5HMNA 1FT7A 3KGQA 1S3ZA 4UIBA 4MHZA 4P4JA 5K8NA 1VHSA 4MHDA 2ANPA 4MFPA 4J3GA 4B11A 2CTBA 2ZEMA 4P6YA 2Q7BA 3V7ZA 4GM5A 3TC8A 3GKRA 3TO9A 1M4GA 4YU9A 4AXVA 3JVNA 3IU1A 1YLEA 3HUVA 4UEFA 4Y49B 3VATA 4XPDB 4A33A 4FD6A 3B35A 2DPTA 2ZENA 4UCNA 1IOIA 5G22A 3CPAA 2WPWA 5JM6A 5D8NA 1YVOA 4CGOA 1TKJA 2VL1A 3TOAA 1ZLHA 1LANA 1NMTA 4NCZA 1YR0A 4M6IA 2PSWA 2OH1A 2K5TA 3B7IA 4AG9A 2B4DB 5AG7A 1Y9WA 4R57A 1Y7RA 2PJ5A 2R8VA 2AFMA 2EUIA 3NE8A 1Z8LA 3OWCA 2ZW4A 2G3TA 4A37A 1HDQA 3EC4A 4P10A 2DXQA 2V8VA 1NE9A 4B5OA 4MBUA 3D67A 2WPXA 5DS0A 4U5YA 1IYKA 4KUBA 1Y7EA 4MFKA 4ZI6A 3B8GA 3W6XA 2PC1A 2REEA 2EO8A 2PR8A 2ZEFA 4UEEA 2CXAA 1IICA 4B5PB 4WJBA 4R3KA 2BSWA 3IGRA 4CRZB 1XMTA 3D4UA 3S9MA 4KOTA 3I9SA 2GFQA 2B3UA 4C7HA 3D7FA 4IHMA 3WABA 4OC0A 2GLFA 3BJ8A 5K8OA 4UCMA 2Q0YA 4NJRA 2CNTA 2YNCA 2AFOA 3CZXA 4NJQA 5J1QA 1XFOA 4U9YA 3KASA 3TO6A 3NE7A 3BI1A 4PPZA 3IFEA 2PJ2A 4CGPA 4ZYQA 2PVWA 3KI9A 4JXRA 2PJ4A 3D66A 4FAIA 2ZW6A 1KUYA 1N71A 4IF5A 4MFLA 5DWMA 4UF4A 4F0XA 2Q43A 3ISZA 4MMOA 2ZW5A 1HDUA 4UEZA 1LFWA 2C6CA 2ZXVA 1P4NA 4XNHC 4MJ8A 1S60A 2Z3LA 2I79A 4R7MA 1R43A 3RNZA 3QB8A 1Y9KA 1ZG8A 5LRKA 1ZG9A 3SJEA 1VGYA 2VZZA 4KOVA 3BHXA 2G3AA 2CNMA 7CPAA 4QUSA 3CXQA 4BBHA 1XMBA 5JH9A 1AUGA 5IB9A 1M4IA 4W9YA 4AVCA 4UFXA 4A38A 1Q2YA 1Z8XA 3TFYA 4OMEA 2YNDA 2YNCC 2Z3NA 4PQAA 1IYLA 4EFDA 3QAHA 1VIXA 3QNVA 4L89A 4ONWA 2V8HA 4X5KA 3RO0A 4KSIA 2FCKA 3GLJA 3DSBA 3P2HA 4MFJA 1LAPA 3D8PA 4MHYA 3SJGA 2IMOA 4AVBA 3TX8A 3B3WA 3R9EA 4JYWA 4A2ZA 3KR5A 2OZGA 1XBUA 1XF8A 3V8IA 4F0YA 2PJBA 1CP6A 3IWWA 4ORFA 3SJFA 3FYNA 1YW4A 2F8HA 5J8FA 1XE4A 5CNPA 3RAMA 1QMUA 2ZEEA 4MCRA 4II9A 3VARA 3PB8X 1UFHA 2PR1A 5F48A 1A2ZA 5F46A 2FXFA 2V8DA 3D7HA 3IWGA 3IJ3A 2P6EA 4PV6A 2PQ8A 4PSWA 5HVGA 2FIAA 3FEDA 3PFOA 1I12A 3LODA 3CXSA 3T90A 2O28A 4Z65A 5K8MA 4UA3A 1BLLE 4RS2A 4DYOA 1CG2A 4CGLA 1QSNA 5F09A 3I1UA 4F9UA 3DNSA 1LAMA 4ONUA 2QIRA 2F5IA 1F2OA 2XEFA 1M1DA 2V77A 2RC4A 3F8KA 3H5ZA 1YGHA 3NFZA 4K3NA 4KOWA 5H86A 2I3CA 3RBUA 2EVNA 2PJ3A 3SJXA 4ZY1A 2R98A 1ZO0A 4A32A 3D2MA 4ZX9A 2ZEGA 4CGNA 2AJ6A 4RI1A 3SXNA 1Y0YA 2PJAA 3VWEA 4UBRA 2H5MA 3B3CA 1FY7A 2REFA 3BLNA 5LYIA 1ELLP 4QBJA 8CPAA 3KKWA 4R8FA 3HLPA 3BXMA 4FUUA 4R3LA 3BJ7A 3W6SA 3KQZA 1S5KA 3PBEA 4MCQA 5EBVA 4A30A 3PZJA 5G1ZA 2ZPAA 4H6UA 4B10A 3LACA 3DLJA 4JD6A 1WK4A 2G0BA 3PRTA 4H89A 4G1PA 3I3GA 2VBQA 3C26A 1NSLA 2OZUA 3W91A 5JQ4A 1VHOA 2AFWA 3EO4A 4QB9A 2OOTA 3VWDA 4BINA 4M6GA 5KTDA 1JWQA 2IL4A 4B5PA 3CDXA 4XPLA 2ZOFA 3LMSA 2J8RA 3F0AA 4FD5A 4Q38A 3D68A 2JEWA 5HVHA 1S7KA 3IIBA 3IU2A 2PJ1A 2VI7A 4OAEA 3DR6A 4XPKA 2P0WA 3SI0A 4L8AA 4MFZA 2DEAA 3H8GA 5J8CA 3TT2A 5H84A 5LRGA 4MXUA 4YRHA 1R57A 1XEBA 2QECA 1M4DA 4UFVA 2NSMA 2OB0A 4CAXA 1IB1E 2Q7SA 4M3SA 4E2AA 4YWYA 1XRYA 2BOAA 3L2NA 4R76A 5E96A 2BO9A 2CF4A 4DJLA 5AG4A 2RFHA 3MGDA 1BPMA 2RB7A 5C88A 2GU2A 3PB4X 3D2PA 2PJ6A 4OIWA 2QJ8A 2P6GA 3LD2A 1ELMP 2PJ0A 3WC7A 1RXTA 3KR4A 4R87A 4B14A 5KTAA 3N7ZA 2PJCA 1Q7LA 3BI0A 4PK3A 2Q04A 2BUEA 2R1IA 4OIDA 2GLJA 4O23A 2IJZA 4C2XA 3DR8A 3B3SA 2JDCA 2EK9A 1XOVA 1TKHA 1Q2CA 2GREA 1K4JA 3GYAA 4B12A 4PXCA 1J4JA 3JUWA 2BCOA 2PRQA 2VXKA 4P4BA 3R95A 1EE3P 4K30A 5AGEA 2D4PA 5F49A 1WWZA 4KS9A 2XEGA 4KORA 3T9YA 2D4OA 3WT4A 2WYRA 1B6BA 3R1KA 4ZBGA 5CPAA 3R9GA 4R6TA 3LWUA 4JXQA 3D7GA 1AMPA 3FBUA 3V38A 4MY3A 3QAYA 1LRZA 1RTQA 2PJ9A 2PRBA 4A94A 1IU8A 4OC3A 3G8WA 4OC1A 5JGFA 4OC2A 2ABZA 4E8OA 2EBJA 3SHPA 1TXRA 3TCVA 3FECA 1XJOA 1VHEA 1I1DA 2J8MA 4X2TA 1M44A 1IGBA 2J9AA 2VQYA 4NGQA 2B58A 4KVOE 4LUAA 4A31A 5LRJA 3D3SA 4OP4A 3WC5A 1CBXA 2FL4A 4C2YA 4HPSA 3D7DA 4WWVA 4AB7A 3H8EA 3P2FA 4LQ6A 1GYTA 3CXPA 4ZY2A 4CAWA 1I21A 1OBRA 2ZEHA 2NYQA 4NGMA 1OZPA 1VKCA 4X3RA 4QVTA 2G9DA 6CPAA 4JJXA 4NSQA 5I4MA 2CY2A 2P6FA 1X12A 1RO5A 4IUSA 5JPHA 2AE6A 2F7VA 3FF3A 1Z4RA 2NMTA 3PEIA 4MRIA 5K8PA 3F5BA 3ISXA 3K9TA 2ODFA 3A9LA 2FT0A 1KUXA 3NH4A 1V0CA 4X8IA 1L0CA 4HNWB 1BAVA 2HUZA 2GE3A 5G20A 4A95A 1YSJA
chains in the Genus database with same CATH topology
5F47A 3IWEA 4CGMA 4KLWA 1MJBA 1YVKA 2YGWA 2B4DA 5DWNA 1YK3A 2Z11A 1PUAA 2JDDA 2Q4VA 4ZGYB 4KSAA 5C82A 2BEIA 1ON0A 1B87A 3SXOA 5KTCA 3TE4A 3EFAA 1QSOA 1CM0A 1SQHA 4KVME 2Z10A 4KLVA 2DPSA 2ZW7A 4C68A 5AG6A 4KOXA 5IX3A 2VEZA 2R7HA 4Y49C 4XPDC 4PSXA 1QSMA 1KUVA 4EVYA 2B5GB 2Z3PA 4MFQA 1QSTA 4HKFA 3ZJ0A 5GCNA 1KZFA 5I0CA 2X7BA 3H4QA 2WUUA 3EY5A 4AG7A 4CS0B 2GANA 2C27A 4BMHA 4UCPA 4KVXA 2FSRA 5AG5A 4JWPA 4NF1A 3JTKA 2FS5A 1S7LA 3K9UA 1PU9A 4CYQA 1P0HA 2A4NA 4CYPA 3R9FA 1GHEA 5HH1A 3S6HA 2PDOA 1MJAA 2B4BA 2OU2A 4HNYB 1BOBA 4KOUA 3G3SA 2KCWA 4FD4A 4DNCA 4F6AA 5IB0A 2Y0MA 4MY0A 5FVJA 4CAEA 1S7NA 3S6GA 3WR7A 2GIVA 3TO7A 2WSAA 5BWAB 2BL1A 2CNSA 4XNHB 3PGPA 2Q4YA 4CYOA 1U6MA 4UWIA 5EC4A 2QMLA 2J8NA 2JEVA 1BO4A 1YX0A 4KOYA 1CJWA 4E0AA 4YGOA 1MJ9A 4B13A 2VZYA 5A27A 2B3VA 4U9ZA 3E0KA 4C2ZA 1S7FA 2FE7A 3FRMA 3EXNA 4Q36A 4NEXA 2Z3KA 4R9MA 5A28A 4OLLA 5ISVA 2JLMA 4AVAA 4KZTA 3TTHA 3RYOA 3ZZIA 2OZHA 1MK4A 3FIXA 4PK2A 3FXTA 2Z0ZA 1XIXA 4CYNA 4LX9A 4HNXB 3DDDA 4CAVA 3PP9A 3S6FA 4M85A 5G21A 3GY9A 4FD7A 4JLYA 1Q2DA 4C7IA 4UFWA 1Z9UA 1YREA 4I49A 2ATRA 4KOSA 2B5GA 3R96A 3S6KA 1IIDA 2HV2A 4KUAA 4KSFA 4UWJA 3FB3A 4QC6A 4CAFA 1Z4EA 4YFJA 4H6ZA 4GS4A 2HQYA 1TIQA 4CRYB 4OADA 2I00A 1QSRA 2ARHA 4MI4A 3UY5A 2YNEA 2Q44A 2Z3OA 2Z3MA 3TOBA 4NXYA 3FNCA 2FIWA 5HMNA 1S3ZA 1VHSA 4MHDA 4MFPA 4J3GA 4B11A 2Q7BA 3GKRA 3TO9A 1M4GA 3JVNA 3IU1A 1YLEA 4Y49B 4A33A 4XPDB 4FD6A 2DPTA 4UCNA 5G22A 2WPWA 1YVOA 4CGOA 3TOAA 4NCZA 1NMTA 1YR0A 2PSWA 2OH1A 2K5TA 4AG9A 2B4DB 5AG7A 1Y9WA 4R57A 1Y7RA 2R8VA 2EUIA 3OWCA 2ZW4A 2G3TA 3EC4A 2DXQA 1NE9A 4B5OA 4MBUA 2WPXA 4U5YA 1IYKA 4KUBA 4MFKA 3B8GA 3W6XA 2PC1A 2REEA 2PR8A 2CXAA 1IICA 4B5PB 4R3KA 2BSWA 3IGRA 4CRZB 1XMTA 4KOTA 3I9SA 2B3UA 4C7HA 3BJ8A 4UCMA 2Q0YA 2CNTA 2YNCA 4U9YA 3TO6A 3NE7A 4CGPA 4JXRA 2ZW6A 1KUYA 1N71A 4IF5A 4MFLA 5DWMA 4F0XA 2ZW5A 2ZXVA 1P4NA 4XNHC 4MJ8A 1S60A 2Z3LA 2I79A 3QB8A 1Y9KA 2VZZA 4KOVA 2G3AA 2CNMA 4QUSA 3CXQA 4BBHA 1M4IA 4AVCA 4UFXA 1Q2YA 3TFYA 2YNDA 2YNCC 2Z3NA 1IYLA 3QAHA 4L89A 4X5KA 2FCKA 3DSBA 3P2HA 4MFJA 3D8PA 4AVBA 3R9EA 4A2ZA 2OZGA 1XF8A 3V8IA 4F0YA 4ORFA 3FYNA 5J8FA 1XE4A 5CNPA 4II9A 1UFHA 2PR1A 5F48A 5F46A 2FXFA 3IWGA 4PV6A 4PSWA 2P6EA 2PQ8A 2FIAA 1I12A 3LODA 3CXSA 3T90A 2O28A 4UA3A 4RS2A 4CGLA 1QSNA 3DNSA 4ONUA 2QIRA 2F5IA 1M1DA 3F8KA 2RC4A 3H5ZA 5H86A 1YGHA 4KOWA 2EVNA 2R98A 1ZO0A 4A32A 3D2MA 4CGNA 2AJ6A 4RI1A 3SXNA 5IV0A 3VWEA 4UBRA 2H5MA 3BLNA 1FY7A 2REFA 4QBJA 3KKWA 4R3LA 3BJ7A 3W6SA 1S5KA 5EBVA 4A30A 3PZJA 5G1ZA 2ZPAA 4H6UA 4B10A 4JD6A 1WK4A 2G0BA 4H89A 3I3GA 2VBQA 3C26A 1NSLA 2OZUA 3W91A 5JQ4A 5KTDA 4QB9A 3EO4A 3VWDA 2IL4A 4B5PA 4XPLA 4Q38A 3F0AA 2J8RA 4FD5A 1S7KA 3IU2A 2VI7A 4OAEA 3DR6A 4XPKA 2P0WA 4L8AA 4MFZA 5J8CA 3TT2A 5H84A 4YRHA 1R57A 1XEBA 2QECA 1M4DA 4UFVA 2OB0A 4CAXA 1IB1E 4M3SA 4E2AA 5E96A 5AG4A 3MGDA 5C88A 3D2PA 2P6GA 3LD2A 1RXTA 4R87A 4B14A 5KTAA 3N7ZA 4PK3A 2Q04A 2BUEA 2R1IA 4C2XA 3DR8A 2JDCA 1Q2CA 3GYAA 1K4JA 4B12A 1J4JA 3JUWA 2VXKA 3R95A 4K30A 5AGEA 2D4PA 5F49A 1WWZA 4KS9A 4KORA 3T9YA 2D4OA 1B6BA 3R1KA 4ZBGA 3R9GA 4JXQA 3FBUA 4MY3A 1LRZA 2PRBA 3G8WA 4E8OA 3SHPA 3TCVA 1I1DA 2J8MA 1M44A 2VQYA 2B58A 4KVOE 4LUAA 4A31A 3D3SA 2FL4A 4C2YA 4AB7A 3P2FA 3CXPA 4CAWA 1I21A 1OZPA 1VKCA 4QVTA 4JJXA 4NSQA 2CY2A 2P6FA 1RO5A 4IUSA 5JPHA 2AE6A 1Z4RA 2NMTA 3F5BA 3A9LA 2FT0A 1KUXA 1V0CA 1L0CA 4HNWB 2HUZA 2GE3A 5G20A 4A95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F47 A;  4KLW A;  1MJB A;  1YVK A;  2B4D A;  5DWN A;  1YK3 A;  2Z11 A;  1PUA A;  2JDD A;  2Q4V A;  5C82 A;  2BEI A;  1ON0 A;  1B87 A;  3SXO A;  5KTC A;  3TE4 A;  3EFA A;  1QSO A;  1CM0 A;  1SQH A;  4KVM E;  2Z10 A;  4KLV A;  2ZW7 A;  4KOX A;  5IX3 A;  2VEZ A;  2R7H A;  4Y49 C;  4XPD C;  4PSX A;  1QSM A;  1KUV A;  4EVY A;  2B5G B;  1QST A;  4HKF A;  3ZJ0 A;  5GCN A;  1KZF A;  5I0C A;  2X7B A;  3H4Q A;  3EY5 A;  4AG7 A;  4CS0 B;  2GAN A;  2C27 A;  4BMH A;  4KVX A;  2FSR A;  4JWP A;  4NF1 A;  2FS5 A;  1S7L A;  3K9U A;  1PU9 A;  1P0H A;  2A4N A;  3R9F A;  1GHE A;  5HH1 A;  3S6H A;  2PDO A;  1MJA A;  2B4B A;  2OU2 A;  1BOB A;  4HNY B;  4KOU A;  3G3S A;  2KCW A;  4FD4 A;  4DNC A;  4F6A A;  5IB0 A;  2Y0M A;  4MY0 A;  5FVJ A;  1S7N A;  3S6G A;  3WR7 A;  2GIV A;  3TO7 A;  2BL1 A;  2CNS A;  4XNH B;  3PGP A;  2Q4Y A;  1U6M A;  4UWI A;  5EC4 A;  2QML A;  2J8N A;  2JEV A;  1BO4 A;  4KOY A;  1YX0 A;  1CJW A;  4E0A A;  4YGO A;  1MJ9 A;  2VZY A;  2B3V A;  4U9Z A;  3E0K A;  1S7F A;  2FE7 A;  3FRM A;  3EXN A;  4NEX A;  4R9M A;  4OLL A;  5ISV A;  2JLM A;  4AVA A;  4KZT A;  3TTH A;  3RYO A;  3ZZI A;  2OZH A;  1MK4 A;  3FIX A;  4PK2 A;  3FXT A;  2Z0Z A;  1XIX A;  4LX9 A;  4HNX B;  3DDD A;  4CAV A;  3PP9 A;  3S6F A;  4M85 A;  3GY9 A;  4FD7 A;  4JLY A;  1Q2D A;  1Z9U A;  1YRE A;  4I49 A;  2ATR A;  4KOS A;  2B5G A;  3R96 A;  3S6K A;  1IID A;  2HV2 A;  4KUA A;  4UWJ A;  3FB3 A;  4QC6 A;  1Z4E A;  4YFJ A;  4H6Z A;  4GS4 A;  2HQY A;  1TIQ A;  4CRY B;  4OAD A;  2I00 A;  1QSR A;  2ARH A;  4MI4 A;  3UY5 A;  2Q44 A;  3TOB A;  4NXY A;  3FNC A;  2FIW A;  5HMN A;  1S3Z A;  1VHS A;  4MHD A;  4J3G A;  2Q7B A;  3GKR A;  3TO9 A;  1M4G A;  3JVN A;  1YLE A;  4Y49 B;  4XPD B;  4FD6 A;  2WPW A;  1YVO A;  3TOA A;  4NCZ A;  1NMT A;  1YR0 A;  2PSW A;  2OH1 A;  2K5T A;  4AG9 A;  2B4D B;  1Y9W A;  4R57 A;  1Y7R A;  2R8V A;  2EUI A;  3OWC A;  2ZW4 A;  2G3T A;  3EC4 A;  2DXQ A;  1NE9 A;  4B5O A;  4MBU A;  2WPX A;  4U5Y A;  1IYK A;  4KUB A;  3B8G A;  3W6X A;  2PC1 A;  2REE A;  2PR8 A;  1IIC A;  4B5P B;  4R3K A;  2BSW A;  3IGR A;  4CRZ B;  1XMT A;  4KOT A;  3I9S A;  2B3U A;  3BJ8 A;  2Q0Y A;  2CNT A;  4U9Y A;  3TO6 A;  3NE7 A;  4JXR A;  2ZW6 A;  1KUY A;  1N71 A;  4IF5 A;  5DWM A;  2ZW5 A;  2ZXV A;  1P4N A;  4XNH C;  4MJ8 A;  1S60 A;  2I79 A;  3QB8 A;  1Y9K A;  2VZZ A;  4KOV A;  2G3A A;  2CNM A;  4QUS A;  3CXQ A;  1M4I A;  4AVC A;  1Q2Y A;  3TFY A;  1IYL A;  3QAH A;  4L89 A;  4X5K A;  2FCK A;  3DSB A;  3P2H A;  3D8P A;  4AVB A;  3R9E A;  2OZG A;  1XF8 A;  3V8I A;  4F0Y A;  4ORF A;  3FYN A;  5J8F A;  1XE4 A;  5CNP A;  4II9 A;  1UFH A;  2PR1 A;  5F48 A;  5F46 A;  2FXF A;  3IWG A;  4PV6 A;  4PSW A;  2P6E A;  2PQ8 A;  2FIA A;  1I12 A;  3LOD A;  3CXS A;  3T90 A;  2O28 A;  4UA3 A;  4RS2 A;  1QSN A;  3DNS A;  4ONU A;  2QIR A;  2F5I A;  1M1D A;  3F8K A;  2RC4 A;  5H86 A;  1YGH A;  4KOW A;  2EVN A;  2R98 A;  3D2M A;  2AJ6 A;  4RI1 A;  3SXN A;  5IV0 A;  3VWE A;  4UBR A;  2H5M A;  3BLN A;  1FY7 A;  2REF A;  4QBJ A;  3KKW A;  4R3L A;  3BJ7 A;  3W6S A;  1S5K A;  5EBV A;  3PZJ A;  2ZPA A;  4H6U A;  4JD6 A;  1WK4 A;  2G0B A;  4H89 A;  3I3G A;  2VBQ A;  3C26 A;  1NSL A;  2OZU A;  3W91 A;  5JQ4 A;  5KTD A;  4QB9 A;  3EO4 A;  3VWD A;  2IL4 A;  4B5P A;  4XPL A;  3F0A A;  2J8R A;  4FD5 A;  1S7K A;  2VI7 A;  4OAE A;  3DR6 A;  4XPK A;  2P0W A;  4L8A A;  5J8C A;  3TT2 A;  5H84 A;  4YRH A;  1R57 A;  1XEB A;  2QEC A;  1M4D A;  2OB0 A;  4CAX A;  1IB1 E;  4M3S A;  4E2A A;  5E96 A;  3MGD A;  5C88 A;  3D2P A;  2P6G A;  3LD2 A;  1RXT A;  4R87 A;  5KTA A;  3N7Z A;  4PK3 A;  2Q04 A;  2BUE A;  2R1I A;  3DR8 A;  2JDC A;  1Q2C A;  3GYA A;  1K4J A;  1J4J A;  3JUW A;  2VXK A;  3R95 A;  4K30 A;  2D4P A;  5F49 A;  1WWZ A;  4KOR A;  3T9Y A;  2D4O A;  1B6B A;  3R1K A;  4ZBG A;  3R9G A;  4JXQ A;  3FBU A;  4MY3 A;  1LRZ A;  2PRB A;  3G8W A;  4E8O A;  3SHP A;  3TCV A;  1I1D A;  2J8M A;  1M44 A;  2VQY A;  2B58 A;  4KVO E;  4LUA A;  3D3S A;  2FL4 A;  4AB7 A;  3P2F A;  3CXP A;  4CAW A;  1I21 A;  1OZP A;  1VKC A;  4QVT A;  4JJX A;  4NSQ A;  2CY2 A;  2P6F A;  1RO5 A;  4IUS A;  5JPH A;  2AE6 A;  1Z4R A;  2NMT A;  3F5B A;  2FT0 A;  1KUX A;  1V0C A;  1L0C A;  4HNW B;  2HUZ A;  2GE3 A; 
#chains in the Genus database with same CATH topology
 1ZLI A;  1Z8T A;  3FX6 A;  1KWM A;  4OKO A;  5F47 A;  4ZX8 A;  3IWE A;  4CGM A;  4KLW A;  2CIJ A;  3S9N A;  3KHX A;  1MJB A;  1FNO A;  1YVK A;  4B6Z A;  2JBJ A;  2YGW A;  3IEH A;  3PFE A;  2B4D A;  4TWE A;  5DWN A;  2Q51 A;  1YK3 A;  2ZEP A;  2Z11 A;  1Z8W A;  1PUA A;  2JDD A;  2AFU A;  2Q4V A;  4ZGY B;  5HXD A;  4KSA A;  2EK8 A;  5C82 A;  2BEI A;  1ON0 A;  1IOF A;  1B87 A;  3SXO A;  5KTC A;  3TE4 A;  4P4E A;  2CTC A;  3EFA A;  1H8L A;  1QSO A;  4Q7A A;  2XEI A;  1CM0 A;  3FH4 A;  1SQH A;  2PJ8 A;  4NFR A;  4KVM E;  2Z10 A;  3SI2 A;  4KLV A;  2DPS A;  2PIZ A;  2ZW7 A;  1Z2L A;  4C68 A;  4EME A;  5AG6 A;  4KOX A;  4P44 A;  5IX3 A;  4NGN A;  2VEZ A;  4F8Z A;  3S9L A;  2R7H A;  4DUK A;  4Y49 C;  4XPD C;  2ZEL A;  1LOK A;  1QSM A;  4PSX A;  4RN7 A;  1KUV A;  2WZN A;  2AFZ A;  4EVY A;  2B5G B;  2Z3P A;  4P4I A;  4NGP A;  3VH9 A;  4MFQ A;  4PXD A;  1QST A;  4HKF A;  4IK2 A;  4ZY0 A;  3ZJ0 A;  5GCN A;  1KZF A;  5I0C A;  1CX8 A;  3GB0 A;  3PB6 X;  2X7B A;  3H4Q A;  2WUU A;  4FWU A;  3EY5 A;  3H8F A;  2ZOG A;  3N5F A;  4AG7 A;  2V8G A;  3JRU A;  1X10 A;  3PB9 X;  2GAN A;  2C27 A;  3RZA A;  4CS0 B;  2O4H A;  4MCP A;  4UCP A;  4KVX A;  2FVG A;  4BMH A;  2FSR A;  3WC6 A;  1PCA A;  4M6H A;  5AG5 A;  4A39 A;  4JWP A;  4PXE A;  4NF1 A;  3JTK A;  2FS5 A;  1S7L A;  4MCS A;  3K9U A;  3B3V A;  1PU9 A;  4CYQ A;  1P0H A;  2A4N A;  2QVP A;  3CPX A;  3R9F A;  4CYP A;  1TF8 A;  2AFX A;  1F2P A;  1GHE A;  1CPS A;  3IC1 A;  5HH1 A;  3S6H A;  3KL9 A;  2PDO A;  1MJA A;  5CBM A;  2B4B A;  2ZEO A;  3B2Y A;  2OU2 A;  1BOB A;  4HNY B;  4KOU A;  3FMC A;  2KCW A;  3G3S A;  4FD4 A;  4DNC A;  4F6A A;  5IB0 A;  3IO1 A;  2Y0M A;  2DF5 A;  4P45 A;  4MHP A;  4MY0 A;  2HB6 A;  5FVJ A;  4CAE A;  2PJ7 A;  1S7N A;  4FBE A;  1ARM A;  3MRU A;  3S6G A;  3WR7 A;  2GIV A;  3TO7 A;  2WSA A;  3CT9 A;  5BWA B;  3B3T A;  4EWT A;  2BL1 A;  2CNS A;  2C6P A;  4XNH B;  3PGP A;  2Q4Y A;  2PIY A;  5EMI A;  4CYO A;  1U6M A;  4UWI A;  1YLO A;  2O53 A;  3PB7 X;  2QML A;  5EC4 A;  2J8N A;  2JEV A;  3NH8 A;  3KZW A;  1BO4 A;  1YX0 A;  3KQX A;  1CJW A;  4KOY A;  4MHN A;  4NGT A;  2PCU A;  3FJU A;  5LYD A;  2C6G A;  4E0A A;  4OC5 A;  4YGO A;  2HC9 A;  1MJ9 A;  2AFS A;  2VZY A;  4B13 A;  5A27 A;  5D29 A;  2ZED A;  1JQG A;  1DE4 C;  1Z5R A;  4BD9 A;  2B3V A;  4U9Z A;  3SI1 A;  3E0K A;  2PVV A;  1UWY A;  3GUX A;  3NA6 A;  4C2Z A;  1S7F A;  2FE7 A;  3FRM A;  3EXN A;  4OC4 A;  1AYE A;  4Q36 A;  4JZ0 A;  1CPX A;  1DTD A;  3FVL A;  1ZG7 A;  1IY7 A;  4CPA A;  1Y0R A;  5ELY A;  4NEX A;  2Z3K A;  4R9M A;  5A28 A;  4OLL A;  5HVF A;  5ISV A;  1YME A;  2JLM A;  3K2K A;  4KZT A;  4NGS A;  4H2K A;  3RYO A;  3TTH A;  4AVA A;  4RUH A;  3ZZI A;  1ARL A;  2OZH A;  1MK4 A;  3FIX A;  4PK2 A;  3FXT A;  2IQ6 A;  2Z0Z A;  1XIX A;  4UIA A;  4LX9 A;  4HNX B;  4CYN A;  3DDD A;  4CAV A;  3MN8 A;  1QQ9 A;  4IAV A;  5IV0 A;  1TF9 A;  3PP9 A;  3S6F A;  4GXH A;  4M85 A;  1R3N A;  3GY9 A;  1YQE A;  1CP7 A;  4FD7 A;  5G21 A;  1M4L A;  2C1C A;  3NH5 A;  4JLY A;  1HEE A;  4LQG A;  3FEE A;  2JBK A;  1Q2D A;  1F57 A;  4C7I A;  4UFW A;  1Z9U A;  1YRE A;  4I49 A;  1TKF A;  4P4F A;  2ATR A;  3KHZ A;  4KOS A;  5LYF A;  2B5G A;  3PBB A;  4NGR A;  3R96 A;  3S6K A;  1IID A;  2HV2 A;  4KUA A;  4KSF A;  4UWJ A;  2OR4 A;  3FB3 A;  4TNU A;  4F9V A;  1LCP A;  4QC6 A;  2POK A;  4CAF A;  1Z4E A;  2Q4Z A;  2PE3 A;  2XEJ A;  3DGV A;  4YFJ A;  4H6Z A;  4GS4 A;  2HQY A;  1BPN A;  1PYT B;  1TIQ A;  4OAD A;  4CRY B;  2I00 A;  1QSR A;  3T8W A;  2ARH A;  1NSA A;  2QYV A;  4MI4 A;  4P4D A;  3GIU A;  3UY5 A;  5LYL A;  2YNE A;  2Q44 A;  5THW A;  4PXB A;  2Z3O A;  2Z3M A;  3TOB A;  4NXY A;  2EWB A;  3FNC A;  1YW6 A;  2FIW A;  5HMN A;  1FT7 A;  3KGQ A;  1S3Z A;  4UIB A;  4MHZ A;  4P4J A;  5K8N A;  1VHS A;  4MHD A;  2ANP A;  4MFP A;  4J3G A;  4B11 A;  2CTB A;  2ZEM A;  4P6Y A;  2Q7B A;  3V7Z A;  4GM5 A;  3TC8 A;  3GKR A;  3TO9 A;  1M4G A;  4YU9 A;  4AXV A;  3JVN A;  3IU1 A;  1YLE A;  3HUV A;  4UEF A;  4Y49 B;  3VAT A;  4XPD B;  4A33 A;  4FD6 A;  3B35 A;  2DPT A;  2ZEN A;  4UCN A;  1IOI A;  5G22 A;  3CPA A;  2WPW A;  5JM6 A;  5D8N A;  1YVO A;  4CGO A;  1TKJ A;  2VL1 A;  3TOA A;  1ZLH A;  1LAN A;  1NMT A;  4NCZ A;  1YR0 A;  4M6I A;  2PSW A;  2OH1 A;  2K5T A;  3B7I A;  4AG9 A;  2B4D B;  5AG7 A;  1Y9W A;  4R57 A;  1Y7R A;  2PJ5 A;  2R8V A;  2AFM A;  2EUI A;  3NE8 A;  1Z8L A;  3OWC A;  2ZW4 A;  2G3T A;  4A37 A;  1HDQ A;  3EC4 A;  4P10 A;  2DXQ A;  2V8V A;  1NE9 A;  4B5O A;  4MBU A;  3D67 A;  2WPX A;  5DS0 A;  4U5Y A;  1IYK A;  4KUB A;  1Y7E A;  4MFK A;  4ZI6 A;  3B8G A;  3W6X A;  2PC1 A;  2REE A;  2EO8 A;  2PR8 A;  2ZEF A;  4UEE A;  2CXA A;  1IIC A;  4B5P B;  4WJB A;  4R3K A;  2BSW A;  3IGR A;  4CRZ B;  1XMT A;  3D4U A;  3S9M A;  4KOT A;  3I9S A;  2GFQ A;  2B3U A;  4C7H A;  3D7F A;  4IHM A;  3WAB A;  4OC0 A;  2GLF A;  3BJ8 A;  5K8O A;  4UCM A;  2Q0Y A;  4NJR A;  2CNT A;  2YNC A;  2AFO A;  3CZX A;  4NJQ A;  5J1Q A;  1XFO A;  4U9Y A;  3KAS A;  3TO6 A;  3NE7 A;  3BI1 A;  4PPZ A;  3IFE A;  2PJ2 A;  4CGP A;  4ZYQ A;  2PVW A;  3KI9 A;  4JXR A;  2PJ4 A;  3D66 A;  4FAI A;  2ZW6 A;  1KUY A;  1N71 A;  4IF5 A;  4MFL A;  5DWM A;  4UF4 A;  4F0X A;  2Q43 A;  3ISZ A;  4MMO A;  2ZW5 A;  1HDU A;  4UEZ A;  1LFW A;  2C6C A;  2ZXV A;  1P4N A;  4XNH C;  4MJ8 A;  1S60 A;  2Z3L A;  2I79 A;  4R7M A;  1R43 A;  3RNZ A;  3QB8 A;  1Y9K A;  1ZG8 A;  5LRK A;  1ZG9 A;  3SJE A;  1VGY A;  2VZZ A;  4KOV A;  3BHX A;  2G3A A;  2CNM A;  7CPA A;  4QUS A;  3CXQ A;  4BBH A;  1XMB A;  5JH9 A;  1AUG A;  5IB9 A;  1M4I A;  4W9Y A;  4AVC A;  4UFX A;  4A38 A;  1Q2Y A;  1Z8X A;  3TFY A;  4OME A;  2YND A;  2YNC C;  2Z3N A;  4PQA A;  1IYL A;  4EFD A;  3QAH A;  1VIX A;  3QNV A;  4L89 A;  4ONW A;  2V8H A;  4X5K A;  3RO0 A;  4KSI A;  2FCK A;  3GLJ A;  3DSB A;  3P2H A;  4MFJ A;  1LAP A;  3D8P A;  4MHY A;  3SJG A;  2IMO A;  4AVB A;  3TX8 A;  3B3W A;  3R9E A;  4JYW A;  4A2Z A;  3KR5 A;  2OZG A;  1XBU A;  1XF8 A;  3V8I A;  4F0Y A;  2PJB A;  1CP6 A;  3IWW A;  4ORF A;  3SJF A;  3FYN A;  1YW4 A;  2F8H A;  5J8F A;  1XE4 A;  5CNP A;  3RAM A;  1QMU A;  2ZEE A;  4MCR A;  4II9 A;  3VAR A;  3PB8 X;  1UFH A;  2PR1 A;  5F48 A;  1A2Z A;  5F46 A;  2FXF A;  2V8D A;  3D7H A;  3IWG A;  3IJ3 A;  2P6E A;  4PV6 A;  2PQ8 A;  4PSW A;  5HVG A;  2FIA A;  3FED A;  3PFO A;  1I12 A;  3LOD A;  3CXS A;  3T90 A;  2O28 A;  4Z65 A;  5K8M A;  4UA3 A;  1BLL E;  4RS2 A;  4DYO A;  1CG2 A;  4CGL A;  1QSN A;  5F09 A;  3I1U A;  4F9U A;  3DNS A;  1LAM A;  4ONU A;  2QIR A;  2F5I A;  1F2O A;  2XEF A;  1M1D A;  2V77 A;  2RC4 A;  3F8K A;  3H5Z A;  1YGH A;  3NFZ A;  4K3N A;  4KOW A;  5H86 A;  2I3C A;  3RBU A;  2EVN A;  2PJ3 A;  3SJX A;  4ZY1 A;  2R98 A;  1ZO0 A;  4A32 A;  3D2M A;  4ZX9 A;  2ZEG A;  4CGN A;  2AJ6 A;  4RI1 A;  3SXN A;  1Y0Y A;  2PJA A;  3VWE A;  4UBR A;  2H5M A;  3B3C A;  1FY7 A;  2REF A;  3BLN A;  5LYI A;  1ELL P;  4QBJ A;  8CPA A;  3KKW A;  4R8F A;  3HLP A;  3BXM A;  4FUU A;  4R3L A;  3BJ7 A;  3W6S A;  3KQZ A;  1S5K A;  3PBE A;  4MCQ A;  5EBV A;  4A30 A;  3PZJ A;  5G1Z A;  2ZPA A;  4H6U A;  4B10 A;  3LAC A;  3DLJ A;  4JD6 A;  1WK4 A;  2G0B A;  3PRT A;  4H89 A;  4G1P A;  3I3G A;  2VBQ A;  3C26 A;  1NSL A;  2OZU A;  3W91 A;  5JQ4 A;  1VHO A;  2AFW A;  3EO4 A;  4QB9 A;  2OOT A;  3VWD A;  4BIN A;  4M6G A;  5KTD A;  1JWQ A;  2IL4 A;  4B5P A;  3CDX A;  4XPL A;  2ZOF A;  3LMS A;  2J8R A;  3F0A A;  4FD5 A;  4Q38 A;  3D68 A;  2JEW A;  5HVH A;  1S7K A;  3IIB A;  3IU2 A;  2PJ1 A;  2VI7 A;  4OAE A;  3DR6 A;  4XPK A;  2P0W A;  3SI0 A;  4L8A A;  4MFZ A;  2DEA A;  3H8G A;  5J8C A;  3TT2 A;  5H84 A;  5LRG A;  4MXU A;  4YRH A;  1R57 A;  1XEB A;  2QEC A;  1M4D A;  4UFV A;  2NSM A;  2OB0 A;  4CAX A;  1IB1 E;  2Q7S A;  4M3S A;  4E2A A;  4YWY A;  1XRY A;  2BOA A;  3L2N A;  4R76 A;  5E96 A;  2BO9 A;  2CF4 A;  4DJL A;  5AG4 A;  2RFH A;  3MGD A;  1BPM A;  2RB7 A;  5C88 A;  2GU2 A;  3PB4 X;  3D2P A;  2PJ6 A;  4OIW A;  2QJ8 A;  2P6G A;  3LD2 A;  1ELM P;  2PJ0 A;  3WC7 A;  1RXT A;  3KR4 A;  4R87 A;  4B14 A;  5KTA A;  3N7Z A;  2PJC A;  1Q7L A;  3BI0 A;  4PK3 A;  2Q04 A;  2BUE A;  2R1I A;  4OID A;  2GLJ A;  4O23 A;  2IJZ A;  4C2X A;  3DR8 A;  3B3S A;  2JDC A;  2EK9 A;  1XOV A;  1TKH A;  1Q2C A;  2GRE A;  1K4J A;  3GYA A;  4B12 A;  4PXC A;  1J4J A;  3JUW A;  2BCO A;  2PRQ A;  2VXK A;  4P4B A;  3R95 A;  1EE3 P;  4K30 A;  5AGE A;  2D4P A;  5F49 A;  1WWZ A;  4KS9 A;  2XEG A;  4KOR A;  3T9Y A;  2D4O A;  3WT4 A;  2WYR A;  1B6B A;  3R1K A;  4ZBG A;  5CPA A;  3R9G A;  4R6T A;  3LWU A;  4JXQ A;  3D7G A;  1AMP A;  3FBU A;  3V38 A;  4MY3 A;  3QAY A;  1LRZ A;  1RTQ A;  2PJ9 A;  2PRB A;  4A94 A;  1IU8 A;  4OC3 A;  3G8W A;  4OC1 A;  5JGF A;  4OC2 A;  2ABZ A;  4E8O A;  2EBJ A;  3SHP A;  1TXR A;  3TCV A;  3FEC A;  1XJO A;  1VHE A;  1I1D A;  2J8M A;  4X2T A;  1M44 A;  1IGB A;  2J9A A;  2VQY A;  4NGQ A;  2B58 A;  4KVO E;  4LUA A;  4A31 A;  5LRJ A;  3D3S A;  4OP4 A;  3WC5 A;  1CBX A;  2FL4 A;  4C2Y A;  4HPS A;  3D7D A;  4WWV A;  4AB7 A;  3H8E A;  3P2F A;  4LQ6 A;  1GYT A;  3CXP A;  4ZY2 A;  4CAW A;  1I21 A;  1OBR A;  2ZEH A;  2NYQ A;  4NGM A;  1OZP A;  1VKC A;  4X3R A;  4QVT A;  2G9D A;  6CPA A;  4JJX A;  4NSQ A;  5I4M A;  2CY2 A;  2P6F A;  1X12 A;  1RO5 A;  4IUS A;  5JPH A;  2AE6 A;  2F7V A;  3FF3 A;  1Z4R A;  2NMT A;  3PEI A;  4MRI A;  5K8P A;  3F5B A;  3ISX A;  3K9T A;  2ODF A;  3A9L A;  2FT0 A;  1KUX A;  3NH4 A;  1V0C A;  4X8I A;  1L0C A;  4HNW B;  1BAV A;  2HUZ A;  2GE3 A;  5G20 A;  4A95 A;  1YSJ A; 
#chains in the Genus database with same CATH homology
 5F47 A;  3IWE A;  4CGM A;  4KLW A;  1MJB A;  1YVK A;  2YGW A;  2B4D A;  5DWN A;  1YK3 A;  2Z11 A;  1PUA A;  2JDD A;  2Q4V A;  4ZGY B;  4KSA A;  5C82 A;  2BEI A;  1ON0 A;  1B87 A;  3SXO A;  5KTC A;  3TE4 A;  3EFA A;  1QSO A;  1CM0 A;  1SQH A;  4KVM E;  2Z10 A;  4KLV A;  2DPS A;  2ZW7 A;  4C68 A;  5AG6 A;  4KOX A;  5IX3 A;  2VEZ A;  2R7H A;  4Y49 C;  4XPD C;  4PSX A;  1QSM A;  1KUV A;  4EVY A;  2B5G B;  2Z3P A;  4MFQ A;  1QST A;  4HKF A;  3ZJ0 A;  5GCN A;  1KZF A;  5I0C A;  2X7B A;  3H4Q A;  2WUU A;  3EY5 A;  4AG7 A;  4CS0 B;  2GAN A;  2C27 A;  4BMH A;  4UCP A;  4KVX A;  2FSR A;  5AG5 A;  4JWP A;  4NF1 A;  3JTK A;  2FS5 A;  1S7L A;  3K9U A;  1PU9 A;  4CYQ A;  1P0H A;  2A4N A;  4CYP A;  3R9F A;  1GHE A;  5HH1 A;  3S6H A;  2PDO A;  1MJA A;  2B4B A;  2OU2 A;  4HNY B;  1BOB A;  4KOU A;  3G3S A;  2KCW A;  4FD4 A;  4DNC A;  4F6A A;  5IB0 A;  2Y0M A;  4MY0 A;  5FVJ A;  4CAE A;  1S7N A;  3S6G A;  3WR7 A;  2GIV A;  3TO7 A;  2WSA A;  5BWA B;  2BL1 A;  2CNS A;  4XNH B;  3PGP A;  2Q4Y A;  4CYO A;  1U6M A;  4UWI A;  5EC4 A;  2QML A;  2J8N A;  2JEV A;  1BO4 A;  1YX0 A;  4KOY A;  1CJW A;  4E0A A;  4YGO A;  1MJ9 A;  4B13 A;  2VZY A;  5A27 A;  2B3V A;  4U9Z A;  3E0K A;  4C2Z A;  1S7F A;  2FE7 A;  3FRM A;  3EXN A;  4Q36 A;  4NEX A;  2Z3K A;  4R9M A;  5A28 A;  4OLL A;  5ISV A;  2JLM A;  4AVA A;  4KZT A;  3TTH A;  3RYO A;  3ZZI A;  2OZH A;  1MK4 A;  3FIX A;  4PK2 A;  3FXT A;  2Z0Z A;  1XIX A;  4CYN A;  4LX9 A;  4HNX B;  3DDD A;  4CAV A;  3PP9 A;  3S6F A;  4M85 A;  5G21 A;  3GY9 A;  4FD7 A;  4JLY A;  1Q2D A;  4C7I A;  4UFW A;  1Z9U A;  1YRE A;  4I49 A;  2ATR A;  4KOS A;  2B5G A;  3R96 A;  3S6K A;  1IID A;  2HV2 A;  4KUA A;  4KSF A;  4UWJ A;  3FB3 A;  4QC6 A;  4CAF A;  1Z4E A;  4YFJ A;  4H6Z A;  4GS4 A;  2HQY A;  1TIQ A;  4CRY B;  4OAD A;  2I00 A;  1QSR A;  2ARH A;  4MI4 A;  3UY5 A;  2YNE A;  2Q44 A;  2Z3O A;  2Z3M A;  3TOB A;  4NXY A;  3FNC A;  2FIW A;  5HMN A;  1S3Z A;  1VHS A;  4MHD A;  4MFP A;  4J3G A;  4B11 A;  2Q7B A;  3GKR A;  3TO9 A;  1M4G A;  3JVN A;  3IU1 A;  1YLE A;  4Y49 B;  4A33 A;  4XPD B;  4FD6 A;  2DPT A;  4UCN A;  5G22 A;  2WPW A;  1YVO A;  4CGO A;  3TOA A;  4NCZ A;  1NMT A;  1YR0 A;  2PSW A;  2OH1 A;  2K5T A;  4AG9 A;  2B4D B;  5AG7 A;  1Y9W A;  4R57 A;  1Y7R A;  2R8V A;  2EUI A;  3OWC A;  2ZW4 A;  2G3T A;  3EC4 A;  2DXQ A;  1NE9 A;  4B5O A;  4MBU A;  2WPX A;  4U5Y A;  1IYK A;  4KUB A;  4MFK A;  3B8G A;  3W6X A;  2PC1 A;  2REE A;  2PR8 A;  2CXA A;  1IIC A;  4B5P B;  4R3K A;  2BSW A;  3IGR A;  4CRZ B;  1XMT A;  4KOT A;  3I9S A;  2B3U A;  4C7H A;  3BJ8 A;  4UCM A;  2Q0Y A;  2CNT A;  2YNC A;  4U9Y A;  3TO6 A;  3NE7 A;  4CGP A;  4JXR A;  2ZW6 A;  1KUY A;  1N71 A;  4IF5 A;  4MFL A;  5DWM A;  4F0X A;  2ZW5 A;  2ZXV A;  1P4N A;  4XNH C;  4MJ8 A;  1S60 A;  2Z3L A;  2I79 A;  3QB8 A;  1Y9K A;  2VZZ A;  4KOV A;  2G3A A;  2CNM A;  4QUS A;  3CXQ A;  4BBH A;  1M4I A;  4AVC A;  4UFX A;  1Q2Y A;  3TFY A;  2YND A;  2YNC C;  2Z3N A;  1IYL A;  3QAH A;  4L89 A;  4X5K A;  2FCK A;  3DSB A;  3P2H A;  4MFJ A;  3D8P A;  4AVB A;  3R9E A;  4A2Z A;  2OZG A;  1XF8 A;  3V8I A;  4F0Y A;  4ORF A;  3FYN A;  5J8F A;  1XE4 A;  5CNP A;  4II9 A;  1UFH A;  2PR1 A;  5F48 A;  5F46 A;  2FXF A;  3IWG A;  4PV6 A;  4PSW A;  2P6E A;  2PQ8 A;  2FIA A;  1I12 A;  3LOD A;  3CXS A;  3T90 A;  2O28 A;  4UA3 A;  4RS2 A;  4CGL A;  1QSN A;  3DNS A;  4ONU A;  2QIR A;  2F5I A;  1M1D A;  3F8K A;  2RC4 A;  3H5Z A;  5H86 A;  1YGH A;  4KOW A;  2EVN A;  2R98 A;  1ZO0 A;  4A32 A;  3D2M A;  4CGN A;  2AJ6 A;  4RI1 A;  3SXN A;  5IV0 A;  3VWE A;  4UBR A;  2H5M A;  3BLN A;  1FY7 A;  2REF A;  4QBJ A;  3KKW A;  4R3L A;  3BJ7 A;  3W6S A;  1S5K A;  5EBV A;  4A30 A;  3PZJ A;  5G1Z A;  2ZPA A;  4H6U A;  4B10 A;  4JD6 A;  1WK4 A;  2G0B A;  4H89 A;  3I3G A;  2VBQ A;  3C26 A;  1NSL A;  2OZU A;  3W91 A;  5JQ4 A;  5KTD A;  4QB9 A;  3EO4 A;  3VWD A;  2IL4 A;  4B5P A;  4XPL A;  4Q38 A;  3F0A A;  2J8R A;  4FD5 A;  1S7K A;  3IU2 A;  2VI7 A;  4OAE A;  3DR6 A;  4XPK A;  2P0W A;  4L8A A;  4MFZ A;  5J8C A;  3TT2 A;  5H84 A;  4YRH A;  1R57 A;  1XEB A;  2QEC A;  1M4D A;  4UFV A;  2OB0 A;  4CAX A;  1IB1 E;  4M3S A;  4E2A A;  5E96 A;  5AG4 A;  3MGD A;  5C88 A;  3D2P A;  2P6G A;  3LD2 A;  1RXT A;  4R87 A;  4B14 A;  5KTA A;  3N7Z A;  4PK3 A;  2Q04 A;  2BUE A;  2R1I A;  4C2X A;  3DR8 A;  2JDC A;  1Q2C A;  3GYA A;  1K4J A;  4B12 A;  1J4J A;  3JUW A;  2VXK A;  3R95 A;  4K30 A;  5AGE A;  2D4P A;  5F49 A;  1WWZ A;  4KS9 A;  4KOR A;  3T9Y A;  2D4O A;  1B6B A;  3R1K A;  4ZBG A;  3R9G A;  4JXQ A;  3FBU A;  4MY3 A;  1LRZ A;  2PRB A;  3G8W A;  4E8O A;  3SHP A;  3TCV A;  1I1D A;  2J8M A;  1M44 A;  2VQY A;  2B58 A;  4KVO E;  4LUA A;  4A31 A;  3D3S A;  2FL4 A;  4C2Y A;  4AB7 A;  3P2F A;  3CXP A;  4CAW A;  1I21 A;  1OZP A;  1VKC A;  4QVT A;  4JJX A;  4NSQ A;  2CY2 A;  2P6F A;  1RO5 A;  4IUS A;  5JPH A;  2AE6 A;  1Z4R A;  2NMT A;  3F5B A;  3A9L A;  2FT0 A;  1KUX A;  1V0C A;  1L0C A;  4HNW B;  2HUZ A;  2GE3 A;  5G20 A;  4A95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...