3W6SA

Yeast n-acetyltransferase mpr1 involved in oxidative stress tolerance via proline metabolism
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
225
structure length
225
Chain Sequence
SIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAFPVFDTKYIPDSLINYLFKLFNLEIESGKTYPQLHSLTKQGFLNYWFHSFAVVVLQTDEKFIQDNQDWNSVLLGTFYIKPNYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPLLGYKYSIFNLVFVTNQASWKIWDKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIEPEFLSME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MPR1 protein
publication title Structural and functional analysis of the yeast N-acetyltransferase Mpr1 involved in oxidative stress tolerance via proline metabolism
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 59
structure length 225
sequence length 225
chains with identical sequence B, C
ec nomenclature ec 2.3.1.271: L-glutamate-5-semialdehyde N-acetyltransferase.
pdb deposition date 2013-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3w6sA00
3TOBA 2IL4A 4KOYA 1S3ZA 4IF5A 4CAVA 4KZTA 3V8IA 1IB1E 2O28A 3R9GA 2ARHA 4F0YA 2X7BA 3ZZIA 3SXNA 1S7FA 4OLLA 2HQYA 2PRBA 2PR1A 5GCNA 1S7NA 3IGRA 4KVOE 3IWGA 4JLYA 1IYKA 5HH1A 4ONUA 5F46A 2JLMA 1UFHA 3VWDA 5KTCA 4CAWA 2Q04A 3LD2A 2ZW4A 3CXPA 1P0HA 4KORA 3B8GA 1M4DA 2I00A 2B4DA 2J8MA 4AVAA 3R1KA 4R9MA 3TCVA 2VEZA 3F5BA 4RI1A 3TOAA 3G8WA 1KUYA 1NE9A 2GIVA 2REFA 4KOVA 1YK3A 2EUIA 2ZXVA 1QSNA 5IB0A 1VHSA 4L8AA 3VWEA 1I21A 4KOSA 4R3LA 2Q0YA 1MJBA 4MBUA 3E0KA 2OZUA 1Q2CA 4F6AA 5C88A 4QC6A 3DR8A 3S6KA 2P6FA 3KKWA 4K30A 1Z9UA 1XF8A 4XPDC 2B58A 5EC4A 3R9EA 2G0BA 4UWJA 2OB0A 2VZYA 2Z11A 1V0CA 2B5GB 2CNSA 2ZW5A 5J8FA 5C82A 1SQHA 4B5OA 2BEIA 2Q7BA 1QSRA 2FSRA 3TO6A 4Y49B 3CXSA 1ON0A 3PZJA 2VXKA 3DDDA 2Q44A 2P6EA 3PGPA 3F8KA 2ATRA 2DXQA 2G3TA 4R87A 2FIAA 1MJ9A 4FD5A 3S6FA 4KUAA 1M4GA 2G3AA 3FIXA 4B5PB 1L0CA 3NE7A 4FD7A 4MY0A 4OAEA 2FXFA 2PQ8A 3FXTA 4E2AA 2B3VA 2R1IA 4UWIA 1YGHA 4UA3A 4MJ8A 1XIXA 2FT0A 2K5TA 2FIWA 4U9YA 2Q4YA 3T90A 3T9YA 3FRMA 3TT2A 4QB9A 4H89A 1QSMA 4PSWA 5CNPA 4YGOA 1J4JA 1MJAA 3ZJ0A 1YVKA 1LRZA 5ISVA 2B4DB 2J8NA 2P6GA 5IV0A 3GYAA 1P4NA 1S5KA 4JD6A 5KTDA 2QIRA 3DSBA 1B6BA 3N7ZA 4LUAA 1YVOA 4XNHB 4MI4A 4KVME 4ORFA 2JEVA 2JDCA 4NCZA 2BUEA 3QB8A 4YFJA 1YR0A 4NSQA 2WPWA 2F5IA 4ZBGA 5F48A 2VZZA 4UBRA 4KOUA 2CNMA 1VKCA 1OZPA 5E96A 2C27A 1TIQA 2QECA 2HV2A 1RO5A 2D4OA 2GANA 5J8CA 4II9A 4FD6A 2OZHA 1BO4A 1QSOA 3F0AA 4E8OA 1Z4EA 1S7KA 4E0AA 3UY5A 2KCWA 1WK4A 1Q2DA 1WWZA 3FYNA 1KUVA 1I12A 2VQYA 4CS0B 1IYLA 5DWNA 3FB3A 1M1DA 2ZW7A 4IUSA 1FY7A 4XPDB 3K9UA 4NF1A 1Y7RA 1M4IA 3BLNA 4KLWA 3P2FA 1YX0A 1Y9KA 2Y0MA 2ZW6A 3RYOA 3GKRA 5H84A 4Y49C 1PU9A 2B3UA 2A4NA 4QBJA 3S6HA 2EVNA 3BJ7A 3C26A 1Y9WA 4L89A 4CRZB 5DWMA 5HMNA 2PDOA 1XE4A 4LX9A 2R98A 3OWCA 2FCKA 4PK3A 5I0CA 2Z10A 1GHEA 4M3SA 2AJ6A 2PC1A 3JVNA 4MY3A 3SXOA 3G3SA 3I3GA 3BJ8A 3PP9A 4RS2A 1PUAA 2NMTA 3D3SA 1XMTA 1NMTA 4XPKA 3D2PA 3W6SA 2R8VA 3SHPA 4R57A 4U9ZA 5FVJA 2VI7A 1XEBA 4KLVA 2PSWA 3GY9A 2QMLA 4MHDA 5IX3A 5JPHA 3EC4A 4KUBA 2OH1A 4BMHA 1R57A 2Q4VA 3S6GA 4KOXA 3H4QA 2CNTA 1KUXA 1IIDA 4AVBA 1K4JA 2GE3A 4JJXA 3D8PA 5H86A 2H5MA 5EBVA 5KTAA 2PR8A 1BOBA 3FBUA 2REEA 4XNHC 4CAXA 3I9SA 3DNSA 4U5YA 2BSWA 1N71A 3W91A 4HNWB 2JDDA 3EY5A 1IICA 1MK4A 3MGDA 2HUZA 4X5KA 1NSLA 4AG7A 4NEXA 4AVCA 4KOTA 3D2MA 4JWPA 1CM0A 4FD4A 2B4BA 4H6UA 1M44A 4KVXA 1B87A 1KZFA 3TTHA 4I49A 3FNCA 4J3GA 2Z0ZA 3LODA 3CXQA 4PSXA 2ZPAA 4PV6A 1I1DA 4GS4A 4EVYA 3R9FA 4XPLA 2AE6A 3TO7A 2OU2A 2BL1A 3WR7A 2D4PA 1YREA 2FL4A 4KOWA 4YRHA 2J8RA 1CJWA 2FS5A 4QVTA 3EO4A 2CY2A 5F47A 2R7HA 3W6XA 4CRYB 4DNCA 3TFYA 3R96A 2VBQA 1QSTA 2I79A 2B5GA 4JXRA 3QAHA 3P2HA 4H6ZA 2P0WA 4HNYB 4AB7A 1Q2YA 3R95A 2RC4A 4R3KA 5JQ4A 3TO9A 1U6MA 1S7LA 4NXYA 4OADA 4M85A 5F49A 1Z4RA 3EFAA 1YLEA 4HKFA 3DR6A 2OZGA 2FE7A 2WPXA 1S60A 3TE4A 4B5PA 3JUWA 4HNXB 4PK2A 4JXQA 3EXNA 4QUSA 1RXTA 4AG9A
chains in the Genus database with same CATH superfamily
3TOBA 2IL4A 4KOYA 3B3VA 1S3ZA 4IF5A 4CAVA 4KZTA 3V8IA 1VGYA 4YU9A 2PJBA 1IB1E 2O28A 3R9GA 2ARHA 4CAFA 4EMEA 1RTQA 1CP6A 1F2OA 2X7BA 4P4EA 1S7FA 3SXNA 2PIZA 2AFOA 2Z3LA 2HQYA 3KL9A 2PRBA 2PR1A 3MRUA 4OLLA 3T8WA 5GCNA 2CF4A 1S7NA 1ARMA 3IGRA 4KVOE 2WUUA 3IWGA 3D7GA 4X8IA 4JLYA 1IYKA 1VHOA 4P44A 5HH1A 1ZG7A 1JQGA 4ONUA 2ODFA 3KZWA 1ZO0A 2Z3NA 5F46A 2JLMA 3KGQA 1UFHA 1X12A 3IFEA 3VWDA 5KTCA 4CAWA 2Q04A 3LD2A 5JGFA 1Z8TA 2PJ0A 3RNZA 4CYQA 2ZW4A 3CXPA 4CGOA 1P0HA 3KHXA 4KORA 3B8GA 1M4DA 2I00A 2B4DA 2J8MA 3A9LA 3KQXA 3PFOA 3R1KA 4OC2A 4AVAA 4R9MA 5G1ZA 3TCVA 4C2ZA 3PB9X 4UFVA 4FBEA 2VEZA 3F5BA 1CPXA 4RI1A 3TOAA 4F0YA 7CPAA 3G8WA 1KUYA 3ZZIA 2YNCA 4K3NA 1NE9A 4NJQA 2GIVA 3VATA 2REFA 4KOVA 4PPZA 1QQ9A 4PXCA 4CGPA 1YK3A 2EUIA 2ZXVA 4MCSA 1QSNA 5D8NA 5IB0A 2PRQA 1VHSA 2ZENA 4L8AA 4YWYA 1ZLIA 3VWEA 1I21A 4KOSA 4Z65A 4R3LA 4H2KA 2Q0YA 1XOVA 4CPAA 1MJBA 2EO8A 4MBUA 3E0KA 2OZUA 1Q2CA 4F6AA 4F8ZA 5C88A 4QC6A 3DR8A 3S6KA 1VHEA 2C6CA 2P6FA 1TKFA 1QMUA 1Z2LA 3KKWA 4MFPA 4K30A 1LCPA 1Z9UA 1BLLE 2ZEHA 1XF8A 3CZXA 2Q7SA 3FMCA 2VL1A 2B58A 4XPDC 2GLJA 4OKOA 5EC4A 3R9EA 3D66A 2PIYA 2G0BA 2PJ4A 4UWJA 2OB0A 2RFHA 2Z3OA 2VZYA 2Q43A 2Z11A 4MHNA 3FEEA 1V0CA 1Z8XA 3K2KA 2B5GB 3JTKA 4CGNA 4F9VA 2CNSA 4PXEA 1F2PA 2ZW5A 3IWWA 3VH9A 4OMEA 4MHPA 4CGMA 5J8FA 4GXHA 2Q4ZA 5C82A 3RAMA 1SQHA 4B5OA 4TNUA 2BEIA 1IY7A 4UIBA 2FSRA 1QSRA 3MN8A 2Q7BA 2YNEA 3SJEA 3TO6A 1HDQA 4R8FA 5LYFA 2ANPA 2XEIA 3CXSA 4Y49B 1CP7A 1ON0A 3PZJA 5K8OA 2VXKA 3DDDA 2XEGA 2Q44A 2P6EA 2ZEOA 3PGPA 4C2YA 1BAVA 5EMIA 1YSJA 3F8KA 4DJLA 2ATRA 2DXQA 2G3TA 3LWUA 4R87A 4R6TA 2FIAA 4A37A 3NFZA 1ELLP 1AYEA 1MJ9A 4FD5A 3S6FA 4KUAA 4MFQA 1NSAA 1M4GA 2PJ3A 3B7IA 3HUVA 2AFZA 2G3AA 3FIXA 3PB7X 4B5PB 1L0CA 3CPXA 3ISZA 3NE7A 4FD7A 4MY0A 2DF5A 5AGEA 4OAEA 4MFLA 2FXFA 4MFJA 2PQ8A 4JYWA 3FXTA 2CTBA 4E2AA 5G20A 2B3VA 2R1IA 4UWIA 4JZ0A 2BO9A 2F7VA 1R3NA 1X10A 1LAMA 1YGHA 5CBMA 3B3SA 1FNOA 3GIUA 3NA6A 4UA3A 2RB7A 1EE3P 2ZEPA 4MJ8A 4X3RA 1XIXA 4C68A 2FT0A 3IIBA 3SI0A 2K5TA 3KI9A 4NGRA 3V7ZA 2FIWA 4U9YA 5K8MA 2Q4YA 3T90A 3T9YA 5LYIA 3RBUA 4KSIA 4A30A 2HB6A 2PJ6A 5G21A 3FRMA 4MFKA 3TT2A 4CYOA 1H8LA 4QB9A 2JBJA 5HVFA 2CTCA 2JEWA 2JBKA 5A28A 4H89A 3BI1A 2QYVA 8CPAA 4MRIA 1QSMA 1BPNA 1KWMA 4PSWA 2V8VA 4ZYQA 4UEEA 4B14A 5CNPA 4A31A 4YGOA 4A2ZA 5ELYA 1J4JA 1MJAA 2PVVA 3ZJ0A 5HVHA 1YVKA 1LRZA 1R43A 5ISVA 2B4DB 2J8NA 1M4LA 1TF8A 2P6GA 2AFUA 5D29A 3CDXA 5IV0A 3GYAA 4B10A 4MFZA 4KS9A 3LMSA 1P4NA 1S5KA 3GB0A 5JH9A 3NH8A 3ISXA 1TF9A 4ONWA 1JWQA 4JD6A 5KTDA 3D4UA 1HEEA 2QIRA 3DSBA 3PBEA 2AFSA 1B6BA 3N7ZA 2YNCC 4LUAA 1YVOA 4IAVA 4FWUA 1PYTB 2EWBA 2O53A 5J1QA 2PJ8A 1UWYA 4XNHB 3KR5A 4MI4A 1ARLA 4KVME 4B12A 4M6GA 4ORFA 2QJ8A 1CG2A 2JEVA 4P4DA 2I3CA 2JDCA 2NYQA 3FX6A 5AG6A 2HC9A 4NCZA 2BUEA 2YGWA 4NGNA 4PXBA 4ZY2A 4EFDA 4RUHA 4X2TA 3QB8A 4NGPA 2V8GA 4OP4A 4YFJA 1YR0A 2F8HA 4NSQA 2WPWA 2F5IA 3WC7A 3PEIA 1Q7LA 2DPSA 4ZBGA 5F48A 5LRJA 4C7IA 2AFWA 2VZZA 3SI1A 4FAIA 4B11A 3NE8A 4ZX9A 4UBRA 4KOUA 2CNMA 1VKCA 4P45A 1OZPA 4UEFA 4MCRA 4OC4A 5E96A 2C27A 1TIQA 2QECA 2HV2A 1XFOA 1RO5A 2ZEDA 3B35A 4WWVA 2D4OA 2GANA 3D7HA 1ZG8A 4PQAA 5J8CA 4II9A 4FD6A 2OZHA 1BO4A 1QSOA 3F0AA 3BHXA 1Z4EA 1S7KA 3D7FA 4A32A 4E8OA 4P10A 2GREA 4E0AA 4OC1A 3UY5A 4A38A 3D7DA 2KCWA 4P4BA 4UFXA 1WK4A 4R76A 5K8PA 1Q2DA 1WWZA 3FYNA 1KUVA 1I12A 2VQYA 4TWEA 1IYLA 5DWNA 4CS0B 3FB3A 3S9MA 4O23A 1M1DA 2ZW7A 4MMOA 4IUSA 1FY7A 3HLPA 4KSAA 4XPDB 3K9UA 3IEHA 4NF1A 3BXMA 1CX8A 2V8DA 4BD9A 4IHMA 1Y7RA 2CXAA 4Q36A 3H8FA 1M4IA 3BLNA 4KLWA 2IMOA 2DPTA 3P2FA 3D68A 1YX0A 4NGQA 1Y9KA 2Y0MA 2ZW6A 4B6ZA 1Y0RA 3JRUA 4M6IA 4Q7AA 3GKRA 3RYOA 3SJXA 5H84A 4Y49C 3TC8A 4A33A 1PU9A 2GLFA 1AMPA 4CAEA 2B3UA 2PJCA 2A4NA 4F9UA 4QBJA 3S6HA 4MCPA 3PBBA 4LQ6A 4UF4A 2EVNA 3BJ7A 4LQGA 3LACA 2WYRA 3C26A 1OBRA 4ZI6A 1Y9WA 4L89A 4CRZB 4W9YA 2PJ7A 5DWMA 2GFQA 4NJRA 5HMNA 1TKHA 2PDOA 3DLJA 1XE4A 4PXDA 3RO0A 4LX9A 4P4JA 4P4FA 2R98A 3OWCA 2FCKA 4PK3A 5I0CA 2Z10A 1GHEA 4M3SA 2AJ6A 2PC1A 3JVNA 5DS0A 1XRYA 4MY3A 2PJAA 3SXOA 4DYOA 5HXDA 3G3SA 2OR4A 3I3GA 3BJ8A 3PP9A 3KR4A 4RS2A 1PUAA 2NMTA 4Q38A 3D3SA 4GM5A 1XMTA 2PJ1A 4UEZA 4UCPA 3I1UA 1LAPA 2C1CA 2ZEEA 3IU1A 4AXVA 1NMTA 2WZNA 3FECA 4XPKA 3D2PA 3W6SA 2R8VA 3SHPA 4R57A 4U9ZA 4DUKA 5FVJA 3V38A 4P4IA 2VI7A 2V8HA 1A2ZA 1XEBA 2ZOGA 4KLVA 2PSWA 3S9NA 3GY9A 2QMLA 4MHDA 2ZEFA 4ZY0A 5IX3A 3N5FA 5JPHA 1PCAA 2ZELA 3EC4A 1XBUA 3PB4X 4KUBA 2OH1A 4BMHA 1R57A 2Q4VA 3S6GA 4KOXA 3H4QA 3S9LA 3CT9A 4MXUA 3WC5A 2CNTA 2C6PA 1KUXA 4NGTA 2FVGA 3KQZA 1IIDA 4AVBA 2EBJA 1K4JA 1YQEA 3IWEA 2GE3A 3PB8X 4A95A 4JJXA 3D8PA 2PVWA 5H86A 2H5MA 1IOFA 1YW6A 1YMEA 5EBVA 5KTAA 4UIAA 2POKA 4UCMA 3IO1A 2PR8A 1BOBA 3BI0A 3FBUA 5G22A 2XEFA 1CPSA 3H8EA 2REEA 3RZAA 4A94A 2Z3MA 4XNHC 3IC1A 4CAXA 3I9SA 3QAYA 2CIJA 3DNSA 2O4HA 4U5YA 2IQ6A 4OC5A 1TXRA 2BSWA 5THWA 1N71A 1FT7A 3PRTA 4CGLA 3W91A 6CPAA 4HNWB 2JDDA 3EY5A 4MHYA 1IICA 4FUUA 1LFWA 1MK4A 4A39A 3B2YA 3SJGA 1Y7EA 3MGDA 2HUZA 4X5KA 4NGSA 1LOKA 1NSLA 2EK9A 1XJOA 3FJUA 1GYTA 4NEXA 4KOTA 3D2MA 5AG7A 3GUXA 4AG7A 4AVCA 4HPSA 5AG4A 4RN7A 2YNDA 4JWPA 5CPAA 1CM0A 3B3CA 4FD4A 1VIXA 5BWAB 4UFWA 2B4BA 2C6GA 4H6UA 1M44A 4KVXA 3IJ3A 3NH4A 1B87A 1KZFA 2DEAA 2J9AA 3TTHA 2AFXA 4I49A 3FNCA 3L2NA 4J3GA 4OC3A 2Z0ZA 3LODA 3CXQA 4PSXA 2ZPAA 1Z8WA 4PV6A 2PE3A 4ZGYB 3NH5A 1I1DA 2Z3KA 4MHZA 2PJ5A 3B3WA 3D67A 3TX8A 4GS4A 4EVYA 2EK8A 1IU8A 3R9FA 4XPLA 1Z8LA 4ZX8A 4OC0A 4EWTA 5A27A 1HDUA 2AE6A 5I4MA 3TO7A 3FVLA 2OU2A 3FF3A 2BL1A 4BBHA 1BPMA 1DE4C 4KSFA 3WR7A 2D4PA 2PCUA 1ZG9A 4UCNA 4C2XA 1YREA 2FL4A 2IJZA 3GLJA 4NGMA 2XEJA 1DTDA 5JM6A 4KOWA 4YRHA 2J8RA 2Q51A 2BOAA 1AUGA 1CJWA 2ZEMA 2FS5A 4OIDA 4QVTA 3FH4A 4CYPA 5LYLA 3EO4A 2CY2A 5F47A 2R7HA 2WSAA 3KHZA 2ABZA 3B3TA 3WC6A 5F09A 3VARA 1Z5RA 1F57A 1ZLHA 2QVPA 1YW4A 3W6XA 4CRYB 5LRKA 3SI2A 2ZOFA 5LYDA 4DNCA 3TFYA 4P6YA 3R96A 4CYNA 3FEDA 3H8GA 2VBQA 1QSTA 2I79A 2B5GA 2GU2A 2PJ9A 4JXRA 3PFEA 3QAHA 3P2HA 1LANA 4H6ZA 5AG5A 2P0WA 4HNYB 3WABA 3WT4A 4AB7A 4BINA 5K8NA 1TKJA 1Q2YA 4IK2A 4WJBA 1YLOA 2RC4A 3R95A 2OOTA 4R3KA 1ELMP 4G1PA 3KASA 1IGBA 1CBXA 3DGVA 5JQ4A 3TO9A 1U6MA 2G9DA 1S7LA 4NXYA 4MCQA 2NSMA 4OADA 4OIWA 3K9TA 4F0XA 4M85A 3CPAA 1Z4RA 3EFAA 1YLEA 1Y0YA 2AFMA 4HKFA 5F49A 4C7HA 5HVGA 3DR6A 2OZGA 1IOIA 2ZEGA 3H5ZA 4B13A 2FE7A 1XMBA 2WPXA 1S60A 2BCOA 2Z3PA 3PB6X 5IB9A 3TE4A 5LRGA 4M6HA 4R7MA 4ZY1A 4B5PA 3JUWA 3IU2A 4HNXB 4PK2A 3SJFA 2V77A 3QNVA 4JXQA 2PJ2A 3EXNA 4QUSA 1RXTA 4NFRA 4AG9A
chains in the Genus database with same CATH topology
3TOBA 2IL4A 4KOYA 1S3ZA 4IF5A 4CAVA 4KZTA 3V8IA 1IB1E 2O28A 3R9GA 2ARHA 4CAFA 4F0YA 2X7BA 3ZZIA 3SXNA 1S7FA 2Z3LA 2HQYA 4OLLA 2PRBA 2PR1A 5GCNA 1S7NA 3IGRA 4KVOE 2WUUA 3IWGA 4JLYA 1IYKA 5HH1A 4ONUA 5F46A 1ZO0A 2Z3NA 2JLMA 1UFHA 3VWDA 5KTCA 4CAWA 2Q04A 3LD2A 4CYQA 2ZW4A 3CXPA 4CGOA 1P0HA 4KORA 3B8GA 1M4DA 2I00A 2B4DA 2J8MA 3A9LA 4AVAA 3R1KA 4R9MA 5G1ZA 3TCVA 4C2ZA 4UFVA 2VEZA 3F5BA 4RI1A 3TOAA 3G8WA 1KUYA 2YNCA 1NE9A 2GIVA 2REFA 4KOVA 4CGPA 1YK3A 2EUIA 2ZXVA 1QSNA 5IB0A 1VHSA 4L8AA 3VWEA 1I21A 4KOSA 4R3LA 2Q0YA 1MJBA 4MBUA 3E0KA 2OZUA 1Q2CA 4F6AA 5C88A 4QC6A 3DR8A 3S6KA 2P6FA 3KKWA 4MFPA 4K30A 1Z9UA 1XF8A 4XPDC 2B58A 5EC4A 3R9EA 2G0BA 4UWJA 2OB0A 2Z3OA 2VZYA 2Z11A 1V0CA 2B5GB 3JTKA 4CGNA 2CNSA 2ZW5A 4CGMA 5J8FA 5C82A 1SQHA 4B5OA 2BEIA 2Q7BA 1QSRA 2FSRA 3TO6A 2YNEA 4Y49B 3CXSA 1ON0A 3PZJA 2VXKA 3DDDA 2Q44A 2P6EA 3PGPA 4C2YA 3F8KA 2ATRA 2DXQA 2G3TA 4R87A 2FIAA 1MJ9A 4FD5A 3S6FA 4KUAA 4MFQA 1M4GA 2G3AA 3FIXA 4B5PB 1L0CA 3NE7A 4FD7A 4MY0A 5AGEA 4OAEA 4MFLA 2FXFA 4MFJA 2PQ8A 3FXTA 4E2AA 5G20A 2B3VA 2R1IA 4UWIA 1YGHA 4UA3A 4MJ8A 1XIXA 4C68A 2FT0A 2K5TA 2FIWA 4U9YA 2Q4YA 3T90A 3T9YA 4A30A 5G21A 3FRMA 4MFKA 3TT2A 4CYOA 4QB9A 5A28A 4H89A 1QSMA 4PSWA 4B14A 5CNPA 4A31A 4YGOA 4A2ZA 1J4JA 1MJAA 3ZJ0A 1YVKA 1LRZA 5ISVA 2B4DB 2J8NA 2P6GA 5IV0A 3GYAA 4B10A 4MFZA 4KS9A 1P4NA 1S5KA 4JD6A 5KTDA 2QIRA 3DSBA 1B6BA 3N7ZA 2YNCC 4LUAA 1YVOA 4XNHB 4MI4A 4KVME 4B12A 4ORFA 2JEVA 2JDCA 5AG6A 4NCZA 2BUEA 2YGWA 3QB8A 4YFJA 1YR0A 4NSQA 2WPWA 2F5IA 2DPSA 4ZBGA 5F48A 4C7IA 2VZZA 4B11A 4UBRA 4KOUA 2CNMA 1VKCA 1OZPA 5E96A 2C27A 1TIQA 2QECA 2HV2A 1RO5A 2D4OA 2GANA 5J8CA 4II9A 4FD6A 2OZHA 1BO4A 1QSOA 3F0AA 4A32A 1Z4EA 1S7KA 4E8OA 4E0AA 3UY5A 2KCWA 4UFXA 1WK4A 1Q2DA 1WWZA 3FYNA 1KUVA 1I12A 2VQYA 4CS0B 1IYLA 5DWNA 3FB3A 1M1DA 2ZW7A 4IUSA 1FY7A 4XPDB 4KSAA 3K9UA 4NF1A 1Y7RA 2CXAA 4Q36A 1M4IA 3BLNA 4KLWA 2DPTA 3P2FA 1YX0A 1Y9KA 2Y0MA 2ZW6A 3RYOA 3GKRA 4A33A 5H84A 4Y49C 1PU9A 4CAEA 2B3UA 2A4NA 4QBJA 3S6HA 2EVNA 3BJ7A 3C26A 1Y9WA 4L89A 4CRZB 5DWMA 5HMNA 2PDOA 1XE4A 4LX9A 2R98A 3OWCA 2FCKA 4PK3A 5I0CA 2Z10A 1GHEA 4M3SA 2AJ6A 2PC1A 3JVNA 4MY3A 3SXOA 3G3SA 3I3GA 3BJ8A 3PP9A 4RS2A 1PUAA 2NMTA 4Q38A 3D3SA 4UCPA 1XMTA 3IU1A 1NMTA 4XPKA 3D2PA 3W6SA 2R8VA 3SHPA 4R57A 4U9ZA 5FVJA 2VI7A 1XEBA 4KLVA 2PSWA 3GY9A 2QMLA 4MHDA 5IX3A 5JPHA 3EC4A 4KUBA 2OH1A 4BMHA 1R57A 2Q4VA 3S6GA 4KOXA 3H4QA 2CNTA 1KUXA 1IIDA 4AVBA 1K4JA 3IWEA 2GE3A 4A95A 4JJXA 3D8PA 5H86A 2H5MA 5EBVA 5KTAA 4UCMA 2PR8A 1BOBA 3FBUA 5G22A 2REEA 2Z3MA 4XNHC 4CAXA 3I9SA 3DNSA 4U5YA 2BSWA 4CGLA 1N71A 3W91A 4HNWB 2JDDA 3EY5A 1IICA 1MK4A 3MGDA 2HUZA 4X5KA 1NSLA 5AG7A 4NEXA 4AG7A 4AVCA 4KOTA 3D2MA 5AG4A 2YNDA 4JWPA 1CM0A 4FD4A 5BWAB 4UFWA 2B4BA 4H6UA 1M44A 4KVXA 1B87A 1KZFA 3TTHA 4I49A 3FNCA 4J3GA 2Z0ZA 3LODA 3CXQA 4PSXA 2ZPAA 4PV6A 4ZGYB 1I1DA 2Z3KA 4GS4A 4EVYA 3R9FA 4XPLA 5A27A 2AE6A 3TO7A 2OU2A 4BBHA 2BL1A 3WR7A 4KSFA 2D4PA 4UCNA 4C2XA 1YREA 2FL4A 4KOWA 4YRHA 2J8RA 1CJWA 2FS5A 4QVTA 4CYPA 3EO4A 2CY2A 5F47A 2R7HA 2WSAA 3W6XA 4CRYB 4DNCA 3TFYA 3R96A 4CYNA 2VBQA 1QSTA 2I79A 2B5GA 4JXRA 3QAHA 3P2HA 4H6ZA 5AG5A 2P0WA 4HNYB 4AB7A 1Q2YA 3R95A 2RC4A 4R3KA 5JQ4A 3TO9A 1U6MA 1S7LA 4NXYA 4OADA 4F0XA 4M85A 5F49A 1Z4RA 3EFAA 1YLEA 4HKFA 4C7HA 3DR6A 2OZGA 3H5ZA 4B13A 2FE7A 2WPXA 1S60A 2Z3PA 3TE4A 4B5PA 3JUWA 3IU2A 4HNXB 4PK2A 4JXQA 3EXNA 4QUSA 1RXTA 4AG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOB A;  2IL4 A;  4KOY A;  1S3Z A;  4IF5 A;  4CAV A;  4KZT A;  3V8I A;  1IB1 E;  2O28 A;  3R9G A;  2ARH A;  4F0Y A;  2X7B A;  3ZZI A;  3SXN A;  1S7F A;  4OLL A;  2HQY A;  2PRB A;  2PR1 A;  5GCN A;  1S7N A;  3IGR A;  4KVO E;  3IWG A;  4JLY A;  1IYK A;  5HH1 A;  4ONU A;  5F46 A;  2JLM A;  1UFH A;  3VWD A;  5KTC A;  4CAW A;  2Q04 A;  3LD2 A;  2ZW4 A;  3CXP A;  1P0H A;  4KOR A;  3B8G A;  1M4D A;  2I00 A;  2B4D A;  2J8M A;  4AVA A;  3R1K A;  4R9M A;  3TCV A;  2VEZ A;  3F5B A;  4RI1 A;  3TOA A;  3G8W A;  1KUY A;  1NE9 A;  2GIV A;  2REF A;  4KOV A;  1YK3 A;  2EUI A;  2ZXV A;  1QSN A;  5IB0 A;  1VHS A;  4L8A A;  3VWE A;  1I21 A;  4KOS A;  4R3L A;  2Q0Y A;  1MJB A;  4MBU A;  3E0K A;  2OZU A;  1Q2C A;  4F6A A;  5C88 A;  4QC6 A;  3DR8 A;  3S6K A;  2P6F A;  3KKW A;  4K30 A;  1Z9U A;  1XF8 A;  4XPD C;  2B58 A;  5EC4 A;  3R9E A;  2G0B A;  4UWJ A;  2OB0 A;  2VZY A;  2Z11 A;  1V0C A;  2B5G B;  2CNS A;  2ZW5 A;  5J8F A;  5C82 A;  1SQH A;  4B5O A;  2BEI A;  2Q7B A;  1QSR A;  2FSR A;  3TO6 A;  4Y49 B;  3CXS A;  1ON0 A;  3PZJ A;  2VXK A;  3DDD A;  2Q44 A;  2P6E A;  3PGP A;  3F8K A;  2ATR A;  2DXQ A;  2G3T A;  4R87 A;  2FIA A;  1MJ9 A;  4FD5 A;  3S6F A;  4KUA A;  1M4G A;  2G3A A;  3FIX A;  4B5P B;  1L0C A;  3NE7 A;  4FD7 A;  4MY0 A;  4OAE A;  2FXF A;  2PQ8 A;  3FXT A;  4E2A A;  2B3V A;  2R1I A;  4UWI A;  1YGH A;  4UA3 A;  4MJ8 A;  1XIX A;  2FT0 A;  2K5T A;  2FIW A;  4U9Y A;  2Q4Y A;  3T90 A;  3T9Y A;  3FRM A;  3TT2 A;  4QB9 A;  4H89 A;  1QSM A;  4PSW A;  5CNP A;  4YGO A;  1J4J A;  1MJA A;  3ZJ0 A;  1YVK A;  1LRZ A;  5ISV A;  2B4D B;  2J8N A;  2P6G A;  5IV0 A;  3GYA A;  1P4N A;  1S5K A;  4JD6 A;  5KTD A;  2QIR A;  3DSB A;  1B6B A;  3N7Z A;  4LUA A;  1YVO A;  4XNH B;  4MI4 A;  4KVM E;  4ORF A;  2JEV A;  2JDC A;  4NCZ A;  2BUE A;  3QB8 A;  4YFJ A;  1YR0 A;  4NSQ A;  2WPW A;  2F5I A;  4ZBG A;  5F48 A;  2VZZ A;  4UBR A;  4KOU A;  2CNM A;  1VKC A;  1OZP A;  5E96 A;  2C27 A;  1TIQ A;  2QEC A;  2HV2 A;  1RO5 A;  2D4O A;  2GAN A;  5J8C A;  4II9 A;  4FD6 A;  2OZH A;  1BO4 A;  1QSO A;  3F0A A;  4E8O A;  1Z4E A;  1S7K A;  4E0A A;  3UY5 A;  2KCW A;  1WK4 A;  1Q2D A;  1WWZ A;  3FYN A;  1KUV A;  1I12 A;  2VQY A;  4CS0 B;  1IYL A;  5DWN A;  3FB3 A;  1M1D A;  2ZW7 A;  4IUS A;  1FY7 A;  4XPD B;  3K9U A;  4NF1 A;  1Y7R A;  1M4I A;  3BLN A;  4KLW A;  3P2F A;  1YX0 A;  1Y9K A;  2Y0M A;  2ZW6 A;  3RYO A;  3GKR A;  5H84 A;  4Y49 C;  1PU9 A;  2B3U A;  2A4N A;  4QBJ A;  3S6H A;  2EVN A;  3BJ7 A;  3C26 A;  1Y9W A;  4L89 A;  4CRZ B;  5DWM A;  5HMN A;  2PDO A;  1XE4 A;  4LX9 A;  2R98 A;  3OWC A;  2FCK A;  4PK3 A;  5I0C A;  2Z10 A;  1GHE A;  4M3S A;  2AJ6 A;  2PC1 A;  3JVN A;  4MY3 A;  3SXO A;  3G3S A;  3I3G A;  3BJ8 A;  3PP9 A;  4RS2 A;  1PUA A;  2NMT A;  3D3S A;  1XMT A;  1NMT A;  4XPK A;  3D2P A;  3W6S A;  2R8V A;  3SHP A;  4R57 A;  4U9Z A;  5FVJ A;  2VI7 A;  1XEB A;  4KLV A;  2PSW A;  3GY9 A;  2QML A;  4MHD A;  5IX3 A;  5JPH A;  3EC4 A;  4KUB A;  2OH1 A;  4BMH A;  1R57 A;  2Q4V A;  3S6G A;  4KOX A;  3H4Q A;  2CNT A;  1KUX A;  1IID A;  4AVB A;  1K4J A;  2GE3 A;  4JJX A;  3D8P A;  5H86 A;  2H5M A;  5EBV A;  5KTA A;  2PR8 A;  1BOB A;  3FBU A;  2REE A;  4XNH C;  4CAX A;  3I9S A;  3DNS A;  4U5Y A;  2BSW A;  1N71 A;  3W91 A;  4HNW B;  2JDD A;  3EY5 A;  1IIC A;  1MK4 A;  3MGD A;  2HUZ A;  4X5K A;  1NSL A;  4AG7 A;  4NEX A;  4AVC A;  4KOT A;  3D2M A;  4JWP A;  1CM0 A;  4FD4 A;  2B4B A;  4H6U A;  1M44 A;  4KVX A;  1B87 A;  1KZF A;  3TTH A;  4I49 A;  3FNC A;  4J3G A;  2Z0Z A;  3LOD A;  3CXQ A;  4PSX A;  2ZPA A;  4PV6 A;  1I1D A;  4GS4 A;  4EVY A;  3R9F A;  4XPL A;  2AE6 A;  3TO7 A;  2OU2 A;  2BL1 A;  3WR7 A;  2D4P A;  1YRE A;  2FL4 A;  4KOW A;  4YRH A;  2J8R A;  1CJW A;  2FS5 A;  4QVT A;  3EO4 A;  2CY2 A;  5F47 A;  2R7H A;  3W6X A;  4CRY B;  4DNC A;  3TFY A;  3R96 A;  2VBQ A;  1QST A;  2I79 A;  2B5G A;  4JXR A;  3QAH A;  3P2H A;  4H6Z A;  2P0W A;  4HNY B;  4AB7 A;  1Q2Y A;  3R95 A;  2RC4 A;  4R3K A;  5JQ4 A;  3TO9 A;  1U6M A;  1S7L A;  4NXY A;  4OAD A;  4M85 A;  5F49 A;  1Z4R A;  3EFA A;  1YLE A;  4HKF A;  3DR6 A;  2OZG A;  2FE7 A;  2WPX A;  1S60 A;  3TE4 A;  4B5P A;  3JUW A;  4HNX B;  4PK2 A;  4JXQ A;  3EXN A;  4QUS A;  1RXT A;  4AG9 A; 
#chains in the Genus database with same CATH topology
 3TOB A;  2IL4 A;  4KOY A;  3B3V A;  1S3Z A;  4IF5 A;  4CAV A;  4KZT A;  3V8I A;  1VGY A;  4YU9 A;  2PJB A;  1IB1 E;  2O28 A;  3R9G A;  2ARH A;  4CAF A;  4EME A;  1RTQ A;  1CP6 A;  1F2O A;  2X7B A;  4P4E A;  1S7F A;  3SXN A;  2PIZ A;  2AFO A;  2Z3L A;  2HQY A;  3KL9 A;  2PRB A;  2PR1 A;  3MRU A;  4OLL A;  3T8W A;  5GCN A;  2CF4 A;  1S7N A;  1ARM A;  3IGR A;  4KVO E;  2WUU A;  3IWG A;  3D7G A;  4X8I A;  4JLY A;  1IYK A;  1VHO A;  4P44 A;  5HH1 A;  1ZG7 A;  1JQG A;  4ONU A;  2ODF A;  3KZW A;  1ZO0 A;  2Z3N A;  5F46 A;  2JLM A;  3KGQ A;  1UFH A;  1X12 A;  3IFE A;  3VWD A;  5KTC A;  4CAW A;  2Q04 A;  3LD2 A;  5JGF A;  1Z8T A;  2PJ0 A;  3RNZ A;  4CYQ A;  2ZW4 A;  3CXP A;  4CGO A;  1P0H A;  3KHX A;  4KOR A;  3B8G A;  1M4D A;  2I00 A;  2B4D A;  2J8M A;  3A9L A;  3KQX A;  3PFO A;  3R1K A;  4OC2 A;  4AVA A;  4R9M A;  5G1Z A;  3TCV A;  4C2Z A;  3PB9 X;  4UFV A;  4FBE A;  2VEZ A;  3F5B A;  1CPX A;  4RI1 A;  3TOA A;  4F0Y A;  7CPA A;  3G8W A;  1KUY A;  3ZZI A;  2YNC A;  4K3N A;  1NE9 A;  4NJQ A;  2GIV A;  3VAT A;  2REF A;  4KOV A;  4PPZ A;  1QQ9 A;  4PXC A;  4CGP A;  1YK3 A;  2EUI A;  2ZXV A;  4MCS A;  1QSN A;  5D8N A;  5IB0 A;  2PRQ A;  1VHS A;  2ZEN A;  4L8A A;  4YWY A;  1ZLI A;  3VWE A;  1I21 A;  4KOS A;  4Z65 A;  4R3L A;  4H2K A;  2Q0Y A;  1XOV A;  4CPA A;  1MJB A;  2EO8 A;  4MBU A;  3E0K A;  2OZU A;  1Q2C A;  4F6A A;  4F8Z A;  5C88 A;  4QC6 A;  3DR8 A;  3S6K A;  1VHE A;  2C6C A;  2P6F A;  1TKF A;  1QMU A;  1Z2L A;  3KKW A;  4MFP A;  4K30 A;  1LCP A;  1Z9U A;  1BLL E;  2ZEH A;  1XF8 A;  3CZX A;  2Q7S A;  3FMC A;  2VL1 A;  2B58 A;  4XPD C;  2GLJ A;  4OKO A;  5EC4 A;  3R9E A;  3D66 A;  2PIY A;  2G0B A;  2PJ4 A;  4UWJ A;  2OB0 A;  2RFH A;  2Z3O A;  2VZY A;  2Q43 A;  2Z11 A;  4MHN A;  3FEE A;  1V0C A;  1Z8X A;  3K2K A;  2B5G B;  3JTK A;  4CGN A;  4F9V A;  2CNS A;  4PXE A;  1F2P A;  2ZW5 A;  3IWW A;  3VH9 A;  4OME A;  4MHP A;  4CGM A;  5J8F A;  4GXH A;  2Q4Z A;  5C82 A;  3RAM A;  1SQH A;  4B5O A;  4TNU A;  2BEI A;  1IY7 A;  4UIB A;  2FSR A;  1QSR A;  3MN8 A;  2Q7B A;  2YNE A;  3SJE A;  3TO6 A;  1HDQ A;  4R8F A;  5LYF A;  2ANP A;  2XEI A;  3CXS A;  4Y49 B;  1CP7 A;  1ON0 A;  3PZJ A;  5K8O A;  2VXK A;  3DDD A;  2XEG A;  2Q44 A;  2P6E A;  2ZEO A;  3PGP A;  4C2Y A;  1BAV A;  5EMI A;  1YSJ A;  3F8K A;  4DJL A;  2ATR A;  2DXQ A;  2G3T A;  3LWU A;  4R87 A;  4R6T A;  2FIA A;  4A37 A;  3NFZ A;  1ELL P;  1AYE A;  1MJ9 A;  4FD5 A;  3S6F A;  4KUA A;  4MFQ A;  1NSA A;  1M4G A;  2PJ3 A;  3B7I A;  3HUV A;  2AFZ A;  2G3A A;  3FIX A;  3PB7 X;  4B5P B;  1L0C A;  3CPX A;  3ISZ A;  3NE7 A;  4FD7 A;  4MY0 A;  2DF5 A;  5AGE A;  4OAE A;  4MFL A;  2FXF A;  4MFJ A;  2PQ8 A;  4JYW A;  3FXT A;  2CTB A;  4E2A A;  5G20 A;  2B3V A;  2R1I A;  4UWI A;  4JZ0 A;  2BO9 A;  2F7V A;  1R3N A;  1X10 A;  1LAM A;  1YGH A;  5CBM A;  3B3S A;  1FNO A;  3GIU A;  3NA6 A;  4UA3 A;  2RB7 A;  1EE3 P;  2ZEP A;  4MJ8 A;  4X3R A;  1XIX A;  4C68 A;  2FT0 A;  3IIB A;  3SI0 A;  2K5T A;  3KI9 A;  4NGR A;  3V7Z A;  2FIW A;  4U9Y A;  5K8M A;  2Q4Y A;  3T90 A;  3T9Y A;  5LYI A;  3RBU A;  4KSI A;  4A30 A;  2HB6 A;  2PJ6 A;  5G21 A;  3FRM A;  4MFK A;  3TT2 A;  4CYO A;  1H8L A;  4QB9 A;  2JBJ A;  5HVF A;  2CTC A;  2JEW A;  2JBK A;  5A28 A;  4H89 A;  3BI1 A;  2QYV A;  8CPA A;  4MRI A;  1QSM A;  1BPN A;  1KWM A;  4PSW A;  2V8V A;  4ZYQ A;  4UEE A;  4B14 A;  5CNP A;  4A31 A;  4YGO A;  4A2Z A;  5ELY A;  1J4J A;  1MJA A;  2PVV A;  3ZJ0 A;  5HVH A;  1YVK A;  1LRZ A;  1R43 A;  5ISV A;  2B4D B;  2J8N A;  1M4L A;  1TF8 A;  2P6G A;  2AFU A;  5D29 A;  3CDX A;  5IV0 A;  3GYA A;  4B10 A;  4MFZ A;  4KS9 A;  3LMS A;  1P4N A;  1S5K A;  3GB0 A;  5JH9 A;  3NH8 A;  3ISX A;  1TF9 A;  4ONW A;  1JWQ A;  4JD6 A;  5KTD A;  3D4U A;  1HEE A;  2QIR A;  3DSB A;  3PBE A;  2AFS A;  1B6B A;  3N7Z A;  2YNC C;  4LUA A;  1YVO A;  4IAV A;  4FWU A;  1PYT B;  2EWB A;  2O53 A;  5J1Q A;  2PJ8 A;  1UWY A;  4XNH B;  3KR5 A;  4MI4 A;  1ARL A;  4KVM E;  4B12 A;  4M6G A;  4ORF A;  2QJ8 A;  1CG2 A;  2JEV A;  4P4D A;  2I3C A;  2JDC A;  2NYQ A;  3FX6 A;  5AG6 A;  2HC9 A;  4NCZ A;  2BUE A;  2YGW A;  4NGN A;  4PXB A;  4ZY2 A;  4EFD A;  4RUH A;  4X2T A;  3QB8 A;  4NGP A;  2V8G A;  4OP4 A;  4YFJ A;  1YR0 A;  2F8H A;  4NSQ A;  2WPW A;  2F5I A;  3WC7 A;  3PEI A;  1Q7L A;  2DPS A;  4ZBG A;  5F48 A;  5LRJ A;  4C7I A;  2AFW A;  2VZZ A;  3SI1 A;  4FAI A;  4B11 A;  3NE8 A;  4ZX9 A;  4UBR A;  4KOU A;  2CNM A;  1VKC A;  4P45 A;  1OZP A;  4UEF A;  4MCR A;  4OC4 A;  5E96 A;  2C27 A;  1TIQ A;  2QEC A;  2HV2 A;  1XFO A;  1RO5 A;  2ZED A;  3B35 A;  4WWV A;  2D4O A;  2GAN A;  3D7H A;  1ZG8 A;  4PQA A;  5J8C A;  4II9 A;  4FD6 A;  2OZH A;  1BO4 A;  1QSO A;  3F0A A;  3BHX A;  1Z4E A;  1S7K A;  3D7F A;  4A32 A;  4E8O A;  4P10 A;  2GRE A;  4E0A A;  4OC1 A;  3UY5 A;  4A38 A;  3D7D A;  2KCW A;  4P4B A;  4UFX A;  1WK4 A;  4R76 A;  5K8P A;  1Q2D A;  1WWZ A;  3FYN A;  1KUV A;  1I12 A;  2VQY A;  4TWE A;  1IYL A;  5DWN A;  4CS0 B;  3FB3 A;  3S9M A;  4O23 A;  1M1D A;  2ZW7 A;  4MMO A;  4IUS A;  1FY7 A;  3HLP A;  4KSA A;  4XPD B;  3K9U A;  3IEH A;  4NF1 A;  3BXM A;  1CX8 A;  2V8D A;  4BD9 A;  4IHM A;  1Y7R A;  2CXA A;  4Q36 A;  3H8F A;  1M4I A;  3BLN A;  4KLW A;  2IMO A;  2DPT A;  3P2F A;  3D68 A;  1YX0 A;  4NGQ A;  1Y9K A;  2Y0M A;  2ZW6 A;  4B6Z A;  1Y0R A;  3JRU A;  4M6I A;  4Q7A A;  3GKR A;  3RYO A;  3SJX A;  5H84 A;  4Y49 C;  3TC8 A;  4A33 A;  1PU9 A;  2GLF A;  1AMP A;  4CAE A;  2B3U A;  2PJC A;  2A4N A;  4F9U A;  4QBJ A;  3S6H A;  4MCP A;  3PBB A;  4LQ6 A;  4UF4 A;  2EVN A;  3BJ7 A;  4LQG A;  3LAC A;  2WYR A;  3C26 A;  1OBR A;  4ZI6 A;  1Y9W A;  4L89 A;  4CRZ B;  4W9Y A;  2PJ7 A;  5DWM A;  2GFQ A;  4NJR A;  5HMN A;  1TKH A;  2PDO A;  3DLJ A;  1XE4 A;  4PXD A;  3RO0 A;  4LX9 A;  4P4J A;  4P4F A;  2R98 A;  3OWC A;  2FCK A;  4PK3 A;  5I0C A;  2Z10 A;  1GHE A;  4M3S A;  2AJ6 A;  2PC1 A;  3JVN A;  5DS0 A;  1XRY A;  4MY3 A;  2PJA A;  3SXO A;  4DYO A;  5HXD A;  3G3S A;  2OR4 A;  3I3G A;  3BJ8 A;  3PP9 A;  3KR4 A;  4RS2 A;  1PUA A;  2NMT A;  4Q38 A;  3D3S A;  4GM5 A;  1XMT A;  2PJ1 A;  4UEZ A;  4UCP A;  3I1U A;  1LAP A;  2C1C A;  2ZEE A;  3IU1 A;  4AXV A;  1NMT A;  2WZN A;  3FEC A;  4XPK A;  3D2P A;  3W6S A;  2R8V A;  3SHP A;  4R57 A;  4U9Z A;  4DUK A;  5FVJ A;  3V38 A;  4P4I A;  2VI7 A;  2V8H A;  1A2Z A;  1XEB A;  2ZOG A;  4KLV A;  2PSW A;  3S9N A;  3GY9 A;  2QML A;  4MHD A;  2ZEF A;  4ZY0 A;  5IX3 A;  3N5F A;  5JPH A;  1PCA A;  2ZEL A;  3EC4 A;  1XBU A;  3PB4 X;  4KUB A;  2OH1 A;  4BMH A;  1R57 A;  2Q4V A;  3S6G A;  4KOX A;  3H4Q A;  3S9L A;  3CT9 A;  4MXU A;  3WC5 A;  2CNT A;  2C6P A;  1KUX A;  4NGT A;  2FVG A;  3KQZ A;  1IID A;  4AVB A;  2EBJ A;  1K4J A;  1YQE A;  3IWE A;  2GE3 A;  3PB8 X;  4A95 A;  4JJX A;  3D8P A;  2PVW A;  5H86 A;  2H5M A;  1IOF A;  1YW6 A;  1YME A;  5EBV A;  5KTA A;  4UIA A;  2POK A;  4UCM A;  3IO1 A;  2PR8 A;  1BOB A;  3BI0 A;  3FBU A;  5G22 A;  2XEF A;  1CPS A;  3H8E A;  2REE A;  3RZA A;  4A94 A;  2Z3M A;  4XNH C;  3IC1 A;  4CAX A;  3I9S A;  3QAY A;  2CIJ A;  3DNS A;  2O4H A;  4U5Y A;  2IQ6 A;  4OC5 A;  1TXR A;  2BSW A;  5THW A;  1N71 A;  1FT7 A;  3PRT A;  4CGL A;  3W91 A;  6CPA A;  4HNW B;  2JDD A;  3EY5 A;  4MHY A;  1IIC A;  4FUU A;  1LFW A;  1MK4 A;  4A39 A;  3B2Y A;  3SJG A;  1Y7E A;  3MGD A;  2HUZ A;  4X5K A;  4NGS A;  1LOK A;  1NSL A;  2EK9 A;  1XJO A;  3FJU A;  1GYT A;  4NEX A;  4KOT A;  3D2M A;  5AG7 A;  3GUX A;  4AG7 A;  4AVC A;  4HPS A;  5AG4 A;  4RN7 A;  2YND A;  4JWP A;  5CPA A;  1CM0 A;  3B3C A;  4FD4 A;  1VIX A;  5BWA B;  4UFW A;  2B4B A;  2C6G A;  4H6U A;  1M44 A;  4KVX A;  3IJ3 A;  3NH4 A;  1B87 A;  1KZF A;  2DEA A;  2J9A A;  3TTH A;  2AFX A;  4I49 A;  3FNC A;  3L2N A;  4J3G A;  4OC3 A;  2Z0Z A;  3LOD A;  3CXQ A;  4PSX A;  2ZPA A;  1Z8W A;  4PV6 A;  2PE3 A;  4ZGY B;  3NH5 A;  1I1D A;  2Z3K A;  4MHZ A;  2PJ5 A;  3B3W A;  3D67 A;  3TX8 A;  4GS4 A;  4EVY A;  2EK8 A;  1IU8 A;  3R9F A;  4XPL A;  1Z8L A;  4ZX8 A;  4OC0 A;  4EWT A;  5A27 A;  1HDU A;  2AE6 A;  5I4M A;  3TO7 A;  3FVL A;  2OU2 A;  3FF3 A;  2BL1 A;  4BBH A;  1BPM A;  1DE4 C;  4KSF A;  3WR7 A;  2D4P A;  2PCU A;  1ZG9 A;  4UCN A;  4C2X A;  1YRE A;  2FL4 A;  2IJZ A;  3GLJ A;  4NGM A;  2XEJ A;  1DTD A;  5JM6 A;  4KOW A;  4YRH A;  2J8R A;  2Q51 A;  2BOA A;  1AUG A;  1CJW A;  2ZEM A;  2FS5 A;  4OID A;  4QVT A;  3FH4 A;  4CYP A;  5LYL A;  3EO4 A;  2CY2 A;  5F47 A;  2R7H A;  2WSA A;  3KHZ A;  2ABZ A;  3B3T A;  3WC6 A;  5F09 A;  3VAR A;  1Z5R A;  1F57 A;  1ZLH A;  2QVP A;  1YW4 A;  3W6X A;  4CRY B;  5LRK A;  3SI2 A;  2ZOF A;  5LYD A;  4DNC A;  3TFY A;  4P6Y A;  3R96 A;  4CYN A;  3FED A;  3H8G A;  2VBQ A;  1QST A;  2I79 A;  2B5G A;  2GU2 A;  2PJ9 A;  4JXR A;  3PFE A;  3QAH A;  3P2H A;  1LAN A;  4H6Z A;  5AG5 A;  2P0W A;  4HNY B;  3WAB A;  3WT4 A;  4AB7 A;  4BIN A;  5K8N A;  1TKJ A;  1Q2Y A;  4IK2 A;  4WJB A;  1YLO A;  2RC4 A;  3R95 A;  2OOT A;  4R3K A;  1ELM P;  4G1P A;  3KAS A;  1IGB A;  1CBX A;  3DGV A;  5JQ4 A;  3TO9 A;  1U6M A;  2G9D A;  1S7L A;  4NXY A;  4MCQ A;  2NSM A;  4OAD A;  4OIW A;  3K9T A;  4F0X A;  4M85 A;  3CPA A;  1Z4R A;  3EFA A;  1YLE A;  1Y0Y A;  2AFM A;  4HKF A;  5F49 A;  4C7H A;  5HVG A;  3DR6 A;  2OZG A;  1IOI A;  2ZEG A;  3H5Z A;  4B13 A;  2FE7 A;  1XMB A;  2WPX A;  1S60 A;  2BCO A;  2Z3P A;  3PB6 X;  5IB9 A;  3TE4 A;  5LRG A;  4M6H A;  4R7M A;  4ZY1 A;  4B5P A;  3JUW A;  3IU2 A;  4HNX B;  4PK2 A;  3SJF A;  2V77 A;  3QNV A;  4JXQ A;  2PJ2 A;  3EXN A;  4QUS A;  1RXT A;  4NFR A;  4AG9 A; 
#chains in the Genus database with same CATH homology
 3TOB A;  2IL4 A;  4KOY A;  1S3Z A;  4IF5 A;  4CAV A;  4KZT A;  3V8I A;  1IB1 E;  2O28 A;  3R9G A;  2ARH A;  4CAF A;  4F0Y A;  2X7B A;  3ZZI A;  3SXN A;  1S7F A;  2Z3L A;  2HQY A;  4OLL A;  2PRB A;  2PR1 A;  5GCN A;  1S7N A;  3IGR A;  4KVO E;  2WUU A;  3IWG A;  4JLY A;  1IYK A;  5HH1 A;  4ONU A;  5F46 A;  1ZO0 A;  2Z3N A;  2JLM A;  1UFH A;  3VWD A;  5KTC A;  4CAW A;  2Q04 A;  3LD2 A;  4CYQ A;  2ZW4 A;  3CXP A;  4CGO A;  1P0H A;  4KOR A;  3B8G A;  1M4D A;  2I00 A;  2B4D A;  2J8M A;  3A9L A;  4AVA A;  3R1K A;  4R9M A;  5G1Z A;  3TCV A;  4C2Z A;  4UFV A;  2VEZ A;  3F5B A;  4RI1 A;  3TOA A;  3G8W A;  1KUY A;  2YNC A;  1NE9 A;  2GIV A;  2REF A;  4KOV A;  4CGP A;  1YK3 A;  2EUI A;  2ZXV A;  1QSN A;  5IB0 A;  1VHS A;  4L8A A;  3VWE A;  1I21 A;  4KOS A;  4R3L A;  2Q0Y A;  1MJB A;  4MBU A;  3E0K A;  2OZU A;  1Q2C A;  4F6A A;  5C88 A;  4QC6 A;  3DR8 A;  3S6K A;  2P6F A;  3KKW A;  4MFP A;  4K30 A;  1Z9U A;  1XF8 A;  4XPD C;  2B58 A;  5EC4 A;  3R9E A;  2G0B A;  4UWJ A;  2OB0 A;  2Z3O A;  2VZY A;  2Z11 A;  1V0C A;  2B5G B;  3JTK A;  4CGN A;  2CNS A;  2ZW5 A;  4CGM A;  5J8F A;  5C82 A;  1SQH A;  4B5O A;  2BEI A;  2Q7B A;  1QSR A;  2FSR A;  3TO6 A;  2YNE A;  4Y49 B;  3CXS A;  1ON0 A;  3PZJ A;  2VXK A;  3DDD A;  2Q44 A;  2P6E A;  3PGP A;  4C2Y A;  3F8K A;  2ATR A;  2DXQ A;  2G3T A;  4R87 A;  2FIA A;  1MJ9 A;  4FD5 A;  3S6F A;  4KUA A;  4MFQ A;  1M4G A;  2G3A A;  3FIX A;  4B5P B;  1L0C A;  3NE7 A;  4FD7 A;  4MY0 A;  5AGE A;  4OAE A;  4MFL A;  2FXF A;  4MFJ A;  2PQ8 A;  3FXT A;  4E2A A;  5G20 A;  2B3V A;  2R1I A;  4UWI A;  1YGH A;  4UA3 A;  4MJ8 A;  1XIX A;  4C68 A;  2FT0 A;  2K5T A;  2FIW A;  4U9Y A;  2Q4Y A;  3T90 A;  3T9Y A;  4A30 A;  5G21 A;  3FRM A;  4MFK A;  3TT2 A;  4CYO A;  4QB9 A;  5A28 A;  4H89 A;  1QSM A;  4PSW A;  4B14 A;  5CNP A;  4A31 A;  4YGO A;  4A2Z A;  1J4J A;  1MJA A;  3ZJ0 A;  1YVK A;  1LRZ A;  5ISV A;  2B4D B;  2J8N A;  2P6G A;  5IV0 A;  3GYA A;  4B10 A;  4MFZ A;  4KS9 A;  1P4N A;  1S5K A;  4JD6 A;  5KTD A;  2QIR A;  3DSB A;  1B6B A;  3N7Z A;  2YNC C;  4LUA A;  1YVO A;  4XNH B;  4MI4 A;  4KVM E;  4B12 A;  4ORF A;  2JEV A;  2JDC A;  5AG6 A;  4NCZ A;  2BUE A;  2YGW A;  3QB8 A;  4YFJ A;  1YR0 A;  4NSQ A;  2WPW A;  2F5I A;  2DPS A;  4ZBG A;  5F48 A;  4C7I A;  2VZZ A;  4B11 A;  4UBR A;  4KOU A;  2CNM A;  1VKC A;  1OZP A;  5E96 A;  2C27 A;  1TIQ A;  2QEC A;  2HV2 A;  1RO5 A;  2D4O A;  2GAN A;  5J8C A;  4II9 A;  4FD6 A;  2OZH A;  1BO4 A;  1QSO A;  3F0A A;  4A32 A;  1Z4E A;  1S7K A;  4E8O A;  4E0A A;  3UY5 A;  2KCW A;  4UFX A;  1WK4 A;  1Q2D A;  1WWZ A;  3FYN A;  1KUV A;  1I12 A;  2VQY A;  4CS0 B;  1IYL A;  5DWN A;  3FB3 A;  1M1D A;  2ZW7 A;  4IUS A;  1FY7 A;  4XPD B;  4KSA A;  3K9U A;  4NF1 A;  1Y7R A;  2CXA A;  4Q36 A;  1M4I A;  3BLN A;  4KLW A;  2DPT A;  3P2F A;  1YX0 A;  1Y9K A;  2Y0M A;  2ZW6 A;  3RYO A;  3GKR A;  4A33 A;  5H84 A;  4Y49 C;  1PU9 A;  4CAE A;  2B3U A;  2A4N A;  4QBJ A;  3S6H A;  2EVN A;  3BJ7 A;  3C26 A;  1Y9W A;  4L89 A;  4CRZ B;  5DWM A;  5HMN A;  2PDO A;  1XE4 A;  4LX9 A;  2R98 A;  3OWC A;  2FCK A;  4PK3 A;  5I0C A;  2Z10 A;  1GHE A;  4M3S A;  2AJ6 A;  2PC1 A;  3JVN A;  4MY3 A;  3SXO A;  3G3S A;  3I3G A;  3BJ8 A;  3PP9 A;  4RS2 A;  1PUA A;  2NMT A;  4Q38 A;  3D3S A;  4UCP A;  1XMT A;  3IU1 A;  1NMT A;  4XPK A;  3D2P A;  3W6S A;  2R8V A;  3SHP A;  4R57 A;  4U9Z A;  5FVJ A;  2VI7 A;  1XEB A;  4KLV A;  2PSW A;  3GY9 A;  2QML A;  4MHD A;  5IX3 A;  5JPH A;  3EC4 A;  4KUB A;  2OH1 A;  4BMH A;  1R57 A;  2Q4V A;  3S6G A;  4KOX A;  3H4Q A;  2CNT A;  1KUX A;  1IID A;  4AVB A;  1K4J A;  3IWE A;  2GE3 A;  4A95 A;  4JJX A;  3D8P A;  5H86 A;  2H5M A;  5EBV A;  5KTA A;  4UCM A;  2PR8 A;  1BOB A;  3FBU A;  5G22 A;  2REE A;  2Z3M A;  4XNH C;  4CAX A;  3I9S A;  3DNS A;  4U5Y A;  2BSW A;  4CGL A;  1N71 A;  3W91 A;  4HNW B;  2JDD A;  3EY5 A;  1IIC A;  1MK4 A;  3MGD A;  2HUZ A;  4X5K A;  1NSL A;  5AG7 A;  4NEX A;  4AG7 A;  4AVC A;  4KOT A;  3D2M A;  5AG4 A;  2YND A;  4JWP A;  1CM0 A;  4FD4 A;  5BWA B;  4UFW A;  2B4B A;  4H6U A;  1M44 A;  4KVX A;  1B87 A;  1KZF A;  3TTH A;  4I49 A;  3FNC A;  4J3G A;  2Z0Z A;  3LOD A;  3CXQ A;  4PSX A;  2ZPA A;  4PV6 A;  4ZGY B;  1I1D A;  2Z3K A;  4GS4 A;  4EVY A;  3R9F A;  4XPL A;  5A27 A;  2AE6 A;  3TO7 A;  2OU2 A;  4BBH A;  2BL1 A;  3WR7 A;  4KSF A;  2D4P A;  4UCN A;  4C2X A;  1YRE A;  2FL4 A;  4KOW A;  4YRH A;  2J8R A;  1CJW A;  2FS5 A;  4QVT A;  4CYP A;  3EO4 A;  2CY2 A;  5F47 A;  2R7H A;  2WSA A;  3W6X A;  4CRY B;  4DNC A;  3TFY A;  3R96 A;  4CYN A;  2VBQ A;  1QST A;  2I79 A;  2B5G A;  4JXR A;  3QAH A;  3P2H A;  4H6Z A;  5AG5 A;  2P0W A;  4HNY B;  4AB7 A;  1Q2Y A;  3R95 A;  2RC4 A;  4R3K A;  5JQ4 A;  3TO9 A;  1U6M A;  1S7L A;  4NXY A;  4OAD A;  4F0X A;  4M85 A;  5F49 A;  1Z4R A;  3EFA A;  1YLE A;  4HKF A;  4C7H A;  3DR6 A;  2OZG A;  3H5Z A;  4B13 A;  2FE7 A;  2WPX A;  1S60 A;  2Z3P A;  3TE4 A;  4B5P A;  3JUW A;  3IU2 A;  4HNX B;  4PK2 A;  4JXQ A;  3EXN A;  4QUS A;  1RXT A;  4AG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...