2AFWA

Crystal structure of human glutaminyl cyclase in complex with n-acetylhistamine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afwA00
4UEZA 2ZELA 2AFMA 4MRIA 4H2KA 4A94A 1ZLHA 4NGNA 3D66A 5LRKA 1Y0YA 1VHOA 2QYVA 3RAMA 3LWUA 3D7HA 5IB9A 3KI9A 2O53A 2ZEHA 4X2TA 4NGRA 2BCOA 1VGYA 4MHNA 3VATA 1HDUA 3PB8X 3HLPA 4MCPA 3FJUA 3NH4A 2J9AA 3IWWA 2ZEOA 4UEEA 1Z2LA 1Y7EA 4PXBA 3DLJA 1BAVA 3D4UA 3PBBA 4X3RA 4TWEA 2JBJA 3MN8A 1F2PA 3HUVA 3VH9A 2PE3A 1QQ9A 2IMOA 2PJ5A 3QNVA 3H8GA 1PYTB 3BHXA 3PFOA 5D29A 3CPXA 2Q43A 2F8HA 2ZEEA 4R8FA 3KR4A 2GLFA 4B6ZA 3KHZA 1BLLE 1CPSA 3H8EA 1Z5RA 4IAVA 2EWBA 4FUUA 6CPAA 1YW6A 2AFWA 3FVLA 5HVFA 4O23A 3S9LA 2PJ7A 3ISZA 2EK8A 4UEFA 1LOKA 4ZX8A 4P44A 2PIYA 4MCRA 5K8NA 2XEJA 2PJAA 4IHMA 2PJ9A 3CDXA 2Q4ZA 1RTQA 5JGFA 4P4BA 3PBEA 1NSAA 2JBKA 4GM5A 3D7DA 3GB0A 3SJGA 3B3CA 5LYLA 5I4MA 1CG2A 4CPAA 4OKOA 4RUHA 1EE3P 2POKA 3DGVA 4ZI6A 4Q7AA 2C1CA 3PB4X 2ZOGA 5DS0A 3BI0A 1DE4C 1Z8LA 3WABA 3IC1A 5THWA 3D67A 3SI2A 1CBXA 4OC2A 3N5FA 2PJCA 3FEDA 4ONWA 4UIBA 4FWUA 3FEEA 4OIDA 4PXDA 5ELYA 2OR4A 2XEFA 1BPNA 2PVVA 4PXCA 4ZY1A 1TF9A 4MHYA 1YSJA 2WZNA 1ELLP 5CBMA 1ZG7A 1LFWA 4OP4A 4NJRA 2QJ8A 4R76A 2CTCA 2XEGA 3SJFA 2PJ8A 3K2KA 1IY7A 4JZ0A 1ARMA 3S9NA 4PQAA 1FNOA 1CP7A 2NYQA 1LANA 3IJ3A 1R3NA 2IJZA 2CTBA 1FT7A 2CIJA 3KR5A 3GUXA 4MMOA 1UWYA 4X8IA 3D68A 3IFEA 2CF4A 1XFOA 2AFXA 4BD9A 4NGQA 1DTDA 2PVWA 3PB6X 1XMBA 3NA6A 2AFSA 2ZEDA 2HB6A 1LAMA 1YW4A 5LYDA 3RZAA 2GREA 4IK2A 4F8ZA 1Q7LA 5HVHA 1VIXA 4R6TA 2PIZA 4MHZA 4P45A 5HVGA 3KQXA 1TXRA 1CX8A 5K8PA 2AFOA 5CPAA 3FECA 2PJ1A 3BXMA 4DYOA 1M4LA 3B35A 2PJ2A 5LYIA 2ZEFA 2V8HA 4DJLA 4NGSA 8CPAA 3TC8A 3D7GA 1AMPA 3PFEA 4OC5A 3L2NA 4R7MA 3SI1A 4OC0A 3SJEA 1F2OA 1F57A 3KQZA 2DEAA 4Z65A 3CT9A 3PB9X 2V8GA 4MCSA 3NH8A 3B3SA 4NGPA 3B3TA 3KASA 3PEIA 1TKHA 4ZY0A 3B3WA 4A39A 1QMUA 2RB7A 2PJ0A 1XRYA 3WC5A 2ZENA 7CPAA 3V7ZA 3ISXA 4P4JA 1ZLIA 4WJBA 3BI1A 4OC1A 2ZEPA 4OMEA 3PRTA 2GU2A 3D7FA 1H8LA 2ZOFA 1ZG8A 1YMEA 1PCAA 3JRUA 3LMSA 3K9TA 4OIWA 4MHPA 3KZWA 2AFUA 5D8NA 1GYTA 3SJXA 1BPMA 5LYFA 1LCPA 2ZEGA 4P4EA 2FVGA 3V38A 1ARLA 4PPZA 4ZY2A 4ZX9A 4EFDA 4F9VA 4P4DA 5JM6A 2O4HA 4ZYQA 4DUKA 4MCQA 4TNUA 4K3NA 2C6GA 3KL9A 2I3CA 4F9UA 1TKJA 5K8MA 2ANPA 4EWTA 1CPXA 3NFZA 1HDQA 3CPAA 4NJQA 4OC4A 4FAIA 2GLJA 5LRJA 3SI0A 2HC9A 3IO1A 3NH5A 5JH9A 2PJ6A 3I1UA 1KWMA 4A38A 2JEWA 3B2YA 3KGQA 3FX6A 2VL1A 4EMEA 2C6CA 4AXVA 4YWYA 4W9YA 3IIBA 3H8FA 1LAPA 3B3VA 5K8OA 2RFHA 4PXEA 2WYRA 2V8VA 3GLJA 3IEHA 2PRQA 3FF3A 3FMCA 4P4IA 1VHEA 1XBUA 2XEIA 2PJ4A 1TF8A 4KSIA 2ABZA 1TKFA 4FBEA 3KHXA 2V77A 1ELMP 2F7VA 3WT4A 2PJBA 4JYWA 4A37A 1JQGA 3S9MA 1YLOA 3WC7A 1OBRA 2PCUA 4P4FA 4NFRA 3MRUA 2BO9A 5F09A 5J1QA 2C6PA 4P10A 4LQGA 2BOAA 4UF4A 4YU9A 2PJ3A 3WC6A 4NGMA 3T8WA 2V8DA 4P6YA 3PB7X 2G9DA 4WWVA 1AYEA 5HXDA 1HEEA 1CP6A 4OC3A 2QVPA 3VARA 2NSMA 5LRGA 3TX8A 1IGBA 4NGTA 3RBUA 2Q51A 2OOTA 1Y0RA 3B7IA 4G1PA 1R43A 3FH4A 4UIAA 2ZEMA 2EK9A 4MXUA 2AFZA 1XJOA 2IQ6A 1ZG9A
chains in the Genus database with same CATH superfamily
4UEZA 2ZELA 2CY2A 2AFMA 4CGMA 4MRIA 4H2KA 3I3GA 4A94A 1ZLHA 4XNHC 5IV0A 4NGNA 4U9ZA 3D66A 4C7HA 5LRKA 1Y0YA 1VHOA 2QYVA 3IGRA 3LWUA 4KVOE 1Z9UA 3RAMA 3D7HA 5IB9A 1MJBA 3KI9A 3F0AA 3TO9A 2O53A 2ZEHA 4X2TA 4NGRA 3RYOA 4CGNA 3TFYA 1V0CA 2BCOA 4KS9A 1VGYA 2R98A 4M6HA 1IIDA 3D3SA 4MHNA 3H4QA 4UCNA 1QSMA 2BEIA 2ZPAA 3VATA 1HDUA 2CNSA 3PB8X 4MFLA 3HLPA 2B5GB 4IF5A 4M6GA 4MCPA 3CXPA 3FJUA 5EC4A 3NH4A 4K30A 3R9GA 4OAEA 3EO4A 2J9AA 5H86A 3IWWA 2ZEOA 4UEEA 1M4GA 1Z2LA 1Y7EA 3N7ZA 3RO0A 2R1IA 4PXBA 3ZZIA 1QSRA 3DLJA 1BAVA 3D4UA 3PBBA 4X3RA 1QSTA 4TWEA 1UFHA 2K5TA 2JBJA 3BJ7A 3MN8A 4UWJA 4BMHA 1F2PA 2FSRA 2Q0YA 3HUVA 3S6KA 1I12A 3VH9A 2PE3A 5F49A 1QQ9A 2IMOA 4GS4A 1B87A 2PJ5A 2GIVA 3H8GA 3QNVA 1PYTB 2FIAA 3BHXA 3PFOA 5ISVA 1IB1E 3C26A 2D4OA 5D29A 1QSOA 3CPXA 2ODFA 2Q43A 4KSAA 2F8HA 2ZEEA 4R8FA 5AG7A 3KR4A 2D4PA 2GLFA 4AG9A 4B6ZA 5F46A 3KHZA 1BLLE 3D2PA 1CPSA 1Z4EA 3T9YA 3H8EA 1Z5RA 2JDCA 4IAVA 2EWBA 2WSAA 1P4NA 4FUUA 6CPAA 3LODA 1YW6A 1YQEA 2AFWA 1KUVA 1Q2CA 4JXRA 4KLWA 4R3KA 3FVLA 5HVFA 4O23A 3S9LA 2PJ7A 3ISZA 2EK8A 4NXYA 1LOKA 4UEFA 4ZX8A 4P44A 4R3LA 2PIYA 3QB8A 5A27A 3IU2A 4MCRA 5K8NA 2XEJA 3F8KA 5AG5A 2PJAA 4IHMA 5KTDA 5G21A 2PJ9A 3CDXA 2Q4ZA 1RTQA 2EO8A 4UFWA 5JGFA 4AB7A 4P4BA 3PBEA 4KOSA 1NSAA 3B8GA 3FB3A 4XNHB 4XPLA 5KTCA 4CGLA 2ZW7A 2JBKA 4GM5A 2EVNA 3D7DA 3GB0A 2OH1A 1QSNA 2G0BA 1YREA 3B3CA 3PP9A 1CG2A 2P6FA 4OKOA 3S6HA 4CPAA 1MK4A 1EE3P 4RUHA 5I4MA 2POKA 2B3VA 2B4DB 3DGVA 4ZI6A 3IU1A 4Q7AA 1XEBA 2BUEA 2C1CA 1SQHA 3BLNA 2DPSA 1Q2YA 3PB4X 4J3GA 2ZOGA 2O28A 5DS0A 1LRZA 5JPHA 3IWGA 4AVBA 4B11A 3BI0A 1DE4C 1Z8LA 4A33A 4E0AA 3WABA 3IC1A 2Z0ZA 5THWA 3D67A 1XOVA 3SI2A 4MFQA 1WK4A 1CBXA 4L8AA 4OC2A 1KZFA 2EUIA 4MFZA 3N5FA 5DWMA 4NCZA 2GANA 4UCMA 2PJCA 3FEDA 2C27A 2OB0A 2J8RA 2JDDA 2VBQA 4ONWA 3GKRA 4QVTA 4UIBA 5IX3A 4CRYB 4FWUA 1GHEA 3FEEA 1S60A 3FXTA 1Y9KA 4OIDA 4PXDA 2BL1A 4Q38A 5ELYA 2OR4A 2XEFA 1BPNA 2PVVA 4PV6A 4PXCA 4ZY1A 1IYKA 1TF9A 2AJ6A 3IWEA 4PSWA 4CAEA 4MHYA 5LYLA 1YSJA 2WZNA 1MJAA 5BWAB 1ELLP 5CBMA 1ZG7A 1LFWA 2NMTA 4OP4A 1S7FA 4Y49C 2PDOA 4NJRA 2Q04A 2QJ8A 4MJ8A 2YNEA 4R76A 2CTCA 2XEGA 1NE9A 3SJFA 1JWQA 1IYLA 3I9SA 2B3UA 4R57A 2PJ8A 4MI4A 4YGOA 3CZXA 2QMLA 3K2KA 3WR7A 1IY7A 4UFVA 5IB0A 1Z8TA 3SHPA 3R9EA 3EC4A 4JZ0A 1ARMA 2BSWA 1S7KA 3A9LA 3S9NA 4PQAA 1FNOA 5EMIA 2QECA 1CP7A 2NYQA 1LANA 1YVKA 2X7BA 3IJ3A 3TOBA 1R3NA 2IJZA 2CTBA 1FT7A 5A28A 2CIJA 3KR5A 3GUXA 4MMOA 5FVJA 1IOIA 2FS5A 1UWYA 4C7IA 4X8IA 2Z3MA 2GE3A 3D68A 3IFEA 2CF4A 1XFOA 2AFXA 4E2AA 4I49A 4BD9A 4NGQA 4F0YA 1BOBA 4MFPA 1DTDA 3JUWA 2HQYA 2PRBA 2PVWA 3PB6X 1XMBA 3NA6A 2FE7A 2VEZA 2AFSA 2ZEDA 4LX9A 2FT0A 2QIRA 2JEVA 1ZO0A 4AG7A 2HB6A 2CXAA 1LAMA 1YW4A 5LYDA 4KVXA 3RZAA 3VWDA 2GREA 2VXKA 4CAVA 4B10A 4FD7A 1YGHA 4MFKA 3SJGA 4IK2A 2YNCA 4F8ZA 1Q7LA 5HVHA 2J8NA 1VIXA 4KZTA 4R6TA 3PZJA 1YK3A 2PIZA 2OZGA 4MHZA 2CNMA 4P45A 4RI1A 5HVGA 2B5GA 3F5BA 4R9MA 2ARHA 2REEA 2OZUA 4IUSA 1Y9WA 2DPTA 1TXRA 3KQXA 1CX8A 5K8PA 1S7LA 2AFOA 5CPAA 4XPDC 1PUAA 3FECA 4E8OA 2PJ1A 3BXMA 1J4JA 1XIXA 4DYOA 1M4LA 4F0XA 3B35A 4FD5A 4FD6A 3SXNA 2H5MA 2PJ2A 5LYIA 4JJXA 3LD2A 2ZEFA 2V8HA 1XF8A 4JD6A 4Y49B 2WPWA 1X10A 4DJLA 2ZW5A 4KUBA 4NGSA 8CPAA 3TC8A 1NSLA 3G3SA 3D7GA 1AMPA 3PFEA 1U6MA 4OC5A 2F5IA 3L2NA 3DR6A 3W91A 4B12A 4R7MA 2B4BA 4OC0A 3SI1A 3SJEA 1F2OA 1F57A 3KQZA 4CAFA 4YRHA 4LUAA 1RO5A 2DEAA 4Z65A 3CT9A 3PB9X 4KSFA 2V8GA 4MCSA 3NH8A 3B3SA 4HPSA 1Z8XA 4NGPA 4FD4A 4MY3A 3S6GA 3TO6A 3B3TA 2Z10A 3KASA 3PEIA 1YR0A 4C2ZA 1TKHA 2PR1A 4ZGYB 4ZY0A 3FYNA 1KUYA 3TCVA 2Q4VA 2HV2A 3B3WA 4QB9A 4A39A 5J8FA 1QMUA 2RB7A 2FIWA 2PJ0A 3DSBA 5HMNA 1XRYA 3WC5A 2REFA 2ZENA 7CPAA 3V7ZA 3CXQA 3ISXA 4P4JA 3ZJ0A 2P6EA 4H6ZA 4HKFA 2G3TA 1ZLIA 4AVCA 4KOUA 4WJBA 3BI1A 2AE6A 2Z3KA 3BJ8A 1S7NA 4OC1A 2ZEPA 1S5KA 2VI7A 2B4DA 4JXQA 5AG6A 2HUZA 1VKCA 4NSQA 4R87A 1XE4A 4OMEA 3DDDA 1B6BA 4CYOA 4CYQA 4CYNA 3W6SA 3PRTA 1CJWA 2Z3PA 4ONUA 4X5KA 2GU2A 3D7FA 4B5PB 2Z3NA 1H8LA 1IICA 1ZG8A 2ZOFA 1YMEA 1PCAA 3JRUA 3LMSA 3TOAA 5AG4A 1ON0A 4KORA 3K9TA 1L0CA 4MHPA 4OIWA 4QBJA 3D2MA 3KZWA 2FXFA 3FRMA 4U5YA 4UFXA 4XPDB 4A32A 5G20A 3P2HA 2AFUA 5D8NA 1GYTA 2Q4YA 5KTAA 3SJXA 1BPMA 5LYFA 1LCPA 2ZEGA 4P4EA 4U9YA 2FVGA 3V38A 4ORFA 2FCKA 3NE8A 1ARLA 3FIXA 3QAHA 3K9UA 4PPZA 4ZY2A 3UY5A 4MY0A 2OZHA 4QUSA 4CGOA 2VZZA 4ZX9A 2PQ8A 5HH1A 4EFDA 2KCWA 4F9VA 4P4DA 5JM6A 4RS2A 1RXTA 4CRZB 2O4HA 4ZYQA 4DUKA 2Z3LA 4MCQA 4TNUA 4K3NA 3FBUA 1CM0A 2Q7BA 2C6GA 4KOVA 4KOWA 3KL9A 3R95A 4A95A 1M4IA 2Q7SA 2I3CA 4B13A 1Z8WA 5E96A 4BINA 2CNTA 1N71A 4F9UA 1TKJA 3TO7A 4PK3A 1S3ZA 5K8MA 2ANPA 4EWTA 1CPXA 3NFZA 1HDQA 4H6UA 4OADA 3CPAA 4NJQA 1XMTA 4OC4A 1VHSA 4FAIA 2GLJA 2OU2A 5LRJA 3JVNA 3TTHA 1P0HA 2I00A 3SI0A 2HC9A 3IO1A 3NH5A 5JH9A 4UA3A 4RN7A 2PJ6A 4JWPA 2Q44A 2VQYA 2ZXVA 4II9A 3I1UA 1TIQA 1KWMA 2DF5A 4OLLA 3R9FA 2JEWA 4M3SA 4KOYA 3B2YA 4A38A 3KGQA 1X12A 3FX6A 2VL1A 4CAWA 3P2FA 4MHDA 1I21A 3H5ZA 3V8IA 4EMEA 4C2XA 4B5OA 2JLMA 2C6CA 1IU8A 2I79A 5DWNA 4AXVA 4YWYA 1M44A 4UBRA 1NMTA 3JTKA 5C82A 5F47A 1YVOA 3T90A 4W9YA 4B14A 3IIBA 3H8FA 4Q36A 1LAPA 5I0CA 4KOXA 5JQ4A 2R8VA 3B3VA 1M4DA 4ZBGA 3VWEA 2ZW4A 3E0KA 4F6AA 5K8OA 4CGPA 2RFHA 4A31A 4LQ6A 4PXEA 2WYRA 3CXSA 2J8MA 2P0WA 2V8VA 3GLJA 3G8WA 3GYAA 2PRQA 3FF3A 3FMCA 1WWZA 1VHEA 3IEHA 4P4IA 2PC1A 1XBUA 1YX0A 4C2YA 3LACA 4HNYB 1MJ9A 4DNCA 4L89A 2XEIA 2P6GA 1TF8A 2PJ4A 4KSIA 3TT2A 4CS0B 4A30A 2ABZA 4M85A 2YNDA 4CYPA 2G3AA 1TKFA 2Z3OA 4NF1A 4YFJA 3KKWA 4FBEA 4KVME 3KHXA 2EBJA 1OZPA 2V77A 2R7HA 4H89A 1ELMP 5EBVA 2F7VA 5G22A 3FNCA 3WT4A 3OWCA 4UCPA 5J8CA 1R57A 1YLEA 2PJBA 2YNCC 3D8PA 4JYWA 4A37A 1JQGA 3S9MA 2YGWA 1YLOA 2ATRA 4MBUA 3PGPA 4KOTA 4KUAA 1A2ZA 3DNSA 3WC7A 1OBRA 1Y7RA 3R1KA 2PCUA 1BO4A 4P4FA 5CNPA 4CAXA 4NFRA 2PSWA 4HNXB 3MRUA 2Y0MA 3EFAA 2PR8A 3DR8A 4C68A 2IL4A 2BO9A 5F09A 3MGDA 4UWIA 4QC6A 3W6XA 2A4NA 5J1QA 1M1DA 2C6PA 4P10A 4JLYA 2VZYA 1IOFA 2BOAA 4LQGA 4BBHA 2WPXA 4UF4A 4YU9A 4EVYA 4GXHA 2PJ3A 2Z11A 4NGMA 4KLVA 5G1ZA 3S6FA 3WC6A 3T8WA 2V8DA 3NE7A 2RC4A 4P6YA 3PB7X 1AUGA 2G9DA 4WWVA 1AYEA 5HXDA 1HEEA 1CP6A 4OC3A 4PSXA 3R96A 2QVPA 1KUXA 1PU9A 5H84A 3VARA 2NSMA 4PK2A 5LRGA 3TX8A 1IGBA 3GY9A 3SXOA 4NGTA 1Q2DA 3RBUA 5C88A 2Q51A 1K4JA 2OOTA 1Y0RA 2GFQA 4A2ZA 3B7IA 2DXQA 4XPKA 3EXNA 3GIUA 5GCNA 4G1PA 4HNWB 1R43A 2ZW6A 3FH4A 5F48A 4UIAA 2ZEMA 4B5PA 1Z4RA 2EK9A 4NEXA 4MXUA 4M6IA 2AFZA 2WUUA 3QAYA 3RNZA 4MFJA 3EY5A 2FL4A 1I1DA 4AVAA 1XJOA 2IQ6A 1ZG9A 5AGEA 2B58A 1FY7A 3TE4A
chains in the Genus database with same CATH topology
4UEZA 2ZELA 2AFMA 4MRIA 4H2KA 4A94A 1ZLHA 4NGNA 3D66A 5LRKA 1Y0YA 1VHOA 2QYVA 3RAMA 3LWUA 3D7HA 5IB9A 3KI9A 2O53A 2ZEHA 4X2TA 4NGRA 2BCOA 1VGYA 4MHNA 3VATA 1HDUA 3PB8X 3HLPA 4MCPA 3FJUA 3NH4A 2J9AA 3IWWA 2ZEOA 4UEEA 1Z2LA 1Y7EA 4PXBA 3DLJA 1BAVA 3D4UA 3PBBA 4X3RA 4TWEA 2JBJA 3MN8A 1F2PA 3HUVA 3VH9A 2PE3A 1QQ9A 2IMOA 2PJ5A 3QNVA 3H8GA 1PYTB 3BHXA 3PFOA 5D29A 3CPXA 2Q43A 2F8HA 2ZEEA 4R8FA 3KR4A 2GLFA 4B6ZA 3KHZA 1BLLE 1CPSA 3H8EA 1Z5RA 4IAVA 2EWBA 4FUUA 6CPAA 1YW6A 2AFWA 3FVLA 5HVFA 4O23A 3S9LA 2PJ7A 3ISZA 2EK8A 4UEFA 1LOKA 4ZX8A 4P44A 2PIYA 4MCRA 5K8NA 2XEJA 2PJAA 4IHMA 2PJ9A 3CDXA 2Q4ZA 1RTQA 5JGFA 4P4BA 3PBEA 1NSAA 2JBKA 4GM5A 3D7DA 3GB0A 3SJGA 3B3CA 5LYLA 5I4MA 1CG2A 4CPAA 4OKOA 4RUHA 1EE3P 2POKA 3DGVA 4ZI6A 4Q7AA 2C1CA 3PB4X 2ZOGA 5DS0A 3BI0A 1DE4C 1Z8LA 3WABA 3IC1A 5THWA 3D67A 3SI2A 1CBXA 4OC2A 3N5FA 2PJCA 3FEDA 4ONWA 4UIBA 4FWUA 3FEEA 4OIDA 4PXDA 5ELYA 2OR4A 2XEFA 1BPNA 2PVVA 4PXCA 4ZY1A 1TF9A 4MHYA 1YSJA 2WZNA 1ELLP 5CBMA 1ZG7A 1LFWA 4OP4A 4NJRA 2QJ8A 4R76A 2CTCA 2XEGA 3SJFA 2PJ8A 3K2KA 1IY7A 4JZ0A 1ARMA 3S9NA 4PQAA 1FNOA 1CP7A 2NYQA 1LANA 3IJ3A 1R3NA 2IJZA 2CTBA 1FT7A 2CIJA 3KR5A 3GUXA 4MMOA 1UWYA 4X8IA 3D68A 3IFEA 2CF4A 1XFOA 2AFXA 4BD9A 4NGQA 1DTDA 2PVWA 3PB6X 1XMBA 3NA6A 2AFSA 2ZEDA 2HB6A 1LAMA 1YW4A 5LYDA 3RZAA 2GREA 4IK2A 4F8ZA 1Q7LA 5HVHA 1VIXA 4R6TA 2PIZA 4MHZA 4P45A 5HVGA 3KQXA 1TXRA 1CX8A 5K8PA 2AFOA 5CPAA 3FECA 2PJ1A 3BXMA 4DYOA 1M4LA 3B35A 2PJ2A 5LYIA 2ZEFA 2V8HA 4DJLA 4NGSA 8CPAA 3TC8A 3D7GA 1AMPA 3PFEA 4OC5A 3L2NA 4R7MA 3SI1A 4OC0A 3SJEA 1F2OA 1F57A 3KQZA 2DEAA 4Z65A 3CT9A 3PB9X 2V8GA 4MCSA 3NH8A 3B3SA 4NGPA 3B3TA 3KASA 3PEIA 1TKHA 4ZY0A 3B3WA 4A39A 1QMUA 2RB7A 2PJ0A 1XRYA 3WC5A 2ZENA 7CPAA 3V7ZA 3ISXA 4P4JA 1ZLIA 4WJBA 3BI1A 4OC1A 2ZEPA 4OMEA 3PRTA 2GU2A 3D7FA 1H8LA 2ZOFA 1ZG8A 1YMEA 1PCAA 3JRUA 3LMSA 3K9TA 4OIWA 4MHPA 3KZWA 2AFUA 5D8NA 1GYTA 3SJXA 1BPMA 5LYFA 1LCPA 2ZEGA 4P4EA 2FVGA 3V38A 1ARLA 4PPZA 4ZY2A 4ZX9A 4EFDA 4F9VA 4P4DA 5JM6A 2O4HA 4ZYQA 4DUKA 4MCQA 4TNUA 4K3NA 2C6GA 3KL9A 2I3CA 4F9UA 1TKJA 5K8MA 2ANPA 4EWTA 1CPXA 3NFZA 1HDQA 3CPAA 4NJQA 4OC4A 4FAIA 2GLJA 5LRJA 3SI0A 2HC9A 3IO1A 3NH5A 5JH9A 2PJ6A 3I1UA 1KWMA 4A38A 2JEWA 3B2YA 3KGQA 3FX6A 2VL1A 4EMEA 2C6CA 4AXVA 4YWYA 4W9YA 3IIBA 3H8FA 1LAPA 3B3VA 5K8OA 2RFHA 4PXEA 2WYRA 2V8VA 3GLJA 3IEHA 2PRQA 3FF3A 3FMCA 4P4IA 1VHEA 1XBUA 2XEIA 2PJ4A 1TF8A 4KSIA 2ABZA 1TKFA 4FBEA 3KHXA 2V77A 1ELMP 2F7VA 3WT4A 2PJBA 4JYWA 4A37A 1JQGA 3S9MA 1YLOA 3WC7A 1OBRA 2PCUA 4P4FA 4NFRA 3MRUA 2BO9A 5F09A 5J1QA 2C6PA 4P10A 4LQGA 2BOAA 4UF4A 4YU9A 2PJ3A 3WC6A 4NGMA 3T8WA 2V8DA 4P6YA 3PB7X 2G9DA 4WWVA 1AYEA 5HXDA 1HEEA 1CP6A 4OC3A 2QVPA 3VARA 2NSMA 5LRGA 3TX8A 1IGBA 4NGTA 3RBUA 2Q51A 2OOTA 1Y0RA 3B7IA 4G1PA 1R43A 3FH4A 4UIAA 2ZEMA 2EK9A 4MXUA 2AFZA 1XJOA 2IQ6A 1ZG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEZ A;  2ZEL A;  2AFM A;  4MRI A;  4H2K A;  4A94 A;  1ZLH A;  4NGN A;  3D66 A;  5LRK A;  1Y0Y A;  1VHO A;  2QYV A;  3RAM A;  3LWU A;  3D7H A;  5IB9 A;  3KI9 A;  2O53 A;  2ZEH A;  4X2T A;  4NGR A;  2BCO A;  1VGY A;  4MHN A;  3VAT A;  1HDU A;  3PB8 X;  3HLP A;  4MCP A;  3FJU A;  3NH4 A;  2J9A A;  3IWW A;  2ZEO A;  4UEE A;  1Z2L A;  1Y7E A;  4PXB A;  3DLJ A;  1BAV A;  3D4U A;  3PBB A;  4X3R A;  4TWE A;  2JBJ A;  3MN8 A;  1F2P A;  3HUV A;  3VH9 A;  2PE3 A;  1QQ9 A;  2IMO A;  2PJ5 A;  3QNV A;  3H8G A;  1PYT B;  3BHX A;  3PFO A;  5D29 A;  3CPX A;  2Q43 A;  2F8H A;  2ZEE A;  4R8F A;  3KR4 A;  2GLF A;  4B6Z A;  3KHZ A;  1BLL E;  1CPS A;  3H8E A;  1Z5R A;  4IAV A;  2EWB A;  4FUU A;  6CPA A;  1YW6 A;  2AFW A;  3FVL A;  5HVF A;  4O23 A;  3S9L A;  2PJ7 A;  3ISZ A;  2EK8 A;  4UEF A;  1LOK A;  4ZX8 A;  4P44 A;  2PIY A;  4MCR A;  5K8N A;  2XEJ A;  2PJA A;  4IHM A;  2PJ9 A;  3CDX A;  2Q4Z A;  1RTQ A;  5JGF A;  4P4B A;  3PBE A;  1NSA A;  2JBK A;  4GM5 A;  3D7D A;  3GB0 A;  3SJG A;  3B3C A;  5LYL A;  5I4M A;  1CG2 A;  4CPA A;  4OKO A;  4RUH A;  1EE3 P;  2POK A;  3DGV A;  4ZI6 A;  4Q7A A;  2C1C A;  3PB4 X;  2ZOG A;  5DS0 A;  3BI0 A;  1DE4 C;  1Z8L A;  3WAB A;  3IC1 A;  5THW A;  3D67 A;  3SI2 A;  1CBX A;  4OC2 A;  3N5F A;  2PJC A;  3FED A;  4ONW A;  4UIB A;  4FWU A;  3FEE A;  4OID A;  4PXD A;  5ELY A;  2OR4 A;  2XEF A;  1BPN A;  2PVV A;  4PXC A;  4ZY1 A;  1TF9 A;  4MHY A;  1YSJ A;  2WZN A;  1ELL P;  5CBM A;  1ZG7 A;  1LFW A;  4OP4 A;  4NJR A;  2QJ8 A;  4R76 A;  2CTC A;  2XEG A;  3SJF A;  2PJ8 A;  3K2K A;  1IY7 A;  4JZ0 A;  1ARM A;  3S9N A;  4PQA A;  1FNO A;  1CP7 A;  2NYQ A;  1LAN A;  3IJ3 A;  1R3N A;  2IJZ A;  2CTB A;  1FT7 A;  2CIJ A;  3KR5 A;  3GUX A;  4MMO A;  1UWY A;  4X8I A;  3D68 A;  3IFE A;  2CF4 A;  1XFO A;  2AFX A;  4BD9 A;  4NGQ A;  1DTD A;  2PVW A;  3PB6 X;  1XMB A;  3NA6 A;  2AFS A;  2ZED A;  2HB6 A;  1LAM A;  1YW4 A;  5LYD A;  3RZA A;  2GRE A;  4IK2 A;  4F8Z A;  1Q7L A;  5HVH A;  1VIX A;  4R6T A;  2PIZ A;  4MHZ A;  4P45 A;  5HVG A;  3KQX A;  1TXR A;  1CX8 A;  5K8P A;  2AFO A;  5CPA A;  3FEC A;  2PJ1 A;  3BXM A;  4DYO A;  1M4L A;  3B35 A;  2PJ2 A;  5LYI A;  2ZEF A;  2V8H A;  4DJL A;  4NGS A;  8CPA A;  3TC8 A;  3D7G A;  1AMP A;  3PFE A;  4OC5 A;  3L2N A;  4R7M A;  3SI1 A;  4OC0 A;  3SJE A;  1F2O A;  1F57 A;  3KQZ A;  2DEA A;  4Z65 A;  3CT9 A;  3PB9 X;  2V8G A;  4MCS A;  3NH8 A;  3B3S A;  4NGP A;  3B3T A;  3KAS A;  3PEI A;  1TKH A;  4ZY0 A;  3B3W A;  4A39 A;  1QMU A;  2RB7 A;  2PJ0 A;  1XRY A;  3WC5 A;  2ZEN A;  7CPA A;  3V7Z A;  3ISX A;  4P4J A;  1ZLI A;  4WJB A;  3BI1 A;  4OC1 A;  2ZEP A;  4OME A;  3PRT A;  2GU2 A;  3D7F A;  1H8L A;  2ZOF A;  1ZG8 A;  1YME A;  1PCA A;  3JRU A;  3LMS A;  3K9T A;  4OIW A;  4MHP A;  3KZW A;  2AFU A;  5D8N A;  1GYT A;  3SJX A;  1BPM A;  5LYF A;  1LCP A;  2ZEG A;  4P4E A;  2FVG A;  3V38 A;  1ARL A;  4PPZ A;  4ZY2 A;  4ZX9 A;  4EFD A;  4F9V A;  4P4D A;  5JM6 A;  2O4H A;  4ZYQ A;  4DUK A;  4MCQ A;  4TNU A;  4K3N A;  2C6G A;  3KL9 A;  2I3C A;  4F9U A;  1TKJ A;  5K8M A;  2ANP A;  4EWT A;  1CPX A;  3NFZ A;  1HDQ A;  3CPA A;  4NJQ A;  4OC4 A;  4FAI A;  2GLJ A;  5LRJ A;  3SI0 A;  2HC9 A;  3IO1 A;  3NH5 A;  5JH9 A;  2PJ6 A;  3I1U A;  1KWM A;  4A38 A;  2JEW A;  3B2Y A;  3KGQ A;  3FX6 A;  2VL1 A;  4EME A;  2C6C A;  4AXV A;  4YWY A;  4W9Y A;  3IIB A;  3H8F A;  1LAP A;  3B3V A;  5K8O A;  2RFH A;  4PXE A;  2WYR A;  2V8V A;  3GLJ A;  3IEH A;  2PRQ A;  3FF3 A;  3FMC A;  4P4I A;  1VHE A;  1XBU A;  2XEI A;  2PJ4 A;  1TF8 A;  4KSI A;  2ABZ A;  1TKF A;  4FBE A;  3KHX A;  2V77 A;  1ELM P;  2F7V A;  3WT4 A;  2PJB A;  4JYW A;  4A37 A;  1JQG A;  3S9M A;  1YLO A;  3WC7 A;  1OBR A;  2PCU A;  4P4F A;  4NFR A;  3MRU A;  2BO9 A;  5F09 A;  5J1Q A;  2C6P A;  4P10 A;  4LQG A;  2BOA A;  4UF4 A;  4YU9 A;  2PJ3 A;  3WC6 A;  4NGM A;  3T8W A;  2V8D A;  4P6Y A;  3PB7 X;  2G9D A;  4WWV A;  1AYE A;  5HXD A;  1HEE A;  1CP6 A;  4OC3 A;  2QVP A;  3VAR A;  2NSM A;  5LRG A;  3TX8 A;  1IGB A;  4NGT A;  3RBU A;  2Q51 A;  2OOT A;  1Y0R A;  3B7I A;  4G1P A;  1R43 A;  3FH4 A;  4UIA A;  2ZEM A;  2EK9 A;  4MXU A;  2AFZ A;  1XJO A;  2IQ6 A;  1ZG9 A; 
#chains in the Genus database with same CATH topology
 4UEZ A;  2ZEL A;  2CY2 A;  2AFM A;  4CGM A;  4MRI A;  4H2K A;  3I3G A;  4A94 A;  1ZLH A;  4XNH C;  5IV0 A;  4NGN A;  4U9Z A;  3D66 A;  4C7H A;  5LRK A;  1Y0Y A;  1VHO A;  2QYV A;  3IGR A;  3LWU A;  4KVO E;  1Z9U A;  3RAM A;  3D7H A;  5IB9 A;  1MJB A;  3KI9 A;  3F0A A;  3TO9 A;  2O53 A;  2ZEH A;  4X2T A;  4NGR A;  3RYO A;  4CGN A;  3TFY A;  1V0C A;  2BCO A;  4KS9 A;  1VGY A;  2R98 A;  4M6H A;  1IID A;  3D3S A;  4MHN A;  3H4Q A;  4UCN A;  1QSM A;  2BEI A;  2ZPA A;  3VAT A;  1HDU A;  2CNS A;  3PB8 X;  4MFL A;  3HLP A;  2B5G B;  4IF5 A;  4M6G A;  4MCP A;  3CXP A;  3FJU A;  5EC4 A;  3NH4 A;  4K30 A;  3R9G A;  4OAE A;  3EO4 A;  2J9A A;  5H86 A;  3IWW A;  2ZEO A;  4UEE A;  1M4G A;  1Z2L A;  1Y7E A;  3N7Z A;  3RO0 A;  2R1I A;  4PXB A;  3ZZI A;  1QSR A;  3DLJ A;  1BAV A;  3D4U A;  3PBB A;  4X3R A;  1QST A;  4TWE A;  1UFH A;  2K5T A;  2JBJ A;  3BJ7 A;  3MN8 A;  4UWJ A;  4BMH A;  1F2P A;  2FSR A;  2Q0Y A;  3HUV A;  3S6K A;  1I12 A;  3VH9 A;  2PE3 A;  5F49 A;  1QQ9 A;  2IMO A;  4GS4 A;  1B87 A;  2PJ5 A;  2GIV A;  3H8G A;  3QNV A;  1PYT B;  2FIA A;  3BHX A;  3PFO A;  5ISV A;  1IB1 E;  3C26 A;  2D4O A;  5D29 A;  1QSO A;  3CPX A;  2ODF A;  2Q43 A;  4KSA A;  2F8H A;  2ZEE A;  4R8F A;  5AG7 A;  3KR4 A;  2D4P A;  2GLF A;  4AG9 A;  4B6Z A;  5F46 A;  3KHZ A;  1BLL E;  3D2P A;  1CPS A;  1Z4E A;  3T9Y A;  3H8E A;  1Z5R A;  2JDC A;  4IAV A;  2EWB A;  2WSA A;  1P4N A;  4FUU A;  6CPA A;  3LOD A;  1YW6 A;  1YQE A;  2AFW A;  1KUV A;  1Q2C A;  4JXR A;  4KLW A;  4R3K A;  3FVL A;  5HVF A;  4O23 A;  3S9L A;  2PJ7 A;  3ISZ A;  2EK8 A;  4NXY A;  1LOK A;  4UEF A;  4ZX8 A;  4P44 A;  4R3L A;  2PIY A;  3QB8 A;  5A27 A;  3IU2 A;  4MCR A;  5K8N A;  2XEJ A;  3F8K A;  5AG5 A;  2PJA A;  4IHM A;  5KTD A;  5G21 A;  2PJ9 A;  3CDX A;  2Q4Z A;  1RTQ A;  2EO8 A;  4UFW A;  5JGF A;  4AB7 A;  4P4B A;  3PBE A;  4KOS A;  1NSA A;  3B8G A;  3FB3 A;  4XNH B;  4XPL A;  5KTC A;  4CGL A;  2ZW7 A;  2JBK A;  4GM5 A;  2EVN A;  3D7D A;  3GB0 A;  2OH1 A;  1QSN A;  2G0B A;  1YRE A;  3B3C A;  3PP9 A;  1CG2 A;  2P6F A;  4OKO A;  3S6H A;  4CPA A;  1MK4 A;  1EE3 P;  4RUH A;  5I4M A;  2POK A;  2B3V A;  2B4D B;  3DGV A;  4ZI6 A;  3IU1 A;  4Q7A A;  1XEB A;  2BUE A;  2C1C A;  1SQH A;  3BLN A;  2DPS A;  1Q2Y A;  3PB4 X;  4J3G A;  2ZOG A;  2O28 A;  5DS0 A;  1LRZ A;  5JPH A;  3IWG A;  4AVB A;  4B11 A;  3BI0 A;  1DE4 C;  1Z8L A;  4A33 A;  4E0A A;  3WAB A;  3IC1 A;  2Z0Z A;  5THW A;  3D67 A;  1XOV A;  3SI2 A;  4MFQ A;  1WK4 A;  1CBX A;  4L8A A;  4OC2 A;  1KZF A;  2EUI A;  4MFZ A;  3N5F A;  5DWM A;  4NCZ A;  2GAN A;  4UCM A;  2PJC A;  3FED A;  2C27 A;  2OB0 A;  2J8R A;  2JDD A;  2VBQ A;  4ONW A;  3GKR A;  4QVT A;  4UIB A;  5IX3 A;  4CRY B;  4FWU A;  1GHE A;  3FEE A;  1S60 A;  3FXT A;  1Y9K A;  4OID A;  4PXD A;  2BL1 A;  4Q38 A;  5ELY A;  2OR4 A;  2XEF A;  1BPN A;  2PVV A;  4PV6 A;  4PXC A;  4ZY1 A;  1IYK A;  1TF9 A;  2AJ6 A;  3IWE A;  4PSW A;  4CAE A;  4MHY A;  5LYL A;  1YSJ A;  2WZN A;  1MJA A;  5BWA B;  1ELL P;  5CBM A;  1ZG7 A;  1LFW A;  2NMT A;  4OP4 A;  1S7F A;  4Y49 C;  2PDO A;  4NJR A;  2Q04 A;  2QJ8 A;  4MJ8 A;  2YNE A;  4R76 A;  2CTC A;  2XEG A;  1NE9 A;  3SJF A;  1JWQ A;  1IYL A;  3I9S A;  2B3U A;  4R57 A;  2PJ8 A;  4MI4 A;  4YGO A;  3CZX A;  2QML A;  3K2K A;  3WR7 A;  1IY7 A;  4UFV A;  5IB0 A;  1Z8T A;  3SHP A;  3R9E A;  3EC4 A;  4JZ0 A;  1ARM A;  2BSW A;  1S7K A;  3A9L A;  3S9N A;  4PQA A;  1FNO A;  5EMI A;  2QEC A;  1CP7 A;  2NYQ A;  1LAN A;  1YVK A;  2X7B A;  3IJ3 A;  3TOB A;  1R3N A;  2IJZ A;  2CTB A;  1FT7 A;  5A28 A;  2CIJ A;  3KR5 A;  3GUX A;  4MMO A;  5FVJ A;  1IOI A;  2FS5 A;  1UWY A;  4C7I A;  4X8I A;  2Z3M A;  2GE3 A;  3D68 A;  3IFE A;  2CF4 A;  1XFO A;  2AFX A;  4E2A A;  4I49 A;  4BD9 A;  4NGQ A;  4F0Y A;  1BOB A;  4MFP A;  1DTD A;  3JUW A;  2HQY A;  2PRB A;  2PVW A;  3PB6 X;  1XMB A;  3NA6 A;  2FE7 A;  2VEZ A;  2AFS A;  2ZED A;  4LX9 A;  2FT0 A;  2QIR A;  2JEV A;  1ZO0 A;  4AG7 A;  2HB6 A;  2CXA A;  1LAM A;  1YW4 A;  5LYD A;  4KVX A;  3RZA A;  3VWD A;  2GRE A;  2VXK A;  4CAV A;  4B10 A;  4FD7 A;  1YGH A;  4MFK A;  3SJG A;  4IK2 A;  2YNC A;  4F8Z A;  1Q7L A;  5HVH A;  2J8N A;  1VIX A;  4KZT A;  4R6T A;  3PZJ A;  1YK3 A;  2PIZ A;  2OZG A;  4MHZ A;  2CNM A;  4P45 A;  4RI1 A;  5HVG A;  2B5G A;  3F5B A;  4R9M A;  2ARH A;  2REE A;  2OZU A;  4IUS A;  1Y9W A;  2DPT A;  1TXR A;  3KQX A;  1CX8 A;  5K8P A;  1S7L A;  2AFO A;  5CPA A;  4XPD C;  1PUA A;  3FEC A;  4E8O A;  2PJ1 A;  3BXM A;  1J4J A;  1XIX A;  4DYO A;  1M4L A;  4F0X A;  3B35 A;  4FD5 A;  4FD6 A;  3SXN A;  2H5M A;  2PJ2 A;  5LYI A;  4JJX A;  3LD2 A;  2ZEF A;  2V8H A;  1XF8 A;  4JD6 A;  4Y49 B;  2WPW A;  1X10 A;  4DJL A;  2ZW5 A;  4KUB A;  4NGS A;  8CPA A;  3TC8 A;  1NSL A;  3G3S A;  3D7G A;  1AMP A;  3PFE A;  1U6M A;  4OC5 A;  2F5I A;  3L2N A;  3DR6 A;  3W91 A;  4B12 A;  4R7M A;  2B4B A;  4OC0 A;  3SI1 A;  3SJE A;  1F2O A;  1F57 A;  3KQZ A;  4CAF A;  4YRH A;  4LUA A;  1RO5 A;  2DEA A;  4Z65 A;  3CT9 A;  3PB9 X;  4KSF A;  2V8G A;  4MCS A;  3NH8 A;  3B3S A;  4HPS A;  1Z8X A;  4NGP A;  4FD4 A;  4MY3 A;  3S6G A;  3TO6 A;  3B3T A;  2Z10 A;  3KAS A;  3PEI A;  1YR0 A;  4C2Z A;  1TKH A;  2PR1 A;  4ZGY B;  4ZY0 A;  3FYN A;  1KUY A;  3TCV A;  2Q4V A;  2HV2 A;  3B3W A;  4QB9 A;  4A39 A;  5J8F A;  1QMU A;  2RB7 A;  2FIW A;  2PJ0 A;  3DSB A;  5HMN A;  1XRY A;  3WC5 A;  2REF A;  2ZEN A;  7CPA A;  3V7Z A;  3CXQ A;  3ISX A;  4P4J A;  3ZJ0 A;  2P6E A;  4H6Z A;  4HKF A;  2G3T A;  1ZLI A;  4AVC A;  4KOU A;  4WJB A;  3BI1 A;  2AE6 A;  2Z3K A;  3BJ8 A;  1S7N A;  4OC1 A;  2ZEP A;  1S5K A;  2VI7 A;  2B4D A;  4JXQ A;  5AG6 A;  2HUZ A;  1VKC A;  4NSQ A;  4R87 A;  1XE4 A;  4OME A;  3DDD A;  1B6B A;  4CYO A;  4CYQ A;  4CYN A;  3W6S A;  3PRT A;  1CJW A;  2Z3P A;  4ONU A;  4X5K A;  2GU2 A;  3D7F A;  4B5P B;  2Z3N A;  1H8L A;  1IIC A;  1ZG8 A;  2ZOF A;  1YME A;  1PCA A;  3JRU A;  3LMS A;  3TOA A;  5AG4 A;  1ON0 A;  4KOR A;  3K9T A;  1L0C A;  4MHP A;  4OIW A;  4QBJ A;  3D2M A;  3KZW A;  2FXF A;  3FRM A;  4U5Y A;  4UFX A;  4XPD B;  4A32 A;  5G20 A;  3P2H A;  2AFU A;  5D8N A;  1GYT A;  2Q4Y A;  5KTA A;  3SJX A;  1BPM A;  5LYF A;  1LCP A;  2ZEG A;  4P4E A;  4U9Y A;  2FVG A;  3V38 A;  4ORF A;  2FCK A;  3NE8 A;  1ARL A;  3FIX A;  3QAH A;  3K9U A;  4PPZ A;  4ZY2 A;  3UY5 A;  4MY0 A;  2OZH A;  4QUS A;  4CGO A;  2VZZ A;  4ZX9 A;  2PQ8 A;  5HH1 A;  4EFD A;  2KCW A;  4F9V A;  4P4D A;  5JM6 A;  4RS2 A;  1RXT A;  4CRZ B;  2O4H A;  4ZYQ A;  4DUK A;  2Z3L A;  4MCQ A;  4TNU A;  4K3N A;  3FBU A;  1CM0 A;  2Q7B A;  2C6G A;  4KOV A;  4KOW A;  3KL9 A;  3R95 A;  4A95 A;  1M4I A;  2Q7S A;  2I3C A;  4B13 A;  1Z8W A;  5E96 A;  4BIN A;  2CNT A;  1N71 A;  4F9U A;  1TKJ A;  3TO7 A;  4PK3 A;  1S3Z A;  5K8M A;  2ANP A;  4EWT A;  1CPX A;  3NFZ A;  1HDQ A;  4H6U A;  4OAD A;  3CPA A;  4NJQ A;  1XMT A;  4OC4 A;  1VHS A;  4FAI A;  2GLJ A;  2OU2 A;  5LRJ A;  3JVN A;  3TTH A;  1P0H A;  2I00 A;  3SI0 A;  2HC9 A;  3IO1 A;  3NH5 A;  5JH9 A;  4UA3 A;  4RN7 A;  2PJ6 A;  4JWP A;  2Q44 A;  2VQY A;  2ZXV A;  4II9 A;  3I1U A;  1TIQ A;  1KWM A;  2DF5 A;  4OLL A;  3R9F A;  2JEW A;  4M3S A;  4KOY A;  3B2Y A;  4A38 A;  3KGQ A;  1X12 A;  3FX6 A;  2VL1 A;  4CAW A;  3P2F A;  4MHD A;  1I21 A;  3H5Z A;  3V8I A;  4EME A;  4C2X A;  4B5O A;  2JLM A;  2C6C A;  1IU8 A;  2I79 A;  5DWN A;  4AXV A;  4YWY A;  1M44 A;  4UBR A;  1NMT A;  3JTK A;  5C82 A;  5F47 A;  1YVO A;  3T90 A;  4W9Y A;  4B14 A;  3IIB A;  3H8F A;  4Q36 A;  1LAP A;  5I0C A;  4KOX A;  5JQ4 A;  2R8V A;  3B3V A;  1M4D A;  4ZBG A;  3VWE A;  2ZW4 A;  3E0K A;  4F6A A;  5K8O A;  4CGP A;  2RFH A;  4A31 A;  4LQ6 A;  4PXE A;  2WYR A;  3CXS A;  2J8M A;  2P0W A;  2V8V A;  3GLJ A;  3G8W A;  3GYA A;  2PRQ A;  3FF3 A;  3FMC A;  1WWZ A;  1VHE A;  3IEH A;  4P4I A;  2PC1 A;  1XBU A;  1YX0 A;  4C2Y A;  3LAC A;  4HNY B;  1MJ9 A;  4DNC A;  4L89 A;  2XEI A;  2P6G A;  1TF8 A;  2PJ4 A;  4KSI A;  3TT2 A;  4CS0 B;  4A30 A;  2ABZ A;  4M85 A;  2YND A;  4CYP A;  2G3A A;  1TKF A;  2Z3O A;  4NF1 A;  4YFJ A;  3KKW A;  4FBE A;  4KVM E;  3KHX A;  2EBJ A;  1OZP A;  2V77 A;  2R7H A;  4H89 A;  1ELM P;  5EBV A;  2F7V A;  5G22 A;  3FNC A;  3WT4 A;  3OWC A;  4UCP A;  5J8C A;  1R57 A;  1YLE A;  2PJB A;  2YNC C;  3D8P A;  4JYW A;  4A37 A;  1JQG A;  3S9M A;  2YGW A;  1YLO A;  2ATR A;  4MBU A;  3PGP A;  4KOT A;  4KUA A;  1A2Z A;  3DNS A;  3WC7 A;  1OBR A;  1Y7R A;  3R1K A;  2PCU A;  1BO4 A;  4P4F A;  5CNP A;  4CAX A;  4NFR A;  2PSW A;  4HNX B;  3MRU A;  2Y0M A;  3EFA A;  2PR8 A;  3DR8 A;  4C68 A;  2IL4 A;  2BO9 A;  5F09 A;  3MGD A;  4UWI A;  4QC6 A;  3W6X A;  2A4N A;  5J1Q A;  1M1D A;  2C6P A;  4P10 A;  4JLY A;  2VZY A;  1IOF A;  2BOA A;  4LQG A;  4BBH A;  2WPX A;  4UF4 A;  4YU9 A;  4EVY A;  4GXH A;  2PJ3 A;  2Z11 A;  4NGM A;  4KLV A;  5G1Z A;  3S6F A;  3WC6 A;  3T8W A;  2V8D A;  3NE7 A;  2RC4 A;  4P6Y A;  3PB7 X;  1AUG A;  2G9D A;  4WWV A;  1AYE A;  5HXD A;  1HEE A;  1CP6 A;  4OC3 A;  4PSX A;  3R96 A;  2QVP A;  1KUX A;  1PU9 A;  5H84 A;  3VAR A;  2NSM A;  4PK2 A;  5LRG A;  3TX8 A;  1IGB A;  3GY9 A;  3SXO A;  4NGT A;  1Q2D A;  3RBU A;  5C88 A;  2Q51 A;  1K4J A;  2OOT A;  1Y0R A;  2GFQ A;  4A2Z A;  3B7I A;  2DXQ A;  4XPK A;  3EXN A;  3GIU A;  5GCN A;  4G1P A;  4HNW B;  1R43 A;  2ZW6 A;  3FH4 A;  5F48 A;  4UIA A;  2ZEM A;  4B5P A;  1Z4R A;  2EK9 A;  4NEX A;  4MXU A;  4M6I A;  2AFZ A;  2WUU A;  3QAY A;  3RNZ A;  4MFJ A;  3EY5 A;  2FL4 A;  1I1D A;  4AVA A;  1XJO A;  2IQ6 A;  1ZG9 A;  5AGE A;  2B58 A;  1FY7 A;  3TE4 A; 
#chains in the Genus database with same CATH homology
 4UEZ A;  2ZEL A;  2AFM A;  4MRI A;  4H2K A;  4A94 A;  1ZLH A;  4NGN A;  3D66 A;  5LRK A;  1Y0Y A;  1VHO A;  2QYV A;  3RAM A;  3LWU A;  3D7H A;  5IB9 A;  3KI9 A;  2O53 A;  2ZEH A;  4X2T A;  4NGR A;  2BCO A;  1VGY A;  4MHN A;  3VAT A;  1HDU A;  3PB8 X;  3HLP A;  4MCP A;  3FJU A;  3NH4 A;  2J9A A;  3IWW A;  2ZEO A;  4UEE A;  1Z2L A;  1Y7E A;  4PXB A;  3DLJ A;  1BAV A;  3D4U A;  3PBB A;  4X3R A;  4TWE A;  2JBJ A;  3MN8 A;  1F2P A;  3HUV A;  3VH9 A;  2PE3 A;  1QQ9 A;  2IMO A;  2PJ5 A;  3QNV A;  3H8G A;  1PYT B;  3BHX A;  3PFO A;  5D29 A;  3CPX A;  2Q43 A;  2F8H A;  2ZEE A;  4R8F A;  3KR4 A;  2GLF A;  4B6Z A;  3KHZ A;  1BLL E;  1CPS A;  3H8E A;  1Z5R A;  4IAV A;  2EWB A;  4FUU A;  6CPA A;  1YW6 A;  2AFW A;  3FVL A;  5HVF A;  4O23 A;  3S9L A;  2PJ7 A;  3ISZ A;  2EK8 A;  4UEF A;  1LOK A;  4ZX8 A;  4P44 A;  2PIY A;  4MCR A;  5K8N A;  2XEJ A;  2PJA A;  4IHM A;  2PJ9 A;  3CDX A;  2Q4Z A;  1RTQ A;  5JGF A;  4P4B A;  3PBE A;  1NSA A;  2JBK A;  4GM5 A;  3D7D A;  3GB0 A;  3SJG A;  3B3C A;  5LYL A;  5I4M A;  1CG2 A;  4CPA A;  4OKO A;  4RUH A;  1EE3 P;  2POK A;  3DGV A;  4ZI6 A;  4Q7A A;  2C1C A;  3PB4 X;  2ZOG A;  5DS0 A;  3BI0 A;  1DE4 C;  1Z8L A;  3WAB A;  3IC1 A;  5THW A;  3D67 A;  3SI2 A;  1CBX A;  4OC2 A;  3N5F A;  2PJC A;  3FED A;  4ONW A;  4UIB A;  4FWU A;  3FEE A;  4OID A;  4PXD A;  5ELY A;  2OR4 A;  2XEF A;  1BPN A;  2PVV A;  4PXC A;  4ZY1 A;  1TF9 A;  4MHY A;  1YSJ A;  2WZN A;  1ELL P;  5CBM A;  1ZG7 A;  1LFW A;  4OP4 A;  4NJR A;  2QJ8 A;  4R76 A;  2CTC A;  2XEG A;  3SJF A;  2PJ8 A;  3K2K A;  1IY7 A;  4JZ0 A;  1ARM A;  3S9N A;  4PQA A;  1FNO A;  1CP7 A;  2NYQ A;  1LAN A;  3IJ3 A;  1R3N A;  2IJZ A;  2CTB A;  1FT7 A;  2CIJ A;  3KR5 A;  3GUX A;  4MMO A;  1UWY A;  4X8I A;  3D68 A;  3IFE A;  2CF4 A;  1XFO A;  2AFX A;  4BD9 A;  4NGQ A;  1DTD A;  2PVW A;  3PB6 X;  1XMB A;  3NA6 A;  2AFS A;  2ZED A;  2HB6 A;  1LAM A;  1YW4 A;  5LYD A;  3RZA A;  2GRE A;  4IK2 A;  4F8Z A;  1Q7L A;  5HVH A;  1VIX A;  4R6T A;  2PIZ A;  4MHZ A;  4P45 A;  5HVG A;  3KQX A;  1TXR A;  1CX8 A;  5K8P A;  2AFO A;  5CPA A;  3FEC A;  2PJ1 A;  3BXM A;  4DYO A;  1M4L A;  3B35 A;  2PJ2 A;  5LYI A;  2ZEF A;  2V8H A;  4DJL A;  4NGS A;  8CPA A;  3TC8 A;  3D7G A;  1AMP A;  3PFE A;  4OC5 A;  3L2N A;  4R7M A;  3SI1 A;  4OC0 A;  3SJE A;  1F2O A;  1F57 A;  3KQZ A;  2DEA A;  4Z65 A;  3CT9 A;  3PB9 X;  2V8G A;  4MCS A;  3NH8 A;  3B3S A;  4NGP A;  3B3T A;  3KAS A;  3PEI A;  1TKH A;  4ZY0 A;  3B3W A;  4A39 A;  1QMU A;  2RB7 A;  2PJ0 A;  1XRY A;  3WC5 A;  2ZEN A;  7CPA A;  3V7Z A;  3ISX A;  4P4J A;  1ZLI A;  4WJB A;  3BI1 A;  4OC1 A;  2ZEP A;  4OME A;  3PRT A;  2GU2 A;  3D7F A;  1H8L A;  2ZOF A;  1ZG8 A;  1YME A;  1PCA A;  3JRU A;  3LMS A;  3K9T A;  4OIW A;  4MHP A;  3KZW A;  2AFU A;  5D8N A;  1GYT A;  3SJX A;  1BPM A;  5LYF A;  1LCP A;  2ZEG A;  4P4E A;  2FVG A;  3V38 A;  1ARL A;  4PPZ A;  4ZY2 A;  4ZX9 A;  4EFD A;  4F9V A;  4P4D A;  5JM6 A;  2O4H A;  4ZYQ A;  4DUK A;  4MCQ A;  4TNU A;  4K3N A;  2C6G A;  3KL9 A;  2I3C A;  4F9U A;  1TKJ A;  5K8M A;  2ANP A;  4EWT A;  1CPX A;  3NFZ A;  1HDQ A;  3CPA A;  4NJQ A;  4OC4 A;  4FAI A;  2GLJ A;  5LRJ A;  3SI0 A;  2HC9 A;  3IO1 A;  3NH5 A;  5JH9 A;  2PJ6 A;  3I1U A;  1KWM A;  4A38 A;  2JEW A;  3B2Y A;  3KGQ A;  3FX6 A;  2VL1 A;  4EME A;  2C6C A;  4AXV A;  4YWY A;  4W9Y A;  3IIB A;  3H8F A;  1LAP A;  3B3V A;  5K8O A;  2RFH A;  4PXE A;  2WYR A;  2V8V A;  3GLJ A;  3IEH A;  2PRQ A;  3FF3 A;  3FMC A;  4P4I A;  1VHE A;  1XBU A;  2XEI A;  2PJ4 A;  1TF8 A;  4KSI A;  2ABZ A;  1TKF A;  4FBE A;  3KHX A;  2V77 A;  1ELM P;  2F7V A;  3WT4 A;  2PJB A;  4JYW A;  4A37 A;  1JQG A;  3S9M A;  1YLO A;  3WC7 A;  1OBR A;  2PCU A;  4P4F A;  4NFR A;  3MRU A;  2BO9 A;  5F09 A;  5J1Q A;  2C6P A;  4P10 A;  4LQG A;  2BOA A;  4UF4 A;  4YU9 A;  2PJ3 A;  3WC6 A;  4NGM A;  3T8W A;  2V8D A;  4P6Y A;  3PB7 X;  2G9D A;  4WWV A;  1AYE A;  5HXD A;  1HEE A;  1CP6 A;  4OC3 A;  2QVP A;  3VAR A;  2NSM A;  5LRG A;  3TX8 A;  1IGB A;  4NGT A;  3RBU A;  2Q51 A;  2OOT A;  1Y0R A;  3B7I A;  4G1P A;  1R43 A;  3FH4 A;  4UIA A;  2ZEM A;  2EK9 A;  4MXU A;  2AFZ A;  1XJO A;  2IQ6 A;  1ZG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...