2AFWA

Crystal structure of human glutaminyl cyclase in complex with n-acetylhistamine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afwA00
3D67A 1H8LA 3T8WA 1LAMA 2ZEFA 4DUKA 4X3RA 2XEGA 5JGFA 7CPAA 5LRGA 3CPXA 4ZY1A 1TKJA 3PB4X 3IEHA 2CF4A 1PCAA 4ZX8A 4ZY0A 3FF3A 1ZG8A 1LCPA 4Q7AA 4TNUA 1Y7EA 3B3WA 4MHPA 1Z2LA 2AFUA 3HUVA 3IWWA 2JBKA 1CP7A 4EFDA 3PEIA 2ZEMA 3BI1A 5IB9A 4O23A 4A94A 2EK9A 2IMOA 4ZYQA 4NGTA 1CX8A 1KWMA 2IQ6A 4W9YA 2NYQA 3K9TA 2EWBA 4NGMA 5D8NA 3S9LA 3FEDA 4OC0A 3N5FA 4A37A 3SJXA 2ZEPA 2I3CA 3NA6A 1ZLIA 3IFEA 3PBBA 4F9UA 4JYWA 4NJQA 4ZX9A 2OR4A 4G1PA 4F8ZA 3LMSA 3KQXA 3QNVA 1Q7LA 1IY7A 4NGSA 4IK2A 3FX6A 1AMPA 4OIWA 2V8DA 4X2TA 2ZELA 3D68A 1YW4A 2VL1A 1XRYA 3SJGA 3S9NA 4IAVA 1BAVA 3SJFA 3NH4A 4MRIA 4X8IA 4EWTA 3B7IA 3B2YA 1TF9A 1RTQA 2IJZA 4TWEA 3VATA 3SI2A 2PJ6A 4MHYA 3KI9A 3H8GA 5LYIA 2ZEEA 1M4LA 3SJEA 5K8PA 1VGYA 4P4BA 5LRKA 3WC7A 1HDQA 3H8FA 3FJUA 2PVVA 2V8HA 3KHZA 2PJAA 3DLJA 1XFOA 2ANPA 4AXVA 3D7HA 4WWVA 1JQGA 4P4DA 4P4IA 1Y0YA 1LANA 3PB8X 2F8HA 2V8VA 2ZENA 2PVWA 3NFZA 2AFSA 2GLJA 5JM6A 5F09A 1AYEA 5J1QA 4YU9A 2XEJA 3KR5A 3D66A 2O4HA 3HLPA 4MMOA 2C1CA 4PXDA 2Q4ZA 5CPAA 4MXUA 4OKOA 2RFHA 3RBUA 5D29A 1LOKA 2PJ5A 3MRUA 3PFEA 2Q51A 3RAMA 2FVGA 1YMEA 4FAIA 2PIZA 5HVFA 4MCQA 1XBUA 5LYLA 1ARMA 2ZEGA 2QVPA 3KR4A 5JH9A 2PRQA 2XEFA 3I1UA 1Y0RA 4UIBA 4P4EA 4PXBA 4GM5A 2PE3A 3D4UA 2NSMA 1F57A 3CPAA 3D7DA 3JRUA 4PXCA 4JZ0A 5ELYA 1FNOA 4F9VA 2PJ7A 4P45A 2BO9A 5LRJA 5HVGA 1ELMP 3BXMA 2JBJA 3FECA 3PRTA 1CP6A 3PB6X 3MN8A 2AFOA 1BLLE 1OBRA 2J9AA 2C6CA 3B3SA 4BD9A 1IGBA 4ZY2A 3IC1A 1ZG9A 2PCUA 2PJ2A 5K8NA 2WYRA 3IJ3A 3GLJA 4FUUA 4OIDA 2PIYA 2EK8A 3DGVA 4CPAA 2ABZA 2CIJA 3KASA 5DS0A 3IO1A 4PPZA 2ZEHA 5THWA 3BHXA 2QJ8A 4MCSA 2DEAA 2PJ1A 1TKFA 1VIXA 4KSIA 4DYOA 3WC5A 3WABA 3SI1A 4PQAA 4MHNA 1ARLA 3PB9X 1ELLP 3ISZA 3H8EA 1YW6A 3WC6A 5LYFA 2PJCA 4IHMA 2PJ9A 4UIAA 1UWYA 4OC2A 2PJ8A 5K8MA 2AFZA 1Z5RA 4NGNA 4P44A 4P10A 3VARA 1CPXA 2CTBA 3GB0A 3PB7X 4UEFA 1VHOA 3TC8A 2ZEDA 1BPMA 1R3NA 3ISXA 4R7MA 1Z8LA 1LFWA 2XEIA 6CPAA 3SI0A 3FVLA 1TXRA 4MHZA 4MCPA 4LQGA 3B3CA 3BI0A 3K2KA 3VH9A 1F2OA 2AFWA 2V77A 3CDXA 4MCRA 2PJBA 2Q43A 3KL9A 3TX8A 3KZWA 2BOAA 2C6PA 1XJOA 4NGRA 1R43A 5I4MA 1CG2A 3B3TA 2POKA 4OC5A 4P4JA 4A38A 4OC3A 2O53A 3FEEA 2F7VA 2OOTA 3NH8A 3S9MA 2C6GA 4P4FA 1F2PA 4A39A 1YSJA 3B35A 1LAPA 1QQ9A 3WT4A 4RUHA 4FBEA 3IIBA 8CPAA 4P6YA 4ZI6A 5LYDA 1EE3P 2HC9A 4EMEA 4Z65A 4UF4A 2BCOA 3KGQA 1ZG7A 4NFRA 4NJRA 4R6TA 4R76A 5CBMA 3D7FA 1VHEA 4UEZA 4DJLA 1CPSA 1QMUA 4NGPA 2AFMA 3KHXA 3V7ZA 3L2NA 4YWYA 2AFXA 4K3NA 1TF8A 2PJ4A 4PXEA 1YLOA 2HB6A 4OC4A 1DTDA 2PJ3A 2GU2A 3CT9A 4FWUA 3NH5A 3RZAA 4OP4A 4B6ZA 4NGQA 3FH4A 4WJBA 2QYVA 1FT7A 1DE4C 1PYTB 2G9DA 2GLFA 2PJ0A 1XMBA 2JEWA 2ZEOA 4UEEA 5K8OA 1NSAA 3FMCA 5HXDA 1GYTA 4OMEA 3KQZA 3D7GA 5HVHA 4OC1A 4H2KA 3PFOA 4ONWA 3GUXA 4R8FA 1CBXA 2RB7A 2CTCA 3V38A 2GREA 1ZLHA 2WZNA 1HDUA 3PBEA 1BPNA 3LWUA 2V8GA 2ZOGA 1HEEA 3B3VA 2ZOFA 1TKHA
chains in the Genus database with same CATH superfamily
2Q7BA 3D67A 3LD2A 4C7HA 1H8LA 2EO8A 3T8WA 1LAMA 2ZEFA 4LQ6A 1S7KA 2ZW6A 4KLWA 4DUKA 4X3RA 2XEGA 1X12A 5JGFA 1GHEA 5LRGA 7CPAA 1QSMA 3CPXA 3BLNA 1S7FA 4HNYB 2QIRA 4ZY1A 2PR8A 1TKJA 5A27A 3CXPA 3PB4X 3IEHA 5G22A 4BBHA 2CF4A 1YVKA 1MJBA 1PCAA 4ZX8A 1X10A 4ZY0A 5AG6A 4CAXA 3FF3A 1ZG8A 2Z11A 2PR1A 2A4NA 1LCPA 4LX9A 4B5PA 4Q7AA 1Z8XA 4TNUA 4Y49B 1Y7EA 3B3WA 4MHPA 4AVBA 1Z2LA 2AFUA 3HUVA 2VEZA 2RC4A 3IWWA 2PDOA 1J4JA 2JBKA 3VWEA 1JWQA 1Z4EA 1CP7A 4EFDA 2KCWA 3PEIA 2ZEMA 3BI1A 5IB9A 1XMTA 2Q4YA 4O23A 4NCZA 1XEBA 1P4NA 2EK9A 4A94A 5A28A 1MJ9A 2IMOA 4PV6A 4ZYQA 2ZW4A 4NGTA 1CX8A 1KWMA 2IQ6A 2Z3NA 4W9YA 2X7BA 2NYQA 1S5KA 2QECA 1YX0A 2REFA 3SHPA 4QBJA 5ISVA 4E8OA 3K9TA 4KVOE 3TFYA 3W91A 2DPSA 1VKCA 2EWBA 4NGMA 5D8NA 4BINA 3S9LA 3FEDA 4OC0A 3N5FA 4A37A 4FD5A 3SJXA 2ZEPA 2I3CA 1M1DA 2O28A 3NA6A 4Q38A 1ZLIA 3IFEA 3JTKA 1RXTA 3PBBA 4UFVA 4F9UA 4JYWA 3PP9A 4NJQA 4ZX9A 2PQ8A 1Z8WA 2OR4A 5J8CA 4CRYB 4G1PA 3SXNA 3RNZA 2K5TA 4F8ZA 4CYNA 3LMSA 4JLYA 4QC6A 3W6XA 2GE3A 2VI7A 1KUVA 1QSOA 1S7LA 2DXQA 2JDDA 2R1IA 1Q7LA 3KQXA 2ODFA 3QNVA 1IY7A 3R1KA 4M3SA 4PSXA 4XNHC 4NGSA 3CXQA 4IK2A 3FX6A 4KSFA 4MY3A 4XPDB 3T9YA 1YREA 1AMPA 4OIWA 2V8DA 4C68A 4B13A 4X2TA 2ZELA 3CZXA 3D68A 1MK4A 1YW4A 2VL1A 1Q2DA 3F0AA 1XRYA 3SJGA 3S9NA 4CGPA 1Q2CA 4IAVA 4K30A 5HH1A 2DF5A 1BAVA 2OZGA 3NH4A 3SJFA 4MRIA 2HQYA 2WSAA 4X8IA 3W6SA 1OZPA 4RN7A 1YK3A 2FXFA 3BJ7A 2FT0A 3R96A 3B7IA 4EWTA 3B2YA 1TF9A 1RTQA 2IJZA 4TWEA 3NE8A 1KUYA 2JDCA 4H89A 4YGOA 3VATA 4E0AA 4KSAA 4Y49C 3SI2A 1KUXA 2PJ6A 2WPWA 2YGWA 4MHYA 3KI9A 3H8GA 2REEA 4NSQA 5LYIA 4JJXA 2ZEEA 4R3KA 5C82A 4JXQA 1M4LA 3D8PA 4KLVA 2ZXVA 3SJEA 4CGOA 5K8PA 1VGYA 4ONUA 3V8IA 4P4BA 3CXSA 5LRKA 3WC7A 1HDQA 1L0CA 3GKRA 2B3VA 3ZZIA 3H8FA 4B5OA 1U6MA 3D2MA 4UCMA 4UFWA 3FJUA 2Z3LA 3LACA 2PVVA 2V8HA 5I0CA 1RO5A 2VXKA 3KHZA 2PJAA 2ZW7A 3FIXA 3DLJA 1XFOA 4Q36A 1XOVA 2ANPA 4AXVA 3D7HA 5GCNA 4WWVA 1JQGA 4P4DA 4P4IA 1Y0YA 4KZTA 1LANA 4CS0B 3PB8X 2F8HA 1B87A 4F0XA 5AG5A 2V8VA 4A31A 4C7IA 2ZENA 1P0HA 2AJ6A 2GANA 2PVWA 3NFZA 4NF1A 3ZJ0A 2B4DB 2AFSA 2G3AA 1CM0A 4IF5A 2NMTA 4NXYA 3QB8A 2GLJA 5JM6A 5F09A 2VZZA 2Q44A 1AYEA 5J1QA 4YU9A 2XEJA 3KR5A 2EVNA 3D66A 2O4HA 4AG9A 5EMIA 4KOSA 1Q2YA 4F0YA 3I3GA 3HLPA 4MMOA 2C1CA 4PXDA 3GY9A 2Q4ZA 5CPAA 4A95A 4MXUA 2FL4A 4KS9A 1S7NA 1S60A 3IWEA 1B6BA 1WK4A 4OKOA 2Q4VA 2VQYA 4CGMA 2RFHA 3RBUA 4NEXA 5D29A 1LOKA 2PJ5A 4UWJA 3IWGA 4CGLA 3MRUA 3PFEA 2Q51A 3QAYA 5H84A 3RAMA 2FVGA 1YMEA 5IV0A 4FAIA 2PIZA 1AUGA 2OZHA 5HVFA 3TTHA 2B4BA 4MCQA 4UCNA 1XBUA 4R57A 5LYLA 1ARMA 3F8KA 2ZEGA 3S6GA 1NSLA 2CY2A 2QVPA 4KOTA 4MHDA 4U9ZA 3KR4A 1Z4RA 5JH9A 2Z3OA 2PRQA 1IOFA 4B14A 2XEFA 3I1UA 4DNCA 1Y0RA 1XF8A 1I21A 4UIBA 4P4EA 5AG4A 4PXBA 4GM5A 2PE3A 3D4UA 2NSMA 1F57A 3CPAA 5G20A 3D7DA 3JRUA 4PXCA 4JZ0A 5ELYA 2VZYA 3KKWA 1FNOA 4M6GA 1VHSA 3TOBA 1IYKA 4BMHA 2PJ7A 4P45A 4UFXA 2BO9A 4F9VA 4H6ZA 1IICA 2FS5A 5LRJA 2PC1A 5HVGA 1ELMP 2ZW5A 3S6FA 1R57A 3BXMA 4A30A 1YQEA 2JBJA 4PSWA 4F6AA 1YGHA 2P0WA 3FECA 3PRTA 2D4OA 1CP6A 2B4DA 3C26A 2ARHA 1V0CA 3PB6X 4MFJA 2GIVA 3MN8A 2AFOA 1BLLE 1OBRA 3DDDA 3EY5A 2J9AA 2C6CA 4R3LA 2CNMA 2B3UA 3B3SA 1IIDA 4BD9A 1IGBA 2R98A 4ORFA 4ZY2A 4CAWA 2FE7A 3IC1A 1S3ZA 1ZG9A 4MBUA 4CYQA 4KOVA 2G3TA 2J8RA 1MJAA 2PCUA 2PJ2A 5F46A 5K8NA 2WYRA 3IJ3A 4B10A 3D2PA 3GLJA 4FUUA 4OIDA 2PIYA 2EK8A 3EFAA 4CAFA 3P2HA 4M6IA 4U9YA 3DGVA 4FD4A 4CPAA 2ABZA 2CIJA 2OU2A 5HMNA 3KASA 5DS0A 1PU9A 1K4JA 3IO1A 2YNCA 4LUAA 2ZEHA 1NMTA 3FNCA 4PPZA 5THWA 3BHXA 4R87A 2QJ8A 4FD6A 2WUUA 3E0KA 3P2FA 4MCSA 4JXRA 1WWZA 2CNTA 2DEAA 2P6FA 2J8MA 3N7ZA 4QB9A 2PJ1A 3TO9A 1UFHA 4M6HA 2Z10A 1TKFA 1Y9KA 1VIXA 2YNEA 3EXNA 4KSIA 4AG7A 4DYOA 3JUWA 3H4QA 4HPSA 3WC5A 3WABA 3SI1A 1BOBA 1M4GA 2PRBA 4M85A 3QAHA 5IX3A 1XIXA 1N71A 4PQAA 4MHNA 1ARLA 2D4PA 1ELLP 2F5IA 3PB9X 3ISZA 5AG7A 3H8EA 4ZBGA 1YW6A 4KVXA 3WC6A 2J8NA 4KUAA 4HNXB 5KTCA 4X5KA 5LYFA 2PJCA 4IHMA 4OADA 2PJ9A 4UIAA 4AVCA 2FSRA 3MGDA 1UWYA 3K9UA 4KOWA 4OC2A 2QMLA 5KTAA 2PJ8A 2Y0MA 1QSNA 5K8MA 3EO4A 3TOAA 4YFJA 1BO4A 4KOXA 2AFZA 2FIAA 2C27A 3R95A 1Z5RA 4NGNA 4P44A 2Z0ZA 4IUSA 4P10A 3D3SA 3I9SA 3VARA 1CPXA 1I1DA 3FXTA 2CTBA 3GB0A 3PB7X 4UEFA 1VHOA 3RYOA 5G21A 5F47A 3TC8A 1SQHA 2ZEDA 3WR7A 4OLLA 1BPMA 1PUAA 1R3NA 5BWAB 1QSTA 2PSWA 3ISXA 4R7MA 1IYLA 5F48A 1Z8LA 1LFWA 5H86A 2XEIA 6CPAA 3IGRA 3SI0A 2H5MA 3FVLA 2R7HA 2WPXA 1TXRA 4MHZA 4MFKA 3DNSA 4MCPA 2BEIA 3G8WA 3B3CA 4LQGA 4XNHB 4UCPA 2IL4A 3NE7A 2OZUA 2P6EA 2DPTA 3BI0A 3K2KA 4KORA 4U5YA 3VH9A 4B11A 1F2OA 2AFWA 2V77A 3CDXA 4MCRA 4YRHA 2PJBA 2Q43A 3KL9A 4XPDC 3TX8A 3KZWA 2BOAA 2C6PA 4L8AA 1XJOA 2BSWA 4NGRA 3LODA 1R43A 5I4MA 1CG2A 2ATRA 3B3TA 2POKA 4XPLA 1M4IA 4OC5A 4P4JA 4A38A 1ZO0A 2YNDA 4OC3A 4AVAA 2CXAA 2OH1A 4GS4A 2O53A 4H6UA 4HKFA 3FEEA 2P6GA 4MJ8A 2F7VA 2OOTA 3NH8A 3S9MA 2B58A 2C6GA 2Q7SA 4P4FA 1F2PA 1ON0A 4OAEA 1YSJA 4A39A 3B35A 2Z3MA 1LAPA 2HUZA 1I12A 5DWMA 4XPKA 1QQ9A 3SXOA 3WT4A 5JQ4A 4J3GA 4RUHA 4FBEA 2JLMA 1Y9WA 5G1ZA 3IIBA 2EUIA 4P6YA 4ZI6A 8CPAA 5LYDA 1EE3P 2HC9A 3UY5A 4A32A 4EMEA 2CNSA 4EVYA 4CAVA 2JEVA 4JD6A 4Z65A 2Q04A 5KTDA 4UF4A 4RS2A 4CGNA 5F49A 2BCOA 2VBQA 3KGQA 4KOUA 4L89A 5CNPA 4KUBA 1ZG7A 2Z3PA 2BUEA 1YLEA 3BJ8A 4NFRA 4NJRA 1LRZA 2B5GB 4PK2A 4R6TA 3D7FA 4R76A 5CBMA 5J8FA 3G3SA 3IU1A 1VHEA 4UEZA 4DJLA 1CPSA 2AE6A 3GIUA 4C2XA 5E96A 1IU8A 1IB1E 1QMUA 4MI4A 4NGPA 5EBVA 3R9FA 4R9MA 1YR0A 3FYNA 2AFMA 3KHXA 3V7ZA 2I00A 3S6HA 3OWCA 2Q0YA 5FVJA 3L2NA 4B12A 4YWYA 2AFXA 4K3NA 3S6KA 4C2ZA 1TF8A 3TO7A 4CRZB 5IB0A 2PJ4A 4PXEA 2ZPAA 1YLOA 3IU2A 5DWNA 4QVTA 2BL1A 2HB6A 4UWIA 4OC4A 5C88A 1Z8TA 4ZGYB 1DTDA 1A2ZA 2HV2A 2PJ3A 1TIQA 2GU2A 3CT9A 4FWUA 4KVME 5AGEA 3NH5A 2Z3KA 4QUSA 3EC4A 4OP4A 3RZAA 4B6ZA 1M4DA 4NGQA 5EC4A 3FH4A 4WJBA 3TE4A 2QYVA 4JWPA 4FD7A 4KOYA 4CYPA 1FT7A 3B8GA 1DE4C 1PYTB 4MY0A 4CAEA 3R9EA 2YNCC 2G9DA 2GFQA 3DR6A 3VWDA 2GLFA 2OB0A 3TCVA 4HNWB 2PJ0A 1Z9UA 3DR8A 3TT2A 1XMBA 2JEWA 4GXHA 4E2AA 4B5PB 4A2ZA 2ZEOA 1NE9A 4UEEA 5K8OA 1NSAA 3FB3A 3FMCA 5HXDA 1GYTA 4OMEA 3JVNA 3TO6A 3KQZA 4PK3A 3D7GA 5JPHA 5HVHA 4OC1A 4H2KA 3F5BA 3PFOA 3GUXA 4ONWA 4A33A 1M44A 4R8FA 3FBUA 1CBXA 2RB7A 2CTCA 3V38A 3H5ZA 3RO0A 1KZFA 2G0BA 2B5GA 2GREA 1ZLHA 2WZNA 2I79A 4MFZA 3PGPA 2EBJA 2R8VA 4I49A 4CYOA 1HDUA 3GYAA 3PBEA 1BPNA 1QSRA 4II9A 3PZJA 3LWUA 3R9GA 3FRMA 1FY7A 3DSBA 1IOIA 3T90A 2FIWA 4UA3A 2V8GA 2ZOGA 1YVOA 1Y7RA 1HEEA 4MFPA 1CJWA 3B3VA 1XE4A 3A9LA 4MFQA 4RI1A 2ZOFA 1TKHA 2FCKA 4UBRA 4AB7A 4MFLA 4C2YA
chains in the Genus database with same CATH topology
3D67A 1H8LA 3T8WA 1LAMA 2ZEFA 4DUKA 4X3RA 2XEGA 5JGFA 7CPAA 5LRGA 3CPXA 4ZY1A 1TKJA 3PB4X 3IEHA 2CF4A 1PCAA 4ZX8A 4ZY0A 3FF3A 1ZG8A 1LCPA 4Q7AA 4TNUA 1Y7EA 3B3WA 4MHPA 1Z2LA 2AFUA 3HUVA 3IWWA 2JBKA 1CP7A 4EFDA 3PEIA 2ZEMA 3BI1A 5IB9A 4O23A 4A94A 2EK9A 2IMOA 4ZYQA 4NGTA 1CX8A 1KWMA 2IQ6A 4W9YA 2NYQA 3K9TA 2EWBA 4NGMA 5D8NA 3S9LA 3FEDA 4OC0A 3N5FA 4A37A 3SJXA 2ZEPA 2I3CA 3NA6A 1ZLIA 3IFEA 3PBBA 4F9UA 4JYWA 4NJQA 4ZX9A 2OR4A 4G1PA 4F8ZA 3LMSA 3KQXA 3QNVA 1Q7LA 1IY7A 4NGSA 4IK2A 3FX6A 1AMPA 4OIWA 2V8DA 4X2TA 2ZELA 3D68A 1YW4A 2VL1A 1XRYA 3SJGA 3S9NA 4IAVA 1BAVA 3SJFA 3NH4A 4MRIA 4X8IA 4EWTA 3B7IA 3B2YA 1TF9A 1RTQA 2IJZA 4TWEA 3VATA 3SI2A 2PJ6A 4MHYA 3KI9A 3H8GA 5LYIA 2ZEEA 1M4LA 3SJEA 5K8PA 1VGYA 4P4BA 5LRKA 3WC7A 1HDQA 3H8FA 3FJUA 2PVVA 2V8HA 3KHZA 2PJAA 3DLJA 1XFOA 2ANPA 4AXVA 3D7HA 4WWVA 1JQGA 4P4DA 4P4IA 1Y0YA 1LANA 3PB8X 2F8HA 2V8VA 2ZENA 2PVWA 3NFZA 2AFSA 2GLJA 5JM6A 5F09A 1AYEA 5J1QA 4YU9A 2XEJA 3KR5A 3D66A 2O4HA 3HLPA 4MMOA 2C1CA 4PXDA 2Q4ZA 5CPAA 4MXUA 4OKOA 2RFHA 3RBUA 5D29A 1LOKA 2PJ5A 3MRUA 3PFEA 2Q51A 3RAMA 2FVGA 1YMEA 4FAIA 2PIZA 5HVFA 4MCQA 1XBUA 5LYLA 1ARMA 2ZEGA 2QVPA 3KR4A 5JH9A 2PRQA 2XEFA 3I1UA 1Y0RA 4UIBA 4P4EA 4PXBA 4GM5A 2PE3A 3D4UA 2NSMA 1F57A 3CPAA 3D7DA 3JRUA 4PXCA 4JZ0A 5ELYA 1FNOA 4F9VA 2PJ7A 4P45A 2BO9A 5LRJA 5HVGA 1ELMP 3BXMA 2JBJA 3FECA 3PRTA 1CP6A 3PB6X 3MN8A 2AFOA 1BLLE 1OBRA 2J9AA 2C6CA 3B3SA 4BD9A 1IGBA 4ZY2A 3IC1A 1ZG9A 2PCUA 2PJ2A 5K8NA 2WYRA 3IJ3A 3GLJA 4FUUA 4OIDA 2PIYA 2EK8A 3DGVA 4CPAA 2ABZA 2CIJA 3KASA 5DS0A 3IO1A 4PPZA 2ZEHA 5THWA 3BHXA 2QJ8A 4MCSA 2DEAA 2PJ1A 1TKFA 1VIXA 4KSIA 4DYOA 3WC5A 3WABA 3SI1A 4PQAA 4MHNA 1ARLA 3PB9X 1ELLP 3ISZA 3H8EA 1YW6A 3WC6A 5LYFA 2PJCA 4IHMA 2PJ9A 4UIAA 1UWYA 4OC2A 2PJ8A 5K8MA 2AFZA 1Z5RA 4NGNA 4P44A 4P10A 3VARA 1CPXA 2CTBA 3GB0A 3PB7X 4UEFA 1VHOA 3TC8A 2ZEDA 1BPMA 1R3NA 3ISXA 4R7MA 1Z8LA 1LFWA 2XEIA 6CPAA 3SI0A 3FVLA 1TXRA 4MHZA 4MCPA 4LQGA 3B3CA 3BI0A 3K2KA 3VH9A 1F2OA 2AFWA 2V77A 3CDXA 4MCRA 2PJBA 2Q43A 3KL9A 3TX8A 3KZWA 2BOAA 2C6PA 1XJOA 4NGRA 1R43A 5I4MA 1CG2A 3B3TA 2POKA 4OC5A 4P4JA 4A38A 4OC3A 2O53A 3FEEA 2F7VA 2OOTA 3NH8A 3S9MA 2C6GA 4P4FA 1F2PA 4A39A 1YSJA 3B35A 1LAPA 1QQ9A 3WT4A 4RUHA 4FBEA 3IIBA 8CPAA 4P6YA 4ZI6A 5LYDA 1EE3P 2HC9A 4EMEA 4Z65A 4UF4A 2BCOA 3KGQA 1ZG7A 4NFRA 4NJRA 4R6TA 4R76A 5CBMA 3D7FA 1VHEA 4UEZA 4DJLA 1CPSA 1QMUA 4NGPA 2AFMA 3KHXA 3V7ZA 3L2NA 4YWYA 2AFXA 4K3NA 1TF8A 2PJ4A 4PXEA 1YLOA 2HB6A 4OC4A 1DTDA 2PJ3A 2GU2A 3CT9A 4FWUA 3NH5A 3RZAA 4OP4A 4B6ZA 4NGQA 3FH4A 4WJBA 2QYVA 1FT7A 1DE4C 1PYTB 2G9DA 2GLFA 2PJ0A 1XMBA 2JEWA 2ZEOA 4UEEA 5K8OA 1NSAA 3FMCA 5HXDA 1GYTA 4OMEA 3KQZA 3D7GA 5HVHA 4OC1A 4H2KA 3PFOA 4ONWA 3GUXA 4R8FA 1CBXA 2RB7A 2CTCA 3V38A 2GREA 1ZLHA 2WZNA 1HDUA 3PBEA 1BPNA 3LWUA 2V8GA 2ZOGA 1HEEA 3B3VA 2ZOFA 1TKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D67 A;  1H8L A;  3T8W A;  1LAM A;  2ZEF A;  4DUK A;  4X3R A;  2XEG A;  5JGF A;  7CPA A;  5LRG A;  3CPX A;  4ZY1 A;  1TKJ A;  3PB4 X;  3IEH A;  2CF4 A;  1PCA A;  4ZX8 A;  4ZY0 A;  3FF3 A;  1ZG8 A;  1LCP A;  4Q7A A;  4TNU A;  1Y7E A;  3B3W A;  4MHP A;  1Z2L A;  2AFU A;  3HUV A;  3IWW A;  2JBK A;  1CP7 A;  4EFD A;  3PEI A;  2ZEM A;  3BI1 A;  5IB9 A;  4O23 A;  4A94 A;  2EK9 A;  2IMO A;  4ZYQ A;  4NGT A;  1CX8 A;  1KWM A;  2IQ6 A;  4W9Y A;  2NYQ A;  3K9T A;  2EWB A;  4NGM A;  5D8N A;  3S9L A;  3FED A;  4OC0 A;  3N5F A;  4A37 A;  3SJX A;  2ZEP A;  2I3C A;  3NA6 A;  1ZLI A;  3IFE A;  3PBB A;  4F9U A;  4JYW A;  4NJQ A;  4ZX9 A;  2OR4 A;  4G1P A;  4F8Z A;  3LMS A;  3KQX A;  3QNV A;  1Q7L A;  1IY7 A;  4NGS A;  4IK2 A;  3FX6 A;  1AMP A;  4OIW A;  2V8D A;  4X2T A;  2ZEL A;  3D68 A;  1YW4 A;  2VL1 A;  1XRY A;  3SJG A;  3S9N A;  4IAV A;  1BAV A;  3SJF A;  3NH4 A;  4MRI A;  4X8I A;  4EWT A;  3B7I A;  3B2Y A;  1TF9 A;  1RTQ A;  2IJZ A;  4TWE A;  3VAT A;  3SI2 A;  2PJ6 A;  4MHY A;  3KI9 A;  3H8G A;  5LYI A;  2ZEE A;  1M4L A;  3SJE A;  5K8P A;  1VGY A;  4P4B A;  5LRK A;  3WC7 A;  1HDQ A;  3H8F A;  3FJU A;  2PVV A;  2V8H A;  3KHZ A;  2PJA A;  3DLJ A;  1XFO A;  2ANP A;  4AXV A;  3D7H A;  4WWV A;  1JQG A;  4P4D A;  4P4I A;  1Y0Y A;  1LAN A;  3PB8 X;  2F8H A;  2V8V A;  2ZEN A;  2PVW A;  3NFZ A;  2AFS A;  2GLJ A;  5JM6 A;  5F09 A;  1AYE A;  5J1Q A;  4YU9 A;  2XEJ A;  3KR5 A;  3D66 A;  2O4H A;  3HLP A;  4MMO A;  2C1C A;  4PXD A;  2Q4Z A;  5CPA A;  4MXU A;  4OKO A;  2RFH A;  3RBU A;  5D29 A;  1LOK A;  2PJ5 A;  3MRU A;  3PFE A;  2Q51 A;  3RAM A;  2FVG A;  1YME A;  4FAI A;  2PIZ A;  5HVF A;  4MCQ A;  1XBU A;  5LYL A;  1ARM A;  2ZEG A;  2QVP A;  3KR4 A;  5JH9 A;  2PRQ A;  2XEF A;  3I1U A;  1Y0R A;  4UIB A;  4P4E A;  4PXB A;  4GM5 A;  2PE3 A;  3D4U A;  2NSM A;  1F57 A;  3CPA A;  3D7D A;  3JRU A;  4PXC A;  4JZ0 A;  5ELY A;  1FNO A;  4F9V A;  2PJ7 A;  4P45 A;  2BO9 A;  5LRJ A;  5HVG A;  1ELM P;  3BXM A;  2JBJ A;  3FEC A;  3PRT A;  1CP6 A;  3PB6 X;  3MN8 A;  2AFO A;  1BLL E;  1OBR A;  2J9A A;  2C6C A;  3B3S A;  4BD9 A;  1IGB A;  4ZY2 A;  3IC1 A;  1ZG9 A;  2PCU A;  2PJ2 A;  5K8N A;  2WYR A;  3IJ3 A;  3GLJ A;  4FUU A;  4OID A;  2PIY A;  2EK8 A;  3DGV A;  4CPA A;  2ABZ A;  2CIJ A;  3KAS A;  5DS0 A;  3IO1 A;  4PPZ A;  2ZEH A;  5THW A;  3BHX A;  2QJ8 A;  4MCS A;  2DEA A;  2PJ1 A;  1TKF A;  1VIX A;  4KSI A;  4DYO A;  3WC5 A;  3WAB A;  3SI1 A;  4PQA A;  4MHN A;  1ARL A;  3PB9 X;  1ELL P;  3ISZ A;  3H8E A;  1YW6 A;  3WC6 A;  5LYF A;  2PJC A;  4IHM A;  2PJ9 A;  4UIA A;  1UWY A;  4OC2 A;  2PJ8 A;  5K8M A;  2AFZ A;  1Z5R A;  4NGN A;  4P44 A;  4P10 A;  3VAR A;  1CPX A;  2CTB A;  3GB0 A;  3PB7 X;  4UEF A;  1VHO A;  3TC8 A;  2ZED A;  1BPM A;  1R3N A;  3ISX A;  4R7M A;  1Z8L A;  1LFW A;  2XEI A;  6CPA A;  3SI0 A;  3FVL A;  1TXR A;  4MHZ A;  4MCP A;  4LQG A;  3B3C A;  3BI0 A;  3K2K A;  3VH9 A;  1F2O A;  2AFW A;  2V77 A;  3CDX A;  4MCR A;  2PJB A;  2Q43 A;  3KL9 A;  3TX8 A;  3KZW A;  2BOA A;  2C6P A;  1XJO A;  4NGR A;  1R43 A;  5I4M A;  1CG2 A;  3B3T A;  2POK A;  4OC5 A;  4P4J A;  4A38 A;  4OC3 A;  2O53 A;  3FEE A;  2F7V A;  2OOT A;  3NH8 A;  3S9M A;  2C6G A;  4P4F A;  1F2P A;  4A39 A;  1YSJ A;  3B35 A;  1LAP A;  1QQ9 A;  3WT4 A;  4RUH A;  4FBE A;  3IIB A;  8CPA A;  4P6Y A;  4ZI6 A;  5LYD A;  1EE3 P;  2HC9 A;  4EME A;  4Z65 A;  4UF4 A;  2BCO A;  3KGQ A;  1ZG7 A;  4NFR A;  4NJR A;  4R6T A;  4R76 A;  5CBM A;  3D7F A;  1VHE A;  4UEZ A;  4DJL A;  1CPS A;  1QMU A;  4NGP A;  2AFM A;  3KHX A;  3V7Z A;  3L2N A;  4YWY A;  2AFX A;  4K3N A;  1TF8 A;  2PJ4 A;  4PXE A;  1YLO A;  2HB6 A;  4OC4 A;  1DTD A;  2PJ3 A;  2GU2 A;  3CT9 A;  4FWU A;  3NH5 A;  3RZA A;  4OP4 A;  4B6Z A;  4NGQ A;  3FH4 A;  4WJB A;  2QYV A;  1FT7 A;  1DE4 C;  1PYT B;  2G9D A;  2GLF A;  2PJ0 A;  1XMB A;  2JEW A;  2ZEO A;  4UEE A;  5K8O A;  1NSA A;  3FMC A;  5HXD A;  1GYT A;  4OME A;  3KQZ A;  3D7G A;  5HVH A;  4OC1 A;  4H2K A;  3PFO A;  4ONW A;  3GUX A;  4R8F A;  1CBX A;  2RB7 A;  2CTC A;  3V38 A;  2GRE A;  1ZLH A;  2WZN A;  1HDU A;  3PBE A;  1BPN A;  3LWU A;  2V8G A;  2ZOG A;  1HEE A;  3B3V A;  2ZOF A;  1TKH A; 
#chains in the Genus database with same CATH topology
 2Q7B A;  3D67 A;  3LD2 A;  4C7H A;  1H8L A;  2EO8 A;  3T8W A;  1LAM A;  2ZEF A;  4LQ6 A;  1S7K A;  2ZW6 A;  4KLW A;  4DUK A;  4X3R A;  2XEG A;  1X12 A;  5JGF A;  1GHE A;  5LRG A;  7CPA A;  1QSM A;  3CPX A;  3BLN A;  1S7F A;  4HNY B;  2QIR A;  4ZY1 A;  2PR8 A;  1TKJ A;  5A27 A;  3CXP A;  3PB4 X;  3IEH A;  5G22 A;  4BBH A;  2CF4 A;  1YVK A;  1MJB A;  1PCA A;  4ZX8 A;  1X10 A;  4ZY0 A;  5AG6 A;  4CAX A;  3FF3 A;  1ZG8 A;  2Z11 A;  2PR1 A;  2A4N A;  1LCP A;  4LX9 A;  4B5P A;  4Q7A A;  1Z8X A;  4TNU A;  4Y49 B;  1Y7E A;  3B3W A;  4MHP A;  4AVB A;  1Z2L A;  2AFU A;  3HUV A;  2VEZ A;  2RC4 A;  3IWW A;  2PDO A;  1J4J A;  2JBK A;  3VWE A;  1JWQ A;  1Z4E A;  1CP7 A;  4EFD A;  2KCW A;  3PEI A;  2ZEM A;  3BI1 A;  5IB9 A;  1XMT A;  2Q4Y A;  4O23 A;  4NCZ A;  1XEB A;  1P4N A;  2EK9 A;  4A94 A;  5A28 A;  1MJ9 A;  2IMO A;  4PV6 A;  4ZYQ A;  2ZW4 A;  4NGT A;  1CX8 A;  1KWM A;  2IQ6 A;  2Z3N A;  4W9Y A;  2X7B A;  2NYQ A;  1S5K A;  2QEC A;  1YX0 A;  2REF A;  3SHP A;  4QBJ A;  5ISV A;  4E8O A;  3K9T A;  4KVO E;  3TFY A;  3W91 A;  2DPS A;  1VKC A;  2EWB A;  4NGM A;  5D8N A;  4BIN A;  3S9L A;  3FED A;  4OC0 A;  3N5F A;  4A37 A;  4FD5 A;  3SJX A;  2ZEP A;  2I3C A;  1M1D A;  2O28 A;  3NA6 A;  4Q38 A;  1ZLI A;  3IFE A;  3JTK A;  1RXT A;  3PBB A;  4UFV A;  4F9U A;  4JYW A;  3PP9 A;  4NJQ A;  4ZX9 A;  2PQ8 A;  1Z8W A;  2OR4 A;  5J8C A;  4CRY B;  4G1P A;  3SXN A;  3RNZ A;  2K5T A;  4F8Z A;  4CYN A;  3LMS A;  4JLY A;  4QC6 A;  3W6X A;  2GE3 A;  2VI7 A;  1KUV A;  1QSO A;  1S7L A;  2DXQ A;  2JDD A;  2R1I A;  1Q7L A;  3KQX A;  2ODF A;  3QNV A;  1IY7 A;  3R1K A;  4M3S A;  4PSX A;  4XNH C;  4NGS A;  3CXQ A;  4IK2 A;  3FX6 A;  4KSF A;  4MY3 A;  4XPD B;  3T9Y A;  1YRE A;  1AMP A;  4OIW A;  2V8D A;  4C68 A;  4B13 A;  4X2T A;  2ZEL A;  3CZX A;  3D68 A;  1MK4 A;  1YW4 A;  2VL1 A;  1Q2D A;  3F0A A;  1XRY A;  3SJG A;  3S9N A;  4CGP A;  1Q2C A;  4IAV A;  4K30 A;  5HH1 A;  2DF5 A;  1BAV A;  2OZG A;  3NH4 A;  3SJF A;  4MRI A;  2HQY A;  2WSA A;  4X8I A;  3W6S A;  1OZP A;  4RN7 A;  1YK3 A;  2FXF A;  3BJ7 A;  2FT0 A;  3R96 A;  3B7I A;  4EWT A;  3B2Y A;  1TF9 A;  1RTQ A;  2IJZ A;  4TWE A;  3NE8 A;  1KUY A;  2JDC A;  4H89 A;  4YGO A;  3VAT A;  4E0A A;  4KSA A;  4Y49 C;  3SI2 A;  1KUX A;  2PJ6 A;  2WPW A;  2YGW A;  4MHY A;  3KI9 A;  3H8G A;  2REE A;  4NSQ A;  5LYI A;  4JJX A;  2ZEE A;  4R3K A;  5C82 A;  4JXQ A;  1M4L A;  3D8P A;  4KLV A;  2ZXV A;  3SJE A;  4CGO A;  5K8P A;  1VGY A;  4ONU A;  3V8I A;  4P4B A;  3CXS A;  5LRK A;  3WC7 A;  1HDQ A;  1L0C A;  3GKR A;  2B3V A;  3ZZI A;  3H8F A;  4B5O A;  1U6M A;  3D2M A;  4UCM A;  4UFW A;  3FJU A;  2Z3L A;  3LAC A;  2PVV A;  2V8H A;  5I0C A;  1RO5 A;  2VXK A;  3KHZ A;  2PJA A;  2ZW7 A;  3FIX A;  3DLJ A;  1XFO A;  4Q36 A;  1XOV A;  2ANP A;  4AXV A;  3D7H A;  5GCN A;  4WWV A;  1JQG A;  4P4D A;  4P4I A;  1Y0Y A;  4KZT A;  1LAN A;  4CS0 B;  3PB8 X;  2F8H A;  1B87 A;  4F0X A;  5AG5 A;  2V8V A;  4A31 A;  4C7I A;  2ZEN A;  1P0H A;  2AJ6 A;  2GAN A;  2PVW A;  3NFZ A;  4NF1 A;  3ZJ0 A;  2B4D B;  2AFS A;  2G3A A;  1CM0 A;  4IF5 A;  2NMT A;  4NXY A;  3QB8 A;  2GLJ A;  5JM6 A;  5F09 A;  2VZZ A;  2Q44 A;  1AYE A;  5J1Q A;  4YU9 A;  2XEJ A;  3KR5 A;  2EVN A;  3D66 A;  2O4H A;  4AG9 A;  5EMI A;  4KOS A;  1Q2Y A;  4F0Y A;  3I3G A;  3HLP A;  4MMO A;  2C1C A;  4PXD A;  3GY9 A;  2Q4Z A;  5CPA A;  4A95 A;  4MXU A;  2FL4 A;  4KS9 A;  1S7N A;  1S60 A;  3IWE A;  1B6B A;  1WK4 A;  4OKO A;  2Q4V A;  2VQY A;  4CGM A;  2RFH A;  3RBU A;  4NEX A;  5D29 A;  1LOK A;  2PJ5 A;  4UWJ A;  3IWG A;  4CGL A;  3MRU A;  3PFE A;  2Q51 A;  3QAY A;  5H84 A;  3RAM A;  2FVG A;  1YME A;  5IV0 A;  4FAI A;  2PIZ A;  1AUG A;  2OZH A;  5HVF A;  3TTH A;  2B4B A;  4MCQ A;  4UCN A;  1XBU A;  4R57 A;  5LYL A;  1ARM A;  3F8K A;  2ZEG A;  3S6G A;  1NSL A;  2CY2 A;  2QVP A;  4KOT A;  4MHD A;  4U9Z A;  3KR4 A;  1Z4R A;  5JH9 A;  2Z3O A;  2PRQ A;  1IOF A;  4B14 A;  2XEF A;  3I1U A;  4DNC A;  1Y0R A;  1XF8 A;  1I21 A;  4UIB A;  4P4E A;  5AG4 A;  4PXB A;  4GM5 A;  2PE3 A;  3D4U A;  2NSM A;  1F57 A;  3CPA A;  5G20 A;  3D7D A;  3JRU A;  4PXC A;  4JZ0 A;  5ELY A;  2VZY A;  3KKW A;  1FNO A;  4M6G A;  1VHS A;  3TOB A;  1IYK A;  4BMH A;  2PJ7 A;  4P45 A;  4UFX A;  2BO9 A;  4F9V A;  4H6Z A;  1IIC A;  2FS5 A;  5LRJ A;  2PC1 A;  5HVG A;  1ELM P;  2ZW5 A;  3S6F A;  1R57 A;  3BXM A;  4A30 A;  1YQE A;  2JBJ A;  4PSW A;  4F6A A;  1YGH A;  2P0W A;  3FEC A;  3PRT A;  2D4O A;  1CP6 A;  2B4D A;  3C26 A;  2ARH A;  1V0C A;  3PB6 X;  4MFJ A;  2GIV A;  3MN8 A;  2AFO A;  1BLL E;  1OBR A;  3DDD A;  3EY5 A;  2J9A A;  2C6C A;  4R3L A;  2CNM A;  2B3U A;  3B3S A;  1IID A;  4BD9 A;  1IGB A;  2R98 A;  4ORF A;  4ZY2 A;  4CAW A;  2FE7 A;  3IC1 A;  1S3Z A;  1ZG9 A;  4MBU A;  4CYQ A;  4KOV A;  2G3T A;  2J8R A;  1MJA A;  2PCU A;  2PJ2 A;  5F46 A;  5K8N A;  2WYR A;  3IJ3 A;  4B10 A;  3D2P A;  3GLJ A;  4FUU A;  4OID A;  2PIY A;  2EK8 A;  3EFA A;  4CAF A;  3P2H A;  4M6I A;  4U9Y A;  3DGV A;  4FD4 A;  4CPA A;  2ABZ A;  2CIJ A;  2OU2 A;  5HMN A;  3KAS A;  5DS0 A;  1PU9 A;  1K4J A;  3IO1 A;  2YNC A;  4LUA A;  2ZEH A;  1NMT A;  3FNC A;  4PPZ A;  5THW A;  3BHX A;  4R87 A;  2QJ8 A;  4FD6 A;  2WUU A;  3E0K A;  3P2F A;  4MCS A;  4JXR A;  1WWZ A;  2CNT A;  2DEA A;  2P6F A;  2J8M A;  3N7Z A;  4QB9 A;  2PJ1 A;  3TO9 A;  1UFH A;  4M6H A;  2Z10 A;  1TKF A;  1Y9K A;  1VIX A;  2YNE A;  3EXN A;  4KSI A;  4AG7 A;  4DYO A;  3JUW A;  3H4Q A;  4HPS A;  3WC5 A;  3WAB A;  3SI1 A;  1BOB A;  1M4G A;  2PRB A;  4M85 A;  3QAH A;  5IX3 A;  1XIX A;  1N71 A;  4PQA A;  4MHN A;  1ARL A;  2D4P A;  1ELL P;  2F5I A;  3PB9 X;  3ISZ A;  5AG7 A;  3H8E A;  4ZBG A;  1YW6 A;  4KVX A;  3WC6 A;  2J8N A;  4KUA A;  4HNX B;  5KTC A;  4X5K A;  5LYF A;  2PJC A;  4IHM A;  4OAD A;  2PJ9 A;  4UIA A;  4AVC A;  2FSR A;  3MGD A;  1UWY A;  3K9U A;  4KOW A;  4OC2 A;  2QML A;  5KTA A;  2PJ8 A;  2Y0M A;  1QSN A;  5K8M A;  3EO4 A;  3TOA A;  4YFJ A;  1BO4 A;  4KOX A;  2AFZ A;  2FIA A;  2C27 A;  3R95 A;  1Z5R A;  4NGN A;  4P44 A;  2Z0Z A;  4IUS A;  4P10 A;  3D3S A;  3I9S A;  3VAR A;  1CPX A;  1I1D A;  3FXT A;  2CTB A;  3GB0 A;  3PB7 X;  4UEF A;  1VHO A;  3RYO A;  5G21 A;  5F47 A;  3TC8 A;  1SQH A;  2ZED A;  3WR7 A;  4OLL A;  1BPM A;  1PUA A;  1R3N A;  5BWA B;  1QST A;  2PSW A;  3ISX A;  4R7M A;  1IYL A;  5F48 A;  1Z8L A;  1LFW A;  5H86 A;  2XEI A;  6CPA A;  3IGR A;  3SI0 A;  2H5M A;  3FVL A;  2R7H A;  2WPX A;  1TXR A;  4MHZ A;  4MFK A;  3DNS A;  4MCP A;  2BEI A;  3G8W A;  3B3C A;  4LQG A;  4XNH B;  4UCP A;  2IL4 A;  3NE7 A;  2OZU A;  2P6E A;  2DPT A;  3BI0 A;  3K2K A;  4KOR A;  4U5Y A;  3VH9 A;  4B11 A;  1F2O A;  2AFW A;  2V77 A;  3CDX A;  4MCR A;  4YRH A;  2PJB A;  2Q43 A;  3KL9 A;  4XPD C;  3TX8 A;  3KZW A;  2BOA A;  2C6P A;  4L8A A;  1XJO A;  2BSW A;  4NGR A;  3LOD A;  1R43 A;  5I4M A;  1CG2 A;  2ATR A;  3B3T A;  2POK A;  4XPL A;  1M4I A;  4OC5 A;  4P4J A;  4A38 A;  1ZO0 A;  2YND A;  4OC3 A;  4AVA A;  2CXA A;  2OH1 A;  4GS4 A;  2O53 A;  4H6U A;  4HKF A;  3FEE A;  2P6G A;  4MJ8 A;  2F7V A;  2OOT A;  3NH8 A;  3S9M A;  2B58 A;  2C6G A;  2Q7S A;  4P4F A;  1F2P A;  1ON0 A;  4OAE A;  1YSJ A;  4A39 A;  3B35 A;  2Z3M A;  1LAP A;  2HUZ A;  1I12 A;  5DWM A;  4XPK A;  1QQ9 A;  3SXO A;  3WT4 A;  5JQ4 A;  4J3G A;  4RUH A;  4FBE A;  2JLM A;  1Y9W A;  5G1Z A;  3IIB A;  2EUI A;  4P6Y A;  4ZI6 A;  8CPA A;  5LYD A;  1EE3 P;  2HC9 A;  3UY5 A;  4A32 A;  4EME A;  2CNS A;  4EVY A;  4CAV A;  2JEV A;  4JD6 A;  4Z65 A;  2Q04 A;  5KTD A;  4UF4 A;  4RS2 A;  4CGN A;  5F49 A;  2BCO A;  2VBQ A;  3KGQ A;  4KOU A;  4L89 A;  5CNP A;  4KUB A;  1ZG7 A;  2Z3P A;  2BUE A;  1YLE A;  3BJ8 A;  4NFR A;  4NJR A;  1LRZ A;  2B5G B;  4PK2 A;  4R6T A;  3D7F A;  4R76 A;  5CBM A;  5J8F A;  3G3S A;  3IU1 A;  1VHE A;  4UEZ A;  4DJL A;  1CPS A;  2AE6 A;  3GIU A;  4C2X A;  5E96 A;  1IU8 A;  1IB1 E;  1QMU A;  4MI4 A;  4NGP A;  5EBV A;  3R9F A;  4R9M A;  1YR0 A;  3FYN A;  2AFM A;  3KHX A;  3V7Z A;  2I00 A;  3S6H A;  3OWC A;  2Q0Y A;  5FVJ A;  3L2N A;  4B12 A;  4YWY A;  2AFX A;  4K3N A;  3S6K A;  4C2Z A;  1TF8 A;  3TO7 A;  4CRZ B;  5IB0 A;  2PJ4 A;  4PXE A;  2ZPA A;  1YLO A;  3IU2 A;  5DWN A;  4QVT A;  2BL1 A;  2HB6 A;  4UWI A;  4OC4 A;  5C88 A;  1Z8T A;  4ZGY B;  1DTD A;  1A2Z A;  2HV2 A;  2PJ3 A;  1TIQ A;  2GU2 A;  3CT9 A;  4FWU A;  4KVM E;  5AGE A;  3NH5 A;  2Z3K A;  4QUS A;  3EC4 A;  4OP4 A;  3RZA A;  4B6Z A;  1M4D A;  4NGQ A;  5EC4 A;  3FH4 A;  4WJB A;  3TE4 A;  2QYV A;  4JWP A;  4FD7 A;  4KOY A;  4CYP A;  1FT7 A;  3B8G A;  1DE4 C;  1PYT B;  4MY0 A;  4CAE A;  3R9E A;  2YNC C;  2G9D A;  2GFQ A;  3DR6 A;  3VWD A;  2GLF A;  2OB0 A;  3TCV A;  4HNW B;  2PJ0 A;  1Z9U A;  3DR8 A;  3TT2 A;  1XMB A;  2JEW A;  4GXH A;  4E2A A;  4B5P B;  4A2Z A;  2ZEO A;  1NE9 A;  4UEE A;  5K8O A;  1NSA A;  3FB3 A;  3FMC A;  5HXD A;  1GYT A;  4OME A;  3JVN A;  3TO6 A;  3KQZ A;  4PK3 A;  3D7G A;  5JPH A;  5HVH A;  4OC1 A;  4H2K A;  3F5B A;  3PFO A;  3GUX A;  4ONW A;  4A33 A;  1M44 A;  4R8F A;  3FBU A;  1CBX A;  2RB7 A;  2CTC A;  3V38 A;  3H5Z A;  3RO0 A;  1KZF A;  2G0B A;  2B5G A;  2GRE A;  1ZLH A;  2WZN A;  2I79 A;  4MFZ A;  3PGP A;  2EBJ A;  2R8V A;  4I49 A;  4CYO A;  1HDU A;  3GYA A;  3PBE A;  1BPN A;  1QSR A;  4II9 A;  3PZJ A;  3LWU A;  3R9G A;  3FRM A;  1FY7 A;  3DSB A;  1IOI A;  3T90 A;  2FIW A;  4UA3 A;  2V8G A;  2ZOG A;  1YVO A;  1Y7R A;  1HEE A;  4MFP A;  1CJW A;  3B3V A;  1XE4 A;  3A9L A;  4MFQ A;  4RI1 A;  2ZOF A;  1TKH A;  2FCK A;  4UBR A;  4AB7 A;  4MFL A;  4C2Y A; 
#chains in the Genus database with same CATH homology
 3D67 A;  1H8L A;  3T8W A;  1LAM A;  2ZEF A;  4DUK A;  4X3R A;  2XEG A;  5JGF A;  7CPA A;  5LRG A;  3CPX A;  4ZY1 A;  1TKJ A;  3PB4 X;  3IEH A;  2CF4 A;  1PCA A;  4ZX8 A;  4ZY0 A;  3FF3 A;  1ZG8 A;  1LCP A;  4Q7A A;  4TNU A;  1Y7E A;  3B3W A;  4MHP A;  1Z2L A;  2AFU A;  3HUV A;  3IWW A;  2JBK A;  1CP7 A;  4EFD A;  3PEI A;  2ZEM A;  3BI1 A;  5IB9 A;  4O23 A;  4A94 A;  2EK9 A;  2IMO A;  4ZYQ A;  4NGT A;  1CX8 A;  1KWM A;  2IQ6 A;  4W9Y A;  2NYQ A;  3K9T A;  2EWB A;  4NGM A;  5D8N A;  3S9L A;  3FED A;  4OC0 A;  3N5F A;  4A37 A;  3SJX A;  2ZEP A;  2I3C A;  3NA6 A;  1ZLI A;  3IFE A;  3PBB A;  4F9U A;  4JYW A;  4NJQ A;  4ZX9 A;  2OR4 A;  4G1P A;  4F8Z A;  3LMS A;  3KQX A;  3QNV A;  1Q7L A;  1IY7 A;  4NGS A;  4IK2 A;  3FX6 A;  1AMP A;  4OIW A;  2V8D A;  4X2T A;  2ZEL A;  3D68 A;  1YW4 A;  2VL1 A;  1XRY A;  3SJG A;  3S9N A;  4IAV A;  1BAV A;  3SJF A;  3NH4 A;  4MRI A;  4X8I A;  4EWT A;  3B7I A;  3B2Y A;  1TF9 A;  1RTQ A;  2IJZ A;  4TWE A;  3VAT A;  3SI2 A;  2PJ6 A;  4MHY A;  3KI9 A;  3H8G A;  5LYI A;  2ZEE A;  1M4L A;  3SJE A;  5K8P A;  1VGY A;  4P4B A;  5LRK A;  3WC7 A;  1HDQ A;  3H8F A;  3FJU A;  2PVV A;  2V8H A;  3KHZ A;  2PJA A;  3DLJ A;  1XFO A;  2ANP A;  4AXV A;  3D7H A;  4WWV A;  1JQG A;  4P4D A;  4P4I A;  1Y0Y A;  1LAN A;  3PB8 X;  2F8H A;  2V8V A;  2ZEN A;  2PVW A;  3NFZ A;  2AFS A;  2GLJ A;  5JM6 A;  5F09 A;  1AYE A;  5J1Q A;  4YU9 A;  2XEJ A;  3KR5 A;  3D66 A;  2O4H A;  3HLP A;  4MMO A;  2C1C A;  4PXD A;  2Q4Z A;  5CPA A;  4MXU A;  4OKO A;  2RFH A;  3RBU A;  5D29 A;  1LOK A;  2PJ5 A;  3MRU A;  3PFE A;  2Q51 A;  3RAM A;  2FVG A;  1YME A;  4FAI A;  2PIZ A;  5HVF A;  4MCQ A;  1XBU A;  5LYL A;  1ARM A;  2ZEG A;  2QVP A;  3KR4 A;  5JH9 A;  2PRQ A;  2XEF A;  3I1U A;  1Y0R A;  4UIB A;  4P4E A;  4PXB A;  4GM5 A;  2PE3 A;  3D4U A;  2NSM A;  1F57 A;  3CPA A;  3D7D A;  3JRU A;  4PXC A;  4JZ0 A;  5ELY A;  1FNO A;  4F9V A;  2PJ7 A;  4P45 A;  2BO9 A;  5LRJ A;  5HVG A;  1ELM P;  3BXM A;  2JBJ A;  3FEC A;  3PRT A;  1CP6 A;  3PB6 X;  3MN8 A;  2AFO A;  1BLL E;  1OBR A;  2J9A A;  2C6C A;  3B3S A;  4BD9 A;  1IGB A;  4ZY2 A;  3IC1 A;  1ZG9 A;  2PCU A;  2PJ2 A;  5K8N A;  2WYR A;  3IJ3 A;  3GLJ A;  4FUU A;  4OID A;  2PIY A;  2EK8 A;  3DGV A;  4CPA A;  2ABZ A;  2CIJ A;  3KAS A;  5DS0 A;  3IO1 A;  4PPZ A;  2ZEH A;  5THW A;  3BHX A;  2QJ8 A;  4MCS A;  2DEA A;  2PJ1 A;  1TKF A;  1VIX A;  4KSI A;  4DYO A;  3WC5 A;  3WAB A;  3SI1 A;  4PQA A;  4MHN A;  1ARL A;  3PB9 X;  1ELL P;  3ISZ A;  3H8E A;  1YW6 A;  3WC6 A;  5LYF A;  2PJC A;  4IHM A;  2PJ9 A;  4UIA A;  1UWY A;  4OC2 A;  2PJ8 A;  5K8M A;  2AFZ A;  1Z5R A;  4NGN A;  4P44 A;  4P10 A;  3VAR A;  1CPX A;  2CTB A;  3GB0 A;  3PB7 X;  4UEF A;  1VHO A;  3TC8 A;  2ZED A;  1BPM A;  1R3N A;  3ISX A;  4R7M A;  1Z8L A;  1LFW A;  2XEI A;  6CPA A;  3SI0 A;  3FVL A;  1TXR A;  4MHZ A;  4MCP A;  4LQG A;  3B3C A;  3BI0 A;  3K2K A;  3VH9 A;  1F2O A;  2AFW A;  2V77 A;  3CDX A;  4MCR A;  2PJB A;  2Q43 A;  3KL9 A;  3TX8 A;  3KZW A;  2BOA A;  2C6P A;  1XJO A;  4NGR A;  1R43 A;  5I4M A;  1CG2 A;  3B3T A;  2POK A;  4OC5 A;  4P4J A;  4A38 A;  4OC3 A;  2O53 A;  3FEE A;  2F7V A;  2OOT A;  3NH8 A;  3S9M A;  2C6G A;  4P4F A;  1F2P A;  4A39 A;  1YSJ A;  3B35 A;  1LAP A;  1QQ9 A;  3WT4 A;  4RUH A;  4FBE A;  3IIB A;  8CPA A;  4P6Y A;  4ZI6 A;  5LYD A;  1EE3 P;  2HC9 A;  4EME A;  4Z65 A;  4UF4 A;  2BCO A;  3KGQ A;  1ZG7 A;  4NFR A;  4NJR A;  4R6T A;  4R76 A;  5CBM A;  3D7F A;  1VHE A;  4UEZ A;  4DJL A;  1CPS A;  1QMU A;  4NGP A;  2AFM A;  3KHX A;  3V7Z A;  3L2N A;  4YWY A;  2AFX A;  4K3N A;  1TF8 A;  2PJ4 A;  4PXE A;  1YLO A;  2HB6 A;  4OC4 A;  1DTD A;  2PJ3 A;  2GU2 A;  3CT9 A;  4FWU A;  3NH5 A;  3RZA A;  4OP4 A;  4B6Z A;  4NGQ A;  3FH4 A;  4WJB A;  2QYV A;  1FT7 A;  1DE4 C;  1PYT B;  2G9D A;  2GLF A;  2PJ0 A;  1XMB A;  2JEW A;  2ZEO A;  4UEE A;  5K8O A;  1NSA A;  3FMC A;  5HXD A;  1GYT A;  4OME A;  3KQZ A;  3D7G A;  5HVH A;  4OC1 A;  4H2K A;  3PFO A;  4ONW A;  3GUX A;  4R8F A;  1CBX A;  2RB7 A;  2CTC A;  3V38 A;  2GRE A;  1ZLH A;  2WZN A;  1HDU A;  3PBE A;  1BPN A;  3LWU A;  2V8G A;  2ZOG A;  1HEE A;  3B3V A;  2ZOF A;  1TKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...