2AFWA

Crystal structure of human glutaminyl cyclase in complex with n-acetylhistamine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afwA00
1LAMA 2PVVA 3B7IA 4PQAA 3GUXA 4NGMA 2CTBA 3KHZA 5D8NA 4FUUA 1R3NA 4MHNA 3K9TA 3I1UA 1BLLE 2HC9A 3FECA 2PJ4A 2FVGA 1CP6A 4OKOA 3CDXA 3SJXA 3FEEA 3IC1A 4DUKA 4ONWA 4MCPA 3KR5A 3PB6X 3NA6A 3V7ZA 4X8IA 1ZLIA 1ELMP 2ANPA 1LAPA 3HUVA 2AFWA 4R6TA 4MCSA 1ZLHA 3D7HA 2CF4A 5K8MA 5LYIA 3JRUA 4MHZA 2I3CA 4NGSA 1YW4A 3WC7A 4NGQA 4NFRA 4OMEA 2ZOGA 4B6ZA 2F7VA 2PJ7A 3D7FA 3PBBA 1YLOA 1CX8A 1LOKA 4R76A 3WABA 2G9DA 3FEDA 3PEIA 2GLFA 4RUHA 3CPXA 3PRTA 3QNVA 1R43A 3BI1A 4EMEA 6CPAA 1ZG7A 4WJBA 2EK8A 3B3WA 4PXDA 4NGPA 2IJZA 4OC0A 5JGFA 1TKHA 4NGTA 3N5FA 4P4BA 2C6GA 5THWA 3FF3A 2AFZA 2WYRA 4G1PA 4A94A 3NH8A 4MCRA 2EK9A 3PB8X 5LYDA 2ZEFA 4PXBA 1NSAA 3KR4A 2DEAA 4UEZA 1KWMA 3PB9X 2OR4A 1IGBA 2POKA 5LYFA 4K3NA 3VATA 3RAMA 3ISXA 3CPAA 3VH9A 2ZEMA 2C1CA 4WWVA 1CBXA 3PB7X 2QYVA 1LCPA 4IK2A 3IO1A 4P6YA 1XJOA 4P4DA 3TC8A 3H8GA 4F8ZA 1VHEA 3WC5A 4FAIA 4UIAA 2PJ1A 3D7DA 3IFEA 4ZY0A 4P10A 2ZOFA 2PJ2A 4UF4A 4Z65A 5CPAA 4P4IA 3NFZA 5IB9A 3KGQA 4OC3A 5LRKA 1QMUA 2ZEGA 5I4MA 2AFUA 4OC1A 1Q7LA 1Z8LA 4MXUA 4OC4A 3S9NA 4PXEA 3DLJA 1IY7A 1HDQA 4F9VA 1VHOA 3B3CA 3D66A 2PIYA 1XFOA 2PJ9A 2PJAA 4OC2A 2VL1A 4A38A 1QQ9A 3KQXA 5HVGA 4KSIA 4UIBA 3VARA 2ZELA 4A37A 4OIDA 3B3SA 2PCUA 2GU2A 1OBRA 3B2YA 3CT9A 2AFOA 3WC6A 2RB7A 4ZI6A 3IWWA 5HVFA 4MMOA 1Z2LA 2C6CA 3FMCA 1YW6A 1DE4C 2PJ3A 5JH9A 2ZEDA 1F57A 2ZEEA 2AFSA 3BXMA 3SJEA 5HVHA 1F2PA 7CPAA 4MCQA 1CPSA 1TKFA 3ISZA 4ZX8A 3FX6A 4F9UA 1CP7A 2ZEHA 5F09A 2ZENA 1AMPA 3H8EA 5ELYA 2O4HA 1HEEA 3FH4A 2BCOA 3WT4A 4X2TA 3NH4A 3GLJA 1M4LA 1F2OA 3H8FA 4NJRA 2PVWA 1H8LA 4EFDA 3PB4X 4MRIA 2CIJA 4H2KA 4GM5A 5K8PA 2QJ8A 4Q7AA 1TXRA 1TF9A 5CBMA 2ABZA 5HXDA 3TX8A 4ZY1A 4EWTA 3D7GA 2JBKA 3B3VA 3RBUA 2PRQA 4A39A 2O53A 2V8VA 1YMEA 4DYOA 1Y0RA 1ARMA 2ZEOA 2GLJA 5J1QA 4P45A 1VGYA 4TWEA 2AFXA 4R8FA 3L2NA 1Y0YA 1LFWA 3GB0A 3D67A 4FWUA 1ELLP 1EE3P 4OP4A 3IJ3A 3V38A 3KZWA 2ZEPA 4YWYA 1VIXA 3DGVA 4NJQA 5K8OA 4IAVA 2V77A 2HB6A 3SI0A 4IHMA 3KI9A 2PJ6A 3SI2A 1BPMA 5LRJA 2PE3A 4JZ0A 1BPNA 4OC5A 5DS0A 2XEFA 3PFEA 3KASA 1ZG8A 4P4JA 2PJCA 2F8HA 3SI1A 1PCAA 2Q51A 1Y7EA 1YSJA 2V8DA 2PJ8A 3MN8A 4NGRA 4BD9A 2RFHA 3D68A 3HLPA 1Z5RA 3D4UA 5LRGA 2PIZA 2IMOA 2PJ0A 3B3TA 1PYTB 2BOAA 4P4EA 3K2KA 1JQGA 5JM6A 4UEFA 2V8HA 2PJ5A 3T8WA 5LYLA 3NH5A 2V8GA 3FJUA 1AYEA 2JBJA 2Q4ZA 5D29A 4AXVA 3KQZA 1ZG9A 3IIBA 1ARLA 2JEWA 1HDUA 1DTDA 2PJBA 1UWYA 3BHXA 4NGNA 2Q43A 4FBEA 2BO9A 3FVLA 3SJFA 3MRUA 4OIWA 3PFOA 2C6PA 4W9YA 2OOTA 4R7MA 1GYTA 2GREA 2J9AA 1FNOA 4X3RA 4TNUA 2QVPA 3KHXA 4JYWA 1FT7A 3LMSA 2IQ6A 4CPAA 2XEIA 3B35A 2AFMA 3LWUA 1CG2A 4LQGA 3SJGA 3PBEA 3RZAA 1CPXA 4ZY2A 2NYQA 3BI0A 4P4FA 1XBUA 2XEJA 1LANA 4ZYQA 2WZNA 4PPZA 5K8NA 1XMBA 4MHYA 4PXCA 1XRYA 4UEEA 3S9LA 2CTCA 4DJLA 1RTQA 2XEGA 4MHPA 2EWBA 3KL9A 3S9MA 3IEHA 4ZX9A 1BAVA 8CPAA 4P44A 4YU9A 1TF8A 1TKJA 2NSMA 4O23A
chains in the Genus database with same CATH superfamily
4CRZB 1LAMA 2PVVA 4QB9A 5H84A 3B7IA 5A27A 2Z10A 4UWJA 3TTHA 4PQAA 1YR0A 3GUXA 4IF5A 4NGMA 4PSXA 2CTBA 4ORFA 4KSAA 3KHZA 1NSLA 5AG7A 5GCNA 1M4GA 5D8NA 4FUUA 1R3NA 2Z3NA 4KOXA 2WPWA 4MHNA 3K9TA 3I1UA 1BLLE 3ZJ0A 2HC9A 3IGRA 2R98A 4A32A 3FECA 4KUBA 2CXAA 2FVGA 2PJ4A 3F0AA 1CP6A 3GY9A 4OKOA 2Q7SA 1IYLA 4JWPA 3CDXA 3SJXA 3FEEA 2B5GA 3IC1A 2G3AA 3DSBA 4IUSA 4MCPA 4ONWA 5AGEA 1VKCA 3FNCA 3SXNA 3KR5A 3TO6A 4UFXA 3PB6X 3QB8A 2HQYA 3NA6A 3V7ZA 2FE7A 4X8IA 2P0WA 2A4NA 2FS5A 4MFKA 1ZLIA 1ELMP 2ANPA 1LAPA 4PK3A 1X12A 1IOFA 3D2PA 3HUVA 4KS9A 4KSFA 2QECA 2PDOA 2ZXVA 2AFWA 4R6TA 4MCSA 3T90A 1ZLHA 3CXQA 3D7HA 2CF4A 1MJAA 5K8MA 5LYIA 3JRUA 4MHZA 4RI1A 2I3CA 4NGSA 1YW4A 3WC7A 4NGQA 4NFRA 4OMEA 5F47A 2ZOGA 3IWEA 4LX9A 1SQHA 2I79A 3W91A 4B6ZA 2F7VA 4CS0B 2PJ7A 2JDDA 4UBRA 4F0XA 1QSRA 3TOBA 4E2AA 1M4DA 2HUZA 3D7FA 2EBJA 3GIUA 3K9UA 1S60A 3PBBA 1YLOA 1CX8A 1XE4A 3LODA 2FT0A 1LOKA 4XPKA 4R76A 2CNMA 5BWAB 5G21A 2G9DA 2Q4VA 3FEDA 3JTKA 3PEIA 3WABA 2GLFA 2GANA 3PZJA 4RUHA 3CPXA 3PRTA 4K30A 4KVME 5DWMA 3QNVA 1R43A 2CNSA 1BO4A 1QSMA 3BI1A 1ZO0A 4EMEA 4A95A 6CPAA 1YQEA 1ZG7A 4WJBA 2YNCC 2OZHA 2EK8A 2PR1A 3B3WA 4XNHC 2R7HA 4JLYA 2YGWA 4PXDA 3V8IA 3P2HA 4YRHA 4NGPA 3ZZIA 2IJZA 5A28A 1PUAA 4OC0A 4XNHB 4U9ZA 1TKHA 4NGTA 2ODFA 4JD6A 4R87A 2Z3KA 3N5FA 5JGFA 2J8RA 4P4BA 2C6GA 5THWA 4YFJA 3FF3A 2AFZA 2WYRA 4G1PA 4A94A 4B10A 3NH8A 4AVBA 2NMTA 2WUUA 1IB1E 4MCRA 2EK9A 3PB8X 4QVTA 2GFQA 5LYDA 4GXHA 2ZEFA 4PXBA 1NSAA 3KR4A 4QC6A 2OH1A 3G3SA 4A33A 1Z9UA 2DEAA 1KWMA 4HNXB 4UEZA 4RN7A 3T9YA 3PB9X 3I3GA 3TO9A 2OR4A 2FSRA 1IGBA 2POKA 5LYFA 1L0CA 4K3NA 3VATA 3RAMA 1TIQA 4UWIA 3ISXA 3CPAA 4E8OA 3TFYA 1R57A 1M1DA 4CYOA 3VH9A 2ZEMA 1ON0A 1Y9WA 2C1CA 4H89A 4MFQA 4NSQA 4U5YA 1CBXA 4WWVA 3FXTA 3PB7X 2RC4A 5J8FA 5DWNA 2ZW5A 2QYVA 1LCPA 4IK2A 3IO1A 4I49A 1CM0A 4P6YA 1XJOA 2Q04A 4P4DA 1S5KA 1WWZA 2JLMA 3TC8A 3H8GA 3I9SA 4F8ZA 4FD4A 1VHEA 3WC5A 4QBJA 4FAIA 4NF1A 2CY2A 4OADA 4UIAA 2PJ1A 3D7DA 4CGPA 3IFEA 4ZY0A 2VQYA 4P10A 2ZOFA 2PJ2A 4UF4A 2DPTA 4Z65A 3JVNA 4KUAA 5CPAA 3S6FA 4P4IA 3NFZA 5IB9A 3H5ZA 4B5PA 4R3KA 2J8NA 3KGQA 4OC3A 2EO8A 1V0CA 2JEVA 2IL4A 5JQ4A 4II9A 4CAXA 4PK2A 5LRKA 2K5TA 2CNTA 1K4JA 1QMUA 1S7FA 2ZEGA 5I4MA 2AFUA 2FCKA 4OC1A 1Q7LA 1VHSA 1Z8LA 2REFA 2FL4A 4MXUA 4OC4A 3WR7A 3S9NA 2PRBA 1Y7RA 4PXEA 3DLJA 3FRMA 1IY7A 4UA3A 1HDQA 4F9VA 3EXNA 4M85A 4FD7A 1VHOA 3B3CA 4KVOE 4CGMA 3D66A 4JXRA 3SXOA 2PIYA 2KCWA 1XFOA 2PJ9A 2PJAA 3PP9A 5AG4A 4OC2A 4A2ZA 4UFVA 2VL1A 4A38A 1QQ9A 3KQXA 5HVGA 4KSIA 2Z3OA 4UIBA 3GYAA 1XIXA 1KUYA 4YGOA 4Q38A 1KZFA 3VARA 3FBUA 2ZELA 4A37A 1PU9A 2B4DA 4OIDA 2REEA 3B3SA 2PCUA 2VBQA 3R95A 2GU2A 1OBRA 3B2YA 3CT9A 2AFOA 5G22A 3WC6A 2RB7A 4ZI6A 2G3TA 3IWWA 5HVFA 4C68A 1IICA 4BINA 4MMOA 1Z2LA 2C6CA 2YNDA 3FMCA 3MGDA 4KOUA 1YW6A 4UCMA 1DE4C 2PJ3A 3S6KA 4C2ZA 4F6AA 5JH9A 2ZEDA 1F57A 2ZEEA 1NE9A 3SHPA 2AFSA 3BXMA 2G0BA 2B3UA 4L8AA 2ZPAA 3SJEA 2H5MA 4C7HA 5HVHA 2PR8A 2Y0MA 1AUGA 3FIXA 1F2PA 3G8WA 2Q7BA 7CPAA 4MCQA 4CYNA 1CPSA 1TKFA 3ISZA 3EY5A 5F49A 1QSTA 3IWGA 4OAEA 4ZX8A 3FX6A 4E0AA 1CP7A 4F9UA 2ZEHA 5F09A 2ZENA 4MFLA 5C88A 2D4OA 2B4BA 1AMPA 2FIWA 4LUAA 4CGNA 3H8EA 5ELYA 2O4HA 3KKWA 1HEEA 1U6MA 4B12A 2ZW4A 3FH4A 2BCOA 3WT4A 1IU8A 2PQ8A 4GS4A 4X2TA 2VI7A 3NH4A 1X10A 3GLJA 1M4LA 1Z4RA 4L89A 4R9MA 1GHEA 1F2OA 3H8FA 4NJRA 2PVWA 4HNWB 1H8LA 2P6FA 5IV0A 4MFPA 4EFDA 2ZW6A 3PB4X 2I00A 4MRIA 2CIJA 1MJ9A 4H2KA 4M6GA 4UFWA 2DXQA 2BSWA 1XMTA 3D3SA 4GM5A 5CNPA 2P6EA 4MY3A 5K8PA 2QJ8A 4Q7AA 4CAFA 2Q0YA 3R96A 1J4JA 2ZW7A 4RS2A 1TXRA 4H6UA 5J8CA 4CRYB 1TF9A 4U9YA 3DDDA 5CBMA 4H6ZA 2ABZA 5HXDA 3TX8A 4ZY1A 3VWEA 4EWTA 3R9FA 1S7NA 2Z11A 2VZZA 3FYNA 2C27A 5JPHA 2B3VA 3D7GA 2PSWA 2JBKA 3B3VA 3NE7A 4XPLA 1Y9KA 3RYOA 1BOBA 3RBUA 2EVNA 2PRQA 4KOTA 4A39A 4MY0A 3UY5A 2O53A 5I0CA 2V8VA 4KLVA 1YMEA 4NXYA 1JWQA 1Y0RA 4DYOA 1ARMA 3DR8A 3IU2A 1B87A 3EO4A 2ZEOA 2GLJA 5J1QA 4P45A 4NCZA 4R3LA 3QAHA 1OZPA 1VGYA 4MBUA 4TWEA 3NE8A 2AFXA 2ATRA 3JUWA 4R8FA 3EFAA 3L2NA 3TCVA 4MJ8A 2ARHA 4MHDA 4B11A 2OZUA 1Z8TA 1I12A 4J3GA 1Y0YA 1NMTA 1LFWA 3GB0A 2R8VA 3D67A 4FWUA 2QMLA 5ISVA 4KOVA 3RNZA 1ELLP 1EE3P 4OP4A 3DNSA 3IJ3A 5KTAA 5C82A 3V38A 5KTDA 1M44A 3KZWA 2ZEPA 4YWYA 1VIXA 4B5PB 2Z0ZA 4B5OA 3EC4A 4JJXA 3DGVA 1UFHA 4NJQA 5K8OA 1YLEA 4IAVA 2V77A 2HB6A 4ZGYB 3SI0A 3R9EA 4CGLA 4AVCA 4IHMA 3KI9A 2PJ6A 3SI2A 1XOVA 4CAEA 1BPMA 3BLNA 2P6GA 5LRJA 3OWCA 1I1DA 3A9LA 2PE3A 3D2MA 1BPNA 2BL1A 4JZ0A 4OC5A 5DS0A 2XEFA 3F5BA 2DF5A 2FIAA 3KASA 3PFEA 4CYPA 1ZG8A 4P4JA 2PJCA 3CXSA 2F8HA 2R1IA 2Z3PA 4DNCA 2WSAA 3SI1A 5F46A 1PCAA 2Q51A 1WK4A 1Y7EA 1Z8WA 5H86A 1YSJA 2B5GB 2V8DA 3R9GA 2AE6A 3TT2A 2PJ8A 3N7ZA 1I21A 1M4IA 4M6IA 5EC4A 3MN8A 4NGRA 3F8KA 4BD9A 2RFHA 3D68A 3HLPA 4DUKA 1Z5RA 4R57A 3D4UA 4CAWA 1Q2DA 5FVJA 5LRGA 2PIZA 2IMOA 2PJ0A 3B3TA 4KOYA 1PYTB 2BOAA 2VEZA 2F5IA 5EMIA 1S3ZA 4P4EA 2B4DB 3IU1A 4M6HA 4Q36A 3S6GA 1XEBA 3K2KA 3FB3A 1JQGA 2BEIA 1Q2YA 5EBVA 5JM6A 5IX3A 4UEFA 2PC1A 4BBHA 2V8HA 4AB7A 5IB0A 2PJ5A 1KUXA 3W6SA 3T8WA 4AVAA 5LYLA 4UCNA 3NH5A 3B8GA 2V8GA 4OLLA 3FJUA 1AYEA 4ZBGA 3S6HA 4F0YA 1P4NA 2JBJA 2Q4ZA 5D29A 3VWDA 2D4PA 2VZYA 4AG9A 4AXVA 4JXQA 3KQZA 1ZG9A 3IIBA 4CYQA 4BMHA 1ARLA 2JEWA 4XPDC 1HDUA 1DTDA 2GE3A 2PJBA 2EUIA 1P0HA 2FXFA 1UWYA 3BHXA 4NGNA 4XPDB 2HV2A 5E96A 3R1KA 4KOWA 1Z4EA 4MFZA 2Q43A 1LRZA 4PV6A 4FBEA 5HH1A 1QSNA 2BO9A 4NEXA 3FVLA 3SJFA 4KVXA 1YK3A 4A31A 1IYKA 3MRUA 4HKFA 4M3SA 4B13A 1S7LA 2DPSA 4LQ6A 4HPSA 2BUEA 4OIWA 3PFOA 2Z3MA 3QAYA 2C6PA 4W9YA 5AG6A 2OOTA 1YX0A 2JDCA 4R7MA 3LD2A 4KORA 2X7BA 4CAVA 4UCPA 1N71A 1GYTA 3BJ8A 5F48A 4EVYA 1QSOA 1IIDA 3PGPA 2GREA 2J9AA 1FNOA 4X3RA 4TNUA 1RXTA 4MFJA 2QVPA 4HNYB 5G1ZA 2YNCA 3KHXA 4CGOA 4JYWA 1FT7A 4ONUA 4MI4A 5KTCA 2O28A 3LMSA 1B6BA 1Q2CA 3C26A 2IQ6A 1YVOA 1MJBA 2QIRA 3TO7A 4CPAA 1FY7A 5HMNA 2GIVA 4C2XA 2XEIA 3B35A 4C7IA 2AFMA 5G20A 3LWUA 2YNEA 1CG2A 4LQGA 3SJGA 4FD6A 3PBEA 3RZAA 1CPXA 3RO0A 4ZY2A 1YREA 3W6XA 2NYQA 4FD5A 1YGHA 2Z3LA 1S7KA 1KUVA 3BI0A 4P4FA 2Q44A 1XBUA 2XEJA 4PSWA 1A2ZA 1LANA 2VXKA 4ZYQA 2WZNA 4PPZA 1CJWA 4B14A 3DR6A 2B58A 5K8NA 1XMBA 1Z8XA 4MHYA 4PXCA 1XRYA 3D8PA 4UEEA 2WPXA 3S9LA 2OZGA 1YVKA 2CTCA 3H4QA 4KLWA 4Y49C 4DJLA 1RTQA 2XEGA 1MK4A 4C2YA 4MHPA 3CXPA 3GKRA 2EWBA 4Y49B 3KL9A 4KOSA 3S9MA 4X5KA 3IEHA 4ZX9A 1BAVA 4A30A 2J8MA 8CPAA 3LACA 3P2FA 4P44A 4YU9A 1TF8A 5AG5A 1IOIA 1RO5A 2Q4YA 4KZTA 1TKJA 2NSMA 3E0KA 2OU2A 1XF8A 3TE4A 4QUSA 4O23A 3BJ7A 4AG7A 2OB0A 2AJ6A 3TOAA 3CZXA
chains in the Genus database with same CATH topology
1LAMA 2PVVA 3B7IA 4PQAA 3GUXA 4NGMA 2CTBA 3KHZA 5D8NA 4FUUA 1R3NA 4MHNA 3K9TA 3I1UA 1BLLE 2HC9A 3FECA 2PJ4A 2FVGA 1CP6A 4OKOA 3CDXA 3SJXA 3FEEA 3IC1A 4DUKA 4ONWA 4MCPA 3KR5A 3PB6X 3NA6A 3V7ZA 4X8IA 1ZLIA 1ELMP 2ANPA 1LAPA 3HUVA 2AFWA 4R6TA 4MCSA 1ZLHA 3D7HA 2CF4A 5K8MA 5LYIA 3JRUA 4MHZA 2I3CA 4NGSA 1YW4A 3WC7A 4NGQA 4NFRA 4OMEA 2ZOGA 4B6ZA 2F7VA 2PJ7A 3D7FA 3PBBA 1YLOA 1CX8A 1LOKA 4R76A 3WABA 2G9DA 3FEDA 3PEIA 2GLFA 4RUHA 3CPXA 3PRTA 3QNVA 1R43A 3BI1A 4EMEA 6CPAA 1ZG7A 4WJBA 2EK8A 3B3WA 4PXDA 4NGPA 2IJZA 4OC0A 5JGFA 1TKHA 4NGTA 3N5FA 4P4BA 2C6GA 5THWA 3FF3A 2AFZA 2WYRA 4G1PA 4A94A 3NH8A 4MCRA 2EK9A 3PB8X 5LYDA 2ZEFA 4PXBA 1NSAA 3KR4A 2DEAA 4UEZA 1KWMA 3PB9X 2OR4A 1IGBA 2POKA 5LYFA 4K3NA 3VATA 3RAMA 3ISXA 3CPAA 3VH9A 2ZEMA 2C1CA 4WWVA 1CBXA 3PB7X 2QYVA 1LCPA 4IK2A 3IO1A 4P6YA 1XJOA 4P4DA 3TC8A 3H8GA 4F8ZA 1VHEA 3WC5A 4FAIA 4UIAA 2PJ1A 3D7DA 3IFEA 4ZY0A 4P10A 2ZOFA 2PJ2A 4UF4A 4Z65A 5CPAA 4P4IA 3NFZA 5IB9A 3KGQA 4OC3A 5LRKA 1QMUA 2ZEGA 5I4MA 2AFUA 4OC1A 1Q7LA 1Z8LA 4MXUA 4OC4A 3S9NA 4PXEA 3DLJA 1IY7A 1HDQA 4F9VA 1VHOA 3B3CA 3D66A 2PIYA 1XFOA 2PJ9A 2PJAA 4OC2A 2VL1A 4A38A 1QQ9A 3KQXA 5HVGA 4KSIA 4UIBA 3VARA 2ZELA 4A37A 4OIDA 3B3SA 2PCUA 2GU2A 1OBRA 3B2YA 3CT9A 2AFOA 3WC6A 2RB7A 4ZI6A 3IWWA 5HVFA 4MMOA 1Z2LA 2C6CA 3FMCA 1YW6A 1DE4C 2PJ3A 5JH9A 2ZEDA 1F57A 2ZEEA 2AFSA 3BXMA 3SJEA 5HVHA 1F2PA 7CPAA 4MCQA 1CPSA 1TKFA 3ISZA 4ZX8A 3FX6A 4F9UA 1CP7A 2ZEHA 5F09A 2ZENA 1AMPA 3H8EA 5ELYA 2O4HA 1HEEA 3FH4A 2BCOA 3WT4A 4X2TA 3NH4A 3GLJA 1M4LA 1F2OA 3H8FA 4NJRA 2PVWA 1H8LA 4EFDA 3PB4X 4MRIA 2CIJA 4H2KA 4GM5A 5K8PA 2QJ8A 4Q7AA 1TXRA 1TF9A 5CBMA 2ABZA 5HXDA 3TX8A 4ZY1A 4EWTA 3D7GA 2JBKA 3B3VA 3RBUA 2PRQA 4A39A 2O53A 2V8VA 1YMEA 4DYOA 1Y0RA 1ARMA 2ZEOA 2GLJA 5J1QA 4P45A 1VGYA 4TWEA 2AFXA 4R8FA 3L2NA 1Y0YA 1LFWA 3GB0A 3D67A 4FWUA 1ELLP 1EE3P 4OP4A 3IJ3A 3V38A 3KZWA 2ZEPA 4YWYA 1VIXA 3DGVA 4NJQA 5K8OA 4IAVA 2V77A 2HB6A 3SI0A 4IHMA 3KI9A 2PJ6A 3SI2A 1BPMA 5LRJA 2PE3A 4JZ0A 1BPNA 4OC5A 5DS0A 2XEFA 3PFEA 3KASA 1ZG8A 4P4JA 2PJCA 2F8HA 3SI1A 1PCAA 2Q51A 1Y7EA 1YSJA 2V8DA 2PJ8A 3MN8A 4NGRA 4BD9A 2RFHA 3D68A 3HLPA 1Z5RA 3D4UA 5LRGA 2PIZA 2IMOA 2PJ0A 3B3TA 1PYTB 2BOAA 4P4EA 3K2KA 1JQGA 5JM6A 4UEFA 2V8HA 2PJ5A 3T8WA 5LYLA 3NH5A 2V8GA 3FJUA 1AYEA 2JBJA 2Q4ZA 5D29A 4AXVA 3KQZA 1ZG9A 3IIBA 1ARLA 2JEWA 1HDUA 1DTDA 2PJBA 1UWYA 3BHXA 4NGNA 2Q43A 4FBEA 2BO9A 3FVLA 3SJFA 3MRUA 4OIWA 3PFOA 2C6PA 4W9YA 2OOTA 4R7MA 1GYTA 2GREA 2J9AA 1FNOA 4X3RA 4TNUA 2QVPA 3KHXA 4JYWA 1FT7A 3LMSA 2IQ6A 4CPAA 2XEIA 3B35A 2AFMA 3LWUA 1CG2A 4LQGA 3SJGA 3PBEA 3RZAA 1CPXA 4ZY2A 2NYQA 3BI0A 4P4FA 1XBUA 2XEJA 1LANA 4ZYQA 2WZNA 4PPZA 5K8NA 1XMBA 4MHYA 4PXCA 1XRYA 4UEEA 3S9LA 2CTCA 4DJLA 1RTQA 2XEGA 4MHPA 2EWBA 3KL9A 3S9MA 3IEHA 4ZX9A 1BAVA 8CPAA 4P44A 4YU9A 1TF8A 1TKJA 2NSMA 4O23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAM A;  2PVV A;  3B7I A;  4PQA A;  3GUX A;  4NGM A;  2CTB A;  3KHZ A;  5D8N A;  4FUU A;  1R3N A;  4MHN A;  3K9T A;  3I1U A;  1BLL E;  2HC9 A;  3FEC A;  2PJ4 A;  2FVG A;  1CP6 A;  4OKO A;  3CDX A;  3SJX A;  3FEE A;  3IC1 A;  4DUK A;  4ONW A;  4MCP A;  3KR5 A;  3PB6 X;  3NA6 A;  3V7Z A;  4X8I A;  1ZLI A;  1ELM P;  2ANP A;  1LAP A;  3HUV A;  2AFW A;  4R6T A;  4MCS A;  1ZLH A;  3D7H A;  2CF4 A;  5K8M A;  5LYI A;  3JRU A;  4MHZ A;  2I3C A;  4NGS A;  1YW4 A;  3WC7 A;  4NGQ A;  4NFR A;  4OME A;  2ZOG A;  4B6Z A;  2F7V A;  2PJ7 A;  3D7F A;  3PBB A;  1YLO A;  1CX8 A;  1LOK A;  4R76 A;  3WAB A;  2G9D A;  3FED A;  3PEI A;  2GLF A;  4RUH A;  3CPX A;  3PRT A;  3QNV A;  1R43 A;  3BI1 A;  4EME A;  6CPA A;  1ZG7 A;  4WJB A;  2EK8 A;  3B3W A;  4PXD A;  4NGP A;  2IJZ A;  4OC0 A;  5JGF A;  1TKH A;  4NGT A;  3N5F A;  4P4B A;  2C6G A;  5THW A;  3FF3 A;  2AFZ A;  2WYR A;  4G1P A;  4A94 A;  3NH8 A;  4MCR A;  2EK9 A;  3PB8 X;  5LYD A;  2ZEF A;  4PXB A;  1NSA A;  3KR4 A;  2DEA A;  4UEZ A;  1KWM A;  3PB9 X;  2OR4 A;  1IGB A;  2POK A;  5LYF A;  4K3N A;  3VAT A;  3RAM A;  3ISX A;  3CPA A;  3VH9 A;  2ZEM A;  2C1C A;  4WWV A;  1CBX A;  3PB7 X;  2QYV A;  1LCP A;  4IK2 A;  3IO1 A;  4P6Y A;  1XJO A;  4P4D A;  3TC8 A;  3H8G A;  4F8Z A;  1VHE A;  3WC5 A;  4FAI A;  4UIA A;  2PJ1 A;  3D7D A;  3IFE A;  4ZY0 A;  4P10 A;  2ZOF A;  2PJ2 A;  4UF4 A;  4Z65 A;  5CPA A;  4P4I A;  3NFZ A;  5IB9 A;  3KGQ A;  4OC3 A;  5LRK A;  1QMU A;  2ZEG A;  5I4M A;  2AFU A;  4OC1 A;  1Q7L A;  1Z8L A;  4MXU A;  4OC4 A;  3S9N A;  4PXE A;  3DLJ A;  1IY7 A;  1HDQ A;  4F9V A;  1VHO A;  3B3C A;  3D66 A;  2PIY A;  1XFO A;  2PJ9 A;  2PJA A;  4OC2 A;  2VL1 A;  4A38 A;  1QQ9 A;  3KQX A;  5HVG A;  4KSI A;  4UIB A;  3VAR A;  2ZEL A;  4A37 A;  4OID A;  3B3S A;  2PCU A;  2GU2 A;  1OBR A;  3B2Y A;  3CT9 A;  2AFO A;  3WC6 A;  2RB7 A;  4ZI6 A;  3IWW A;  5HVF A;  4MMO A;  1Z2L A;  2C6C A;  3FMC A;  1YW6 A;  1DE4 C;  2PJ3 A;  5JH9 A;  2ZED A;  1F57 A;  2ZEE A;  2AFS A;  3BXM A;  3SJE A;  5HVH A;  1F2P A;  7CPA A;  4MCQ A;  1CPS A;  1TKF A;  3ISZ A;  4ZX8 A;  3FX6 A;  4F9U A;  1CP7 A;  2ZEH A;  5F09 A;  2ZEN A;  1AMP A;  3H8E A;  5ELY A;  2O4H A;  1HEE A;  3FH4 A;  2BCO A;  3WT4 A;  4X2T A;  3NH4 A;  3GLJ A;  1M4L A;  1F2O A;  3H8F A;  4NJR A;  2PVW A;  1H8L A;  4EFD A;  3PB4 X;  4MRI A;  2CIJ A;  4H2K A;  4GM5 A;  5K8P A;  2QJ8 A;  4Q7A A;  1TXR A;  1TF9 A;  5CBM A;  2ABZ A;  5HXD A;  3TX8 A;  4ZY1 A;  4EWT A;  3D7G A;  2JBK A;  3B3V A;  3RBU A;  2PRQ A;  4A39 A;  2O53 A;  2V8V A;  1YME A;  4DYO A;  1Y0R A;  1ARM A;  2ZEO A;  2GLJ A;  5J1Q A;  4P45 A;  1VGY A;  4TWE A;  2AFX A;  4R8F A;  3L2N A;  1Y0Y A;  1LFW A;  3GB0 A;  3D67 A;  4FWU A;  1ELL P;  1EE3 P;  4OP4 A;  3IJ3 A;  3V38 A;  3KZW A;  2ZEP A;  4YWY A;  1VIX A;  3DGV A;  4NJQ A;  5K8O A;  4IAV A;  2V77 A;  2HB6 A;  3SI0 A;  4IHM A;  3KI9 A;  2PJ6 A;  3SI2 A;  1BPM A;  5LRJ A;  2PE3 A;  4JZ0 A;  1BPN A;  4OC5 A;  5DS0 A;  2XEF A;  3PFE A;  3KAS A;  1ZG8 A;  4P4J A;  2PJC A;  2F8H A;  3SI1 A;  1PCA A;  2Q51 A;  1Y7E A;  1YSJ A;  2V8D A;  2PJ8 A;  3MN8 A;  4NGR A;  4BD9 A;  2RFH A;  3D68 A;  3HLP A;  1Z5R A;  3D4U A;  5LRG A;  2PIZ A;  2IMO A;  2PJ0 A;  3B3T A;  1PYT B;  2BOA A;  4P4E A;  3K2K A;  1JQG A;  5JM6 A;  4UEF A;  2V8H A;  2PJ5 A;  3T8W A;  5LYL A;  3NH5 A;  2V8G A;  3FJU A;  1AYE A;  2JBJ A;  2Q4Z A;  5D29 A;  4AXV A;  3KQZ A;  1ZG9 A;  3IIB A;  1ARL A;  2JEW A;  1HDU A;  1DTD A;  2PJB A;  1UWY A;  3BHX A;  4NGN A;  2Q43 A;  4FBE A;  2BO9 A;  3FVL A;  3SJF A;  3MRU A;  4OIW A;  3PFO A;  2C6P A;  4W9Y A;  2OOT A;  4R7M A;  1GYT A;  2GRE A;  2J9A A;  1FNO A;  4X3R A;  4TNU A;  2QVP A;  3KHX A;  4JYW A;  1FT7 A;  3LMS A;  2IQ6 A;  4CPA A;  2XEI A;  3B35 A;  2AFM A;  3LWU A;  1CG2 A;  4LQG A;  3SJG A;  3PBE A;  3RZA A;  1CPX A;  4ZY2 A;  2NYQ A;  3BI0 A;  4P4F A;  1XBU A;  2XEJ A;  1LAN A;  4ZYQ A;  2WZN A;  4PPZ A;  5K8N A;  1XMB A;  4MHY A;  4PXC A;  1XRY A;  4UEE A;  3S9L A;  2CTC A;  4DJL A;  1RTQ A;  2XEG A;  4MHP A;  2EWB A;  3KL9 A;  3S9M A;  3IEH A;  4ZX9 A;  1BAV A;  8CPA A;  4P44 A;  4YU9 A;  1TF8 A;  1TKJ A;  2NSM A;  4O23 A; 
#chains in the Genus database with same CATH topology
 4CRZ B;  1LAM A;  2PVV A;  4QB9 A;  5H84 A;  3B7I A;  5A27 A;  2Z10 A;  4UWJ A;  3TTH A;  4PQA A;  1YR0 A;  3GUX A;  4IF5 A;  4NGM A;  4PSX A;  2CTB A;  4ORF A;  4KSA A;  3KHZ A;  1NSL A;  5AG7 A;  5GCN A;  1M4G A;  5D8N A;  4FUU A;  1R3N A;  2Z3N A;  4KOX A;  2WPW A;  4MHN A;  3K9T A;  3I1U A;  1BLL E;  3ZJ0 A;  2HC9 A;  3IGR A;  2R98 A;  4A32 A;  3FEC A;  4KUB A;  2CXA A;  2FVG A;  2PJ4 A;  3F0A A;  1CP6 A;  3GY9 A;  4OKO A;  2Q7S A;  1IYL A;  4JWP A;  3CDX A;  3SJX A;  3FEE A;  2B5G A;  3IC1 A;  2G3A A;  3DSB A;  4IUS A;  4MCP A;  4ONW A;  5AGE A;  1VKC A;  3FNC A;  3SXN A;  3KR5 A;  3TO6 A;  4UFX A;  3PB6 X;  3QB8 A;  2HQY A;  3NA6 A;  3V7Z A;  2FE7 A;  4X8I A;  2P0W A;  2A4N A;  2FS5 A;  4MFK A;  1ZLI A;  1ELM P;  2ANP A;  1LAP A;  4PK3 A;  1X12 A;  1IOF A;  3D2P A;  3HUV A;  4KS9 A;  4KSF A;  2QEC A;  2PDO A;  2ZXV A;  2AFW A;  4R6T A;  4MCS A;  3T90 A;  1ZLH A;  3CXQ A;  3D7H A;  2CF4 A;  1MJA A;  5K8M A;  5LYI A;  3JRU A;  4MHZ A;  4RI1 A;  2I3C A;  4NGS A;  1YW4 A;  3WC7 A;  4NGQ A;  4NFR A;  4OME A;  5F47 A;  2ZOG A;  3IWE A;  4LX9 A;  1SQH A;  2I79 A;  3W91 A;  4B6Z A;  2F7V A;  4CS0 B;  2PJ7 A;  2JDD A;  4UBR A;  4F0X A;  1QSR A;  3TOB A;  4E2A A;  1M4D A;  2HUZ A;  3D7F A;  2EBJ A;  3GIU A;  3K9U A;  1S60 A;  3PBB A;  1YLO A;  1CX8 A;  1XE4 A;  3LOD A;  2FT0 A;  1LOK A;  4XPK A;  4R76 A;  2CNM A;  5BWA B;  5G21 A;  2G9D A;  2Q4V A;  3FED A;  3JTK A;  3PEI A;  3WAB A;  2GLF A;  2GAN A;  3PZJ A;  4RUH A;  3CPX A;  3PRT A;  4K30 A;  4KVM E;  5DWM A;  3QNV A;  1R43 A;  2CNS A;  1BO4 A;  1QSM A;  3BI1 A;  1ZO0 A;  4EME A;  4A95 A;  6CPA A;  1YQE A;  1ZG7 A;  4WJB A;  2YNC C;  2OZH A;  2EK8 A;  2PR1 A;  3B3W A;  4XNH C;  2R7H A;  4JLY A;  2YGW A;  4PXD A;  3V8I A;  3P2H A;  4YRH A;  4NGP A;  3ZZI A;  2IJZ A;  5A28 A;  1PUA A;  4OC0 A;  4XNH B;  4U9Z A;  1TKH A;  4NGT A;  2ODF A;  4JD6 A;  4R87 A;  2Z3K A;  3N5F A;  5JGF A;  2J8R A;  4P4B A;  2C6G A;  5THW A;  4YFJ A;  3FF3 A;  2AFZ A;  2WYR A;  4G1P A;  4A94 A;  4B10 A;  3NH8 A;  4AVB A;  2NMT A;  2WUU A;  1IB1 E;  4MCR A;  2EK9 A;  3PB8 X;  4QVT A;  2GFQ A;  5LYD A;  4GXH A;  2ZEF A;  4PXB A;  1NSA A;  3KR4 A;  4QC6 A;  2OH1 A;  3G3S A;  4A33 A;  1Z9U A;  2DEA A;  1KWM A;  4HNX B;  4UEZ A;  4RN7 A;  3T9Y A;  3PB9 X;  3I3G A;  3TO9 A;  2OR4 A;  2FSR A;  1IGB A;  2POK A;  5LYF A;  1L0C A;  4K3N A;  3VAT A;  3RAM A;  1TIQ A;  4UWI A;  3ISX A;  3CPA A;  4E8O A;  3TFY A;  1R57 A;  1M1D A;  4CYO A;  3VH9 A;  2ZEM A;  1ON0 A;  1Y9W A;  2C1C A;  4H89 A;  4MFQ A;  4NSQ A;  4U5Y A;  1CBX A;  4WWV A;  3FXT A;  3PB7 X;  2RC4 A;  5J8F A;  5DWN A;  2ZW5 A;  2QYV A;  1LCP A;  4IK2 A;  3IO1 A;  4I49 A;  1CM0 A;  4P6Y A;  1XJO A;  2Q04 A;  4P4D A;  1S5K A;  1WWZ A;  2JLM A;  3TC8 A;  3H8G A;  3I9S A;  4F8Z A;  4FD4 A;  1VHE A;  3WC5 A;  4QBJ A;  4FAI A;  4NF1 A;  2CY2 A;  4OAD A;  4UIA A;  2PJ1 A;  3D7D A;  4CGP A;  3IFE A;  4ZY0 A;  2VQY A;  4P10 A;  2ZOF A;  2PJ2 A;  4UF4 A;  2DPT A;  4Z65 A;  3JVN A;  4KUA A;  5CPA A;  3S6F A;  4P4I A;  3NFZ A;  5IB9 A;  3H5Z A;  4B5P A;  4R3K A;  2J8N A;  3KGQ A;  4OC3 A;  2EO8 A;  1V0C A;  2JEV A;  2IL4 A;  5JQ4 A;  4II9 A;  4CAX A;  4PK2 A;  5LRK A;  2K5T A;  2CNT A;  1K4J A;  1QMU A;  1S7F A;  2ZEG A;  5I4M A;  2AFU A;  2FCK A;  4OC1 A;  1Q7L A;  1VHS A;  1Z8L A;  2REF A;  2FL4 A;  4MXU A;  4OC4 A;  3WR7 A;  3S9N A;  2PRB A;  1Y7R A;  4PXE A;  3DLJ A;  3FRM A;  1IY7 A;  4UA3 A;  1HDQ A;  4F9V A;  3EXN A;  4M85 A;  4FD7 A;  1VHO A;  3B3C A;  4KVO E;  4CGM A;  3D66 A;  4JXR A;  3SXO A;  2PIY A;  2KCW A;  1XFO A;  2PJ9 A;  2PJA A;  3PP9 A;  5AG4 A;  4OC2 A;  4A2Z A;  4UFV A;  2VL1 A;  4A38 A;  1QQ9 A;  3KQX A;  5HVG A;  4KSI A;  2Z3O A;  4UIB A;  3GYA A;  1XIX A;  1KUY A;  4YGO A;  4Q38 A;  1KZF A;  3VAR A;  3FBU A;  2ZEL A;  4A37 A;  1PU9 A;  2B4D A;  4OID A;  2REE A;  3B3S A;  2PCU A;  2VBQ A;  3R95 A;  2GU2 A;  1OBR A;  3B2Y A;  3CT9 A;  2AFO A;  5G22 A;  3WC6 A;  2RB7 A;  4ZI6 A;  2G3T A;  3IWW A;  5HVF A;  4C68 A;  1IIC A;  4BIN A;  4MMO A;  1Z2L A;  2C6C A;  2YND A;  3FMC A;  3MGD A;  4KOU A;  1YW6 A;  4UCM A;  1DE4 C;  2PJ3 A;  3S6K A;  4C2Z A;  4F6A A;  5JH9 A;  2ZED A;  1F57 A;  2ZEE A;  1NE9 A;  3SHP A;  2AFS A;  3BXM A;  2G0B A;  2B3U A;  4L8A A;  2ZPA A;  3SJE A;  2H5M A;  4C7H A;  5HVH A;  2PR8 A;  2Y0M A;  1AUG A;  3FIX A;  1F2P A;  3G8W A;  2Q7B A;  7CPA A;  4MCQ A;  4CYN A;  1CPS A;  1TKF A;  3ISZ A;  3EY5 A;  5F49 A;  1QST A;  3IWG A;  4OAE A;  4ZX8 A;  3FX6 A;  4E0A A;  1CP7 A;  4F9U A;  2ZEH A;  5F09 A;  2ZEN A;  4MFL A;  5C88 A;  2D4O A;  2B4B A;  1AMP A;  2FIW A;  4LUA A;  4CGN A;  3H8E A;  5ELY A;  2O4H A;  3KKW A;  1HEE A;  1U6M A;  4B12 A;  2ZW4 A;  3FH4 A;  2BCO A;  3WT4 A;  1IU8 A;  2PQ8 A;  4GS4 A;  4X2T A;  2VI7 A;  3NH4 A;  1X10 A;  3GLJ A;  1M4L A;  1Z4R A;  4L89 A;  4R9M A;  1GHE A;  1F2O A;  3H8F A;  4NJR A;  2PVW A;  4HNW B;  1H8L A;  2P6F A;  5IV0 A;  4MFP A;  4EFD A;  2ZW6 A;  3PB4 X;  2I00 A;  4MRI A;  2CIJ A;  1MJ9 A;  4H2K A;  4M6G A;  4UFW A;  2DXQ A;  2BSW A;  1XMT A;  3D3S A;  4GM5 A;  5CNP A;  2P6E A;  4MY3 A;  5K8P A;  2QJ8 A;  4Q7A A;  4CAF A;  2Q0Y A;  3R96 A;  1J4J A;  2ZW7 A;  4RS2 A;  1TXR A;  4H6U A;  5J8C A;  4CRY B;  1TF9 A;  4U9Y A;  3DDD A;  5CBM A;  4H6Z A;  2ABZ A;  5HXD A;  3TX8 A;  4ZY1 A;  3VWE A;  4EWT A;  3R9F A;  1S7N A;  2Z11 A;  2VZZ A;  3FYN A;  2C27 A;  5JPH A;  2B3V A;  3D7G A;  2PSW A;  2JBK A;  3B3V A;  3NE7 A;  4XPL A;  1Y9K A;  3RYO A;  1BOB A;  3RBU A;  2EVN A;  2PRQ A;  4KOT A;  4A39 A;  4MY0 A;  3UY5 A;  2O53 A;  5I0C A;  2V8V A;  4KLV A;  1YME A;  4NXY A;  1JWQ A;  1Y0R A;  4DYO A;  1ARM A;  3DR8 A;  3IU2 A;  1B87 A;  3EO4 A;  2ZEO A;  2GLJ A;  5J1Q A;  4P45 A;  4NCZ A;  4R3L A;  3QAH A;  1OZP A;  1VGY A;  4MBU A;  4TWE A;  3NE8 A;  2AFX A;  2ATR A;  3JUW A;  4R8F A;  3EFA A;  3L2N A;  3TCV A;  4MJ8 A;  2ARH A;  4MHD A;  4B11 A;  2OZU A;  1Z8T A;  1I12 A;  4J3G A;  1Y0Y A;  1NMT A;  1LFW A;  3GB0 A;  2R8V A;  3D67 A;  4FWU A;  2QML A;  5ISV A;  4KOV A;  3RNZ A;  1ELL P;  1EE3 P;  4OP4 A;  3DNS A;  3IJ3 A;  5KTA A;  5C82 A;  3V38 A;  5KTD A;  1M44 A;  3KZW A;  2ZEP A;  4YWY A;  1VIX A;  4B5P B;  2Z0Z A;  4B5O A;  3EC4 A;  4JJX A;  3DGV A;  1UFH A;  4NJQ A;  5K8O A;  1YLE A;  4IAV A;  2V77 A;  2HB6 A;  4ZGY B;  3SI0 A;  3R9E A;  4CGL A;  4AVC A;  4IHM A;  3KI9 A;  2PJ6 A;  3SI2 A;  1XOV A;  4CAE A;  1BPM A;  3BLN A;  2P6G A;  5LRJ A;  3OWC A;  1I1D A;  3A9L A;  2PE3 A;  3D2M A;  1BPN A;  2BL1 A;  4JZ0 A;  4OC5 A;  5DS0 A;  2XEF A;  3F5B A;  2DF5 A;  2FIA A;  3KAS A;  3PFE A;  4CYP A;  1ZG8 A;  4P4J A;  2PJC A;  3CXS A;  2F8H A;  2R1I A;  2Z3P A;  4DNC A;  2WSA A;  3SI1 A;  5F46 A;  1PCA A;  2Q51 A;  1WK4 A;  1Y7E A;  1Z8W A;  5H86 A;  1YSJ A;  2B5G B;  2V8D A;  3R9G A;  2AE6 A;  3TT2 A;  2PJ8 A;  3N7Z A;  1I21 A;  1M4I A;  4M6I A;  5EC4 A;  3MN8 A;  4NGR A;  3F8K A;  4BD9 A;  2RFH A;  3D68 A;  3HLP A;  4DUK A;  1Z5R A;  4R57 A;  3D4U A;  4CAW A;  1Q2D A;  5FVJ A;  5LRG A;  2PIZ A;  2IMO A;  2PJ0 A;  3B3T A;  4KOY A;  1PYT B;  2BOA A;  2VEZ A;  2F5I A;  5EMI A;  1S3Z A;  4P4E A;  2B4D B;  3IU1 A;  4M6H A;  4Q36 A;  3S6G A;  1XEB A;  3K2K A;  3FB3 A;  1JQG A;  2BEI A;  1Q2Y A;  5EBV A;  5JM6 A;  5IX3 A;  4UEF A;  2PC1 A;  4BBH A;  2V8H A;  4AB7 A;  5IB0 A;  2PJ5 A;  1KUX A;  3W6S A;  3T8W A;  4AVA A;  5LYL A;  4UCN A;  3NH5 A;  3B8G A;  2V8G A;  4OLL A;  3FJU A;  1AYE A;  4ZBG A;  3S6H A;  4F0Y A;  1P4N A;  2JBJ A;  2Q4Z A;  5D29 A;  3VWD A;  2D4P A;  2VZY A;  4AG9 A;  4AXV A;  4JXQ A;  3KQZ A;  1ZG9 A;  3IIB A;  4CYQ A;  4BMH A;  1ARL A;  2JEW A;  4XPD C;  1HDU A;  1DTD A;  2GE3 A;  2PJB A;  2EUI A;  1P0H A;  2FXF A;  1UWY A;  3BHX A;  4NGN A;  4XPD B;  2HV2 A;  5E96 A;  3R1K A;  4KOW A;  1Z4E A;  4MFZ A;  2Q43 A;  1LRZ A;  4PV6 A;  4FBE A;  5HH1 A;  1QSN A;  2BO9 A;  4NEX A;  3FVL A;  3SJF A;  4KVX A;  1YK3 A;  4A31 A;  1IYK A;  3MRU A;  4HKF A;  4M3S A;  4B13 A;  1S7L A;  2DPS A;  4LQ6 A;  4HPS A;  2BUE A;  4OIW A;  3PFO A;  2Z3M A;  3QAY A;  2C6P A;  4W9Y A;  5AG6 A;  2OOT A;  1YX0 A;  2JDC A;  4R7M A;  3LD2 A;  4KOR A;  2X7B A;  4CAV A;  4UCP A;  1N71 A;  1GYT A;  3BJ8 A;  5F48 A;  4EVY A;  1QSO A;  1IID A;  3PGP A;  2GRE A;  2J9A A;  1FNO A;  4X3R A;  4TNU A;  1RXT A;  4MFJ A;  2QVP A;  4HNY B;  5G1Z A;  2YNC A;  3KHX A;  4CGO A;  4JYW A;  1FT7 A;  4ONU A;  4MI4 A;  5KTC A;  2O28 A;  3LMS A;  1B6B A;  1Q2C A;  3C26 A;  2IQ6 A;  1YVO A;  1MJB A;  2QIR A;  3TO7 A;  4CPA A;  1FY7 A;  5HMN A;  2GIV A;  4C2X A;  2XEI A;  3B35 A;  4C7I A;  2AFM A;  5G20 A;  3LWU A;  2YNE A;  1CG2 A;  4LQG A;  3SJG A;  4FD6 A;  3PBE A;  3RZA A;  1CPX A;  3RO0 A;  4ZY2 A;  1YRE A;  3W6X A;  2NYQ A;  4FD5 A;  1YGH A;  2Z3L A;  1S7K A;  1KUV A;  3BI0 A;  4P4F A;  2Q44 A;  1XBU A;  2XEJ A;  4PSW A;  1A2Z A;  1LAN A;  2VXK A;  4ZYQ A;  2WZN A;  4PPZ A;  1CJW A;  4B14 A;  3DR6 A;  2B58 A;  5K8N A;  1XMB A;  1Z8X A;  4MHY A;  4PXC A;  1XRY A;  3D8P A;  4UEE A;  2WPX A;  3S9L A;  2OZG A;  1YVK A;  2CTC A;  3H4Q A;  4KLW A;  4Y49 C;  4DJL A;  1RTQ A;  2XEG A;  1MK4 A;  4C2Y A;  4MHP A;  3CXP A;  3GKR A;  2EWB A;  4Y49 B;  3KL9 A;  4KOS A;  3S9M A;  4X5K A;  3IEH A;  4ZX9 A;  1BAV A;  4A30 A;  2J8M A;  8CPA A;  3LAC A;  3P2F A;  4P44 A;  4YU9 A;  1TF8 A;  5AG5 A;  1IOI A;  1RO5 A;  2Q4Y A;  4KZT A;  1TKJ A;  2NSM A;  3E0K A;  2OU2 A;  1XF8 A;  3TE4 A;  4QUS A;  4O23 A;  3BJ7 A;  4AG7 A;  2OB0 A;  2AJ6 A;  3TOA A;  3CZX A; 
#chains in the Genus database with same CATH homology
 1LAM A;  2PVV A;  3B7I A;  4PQA A;  3GUX A;  4NGM A;  2CTB A;  3KHZ A;  5D8N A;  4FUU A;  1R3N A;  4MHN A;  3K9T A;  3I1U A;  1BLL E;  2HC9 A;  3FEC A;  2PJ4 A;  2FVG A;  1CP6 A;  4OKO A;  3CDX A;  3SJX A;  3FEE A;  3IC1 A;  4DUK A;  4ONW A;  4MCP A;  3KR5 A;  3PB6 X;  3NA6 A;  3V7Z A;  4X8I A;  1ZLI A;  1ELM P;  2ANP A;  1LAP A;  3HUV A;  2AFW A;  4R6T A;  4MCS A;  1ZLH A;  3D7H A;  2CF4 A;  5K8M A;  5LYI A;  3JRU A;  4MHZ A;  2I3C A;  4NGS A;  1YW4 A;  3WC7 A;  4NGQ A;  4NFR A;  4OME A;  2ZOG A;  4B6Z A;  2F7V A;  2PJ7 A;  3D7F A;  3PBB A;  1YLO A;  1CX8 A;  1LOK A;  4R76 A;  3WAB A;  2G9D A;  3FED A;  3PEI A;  2GLF A;  4RUH A;  3CPX A;  3PRT A;  3QNV A;  1R43 A;  3BI1 A;  4EME A;  6CPA A;  1ZG7 A;  4WJB A;  2EK8 A;  3B3W A;  4PXD A;  4NGP A;  2IJZ A;  4OC0 A;  5JGF A;  1TKH A;  4NGT A;  3N5F A;  4P4B A;  2C6G A;  5THW A;  3FF3 A;  2AFZ A;  2WYR A;  4G1P A;  4A94 A;  3NH8 A;  4MCR A;  2EK9 A;  3PB8 X;  5LYD A;  2ZEF A;  4PXB A;  1NSA A;  3KR4 A;  2DEA A;  4UEZ A;  1KWM A;  3PB9 X;  2OR4 A;  1IGB A;  2POK A;  5LYF A;  4K3N A;  3VAT A;  3RAM A;  3ISX A;  3CPA A;  3VH9 A;  2ZEM A;  2C1C A;  4WWV A;  1CBX A;  3PB7 X;  2QYV A;  1LCP A;  4IK2 A;  3IO1 A;  4P6Y A;  1XJO A;  4P4D A;  3TC8 A;  3H8G A;  4F8Z A;  1VHE A;  3WC5 A;  4FAI A;  4UIA A;  2PJ1 A;  3D7D A;  3IFE A;  4ZY0 A;  4P10 A;  2ZOF A;  2PJ2 A;  4UF4 A;  4Z65 A;  5CPA A;  4P4I A;  3NFZ A;  5IB9 A;  3KGQ A;  4OC3 A;  5LRK A;  1QMU A;  2ZEG A;  5I4M A;  2AFU A;  4OC1 A;  1Q7L A;  1Z8L A;  4MXU A;  4OC4 A;  3S9N A;  4PXE A;  3DLJ A;  1IY7 A;  1HDQ A;  4F9V A;  1VHO A;  3B3C A;  3D66 A;  2PIY A;  1XFO A;  2PJ9 A;  2PJA A;  4OC2 A;  2VL1 A;  4A38 A;  1QQ9 A;  3KQX A;  5HVG A;  4KSI A;  4UIB A;  3VAR A;  2ZEL A;  4A37 A;  4OID A;  3B3S A;  2PCU A;  2GU2 A;  1OBR A;  3B2Y A;  3CT9 A;  2AFO A;  3WC6 A;  2RB7 A;  4ZI6 A;  3IWW A;  5HVF A;  4MMO A;  1Z2L A;  2C6C A;  3FMC A;  1YW6 A;  1DE4 C;  2PJ3 A;  5JH9 A;  2ZED A;  1F57 A;  2ZEE A;  2AFS A;  3BXM A;  3SJE A;  5HVH A;  1F2P A;  7CPA A;  4MCQ A;  1CPS A;  1TKF A;  3ISZ A;  4ZX8 A;  3FX6 A;  4F9U A;  1CP7 A;  2ZEH A;  5F09 A;  2ZEN A;  1AMP A;  3H8E A;  5ELY A;  2O4H A;  1HEE A;  3FH4 A;  2BCO A;  3WT4 A;  4X2T A;  3NH4 A;  3GLJ A;  1M4L A;  1F2O A;  3H8F A;  4NJR A;  2PVW A;  1H8L A;  4EFD A;  3PB4 X;  4MRI A;  2CIJ A;  4H2K A;  4GM5 A;  5K8P A;  2QJ8 A;  4Q7A A;  1TXR A;  1TF9 A;  5CBM A;  2ABZ A;  5HXD A;  3TX8 A;  4ZY1 A;  4EWT A;  3D7G A;  2JBK A;  3B3V A;  3RBU A;  2PRQ A;  4A39 A;  2O53 A;  2V8V A;  1YME A;  4DYO A;  1Y0R A;  1ARM A;  2ZEO A;  2GLJ A;  5J1Q A;  4P45 A;  1VGY A;  4TWE A;  2AFX A;  4R8F A;  3L2N A;  1Y0Y A;  1LFW A;  3GB0 A;  3D67 A;  4FWU A;  1ELL P;  1EE3 P;  4OP4 A;  3IJ3 A;  3V38 A;  3KZW A;  2ZEP A;  4YWY A;  1VIX A;  3DGV A;  4NJQ A;  5K8O A;  4IAV A;  2V77 A;  2HB6 A;  3SI0 A;  4IHM A;  3KI9 A;  2PJ6 A;  3SI2 A;  1BPM A;  5LRJ A;  2PE3 A;  4JZ0 A;  1BPN A;  4OC5 A;  5DS0 A;  2XEF A;  3PFE A;  3KAS A;  1ZG8 A;  4P4J A;  2PJC A;  2F8H A;  3SI1 A;  1PCA A;  2Q51 A;  1Y7E A;  1YSJ A;  2V8D A;  2PJ8 A;  3MN8 A;  4NGR A;  4BD9 A;  2RFH A;  3D68 A;  3HLP A;  1Z5R A;  3D4U A;  5LRG A;  2PIZ A;  2IMO A;  2PJ0 A;  3B3T A;  1PYT B;  2BOA A;  4P4E A;  3K2K A;  1JQG A;  5JM6 A;  4UEF A;  2V8H A;  2PJ5 A;  3T8W A;  5LYL A;  3NH5 A;  2V8G A;  3FJU A;  1AYE A;  2JBJ A;  2Q4Z A;  5D29 A;  4AXV A;  3KQZ A;  1ZG9 A;  3IIB A;  1ARL A;  2JEW A;  1HDU A;  1DTD A;  2PJB A;  1UWY A;  3BHX A;  4NGN A;  2Q43 A;  4FBE A;  2BO9 A;  3FVL A;  3SJF A;  3MRU A;  4OIW A;  3PFO A;  2C6P A;  4W9Y A;  2OOT A;  4R7M A;  1GYT A;  2GRE A;  2J9A A;  1FNO A;  4X3R A;  4TNU A;  2QVP A;  3KHX A;  4JYW A;  1FT7 A;  3LMS A;  2IQ6 A;  4CPA A;  2XEI A;  3B35 A;  2AFM A;  3LWU A;  1CG2 A;  4LQG A;  3SJG A;  3PBE A;  3RZA A;  1CPX A;  4ZY2 A;  2NYQ A;  3BI0 A;  4P4F A;  1XBU A;  2XEJ A;  1LAN A;  4ZYQ A;  2WZN A;  4PPZ A;  5K8N A;  1XMB A;  4MHY A;  4PXC A;  1XRY A;  4UEE A;  3S9L A;  2CTC A;  4DJL A;  1RTQ A;  2XEG A;  4MHP A;  2EWB A;  3KL9 A;  3S9M A;  3IEH A;  4ZX9 A;  1BAV A;  8CPA A;  4P44 A;  4YU9 A;  1TF8 A;  1TKJ A;  2NSM A;  4O23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...