2AJ6A

Crystal structure of a putative gnat family acetyltransferase (mw0638) from staphylococcus aureus subsp. aureus at 1.63 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
HHMRTLNKDEHNYIKQIANIHETLLSQVESNYKCTKLSIALRYEMICSRLEHTNDKIYIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALEKWAKTMNAKRISNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypothetical protein MW0638
publication title Crystal structure of hypothetical protein MW0638 from Staphylococcus aureus MW2 at 1.63 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2aj6A00
4KVOE 1I12A 2REEA 4AVBA 4KOUA 3P2FA 4L89A 1IYKA 2CNTA 2J8NA 1IYLA 3SXOA 3FRMA 4QBJA 1M4DA 2ARHA 4II9A 2HUZA 3TT2A 2VXKA 2P6FA 4FD5A 1S7FA 2Q4VA 3NE7A 3PP9A 3R1KA 1M4IA 2KCWA 1UFHA 1XMTA 1Q2DA 2B4DB 4ONUA 3TO7A 4UBRA 3ZZIA 2CNSA 5EBVA 2F5IA 2BUEA 3FNCA 2D4OA 1R57A 5JPHA 3FYNA 4R87A 1KZFA 1KUYA 5GCNA 4UA3A 2VEZA 3I9SA 1Y7RA 3ZJ0A 5KTDA 4FD4A 2FCKA 3UY5A 1QSOA 4HNXB 2A4NA 1M4GA 3VWEA 1BOBA 2O28A 3DNSA 3VWDA 1IIDA 2QMLA 3BJ7A 3FIXA 5H84A 3R9EA 1WK4A 4B5PB 3DDDA 1ON0A 1Z9UA 2X7BA 4U5YA 1YVOA 4NXYA 1S3ZA 1S60A 1YLEA 4KOVA 4XNHC 2FIWA 2R8VA 2P0WA 3P2HA 4JXRA 3CXPA 2B5GA 4HNWB 5E96A 4ZBGA 1SQHA 4CAWA 2PQ8A 1CJWA 5F46A 3S6HA 3V8IA 5IV0A 3SXNA 4NEXA 3W6XA 2G3AA 1XEBA 2PRBA 3S6FA 3F0AA 3C26A 2CNMA 4CAVA 2Q7BA 4DNCA 3LODA 4CRZB 5IB0A 1B6BA 1PUAA 2PC1A 3GYAA 3W6SA 2AJ6A 4JJXA 1MJAA 2OH1A 4KOWA 4MY0A 1I1DA 3TTHA 3T9YA 4Y49B 4FD7A 3TO9A 2GIVA 4R3LA 2OZGA 1RXTA 1S5KA 4PSWA 3H4QA 3F8KA 3DSBA 2ATRA 4PSXA 2R7HA 1P0HA 1XF8A 3RYOA 2FIAA 2Z10A 4KVXA 3SHPA 1IICA 5JQ4A 3FXTA 3DR6A 1TIQA 1S7NA 2C27A 3R95A 3FBUA 4AG7A 4KUBA 3GKRA 2R1IA 4H89A 1Y9WA 1XE4A 1NMTA 2D4PA 1K4JA 5KTCA 1VHSA 2Q0YA 3DR8A 1LRZA 1N71A 3PZJA 3G8WA 1QSRA 2ZW6A 2HV2A 1MJ9A 2QIRA 4GS4A 2EVNA 1QSNA 1WWZA 2VBQA 1V0CA 4F0YA 4RS2A 3EO4A 2OZUA 4CS0B 3EXNA 2G0BA 2BEIA 5KTAA 4XPKA 2REFA 2Q4YA 4B5OA 2B4DA 5CNPA 3PGPA 1YK3A 2GANA 2JDDA 3N7ZA 4BMHA 2Z11A 4KZTA 3IWGA 3JUWA 3TE4A 4XPDB 1RO5A 3OWCA 3IGRA 2FT0A 5H86A 4E0AA 2PDOA 3MGDA 4KLWA 2WPXA 2HQYA 1KUVA 4ORFA 3EFAA 4Y49C 1MJBA 4QC6A 3S6KA 2ZW7A 4H6UA 3W91A 4QVTA 3TO6A 2IL4A 3T90A 2B4BA 1I21A 5I0CA 4M3SA 4JXQA 1QSMA 4LX9A 4HNYB 4B5PA 3D2MA 1P4NA 4E8OA 1OZPA 2EUIA 4M85A 2FXFA 3R9GA 2I00A 2BSWA 2PR1A 4UWJA 4MJ8A 2OU2A 1M44A 2J8MA 4KOXA 1CM0A 4CRYB 3S6GA 5HH1A 2OB0A 1PU9A 1YGHA 2JEVA 3BLNA 2VZZA 2Y0MA 4KOTA 1YX0A 5F47A 4OLLA 3CXQA 2G3TA 4KOSA 4U9ZA 4KORA 1VKCA 3R96A 3B8GA 3EY5A 4KLVA 2QECA 5HMNA 2K5TA 1L0CA 3QAHA 1Q2YA 3QB8A 4JD6A 4PK2A 2B3VA 4EVYA 4YFJA 3TCVA 4K30A 3GY9A 3KKWA 2FL4A 1YVKA 4XPDC 4E2AA 3FB3A 4IF5A 2Q04A 1BO4A 4MBUA 2R98A 4AVAA 1GHEA 4I49A 2FE7A 4HKFA 1MK4A 5F49A 4MY3A 1M1DA 4LUAA 2JDCA 5C88A 3LD2A 2FSRA 4FD6A 2B58A 4AB7A 1NE9A 3F5BA 4YGOA 5C82A 2NMTA 4L8AA 4AG9A 2BL1A 4NF1A 3K9UA 3D8PA 3JVNA 4R3KA 4KUAA 3E0KA 2P6GA 4AVCA 3CXSA 2B5GB 1U6MA 2PSWA 2I79A 1S7KA 4X5KA 1Q2CA 1IB1E 2J8RA 2ZW5A 2ZPAA 4KVME 2FS5A 4YRHA 2GE3A 3R9FA 2VQYA 1Z4RA 3WR7A 4U9YA 1B87A 3TOBA 5DWNA 3TOAA 4NCZA 2OZHA 2RC4A 4MHDA 2ZW4A 2WPWA 5IX3A 4XPLA 1YREA 3D3SA 2VZYA 1FY7A 1S7LA 5J8CA 4MI4A 4NSQA 5F48A 5DWMA 5ISVA 3TFYA 4JWPA 1Z4EA 4PV6A 1XIXA 2Z0ZA 2DXQA 3I3GA 3G3SA 4J3GA 2B3UA 2Q44A 4CAXA 4R57A 2AE6A 4JLYA 1YR0A 4F6AA 1NSLA 4RI1A 1KUXA 4UWIA 1QSTA 1J4JA 2JLMA 4QUSA 4PK3A 3BJ8A 5FVJA 2VI7A 2CY2A 3D2PA 4R9MA 4QB9A 4XNHB 1Y9KA 2ZXVA 2PR8A 3EC4A 4IUSA 4OAEA 5EC4A 2H5MA 4KOYA 5J8FA 2P6EA 4H6ZA 4OADA
chains in the Genus database with same CATH superfamily
4KVOE 5G20A 3KR5A 1I12A 2REEA 3B3SA 2AFUA 4AVBA 4KOUA 1LOKA 2Z3MA 4P4JA 4ZY1A 3P2FA 4L89A 1IYKA 2CNTA 2J8NA 2PJ4A 3S9MA 1IYLA 1YSJA 3SXOA 4MHYA 1IY7A 1Z5RA 3FRMA 4QBJA 4C2YA 1Q7LA 1M4DA 2ARHA 3BI0A 1VHEA 4II9A 1TF8A 2HUZA 3D7GA 4NGSA 2PJAA 4NJRA 3TT2A 2VXKA 2P6FA 3PB8X 4FD5A 1S7FA 1Y0RA 2Q4VA 3GB0A 3MN8A 3NE7A 3IWEA 2C6PA 3PP9A 3R1KA 1M4IA 2KCWA 1UFHA 4P4BA 1XMTA 1Q2DA 2PE3A 1CG2A 4B6ZA 2B4DB 4OIWA 2ZEHA 4ONUA 1ARMA 2AFMA 3TO7A 3IJ3A 4UBRA 3ZZIA 2CNSA 3WABA 3GLJA 5EBVA 2F5IA 3FEDA 3MRUA 2PJ2A 2BUEA 3FNCA 5F09A 2D4OA 1R57A 4OC4A 5JPHA 3S9LA 3FYNA 3NH5A 4R87A 1KZFA 1KUYA 5GCNA 4OC0A 4UA3A 2JBKA 2PJ6A 2VEZA 2AFXA 3I9SA 1Y7RA 2Q4ZA 4MFJA 3ZJ0A 5KTDA 1ELLP 1XRYA 4MCRA 5LRGA 4FD4A 3VATA 2FCKA 5AG6A 4IAVA 4M6HA 4B11A 1BAVA 3UY5A 1QSOA 3IFEA 4Q7AA 4O23A 4HNXB 2A4NA 4AXVA 1M4GA 2IQ6A 3VWEA 1BOBA 2O28A 3DNSA 3NH4A 3VWDA 2EBJA 5K8OA 4NGNA 4CPAA 2HC9A 1BPNA 1A2ZA 1IIDA 1PYTB 8CPAA 2EK9A 2QMLA 5G1ZA 3BJ7A 4KSIA 3FIXA 2ABZA 5H84A 3R9EA 1WK4A 5JGFA 4MRIA 4YU9A 4B5PB 5AG5A 2ZEPA 3LACA 4C7HA 2XEFA 2ZOFA 4CGNA 3DDDA 1ON0A 1Z9UA 2X7BA 2Z3NA 2VL1A 3PB9X 4U5YA 3TC8A 1YVOA 4KSAA 4C68A 4BD9A 1QQ9A 2PVWA 3B3TA 4NXYA 1TKHA 1S3ZA 2Q43A 1PCAA 1S60A 4RN7A 1YLEA 4KOVA 4XNHC 1CBXA 4MFKA 1ZO0A 2FIWA 1JQGA 2R8VA 2P0WA 2Z3LA 3IU2A 4OC2A 1BLLE 3P2HA 4JXRA 3CXPA 5K8PA 2B5GA 4CYQA 4HNWB 2O4HA 4NFRA 3IIBA 2HB6A 5E96A 4ZBGA 1SQHA 2JEWA 3LMSA 4CAWA 4Q38A 2PQ8A 1CJWA 2ZEGA 3KHXA 5F46A 2NYQA 3S6HA 3KQZA 4NGQA 5A27A 3V8IA 4P44A 1TF9A 4CGOA 5IB9A 1VHOA 5IV0A 3SXNA 4MCPA 4A32A 4NEXA 3W6XA 2G3AA 3SI2A 1XEBA 2PRBA 3S6FA 3ISZA 3F0AA 3C26A 2CNMA 3FJUA 4F0XA 1AUGA 4CAVA 3KZWA 2PJCA 2V8HA 2GLJA 3BHXA 4KS9A 4B13A 2PIYA 2Q7BA 2XEJA 1HEEA 2DPSA 4K3NA 2PJ7A 3NH8A 4DNCA 3NA6A 3LODA 4CRZB 1TKFA 1B6BA 1PUAA 2PC1A 2ZELA 3GYAA 3WC6A 2I3CA 3B7IA 5JM6A 3FF3A 3W6SA 2AJ6A 5HVGA 4JJXA 1AMPA 1MJAA 5LYLA 2OH1A 4KOWA 4MY0A 3WT4A 3NFZA 1I1DA 3GIUA 3TTHA 1GYTA 2PJ0A 3T9YA 3H5ZA 1R43A 4UEFA 4UCNA 4CYNA 2F8HA 4Y49B 5JH9A 4FD7A 3TO9A 2GIVA 3IWWA 4MCSA 4R3LA 4MHZA 4DYOA 3DGVA 4MCQA 2OZGA 1RXTA 1S5KA 2Q7SA 1EE3P 4PSWA 4UEEA 3B3VA 3H4QA 3F8KA 3DSBA 1H8LA 2ATRA 4ONWA 4PSXA 4TNUA 4YWYA 3K2KA 2R7HA 1P0HA 1XF8A 3RYOA 5LYDA 3SJXA 2FIAA 2Z3PA 2GLFA 4P4EA 2Z10A 4KVXA 3SHPA 5EMIA 1IICA 4BINA 5JQ4A 2AFSA 4C7IA 1HDUA 2ZENA 3FXTA 4MFQA 4NGMA 3S9NA 3DR6A 1TIQA 1S7NA 2C27A 4P10A 4B14A 3R95A 3FBUA 4H2KA 4AG7A 3D7DA 4CGPA 4KUBA 4UCMA 4NGTA 4CAFA 3GKRA 2PRQA 2R1IA 3PFEA 4A33A 4H89A 2GU2A 1Y9WA 3B35A 1XE4A 1NMTA 2D4PA 2PJ9A 1K4JA 3PB4X 4A95A 5KTCA 1ZG7A 1VHSA 4R6TA 2Q0YA 3DR8A 1LRZA 2YNEA 3V38A 1ZG9A 1N71A 3PZJA 5D8NA 3G8WA 1QSRA 1IOIA 2C6CA 2ZW6A 4ZGYB 1FNOA 2HV2A 3FMCA 5J1QA 1MJ9A 4P6YA 2GREA 2QIRA 3PRTA 4GS4A 2EVNA 1QSNA 4MHNA 1WWZA 2VBQA 1V0CA 4F0YA 4RS2A 3EO4A 2OZUA 2JBJA 4CS0B 3D68A 5CBMA 3EXNA 2G0BA 2BEIA 4MXUA 4UIBA 5KTAA 3K9TA 4XPKA 3H8GA 3T8WA 1LFWA 2REFA 3N5FA 5LRJA 3CPXA 2Q4YA 4B5OA 2B4DA 2EK8A 1F2OA 3FECA 3IO1A 5CNPA 3PGPA 2ZOGA 1IGBA 1YK3A 2GANA 2JDDA 5HVHA 3N7ZA 4BMHA 4DUKA 2Z11A 4BBHA 4KZTA 3IWGA 3JUWA 3TE4A 4XPDB 1RO5A 2DF5A 3OWCA 3IGRA 4ZX9A 4X2TA 2FT0A 4UFWA 4OC5A 3PB7X 3GUXA 4EWTA 5H86A 3D7FA 4E0AA 2PDOA 4UEZA 3RBUA 3MGDA 1VIXA 4KLWA 2PJBA 2WPXA 4PQAA 2YNCC 4ZX8A 2HQYA 1KUVA 4ORFA 4OP4A 2PCUA 3EFAA 1YMEA 2WYRA 4M6IA 4WJBA 2QJ8A 4Y49C 4TWEA 3HLPA 1MJBA 2O53A 3BXMA 1LANA 4QC6A 3CT9A 1DTDA 2ZW7A 1YLOA 3S6KA 4H6UA 3W91A 3IU1A 4QVTA 3TO6A 5D29A 2IL4A 3T90A 4MFLA 2B4BA 2PIZA 1I21A 3PFOA 4P45A 5AG4A 5I0CA 2NSMA 4M3SA 4JXQA 1QSMA 4P4IA 4LX9A 4HNYB 1ARLA 4NGRA 1XJOA 4CAEA 4B5PA 4CYPA 3D2MA 3FVLA 1NSAA 2C6GA 1CP6A 1P4NA 3CZXA 4MFZA 1YW4A 4NGPA 1KWMA 1OZPA 2EUIA 4M85A 4E8OA 2FXFA 3R9GA 2I00A 2PJ1A 2BSWA 4OKOA 2V8GA 2PR1A 4A30A 4UWJA 1CPXA 4UIAA 4MJ8A 2OU2A 1M44A 2J8MA 4KOXA 1XOVA 4FWUA 4IK2A 2C1CA 4ZYQA 3KI9A 5AG7A 1CM0A 4CRYB 2CTBA 4PXDA 5BWAB 3NE8A 3S6GA 3IC1A 5HH1A 2OB0A 1PU9A 1YGHA 4WWVA 3RNZA 2JEVA 3BLNA 2VZZA 2Y0MA 1F57A 4P4DA 4CGMA 4KOTA 3QAYA 1YX0A 5F47A 4B10A 4GXHA 4OLLA 5I4MA 4ZY0A 3B3CA 1HDQA 1YW6A 3CXQA 2G3TA 3WC5A 2EWBA 4KOSA 4U9ZA 2AFOA 4KORA 5CPAA 4W9YA 1VKCA 4CYOA 3R96A 4FBEA 3B8GA 3EY5A 2G9DA 2IMOA 4KLVA 2QECA 5HMNA 2K5TA 1L0CA 3QAHA 4FUUA 1Q2YA 3FX6A 3QB8A 3SI0A 1TXRA 5A28A 1CPSA 4JD6A 5IB0A 3PB6X 2AFZA 4PK2A 3KR4A 2RB7A 3SI1A 5K8MA 1QMUA 2B3VA 4EVYA 2YGWA 3TCVA 1LAPA 2CIJA 2WUUA 4YFJA 4K30A 3L2NA 2V8DA 2BOAA 3GY9A 3KHZA 4OC1A 4MFPA 3SJGA 3KKWA 3KL9A 4UCPA 4PXCA 4R76A 2ZEOA 2FL4A 1YVKA 4Q36A 3D4UA 1X12A 1R3NA 1XFOA 4UFXA 5DS0A 2OOTA 4XPDC 4E2AA 4IHMA 3FB3A 4IF5A 5ELYA 1XMBA 1BO4A 2BCOA 2Q04A 3IEHA 4MBUA 4PXBA 2AFWA 2BO9A 2R98A 1ELMP 2CF4A 4AVAA 2ZEMA 4R8FA 1GHEA 4I49A 4F8ZA 3KGQA 4JZ0A 1M4LA 2FE7A 3D66A 4HKFA 4OIDA 1MK4A 5F49A 2XEGA 3BI1A 4MY3A 3VH9A 7CPAA 2F7VA 1TKJA 1M1DA 2QVPA 5HXDA 1JWQA 2JDCA 4LUAA 4A39A 5C88A 3LD2A 4HPSA 4A38A 2FSRA 4R7MA 1X10A 5AGEA 3B3WA 3V7ZA 1Z8WA 4G1PA 2PJ5A 2B58A 4FD6A 1LAMA 5G21A 4AB7A 2PVVA 1CX8A 3KASA 3JTKA 1NE9A 3F5BA 4YGOA 4Z65A 5C82A 2GFQA 2Q51A 3FH4A 4LQ6A 2NMTA 2CXAA 3DLJA 4A31A 4L8AA 4JYWA 4AG9A 2FVGA 4CGLA 2BL1A 4NF1A 3K9UA 4F9UA 2WSAA 3D8PA 4OC3A 3JVNA 2POKA 1BPMA 3E0KA 4KUAA 2P6GA 4R3KA 4AVCA 3CXSA 2B5GB 1U6MA 1Z8TA 2PJ8A 2PSWA 4A37A 4PPZA 4M6GA 4EFDA 3WC7A 2I79A 3QNVA 4ZY2A 1S7KA 4X5KA 5LYIA 1IU8A 1Q2CA 2ZEFA 1IB1E 2J8RA 2Z3KA 2ZW5A 2ZEDA 2QYVA 1Y0YA 2V8VA 3ISXA 2ZPAA 4KVME 1ZLHA 1YQEA 2FS5A 4MHPA 2DEAA 4YRHA 3B2YA 2GE3A 3RO0A 4FAIA 3R9FA 2VQYA 1Z4RA 3WR7A 4U9YA 1B87A 3TX8A 2J9AA 3TOBA 2CTCA 5DWNA 1LCPA 3TOAA 2IJZA 4NCZA 2OZHA 2RC4A 4MHDA 4UFVA 2YNDA 2Z3OA 2ZW4A 2WPWA 1UWYA 1ZLIA 3D67A 3LWUA 3SJEA 5IX3A 4XPLA 1Z8LA 3PBEA 1YREA 3D3SA 2VZYA 2WZNA 3KQXA 1FY7A 4C2ZA 4A2ZA 1RTQA 1S7LA 5J8CA 3PEIA 4MI4A 4LQGA 4NSQA 3D7HA 5F48A 5DWMA 2XEIA 4EMEA 5ISVA 2OR4A 4P4FA 4GM5A 2ODFA 4KSFA 1VGYA 3TFYA 4MMOA 4JWPA 1CP7A 3H8FA 2EO8A 4OMEA 1Z4EA 4PV6A 1XIXA 2Z0ZA 4A94A 2DXQA 2RFHA 2ZEEA 1ZG8A 2V77A 3HUVA 3I3GA 3RZAA 3G3SA 4J3GA 2B3UA 5LYFA 2Q44A 4CAXA 4PXEA 4R57A 4B12A 2AE6A 4JLYA 1YR0A 3JRUA 1NSLA 4DJLA 4F6AA 1Z8XA 4RI1A 1KUXA 1Z2LA 5THWA 4UWIA 3VARA 6CPAA 1QSTA 1J4JA 3PBBA 4NJQA 3SJFA 1FT7A 2JLMA 4QUSA 3I1UA 3BJ8A 4PK3A 2VI7A 5FVJA 2CY2A 3A9LA 3D2PA 4R9MA 3CDXA 4QB9A 4UF4A 4ZI6A 4X3RA 4XNHB 2DPTA 1F2PA 1Y9KA 2ZXVA 5HVFA 5LRKA 2PJ3A 3CPAA 4C2XA 2PR8A 3EC4A 4IUSA 4OAEA 4X8IA 5K8NA 5EC4A 3RAMA 1DE4C 2H5MA 1IOFA 2ANPA 1OBRA 4KOYA 4F9VA 4RUHA 5J8FA 2P6EA 2YNCA 1XBUA 1Y7EA 5G22A 3H8EA 4H6ZA 1AYEA 4OADA 3FEEA
chains in the Genus database with same CATH topology
4KVOE 5G20A 1I12A 2REEA 4AVBA 4KOUA 2Z3MA 3P2FA 4L89A 1IYKA 2CNTA 2J8NA 1IYLA 3SXOA 3FRMA 4QBJA 4C2YA 1M4DA 2ARHA 4II9A 2HUZA 3TT2A 2VXKA 2P6FA 4FD5A 1S7FA 4CGOA 2Q4VA 3NE7A 3PP9A 3IWEA 3R1KA 1M4IA 2KCWA 1UFHA 1XMTA 1Q2DA 2B4DB 4ONUA 3TO7A 4UBRA 3ZZIA 2CNSA 5EBVA 2F5IA 2BUEA 3FNCA 2D4OA 1R57A 5JPHA 3FYNA 4R87A 1KZFA 1KUYA 5GCNA 4UA3A 2VEZA 3I9SA 4MFJA 1Y7RA 3ZJ0A 5KTDA 4FD4A 2FCKA 5AG6A 4B11A 3UY5A 1QSOA 4HNXB 2A4NA 1M4GA 3VWEA 1BOBA 2O28A 3DNSA 3VWDA 1IIDA 2QMLA 5G1ZA 3BJ7A 3FIXA 5H84A 3R9EA 1WK4A 4B5PB 5AG5A 4C7HA 4CGNA 3DDDA 1ON0A 1Z9UA 2X7BA 2Z3NA 4U5YA 4C68A 1YVOA 4KSAA 4NXYA 1S3ZA 1S60A 1YLEA 4KOVA 4XNHC 4MFKA 1ZO0A 2FIWA 2R8VA 2P0WA 2Z3LA 3IU2A 3P2HA 4JXRA 3CXPA 2B5GA 4CYQA 4HNWB 5E96A 4ZBGA 1SQHA 4CAWA 4Q38A 2PQ8A 1CJWA 5F46A 3S6HA 5A27A 3V8IA 5IV0A 3SXNA 4A32A 4NEXA 3W6XA 2G3AA 1XEBA 2PRBA 3S6FA 3F0AA 3C26A 2CNMA 4F0XA 4CAVA 4KS9A 4B13A 2Q7BA 2DPSA 4DNCA 3LODA 4CRZB 5IB0A 1B6BA 1PUAA 2PC1A 3GYAA 3W6SA 2AJ6A 4JJXA 1MJAA 2OH1A 4KOWA 4MY0A 1I1DA 3TTHA 3T9YA 3H5ZA 4CYNA 4UCNA 4Y49B 4FD7A 3TO9A 2GIVA 4R3LA 2OZGA 1RXTA 1S5KA 4PSWA 3H4QA 3F8KA 3DSBA 2ATRA 4PSXA 2R7HA 1P0HA 1XF8A 3RYOA 2FIAA 2Z3PA 2Z10A 4KVXA 3SHPA 1IICA 5JQ4A 4C7IA 3FXTA 4MFQA 3DR6A 1TIQA 1S7NA 2C27A 4B14A 3R95A 3FBUA 4AG7A 4CGPA 4KUBA 4UCMA 4CAFA 3GKRA 2R1IA 4A33A 4H89A 1Y9WA 1XE4A 1NMTA 2D4PA 1K4JA 4A95A 5KTCA 1VHSA 2Q0YA 3DR8A 1LRZA 2YNEA 1N71A 3PZJA 3G8WA 1QSRA 2ZW6A 4ZGYB 2HV2A 1MJ9A 2QIRA 4GS4A 2EVNA 1QSNA 1WWZA 2VBQA 1V0CA 4F0YA 4RS2A 3EO4A 2OZUA 4CS0B 3EXNA 2G0BA 2BEIA 5KTAA 4XPKA 2REFA 2Q4YA 4B5OA 2B4DA 5CNPA 3PGPA 1YK3A 2GANA 2JDDA 3N7ZA 4BMHA 2Z11A 4BBHA 4KZTA 3IWGA 3JUWA 3TE4A 4XPDB 1RO5A 3OWCA 3IGRA 2FT0A 4UFWA 5H86A 4E0AA 2PDOA 3MGDA 4KLWA 2WPXA 2YNCC 2HQYA 1KUVA 4ORFA 3EFAA 4Y49C 1MJBA 4QC6A 3S6KA 2ZW7A 4H6UA 3W91A 3IU1A 4QVTA 3TO6A 2IL4A 3T90A 4MFLA 2B4BA 1I21A 5I0CA 5AG4A 4M3SA 4JXQA 1QSMA 4LX9A 4HNYB 4CYPA 4CAEA 4B5PA 3D2MA 4MFZA 1P4NA 4E8OA 1OZPA 2EUIA 4M85A 2FXFA 3R9GA 2I00A 2BSWA 2PR1A 4A30A 4UWJA 4MJ8A 2OU2A 1M44A 2J8MA 4KOXA 5AG7A 1CM0A 4CRYB 5BWAB 3S6GA 5HH1A 2OB0A 1PU9A 1YGHA 2JEVA 3BLNA 2VZZA 2Y0MA 4CGMA 4KOTA 4B10A 1YX0A 5F47A 4OLLA 3CXQA 2G3TA 4KOSA 4U9ZA 4KORA 1VKCA 4CYOA 3R96A 3B8GA 3EY5A 4KLVA 2QECA 5HMNA 2K5TA 1L0CA 3QAHA 1Q2YA 3QB8A 5A28A 4JD6A 4PK2A 2B3VA 4EVYA 2YGWA 3TCVA 4YFJA 2WUUA 4K30A 3GY9A 4MFPA 3KKWA 4UCPA 2FL4A 1YVKA 4Q36A 4UFXA 4XPDC 4E2AA 3FB3A 4IF5A 2Q04A 1BO4A 4MBUA 2R98A 4AVAA 1GHEA 4I49A 2FE7A 4HKFA 1MK4A 5F49A 4MY3A 1M1DA 4LUAA 2JDCA 5C88A 3LD2A 2FSRA 5AGEA 5G21A 4FD6A 2B58A 4AB7A 3JTKA 1NE9A 3F5BA 4YGOA 5C82A 2NMTA 2CXAA 4A31A 4L8AA 4AG9A 4CGLA 2BL1A 4NF1A 3K9UA 2WSAA 3D8PA 3JVNA 4R3KA 4KUAA 3E0KA 2P6GA 4AVCA 3CXSA 2B5GB 1U6MA 2PSWA 2I79A 1S7KA 4X5KA 1Q2CA 1IB1E 2J8RA 2Z3KA 2ZW5A 2ZPAA 4KVME 2FS5A 4YRHA 2GE3A 3R9FA 2VQYA 1Z4RA 3WR7A 4U9YA 1B87A 3TOBA 5DWNA 3TOAA 4NCZA 2OZHA 2RC4A 4MHDA 4UFVA 2YNDA 2Z3OA 2ZW4A 2WPWA 5IX3A 4XPLA 1YREA 3D3SA 2VZYA 1FY7A 4C2ZA 4A2ZA 1S7LA 5J8CA 4MI4A 4NSQA 5F48A 5DWMA 5ISVA 4KSFA 3TFYA 4JWPA 1Z4EA 4PV6A 1XIXA 2Z0ZA 2DXQA 3I3GA 3G3SA 4J3GA 2B3UA 2Q44A 4CAXA 4R57A 4B12A 2AE6A 4JLYA 1YR0A 4F6AA 1NSLA 4RI1A 1KUXA 4UWIA 1QSTA 1J4JA 2JLMA 4QUSA 4PK3A 3BJ8A 5FVJA 2VI7A 2CY2A 3A9LA 3D2PA 4R9MA 4QB9A 4XNHB 2DPTA 1Y9KA 2ZXVA 4C2XA 2PR8A 3EC4A 4IUSA 4OAEA 5EC4A 2H5MA 4KOYA 5J8FA 2P6EA 2YNCA 5G22A 4H6ZA 4OADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVO E;  1I12 A;  2REE A;  4AVB A;  4KOU A;  3P2F A;  4L89 A;  1IYK A;  2CNT A;  2J8N A;  1IYL A;  3SXO A;  3FRM A;  4QBJ A;  1M4D A;  2ARH A;  4II9 A;  2HUZ A;  3TT2 A;  2VXK A;  2P6F A;  4FD5 A;  1S7F A;  2Q4V A;  3NE7 A;  3PP9 A;  3R1K A;  1M4I A;  2KCW A;  1UFH A;  1XMT A;  1Q2D A;  2B4D B;  4ONU A;  3TO7 A;  4UBR A;  3ZZI A;  2CNS A;  5EBV A;  2F5I A;  2BUE A;  3FNC A;  2D4O A;  1R57 A;  5JPH A;  3FYN A;  4R87 A;  1KZF A;  1KUY A;  5GCN A;  4UA3 A;  2VEZ A;  3I9S A;  1Y7R A;  3ZJ0 A;  5KTD A;  4FD4 A;  2FCK A;  3UY5 A;  1QSO A;  4HNX B;  2A4N A;  1M4G A;  3VWE A;  1BOB A;  2O28 A;  3DNS A;  3VWD A;  1IID A;  2QML A;  3BJ7 A;  3FIX A;  5H84 A;  3R9E A;  1WK4 A;  4B5P B;  3DDD A;  1ON0 A;  1Z9U A;  2X7B A;  4U5Y A;  1YVO A;  4NXY A;  1S3Z A;  1S60 A;  1YLE A;  4KOV A;  4XNH C;  2FIW A;  2R8V A;  2P0W A;  3P2H A;  4JXR A;  3CXP A;  2B5G A;  4HNW B;  5E96 A;  4ZBG A;  1SQH A;  4CAW A;  2PQ8 A;  1CJW A;  5F46 A;  3S6H A;  3V8I A;  5IV0 A;  3SXN A;  4NEX A;  3W6X A;  2G3A A;  1XEB A;  2PRB A;  3S6F A;  3F0A A;  3C26 A;  2CNM A;  4CAV A;  2Q7B A;  4DNC A;  3LOD A;  4CRZ B;  5IB0 A;  1B6B A;  1PUA A;  2PC1 A;  3GYA A;  3W6S A;  2AJ6 A;  4JJX A;  1MJA A;  2OH1 A;  4KOW A;  4MY0 A;  1I1D A;  3TTH A;  3T9Y A;  4Y49 B;  4FD7 A;  3TO9 A;  2GIV A;  4R3L A;  2OZG A;  1RXT A;  1S5K A;  4PSW A;  3H4Q A;  3F8K A;  3DSB A;  2ATR A;  4PSX A;  2R7H A;  1P0H A;  1XF8 A;  3RYO A;  2FIA A;  2Z10 A;  4KVX A;  3SHP A;  1IIC A;  5JQ4 A;  3FXT A;  3DR6 A;  1TIQ A;  1S7N A;  2C27 A;  3R95 A;  3FBU A;  4AG7 A;  4KUB A;  3GKR A;  2R1I A;  4H89 A;  1Y9W A;  1XE4 A;  1NMT A;  2D4P A;  1K4J A;  5KTC A;  1VHS A;  2Q0Y A;  3DR8 A;  1LRZ A;  1N71 A;  3PZJ A;  3G8W A;  1QSR A;  2ZW6 A;  2HV2 A;  1MJ9 A;  2QIR A;  4GS4 A;  2EVN A;  1QSN A;  1WWZ A;  2VBQ A;  1V0C A;  4F0Y A;  4RS2 A;  3EO4 A;  2OZU A;  4CS0 B;  3EXN A;  2G0B A;  2BEI A;  5KTA A;  4XPK A;  2REF A;  2Q4Y A;  4B5O A;  2B4D A;  5CNP A;  3PGP A;  1YK3 A;  2GAN A;  2JDD A;  3N7Z A;  4BMH A;  2Z11 A;  4KZT A;  3IWG A;  3JUW A;  3TE4 A;  4XPD B;  1RO5 A;  3OWC A;  3IGR A;  2FT0 A;  5H86 A;  4E0A A;  2PDO A;  3MGD A;  4KLW A;  2WPX A;  2HQY A;  1KUV A;  4ORF A;  3EFA A;  4Y49 C;  1MJB A;  4QC6 A;  3S6K A;  2ZW7 A;  4H6U A;  3W91 A;  4QVT A;  3TO6 A;  2IL4 A;  3T90 A;  2B4B A;  1I21 A;  5I0C A;  4M3S A;  4JXQ A;  1QSM A;  4LX9 A;  4HNY B;  4B5P A;  3D2M A;  1P4N A;  4E8O A;  1OZP A;  2EUI A;  4M85 A;  2FXF A;  3R9G A;  2I00 A;  2BSW A;  2PR1 A;  4UWJ A;  4MJ8 A;  2OU2 A;  1M44 A;  2J8M A;  4KOX A;  1CM0 A;  4CRY B;  3S6G A;  5HH1 A;  2OB0 A;  1PU9 A;  1YGH A;  2JEV A;  3BLN A;  2VZZ A;  2Y0M A;  4KOT A;  1YX0 A;  5F47 A;  4OLL A;  3CXQ A;  2G3T A;  4KOS A;  4U9Z A;  4KOR A;  1VKC A;  3R96 A;  3B8G A;  3EY5 A;  4KLV A;  2QEC A;  5HMN A;  2K5T A;  1L0C A;  3QAH A;  1Q2Y A;  3QB8 A;  4JD6 A;  4PK2 A;  2B3V A;  4EVY A;  4YFJ A;  3TCV A;  4K30 A;  3GY9 A;  3KKW A;  2FL4 A;  1YVK A;  4XPD C;  4E2A A;  3FB3 A;  4IF5 A;  2Q04 A;  1BO4 A;  4MBU A;  2R98 A;  4AVA A;  1GHE A;  4I49 A;  2FE7 A;  4HKF A;  1MK4 A;  5F49 A;  4MY3 A;  1M1D A;  4LUA A;  2JDC A;  5C88 A;  3LD2 A;  2FSR A;  4FD6 A;  2B58 A;  4AB7 A;  1NE9 A;  3F5B A;  4YGO A;  5C82 A;  2NMT A;  4L8A A;  4AG9 A;  2BL1 A;  4NF1 A;  3K9U A;  3D8P A;  3JVN A;  4R3K A;  4KUA A;  3E0K A;  2P6G A;  4AVC A;  3CXS A;  2B5G B;  1U6M A;  2PSW A;  2I79 A;  1S7K A;  4X5K A;  1Q2C A;  1IB1 E;  2J8R A;  2ZW5 A;  2ZPA A;  4KVM E;  2FS5 A;  4YRH A;  2GE3 A;  3R9F A;  2VQY A;  1Z4R A;  3WR7 A;  4U9Y A;  1B87 A;  3TOB A;  5DWN A;  3TOA A;  4NCZ A;  2OZH A;  2RC4 A;  4MHD A;  2ZW4 A;  2WPW A;  5IX3 A;  4XPL A;  1YRE A;  3D3S A;  2VZY A;  1FY7 A;  1S7L A;  5J8C A;  4MI4 A;  4NSQ A;  5F48 A;  5DWM A;  5ISV A;  3TFY A;  4JWP A;  1Z4E A;  4PV6 A;  1XIX A;  2Z0Z A;  2DXQ A;  3I3G A;  3G3S A;  4J3G A;  2B3U A;  2Q44 A;  4CAX A;  4R57 A;  2AE6 A;  4JLY A;  1YR0 A;  4F6A A;  1NSL A;  4RI1 A;  1KUX A;  4UWI A;  1QST A;  1J4J A;  2JLM A;  4QUS A;  4PK3 A;  3BJ8 A;  5FVJ A;  2VI7 A;  2CY2 A;  3D2P A;  4R9M A;  4QB9 A;  4XNH B;  1Y9K A;  2ZXV A;  2PR8 A;  3EC4 A;  4IUS A;  4OAE A;  5EC4 A;  2H5M A;  4KOY A;  5J8F A;  2P6E A;  4H6Z A;  4OAD A; 
#chains in the Genus database with same CATH topology
 4KVO E;  5G20 A;  3KR5 A;  1I12 A;  2REE A;  3B3S A;  2AFU A;  4AVB A;  4KOU A;  1LOK A;  2Z3M A;  4P4J A;  4ZY1 A;  3P2F A;  4L89 A;  1IYK A;  2CNT A;  2J8N A;  2PJ4 A;  3S9M A;  1IYL A;  1YSJ A;  3SXO A;  4MHY A;  1IY7 A;  1Z5R A;  3FRM A;  4QBJ A;  4C2Y A;  1Q7L A;  1M4D A;  2ARH A;  3BI0 A;  1VHE A;  4II9 A;  1TF8 A;  2HUZ A;  3D7G A;  4NGS A;  2PJA A;  4NJR A;  3TT2 A;  2VXK A;  2P6F A;  3PB8 X;  4FD5 A;  1S7F A;  1Y0R A;  2Q4V A;  3GB0 A;  3MN8 A;  3NE7 A;  3IWE A;  2C6P A;  3PP9 A;  3R1K A;  1M4I A;  2KCW A;  1UFH A;  4P4B A;  1XMT A;  1Q2D A;  2PE3 A;  1CG2 A;  4B6Z A;  2B4D B;  4OIW A;  2ZEH A;  4ONU A;  1ARM A;  2AFM A;  3TO7 A;  3IJ3 A;  4UBR A;  3ZZI A;  2CNS A;  3WAB A;  3GLJ A;  5EBV A;  2F5I A;  3FED A;  3MRU A;  2PJ2 A;  2BUE A;  3FNC A;  5F09 A;  2D4O A;  1R57 A;  4OC4 A;  5JPH A;  3S9L A;  3FYN A;  3NH5 A;  4R87 A;  1KZF A;  1KUY A;  5GCN A;  4OC0 A;  4UA3 A;  2JBK A;  2PJ6 A;  2VEZ A;  2AFX A;  3I9S A;  1Y7R A;  2Q4Z A;  4MFJ A;  3ZJ0 A;  5KTD A;  1ELL P;  1XRY A;  4MCR A;  5LRG A;  4FD4 A;  3VAT A;  2FCK A;  5AG6 A;  4IAV A;  4M6H A;  4B11 A;  1BAV A;  3UY5 A;  1QSO A;  3IFE A;  4Q7A A;  4O23 A;  4HNX B;  2A4N A;  4AXV A;  1M4G A;  2IQ6 A;  3VWE A;  1BOB A;  2O28 A;  3DNS A;  3NH4 A;  3VWD A;  2EBJ A;  5K8O A;  4NGN A;  4CPA A;  2HC9 A;  1BPN A;  1A2Z A;  1IID A;  1PYT B;  8CPA A;  2EK9 A;  2QML A;  5G1Z A;  3BJ7 A;  4KSI A;  3FIX A;  2ABZ A;  5H84 A;  3R9E A;  1WK4 A;  5JGF A;  4MRI A;  4YU9 A;  4B5P B;  5AG5 A;  2ZEP A;  3LAC A;  4C7H A;  2XEF A;  2ZOF A;  4CGN A;  3DDD A;  1ON0 A;  1Z9U A;  2X7B A;  2Z3N A;  2VL1 A;  3PB9 X;  4U5Y A;  3TC8 A;  1YVO A;  4KSA A;  4C68 A;  4BD9 A;  1QQ9 A;  2PVW A;  3B3T A;  4NXY A;  1TKH A;  1S3Z A;  2Q43 A;  1PCA A;  1S60 A;  4RN7 A;  1YLE A;  4KOV A;  4XNH C;  1CBX A;  4MFK A;  1ZO0 A;  2FIW A;  1JQG A;  2R8V A;  2P0W A;  2Z3L A;  3IU2 A;  4OC2 A;  1BLL E;  3P2H A;  4JXR A;  3CXP A;  5K8P A;  2B5G A;  4CYQ A;  4HNW B;  2O4H A;  4NFR A;  3IIB A;  2HB6 A;  5E96 A;  4ZBG A;  1SQH A;  2JEW A;  3LMS A;  4CAW A;  4Q38 A;  2PQ8 A;  1CJW A;  2ZEG A;  3KHX A;  5F46 A;  2NYQ A;  3S6H A;  3KQZ A;  4NGQ A;  5A27 A;  3V8I A;  4P44 A;  1TF9 A;  4CGO A;  5IB9 A;  1VHO A;  5IV0 A;  3SXN A;  4MCP A;  4A32 A;  4NEX A;  3W6X A;  2G3A A;  3SI2 A;  1XEB A;  2PRB A;  3S6F A;  3ISZ A;  3F0A A;  3C26 A;  2CNM A;  3FJU A;  4F0X A;  1AUG A;  4CAV A;  3KZW A;  2PJC A;  2V8H A;  2GLJ A;  3BHX A;  4KS9 A;  4B13 A;  2PIY A;  2Q7B A;  2XEJ A;  1HEE A;  2DPS A;  4K3N A;  2PJ7 A;  3NH8 A;  4DNC A;  3NA6 A;  3LOD A;  4CRZ B;  1TKF A;  1B6B A;  1PUA A;  2PC1 A;  2ZEL A;  3GYA A;  3WC6 A;  2I3C A;  3B7I A;  5JM6 A;  3FF3 A;  3W6S A;  2AJ6 A;  5HVG A;  4JJX A;  1AMP A;  1MJA A;  5LYL A;  2OH1 A;  4KOW A;  4MY0 A;  3WT4 A;  3NFZ A;  1I1D A;  3GIU A;  3TTH A;  1GYT A;  2PJ0 A;  3T9Y A;  3H5Z A;  1R43 A;  4UEF A;  4UCN A;  4CYN A;  2F8H A;  4Y49 B;  5JH9 A;  4FD7 A;  3TO9 A;  2GIV A;  3IWW A;  4MCS A;  4R3L A;  4MHZ A;  4DYO A;  3DGV A;  4MCQ A;  2OZG A;  1RXT A;  1S5K A;  2Q7S A;  1EE3 P;  4PSW A;  4UEE A;  3B3V A;  3H4Q A;  3F8K A;  3DSB A;  1H8L A;  2ATR A;  4ONW A;  4PSX A;  4TNU A;  4YWY A;  3K2K A;  2R7H A;  1P0H A;  1XF8 A;  3RYO A;  5LYD A;  3SJX A;  2FIA A;  2Z3P A;  2GLF A;  4P4E A;  2Z10 A;  4KVX A;  3SHP A;  5EMI A;  1IIC A;  4BIN A;  5JQ4 A;  2AFS A;  4C7I A;  1HDU A;  2ZEN A;  3FXT A;  4MFQ A;  4NGM A;  3S9N A;  3DR6 A;  1TIQ A;  1S7N A;  2C27 A;  4P10 A;  4B14 A;  3R95 A;  3FBU A;  4H2K A;  4AG7 A;  3D7D A;  4CGP A;  4KUB A;  4UCM A;  4NGT A;  4CAF A;  3GKR A;  2PRQ A;  2R1I A;  3PFE A;  4A33 A;  4H89 A;  2GU2 A;  1Y9W A;  3B35 A;  1XE4 A;  1NMT A;  2D4P A;  2PJ9 A;  1K4J A;  3PB4 X;  4A95 A;  5KTC A;  1ZG7 A;  1VHS A;  4R6T A;  2Q0Y A;  3DR8 A;  1LRZ A;  2YNE A;  3V38 A;  1ZG9 A;  1N71 A;  3PZJ A;  5D8N A;  3G8W A;  1QSR A;  1IOI A;  2C6C A;  2ZW6 A;  4ZGY B;  1FNO A;  2HV2 A;  3FMC A;  5J1Q A;  1MJ9 A;  4P6Y A;  2GRE A;  2QIR A;  3PRT A;  4GS4 A;  2EVN A;  1QSN A;  4MHN A;  1WWZ A;  2VBQ A;  1V0C A;  4F0Y A;  4RS2 A;  3EO4 A;  2OZU A;  2JBJ A;  4CS0 B;  3D68 A;  5CBM A;  3EXN A;  2G0B A;  2BEI A;  4MXU A;  4UIB A;  5KTA A;  3K9T A;  4XPK A;  3H8G A;  3T8W A;  1LFW A;  2REF A;  3N5F A;  5LRJ A;  3CPX A;  2Q4Y A;  4B5O A;  2B4D A;  2EK8 A;  1F2O A;  3FEC A;  3IO1 A;  5CNP A;  3PGP A;  2ZOG A;  1IGB A;  1YK3 A;  2GAN A;  2JDD A;  5HVH A;  3N7Z A;  4BMH A;  4DUK A;  2Z11 A;  4BBH A;  4KZT A;  3IWG A;  3JUW A;  3TE4 A;  4XPD B;  1RO5 A;  2DF5 A;  3OWC A;  3IGR A;  4ZX9 A;  4X2T A;  2FT0 A;  4UFW A;  4OC5 A;  3PB7 X;  3GUX A;  4EWT A;  5H86 A;  3D7F A;  4E0A A;  2PDO A;  4UEZ A;  3RBU A;  3MGD A;  1VIX A;  4KLW A;  2PJB A;  2WPX A;  4PQA A;  2YNC C;  4ZX8 A;  2HQY A;  1KUV A;  4ORF A;  4OP4 A;  2PCU A;  3EFA A;  1YME A;  2WYR A;  4M6I A;  4WJB A;  2QJ8 A;  4Y49 C;  4TWE A;  3HLP A;  1MJB A;  2O53 A;  3BXM A;  1LAN A;  4QC6 A;  3CT9 A;  1DTD A;  2ZW7 A;  1YLO A;  3S6K A;  4H6U A;  3W91 A;  3IU1 A;  4QVT A;  3TO6 A;  5D29 A;  2IL4 A;  3T90 A;  4MFL A;  2B4B A;  2PIZ A;  1I21 A;  3PFO A;  4P45 A;  5AG4 A;  5I0C A;  2NSM A;  4M3S A;  4JXQ A;  1QSM A;  4P4I A;  4LX9 A;  4HNY B;  1ARL A;  4NGR A;  1XJO A;  4CAE A;  4B5P A;  4CYP A;  3D2M A;  3FVL A;  1NSA A;  2C6G A;  1CP6 A;  1P4N A;  3CZX A;  4MFZ A;  1YW4 A;  4NGP A;  1KWM A;  1OZP A;  2EUI A;  4M85 A;  4E8O A;  2FXF A;  3R9G A;  2I00 A;  2PJ1 A;  2BSW A;  4OKO A;  2V8G A;  2PR1 A;  4A30 A;  4UWJ A;  1CPX A;  4UIA A;  4MJ8 A;  2OU2 A;  1M44 A;  2J8M A;  4KOX A;  1XOV A;  4FWU A;  4IK2 A;  2C1C A;  4ZYQ A;  3KI9 A;  5AG7 A;  1CM0 A;  4CRY B;  2CTB A;  4PXD A;  5BWA B;  3NE8 A;  3S6G A;  3IC1 A;  5HH1 A;  2OB0 A;  1PU9 A;  1YGH A;  4WWV A;  3RNZ A;  2JEV A;  3BLN A;  2VZZ A;  2Y0M A;  1F57 A;  4P4D A;  4CGM A;  4KOT A;  3QAY A;  1YX0 A;  5F47 A;  4B10 A;  4GXH A;  4OLL A;  5I4M A;  4ZY0 A;  3B3C A;  1HDQ A;  1YW6 A;  3CXQ A;  2G3T A;  3WC5 A;  2EWB A;  4KOS A;  4U9Z A;  2AFO A;  4KOR A;  5CPA A;  4W9Y A;  1VKC A;  4CYO A;  3R96 A;  4FBE A;  3B8G A;  3EY5 A;  2G9D A;  2IMO A;  4KLV A;  2QEC A;  5HMN A;  2K5T A;  1L0C A;  3QAH A;  4FUU A;  1Q2Y A;  3FX6 A;  3QB8 A;  3SI0 A;  1TXR A;  5A28 A;  1CPS A;  4JD6 A;  5IB0 A;  3PB6 X;  2AFZ A;  4PK2 A;  3KR4 A;  2RB7 A;  3SI1 A;  5K8M A;  1QMU A;  2B3V A;  4EVY A;  2YGW A;  3TCV A;  1LAP A;  2CIJ A;  2WUU A;  4YFJ A;  4K30 A;  3L2N A;  2V8D A;  2BOA A;  3GY9 A;  3KHZ A;  4OC1 A;  4MFP A;  3SJG A;  3KKW A;  3KL9 A;  4UCP A;  4PXC A;  4R76 A;  2ZEO A;  2FL4 A;  1YVK A;  4Q36 A;  3D4U A;  1X12 A;  1R3N A;  1XFO A;  4UFX A;  5DS0 A;  2OOT A;  4XPD C;  4E2A A;  4IHM A;  3FB3 A;  4IF5 A;  5ELY A;  1XMB A;  1BO4 A;  2BCO A;  2Q04 A;  3IEH A;  4MBU A;  4PXB A;  2AFW A;  2BO9 A;  2R98 A;  1ELM P;  2CF4 A;  4AVA A;  2ZEM A;  4R8F A;  1GHE A;  4I49 A;  4F8Z A;  3KGQ A;  4JZ0 A;  1M4L A;  2FE7 A;  3D66 A;  4HKF A;  4OID A;  1MK4 A;  5F49 A;  2XEG A;  3BI1 A;  4MY3 A;  3VH9 A;  7CPA A;  2F7V A;  1TKJ A;  1M1D A;  2QVP A;  5HXD A;  1JWQ A;  2JDC A;  4LUA A;  4A39 A;  5C88 A;  3LD2 A;  4HPS A;  4A38 A;  2FSR A;  4R7M A;  1X10 A;  5AGE A;  3B3W A;  3V7Z A;  1Z8W A;  4G1P A;  2PJ5 A;  2B58 A;  4FD6 A;  1LAM A;  5G21 A;  4AB7 A;  2PVV A;  1CX8 A;  3KAS A;  3JTK A;  1NE9 A;  3F5B A;  4YGO A;  4Z65 A;  5C82 A;  2GFQ A;  2Q51 A;  3FH4 A;  4LQ6 A;  2NMT A;  2CXA A;  3DLJ A;  4A31 A;  4L8A A;  4JYW A;  4AG9 A;  2FVG A;  4CGL A;  2BL1 A;  4NF1 A;  3K9U A;  4F9U A;  2WSA A;  3D8P A;  4OC3 A;  3JVN A;  2POK A;  1BPM A;  3E0K A;  4KUA A;  2P6G A;  4R3K A;  4AVC A;  3CXS A;  2B5G B;  1U6M A;  1Z8T A;  2PJ8 A;  2PSW A;  4A37 A;  4PPZ A;  4M6G A;  4EFD A;  3WC7 A;  2I79 A;  3QNV A;  4ZY2 A;  1S7K A;  4X5K A;  5LYI A;  1IU8 A;  1Q2C A;  2ZEF A;  1IB1 E;  2J8R A;  2Z3K A;  2ZW5 A;  2ZED A;  2QYV A;  1Y0Y A;  2V8V A;  3ISX A;  2ZPA A;  4KVM E;  1ZLH A;  1YQE A;  2FS5 A;  4MHP A;  2DEA A;  4YRH A;  3B2Y A;  2GE3 A;  3RO0 A;  4FAI A;  3R9F A;  2VQY A;  1Z4R A;  3WR7 A;  4U9Y A;  1B87 A;  3TX8 A;  2J9A A;  3TOB A;  2CTC A;  5DWN A;  1LCP A;  3TOA A;  2IJZ A;  4NCZ A;  2OZH A;  2RC4 A;  4MHD A;  4UFV A;  2YND A;  2Z3O A;  2ZW4 A;  2WPW A;  1UWY A;  1ZLI A;  3D67 A;  3LWU A;  3SJE A;  5IX3 A;  4XPL A;  1Z8L A;  3PBE A;  1YRE A;  3D3S A;  2VZY A;  2WZN A;  3KQX A;  1FY7 A;  4C2Z A;  4A2Z A;  1RTQ A;  1S7L A;  5J8C A;  3PEI A;  4MI4 A;  4LQG A;  4NSQ A;  3D7H A;  5F48 A;  5DWM A;  2XEI A;  4EME A;  5ISV A;  2OR4 A;  4P4F A;  4GM5 A;  2ODF A;  4KSF A;  1VGY A;  3TFY A;  4MMO A;  4JWP A;  1CP7 A;  3H8F A;  2EO8 A;  4OME A;  1Z4E A;  4PV6 A;  1XIX A;  2Z0Z A;  4A94 A;  2DXQ A;  2RFH A;  2ZEE A;  1ZG8 A;  2V77 A;  3HUV A;  3I3G A;  3RZA A;  3G3S A;  4J3G A;  2B3U A;  5LYF A;  2Q44 A;  4CAX A;  4PXE A;  4R57 A;  4B12 A;  2AE6 A;  4JLY A;  1YR0 A;  3JRU A;  1NSL A;  4DJL A;  4F6A A;  1Z8X A;  4RI1 A;  1KUX A;  1Z2L A;  5THW A;  4UWI A;  3VAR A;  6CPA A;  1QST A;  1J4J A;  3PBB A;  4NJQ A;  3SJF A;  1FT7 A;  2JLM A;  4QUS A;  3I1U A;  3BJ8 A;  4PK3 A;  2VI7 A;  5FVJ A;  2CY2 A;  3A9L A;  3D2P A;  4R9M A;  3CDX A;  4QB9 A;  4UF4 A;  4ZI6 A;  4X3R A;  4XNH B;  2DPT A;  1F2P A;  1Y9K A;  2ZXV A;  5HVF A;  5LRK A;  2PJ3 A;  3CPA A;  4C2X A;  2PR8 A;  3EC4 A;  4IUS A;  4OAE A;  4X8I A;  5K8N A;  5EC4 A;  3RAM A;  1DE4 C;  2H5M A;  1IOF A;  2ANP A;  1OBR A;  4KOY A;  4F9V A;  4RUH A;  5J8F A;  2P6E A;  2YNC A;  1XBU A;  1Y7E A;  5G22 A;  3H8E A;  4H6Z A;  1AYE A;  4OAD A;  3FEE A; 
#chains in the Genus database with same CATH homology
 4KVO E;  5G20 A;  1I12 A;  2REE A;  4AVB A;  4KOU A;  2Z3M A;  3P2F A;  4L89 A;  1IYK A;  2CNT A;  2J8N A;  1IYL A;  3SXO A;  3FRM A;  4QBJ A;  4C2Y A;  1M4D A;  2ARH A;  4II9 A;  2HUZ A;  3TT2 A;  2VXK A;  2P6F A;  4FD5 A;  1S7F A;  4CGO A;  2Q4V A;  3NE7 A;  3PP9 A;  3IWE A;  3R1K A;  1M4I A;  2KCW A;  1UFH A;  1XMT A;  1Q2D A;  2B4D B;  4ONU A;  3TO7 A;  4UBR A;  3ZZI A;  2CNS A;  5EBV A;  2F5I A;  2BUE A;  3FNC A;  2D4O A;  1R57 A;  5JPH A;  3FYN A;  4R87 A;  1KZF A;  1KUY A;  5GCN A;  4UA3 A;  2VEZ A;  3I9S A;  4MFJ A;  1Y7R A;  3ZJ0 A;  5KTD A;  4FD4 A;  2FCK A;  5AG6 A;  4B11 A;  3UY5 A;  1QSO A;  4HNX B;  2A4N A;  1M4G A;  3VWE A;  1BOB A;  2O28 A;  3DNS A;  3VWD A;  1IID A;  2QML A;  5G1Z A;  3BJ7 A;  3FIX A;  5H84 A;  3R9E A;  1WK4 A;  4B5P B;  5AG5 A;  4C7H A;  4CGN A;  3DDD A;  1ON0 A;  1Z9U A;  2X7B A;  2Z3N A;  4U5Y A;  4C68 A;  1YVO A;  4KSA A;  4NXY A;  1S3Z A;  1S60 A;  1YLE A;  4KOV A;  4XNH C;  4MFK A;  1ZO0 A;  2FIW A;  2R8V A;  2P0W A;  2Z3L A;  3IU2 A;  3P2H A;  4JXR A;  3CXP A;  2B5G A;  4CYQ A;  4HNW B;  5E96 A;  4ZBG A;  1SQH A;  4CAW A;  4Q38 A;  2PQ8 A;  1CJW A;  5F46 A;  3S6H A;  5A27 A;  3V8I A;  5IV0 A;  3SXN A;  4A32 A;  4NEX A;  3W6X A;  2G3A A;  1XEB A;  2PRB A;  3S6F A;  3F0A A;  3C26 A;  2CNM A;  4F0X A;  4CAV A;  4KS9 A;  4B13 A;  2Q7B A;  2DPS A;  4DNC A;  3LOD A;  4CRZ B;  5IB0 A;  1B6B A;  1PUA A;  2PC1 A;  3GYA A;  3W6S A;  2AJ6 A;  4JJX A;  1MJA A;  2OH1 A;  4KOW A;  4MY0 A;  1I1D A;  3TTH A;  3T9Y A;  3H5Z A;  4CYN A;  4UCN A;  4Y49 B;  4FD7 A;  3TO9 A;  2GIV A;  4R3L A;  2OZG A;  1RXT A;  1S5K A;  4PSW A;  3H4Q A;  3F8K A;  3DSB A;  2ATR A;  4PSX A;  2R7H A;  1P0H A;  1XF8 A;  3RYO A;  2FIA A;  2Z3P A;  2Z10 A;  4KVX A;  3SHP A;  1IIC A;  5JQ4 A;  4C7I A;  3FXT A;  4MFQ A;  3DR6 A;  1TIQ A;  1S7N A;  2C27 A;  4B14 A;  3R95 A;  3FBU A;  4AG7 A;  4CGP A;  4KUB A;  4UCM A;  4CAF A;  3GKR A;  2R1I A;  4A33 A;  4H89 A;  1Y9W A;  1XE4 A;  1NMT A;  2D4P A;  1K4J A;  4A95 A;  5KTC A;  1VHS A;  2Q0Y A;  3DR8 A;  1LRZ A;  2YNE A;  1N71 A;  3PZJ A;  3G8W A;  1QSR A;  2ZW6 A;  4ZGY B;  2HV2 A;  1MJ9 A;  2QIR A;  4GS4 A;  2EVN A;  1QSN A;  1WWZ A;  2VBQ A;  1V0C A;  4F0Y A;  4RS2 A;  3EO4 A;  2OZU A;  4CS0 B;  3EXN A;  2G0B A;  2BEI A;  5KTA A;  4XPK A;  2REF A;  2Q4Y A;  4B5O A;  2B4D A;  5CNP A;  3PGP A;  1YK3 A;  2GAN A;  2JDD A;  3N7Z A;  4BMH A;  2Z11 A;  4BBH A;  4KZT A;  3IWG A;  3JUW A;  3TE4 A;  4XPD B;  1RO5 A;  3OWC A;  3IGR A;  2FT0 A;  4UFW A;  5H86 A;  4E0A A;  2PDO A;  3MGD A;  4KLW A;  2WPX A;  2YNC C;  2HQY A;  1KUV A;  4ORF A;  3EFA A;  4Y49 C;  1MJB A;  4QC6 A;  3S6K A;  2ZW7 A;  4H6U A;  3W91 A;  3IU1 A;  4QVT A;  3TO6 A;  2IL4 A;  3T90 A;  4MFL A;  2B4B A;  1I21 A;  5I0C A;  5AG4 A;  4M3S A;  4JXQ A;  1QSM A;  4LX9 A;  4HNY B;  4CYP A;  4CAE A;  4B5P A;  3D2M A;  4MFZ A;  1P4N A;  4E8O A;  1OZP A;  2EUI A;  4M85 A;  2FXF A;  3R9G A;  2I00 A;  2BSW A;  2PR1 A;  4A30 A;  4UWJ A;  4MJ8 A;  2OU2 A;  1M44 A;  2J8M A;  4KOX A;  5AG7 A;  1CM0 A;  4CRY B;  5BWA B;  3S6G A;  5HH1 A;  2OB0 A;  1PU9 A;  1YGH A;  2JEV A;  3BLN A;  2VZZ A;  2Y0M A;  4CGM A;  4KOT A;  4B10 A;  1YX0 A;  5F47 A;  4OLL A;  3CXQ A;  2G3T A;  4KOS A;  4U9Z A;  4KOR A;  1VKC A;  4CYO A;  3R96 A;  3B8G A;  3EY5 A;  4KLV A;  2QEC A;  5HMN A;  2K5T A;  1L0C A;  3QAH A;  1Q2Y A;  3QB8 A;  5A28 A;  4JD6 A;  4PK2 A;  2B3V A;  4EVY A;  2YGW A;  3TCV A;  4YFJ A;  2WUU A;  4K30 A;  3GY9 A;  4MFP A;  3KKW A;  4UCP A;  2FL4 A;  1YVK A;  4Q36 A;  4UFX A;  4XPD C;  4E2A A;  3FB3 A;  4IF5 A;  2Q04 A;  1BO4 A;  4MBU A;  2R98 A;  4AVA A;  1GHE A;  4I49 A;  2FE7 A;  4HKF A;  1MK4 A;  5F49 A;  4MY3 A;  1M1D A;  4LUA A;  2JDC A;  5C88 A;  3LD2 A;  2FSR A;  5AGE A;  5G21 A;  4FD6 A;  2B58 A;  4AB7 A;  3JTK A;  1NE9 A;  3F5B A;  4YGO A;  5C82 A;  2NMT A;  2CXA A;  4A31 A;  4L8A A;  4AG9 A;  4CGL A;  2BL1 A;  4NF1 A;  3K9U A;  2WSA A;  3D8P A;  3JVN A;  4R3K A;  4KUA A;  3E0K A;  2P6G A;  4AVC A;  3CXS A;  2B5G B;  1U6M A;  2PSW A;  2I79 A;  1S7K A;  4X5K A;  1Q2C A;  1IB1 E;  2J8R A;  2Z3K A;  2ZW5 A;  2ZPA A;  4KVM E;  2FS5 A;  4YRH A;  2GE3 A;  3R9F A;  2VQY A;  1Z4R A;  3WR7 A;  4U9Y A;  1B87 A;  3TOB A;  5DWN A;  3TOA A;  4NCZ A;  2OZH A;  2RC4 A;  4MHD A;  4UFV A;  2YND A;  2Z3O A;  2ZW4 A;  2WPW A;  5IX3 A;  4XPL A;  1YRE A;  3D3S A;  2VZY A;  1FY7 A;  4C2Z A;  4A2Z A;  1S7L A;  5J8C A;  4MI4 A;  4NSQ A;  5F48 A;  5DWM A;  5ISV A;  4KSF A;  3TFY A;  4JWP A;  1Z4E A;  4PV6 A;  1XIX A;  2Z0Z A;  2DXQ A;  3I3G A;  3G3S A;  4J3G A;  2B3U A;  2Q44 A;  4CAX A;  4R57 A;  4B12 A;  2AE6 A;  4JLY A;  1YR0 A;  4F6A A;  1NSL A;  4RI1 A;  1KUX A;  4UWI A;  1QST A;  1J4J A;  2JLM A;  4QUS A;  4PK3 A;  3BJ8 A;  5FVJ A;  2VI7 A;  2CY2 A;  3A9L A;  3D2P A;  4R9M A;  4QB9 A;  4XNH B;  2DPT A;  1Y9K A;  2ZXV A;  4C2X A;  2PR8 A;  3EC4 A;  4IUS A;  4OAE A;  5EC4 A;  2H5M A;  4KOY A;  5J8F A;  2P6E A;  2YNC A;  5G22 A;  4H6Z A;  4OAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...