2AJ6A

Crystal structure of a putative gnat family acetyltransferase (mw0638) from staphylococcus aureus subsp. aureus at 1.63 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
HHMRTLNKDEHNYIKQIANIHETLLSQVESNYKCTKLSIALRYEMICSRLEHTNDKIYIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALEKWAKTMNAKRISNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein MW0638
publication title Crystal structure of hypothetical protein MW0638 from Staphylococcus aureus MW2 at 1.63 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2aj6A00
4R87A 2Q04A 3TO7A 3H4QA 2ZPAA 4KOUA 3CXPA 4UBRA 3S6KA 4MI4A 4KVOE 3EY5A 2P6FA 3R96A 5JQ4A 3S6GA 1YREA 4EVYA 3P2HA 2B4DB 4CAXA 1S7FA 4UWJA 2R98A 3GYAA 4KLVA 4NXYA 2VQYA 4PK2A 2REEA 3DSBA 1YR0A 2G0BA 1B6BA 1YLEA 2GE3A 3DR8A 2H5MA 2VI7A 2HUZA 1YX0A 2PRBA 2P6GA 4L8AA 4R3KA 4FD4A 5DWMA 3FB3A 2FXFA 2ZXVA 3ZZIA 2FSRA 1RXTA 2QMLA 5F47A 3EXNA 3T9YA 5H84A 4FD7A 2FIWA 3LD2A 4KUBA 2BUEA 3EC4A 2KCWA 5J8CA 4M85A 1Q2DA 2OZGA 2D4PA 1YVOA 3TO6A 4H6UA 3LODA 1M1DA 1Z4EA 1P4NA 3F0AA 4MHDA 4E8OA 2D4OA 5IV0A 2RC4A 2VBQA 4FD6A 4U9YA 4CAWA 4CRZB 1KUVA 1M4DA 2NMTA 2FT0A 2J8NA 1UFHA 4J3GA 4IF5A 1Y9WA 4H6ZA 4KVME 2OH1A 1QSRA 2A4NA 3F8KA 4XPDB 4KLWA 1GHEA 2K5TA 3VWEA 3CXQA 4QVTA 1BOBA 1MK4A 4OAEA 4M3SA 4YGOA 4KOVA 3QB8A 2EUIA 2B4DA 3FXTA 4KZTA 4XNHC 2GANA 2C27A 4NSQA 2WPXA 1ON0A 1M4GA 1LRZA 3JUWA 3D2MA 4AG9A 2ZW4A 1NE9A 5EC4A 5J8FA 3R95A 4XPKA 1XMTA 1IIDA 4RI1A 2Y0MA 2OZHA 1KZFA 1XEBA 3R1KA 4MBUA 3C26A 3FRMA 4AVAA 4UWIA 2Q44A 4KOTA 1YGHA 3TT2A 3GY9A 1QSMA 4OADA 3VWDA 4CAVA 3SXOA 3PZJA 3P2FA 1IYLA 3TTHA 2B5GB 5H86A 4JLYA 1VKCA 2G3AA 5GCNA 3FIXA 3W6XA 1L0CA 3R9EA 2ATRA 2PR1A 2Q4VA 1CM0A 2ARHA 2FS5A 4B5PB 2ZW7A 3TE4A 3F5BA 3OWCA 2DXQA 3DNSA 4CS0B 1NSLA 1KUYA 4I49A 3FNCA 4LX9A 1I1DA 4B5OA 1P0HA 2QIRA 1XF8A 3TCVA 2VEZA 1QSTA 1MJBA 2VXKA 4U5YA 1K4JA 3N7ZA 5HMNA 2AJ6A 4F0YA 1OZPA 2R1IA 4L89A 4KOSA 1M44A 4HKFA 1I12A 2PDOA 4E0AA 1S7KA 2J8MA 4NCZA 1R57A 3RYOA 2JDCA 4JXQA 3TO9A 5F46A 4R9MA 2JDDA 4KOYA 2JEVA 1YVKA 4II9A 3PP9A 2PC1A 3BLNA 4H89A 1IB1E 3DR6A 5IB0A 4MJ8A 1Z4RA 2JLMA 1NMTA 2AE6A 4F6AA 3KKWA 1S60A 5FVJA 4RS2A 3D8PA 4JJXA 5HH1A 4MY3A 3EFAA 1Z9UA 4QBJA 3G3SA 2Q7BA 3NE7A 1U6MA 3CXSA 4ZBGA 4KORA 5F49A 4XPLA 5JPHA 5CNPA 3FBUA 3JVNA 1BO4A 2F5IA 4Y49B 2P6EA 3R9FA 3PGPA 4KVXA 3G8WA 4ORFA 4QUSA 2B3UA 3UY5A 4B5PA 2FE7A 4OLLA 2FIAA 4UA3A 3TOBA 1PUAA 4XPDC 1QSNA 4KUAA 2Z10A 2BEIA 2Q4YA 4BMHA 1V0CA 2FL4A 2OB0A 4AVBA 5KTDA 2I79A 1Q2YA 1VHSA 2B58A 3BJ8A 2ZW5A 5I0CA 4Y49C 4CRYB 4YRHA 2B4BA 3SHPA 2Z0ZA 2R8VA 3K9UA 4K30A 2WPWA 1M4IA 5IX3A 3S6FA 5C88A 4U9ZA 1MJAA 3TFYA 3V8IA 1J4JA 2VZYA 5EBVA 4IUSA 1CJWA 2QECA 1S7NA 1WK4A 5C82A 2PQ8A 1Y7RA 3S6HA 4ONUA 4KOXA 3MGDA 2GIVA 1Y9KA 3W6SA 4HNXB 2CNSA 2EVNA 2HV2A 1KUXA 3IGRA 5F48A 4NEXA 1S3ZA 3E0KA 1IYKA 4QB9A 4AG7A 4DNCA 4PK3A 2X7BA 2HQYA 2OU2A 2ZW6A 2CY2A 5KTAA 2PR8A 2REFA 2FCKA 1B87A 3I9SA 1RO5A 4KOWA 2O28A 2PSWA 3IWGA 3R9GA 2BSWA 3I3GA 2BL1A 4JWPA 4R3LA 1PU9A 1S7LA 1I21A 1QSOA 3DDDA 1WWZA 1MJ9A 2J8RA 1YK3A 3QAHA 5DWNA 3D2PA 2CNMA 4JXRA 4XNHB 3WR7A 1N71A 4FD5A 3BJ7A 2R7HA 1Q2CA 2B5GA 2IL4A 5ISVA 2B3VA 2Q0YA 2Z11A 4AB7A 4AVCA 5E96A 1XE4A 3FYNA 4YFJA 3ZJ0A 4HNYB 1S5KA 4JD6A 3T90A 4LUAA 3EO4A 4PSWA 3SXNA 3TOAA 1FY7A 4E2AA 1TIQA 1SQHA 2G3TA 2VZZA 4GS4A 3D3SA 5KTCA 4MY0A 4PSXA 2P0WA 2I00A 4PV6A 3B8GA 3GKRA 4R57A 1IICA 4HNWB 4NF1A 2OZUA 4X5KA 4QC6A 3W91A 2CNTA 1XIXA
chains in the Genus database with same CATH superfamily
4A2ZA 2PRQA 4R87A 2Q04A 3TO7A 3PRTA 2C6GA 2ZOFA 4NFRA 4UFXA 1CBXA 3B35A 4K3NA 3H4QA 3DLJA 5D8NA 5A27A 2ZPAA 2Z3LA 4KOUA 1CPXA 3CXPA 4GXHA 4FWUA 4FAIA 4UBRA 2ODFA 3S6KA 4MI4A 3SI0A 2ABZA 2AFOA 4G1PA 4KVOE 3EY5A 1R43A 2P6FA 3R96A 2HC9A 2G9DA 3I1UA 3B7IA 4P4IA 2EO8A 5JQ4A 3S6GA 1YREA 4C2YA 3P2HA 4A33A 4EVYA 1Z5RA 2B4DB 3S9LA 5K8PA 3NE8A 4P45A 2PJ2A 4CAXA 1F57A 2C6PA 3S9NA 2ZEEA 4ZY1A 4UIAA 4P10A 4UFWA 4BINA 2DEAA 4CAFA 1S7FA 4UWJA 2AFUA 2R98A 4HPSA 1JWQA 3NFZA 3GYAA 4KLVA 4P4FA 5LYIA 1F2OA 4NXYA 4A94A 2VQYA 3PFEA 4PK2A 2Q43A 2REEA 8CPAA 5HVGA 4C2XA 5LYLA 3NH4A 3DSBA 1XFOA 1YR0A 2G0BA 3D7FA 2C1CA 1B6BA 1YLEA 2Q51A 1VGYA 2GE3A 2J9AA 3DR8A 2H5MA 2CTCA 2VI7A 2HUZA 3D7HA 1YX0A 4RN7A 2PRBA 2QYVA 4R7MA 3H8FA 4UCNA 2P6GA 4L8AA 4R3KA 4F8ZA 4FD4A 1HDQA 5DWMA 3FB3A 2FXFA 4CGLA 2V8HA 2CF4A 2ZXVA 3ZZIA 4OIWA 2FSRA 4B6ZA 5K8NA 1RXTA 2QMLA 2YNCC 2NYQA 5F47A 3EXNA 3T9YA 4MFLA 3WABA 1H8LA 3JRUA 5H84A 1LCPA 3FMCA 3IO1A 4FD7A 4A37A 2FIWA 2BUEA 3EC4A 2KCWA 3LD2A 4KUBA 5J8CA 4M85A 1YMEA 1Q2DA 4UCMA 2OZGA 2D4PA 3ISZA 4Q7AA 3LWUA 4F9VA 1YVOA 4UF4A 3TO6A 4H6UA 3LODA 1M1DA 1ELMP 4MCRA 1VHEA 3PB6X 1Z4EA 2EK8A 1P4NA 2O53A 3F0AA 4MHDA 4E8OA 3GUXA 4JYWA 4R6TA 2V8GA 2D4OA 4NGQA 5IV0A 2RC4A 5THWA 3D7DA 1JQGA 1TKHA 2VBQA 1Z8WA 4X3RA 4FD6A 4U9YA 4CAWA 4CRZB 2PJ5A 2IQ6A 2RFHA 1KUVA 4MHNA 3FVLA 1M4DA 1ARLA 2NMTA 2FT0A 3KR4A 3RO0A 4B10A 1IOFA 3H8GA 3QNVA 2J8NA 2ZOGA 2ZENA 1UFHA 4PPZA 5LRGA 4J3GA 2GREA 4IF5A 1Y9WA 4H6ZA 3CPAA 4KVME 2OH1A 1QSRA 2A4NA 4MHPA 1BPNA 3F8KA 3IFEA 2DPSA 2EBJA 4XPDB 5J1QA 4KSIA 4AXVA 4MHZA 4KLWA 1GHEA 2K5TA 3VWEA 3CXQA 4NGNA 3IIBA 4B14A 4QVTA 4EWTA 1BOBA 1MK4A 1ZLIA 4OAEA 5HXDA 4C7HA 4M3SA 4YGOA 4KOVA 3QB8A 4X2TA 3KQZA 1LAMA 2EUIA 4F9UA 2B4DA 3FXTA 3MRUA 4KZTA 4EFDA 1KWMA 3MN8A 4XNHC 3KHZA 2ZELA 2GANA 2PJ9A 2C27A 3CZXA 4PXDA 4NSQA 3KL9A 4ZGYB 2YNCA 1ARMA 2WPXA 1ON0A 4FUUA 4P44A 4R8FA 1M4GA 1LRZA 3JUWA 3D2MA 2NSMA 3KQXA 4AG9A 2ZW4A 3KR5A 4OC4A 3GB0A 1NE9A 2V8VA 2V8DA 4P4JA 2OOTA 4CYOA 4A39A 4NJQA 5EC4A 5J8FA 3R95A 4XPKA 3D66A 1AMPA 4DUKA 3D4UA 1XMTA 3KHXA 5A28A 1IIDA 4RI1A 4ZYQA 1M4LA 2PE3A 2Y0MA 2OZHA 1KZFA 1XEBA 1VHOA 2ZEHA 3R1KA 4MBUA 1PYTB 3C26A 3FRMA 4AVAA 1Y0YA 4UWIA 2GLFA 2Q44A 1BLLE 4CGMA 4KOTA 2PJ4A 1YGHA 4A95A 4TWEA 3TT2A 1BAVA 3PFOA 4NGPA 3GY9A 4C2ZA 1QSMA 4OADA 2AFWA 3VWDA 3SXOA 4CAVA 3PZJA 1DE4C 3WT4A 3P2FA 1IYLA 3TTHA 3D7GA 2B5GB 5H86A 4CGNA 2PCUA 4JLYA 4NGMA 3PB7X 3WC5A 3PB9X 3FEDA 1VKCA 2G3AA 3GIUA 3B3WA 5GCNA 1UWYA 1NSAA 3FIXA 5D29A 3W6XA 5AG7A 2QVPA 1L0CA 3DGVA 2ATRA 3FF3A 2PR1A 2Q4VA 3R9EA 1CM0A 2C6CA 1IOIA 2Q7SA 5HVFA 2ARHA 2FS5A 2PJ3A 4NGRA 2ZW7A 4B5PB 3TE4A 4M6GA 4MXUA 2ANPA 3F5BA 1TF9A 3OWCA 2DXQA 3DNSA 3PBEA 4JZ0A 4CS0B 1NSLA 1KUYA 3NH5A 1ZG7A 1LANA 2POKA 4I49A 3LACA 3FNCA 1Z8LA 1AUGA 4LX9A 1I1DA 2EK9A 4B5OA 4GM5A 1P0HA 1YSJA 1XF8A 2QIRA 3B3CA 3TCVA 2PVVA 2VEZA 1QSTA 5LRJA 5LYDA 4B12A 1Z8TA 1MJBA 2VXKA 3ISXA 1K4JA 4U5YA 3RBUA 3N7ZA 5HMNA 5K8OA 3QAYA 1Z8XA 2AJ6A 3B3SA 5AG6A 2YNEA 4F0YA 1OZPA 3JTKA 3FJUA 2ZEPA 4MFZA 2GFQA 4IHMA 4Q36A 2R1IA 4L89A 4KOSA 1M44A 4HKFA 1I12A 3VH9A 5G1ZA 4NGTA 2PDOA 4A31A 4E0AA 1S7KA 2J8MA 4NCZA 1R57A 2JBKA 4R76A 3VARA 4DYOA 1DTDA 4NGSA 1LOKA 4ZY2A 3TC8A 1CX8A 3RYOA 2JDCA 3IWEA 3FECA 4JXQA 4MFJA 3TO9A 4OMEA 5F46A 4R9MA 2Q4ZA 2WUUA 3N5FA 4UEEA 2JDDA 3IJ3A 3NA6A 4KOYA 2BOAA 3PEIA 4MFQA 2JEVA 4A38A 3FX6A 1YVKA 4IK2A 4II9A 3PP9A 2PC1A 4PXEA 3BLNA 4H89A 1IB1E 3B2YA 3DR6A 4MCSA 5IB0A 4MJ8A 4PXCA 1Z4RA 2JLMA 1NMTA 2AE6A 2PJ0A 3KI9A 3SJFA 4F6AA 4CAEA 3KKWA 1S60A 5FVJA 2CNTA 1LAPA 2ZEOA 4RS2A 3D8PA 4JJXA 4RUHA 3H5ZA 2CXAA 1TKFA 5CPAA 1IGBA 3BXMA 5G21A 3HLPA 5EMIA 5HH1A 3TX8A 4TNUA 4MY3A 7CPAA 3EFAA 1Z9UA 4MRIA 4OP4A 2Z3KA 4QBJA 3G3SA 1GYTA 3NE7A 2Q7BA 5DS0A 1U6MA 3CXSA 1BPMA 4ZBGA 4KORA 4A32A 1F2PA 3KZWA 1CPSA 5F49A 4XPLA 2IMOA 5JPHA 1ZG9A 2ZEFA 5F09A 5CNPA 3FBUA 4P4BA 3JVNA 4WWVA 4PQAA 1BO4A 1XMBA 3CDXA 5I4MA 1YW4A 2F5IA 2AFXA 1X10A 4Y49B 5AG5A 3SI2A 2P6EA 4WJBA 3R9FA 5G22A 2Z3MA 2Z3OA 1YQEA 3PGPA 3NH8A 3B3TA 4KVXA 3G8WA 4ORFA 4CGOA 3L2NA 4QUSA 3IEHA 2PIYA 2B3UA 1HDUA 3UY5A 2Z3PA 2AFMA 2FE7A 4O23A 4OLLA 2FIAA 4UA3A 4B5PA 2PIZA 4F0XA 2XEGA 4OC0A 3TOBA 1PUAA 3CT9A 4XPDC 2V77A 4BD9A 1QSNA 4CPAA 1Y0RA 2WSAA 4LQ6A 4KUAA 2BCOA 1IU8A 2BEIA 2Q4YA 2Z10A 4BMHA 1V0CA 2FL4A 2OB0A 3PB4X 3RZAA 4AVBA 5JH9A 1R3NA 1ZO0A 5IB9A 4ZX8A 1VIXA 4MMOA 2I79A 5KTDA 2FVGA 3PBBA 1Q2YA 1VHSA 2B58A 4M6HA 2PJCA 3BJ8A 1TKJA 3IWWA 2ZW5A 5I0CA 4LQGA 4Y49C 4CRYB 3K2KA 4YRHA 2B4BA 3SHPA 3RNZA 4MCQA 4P6YA 2YNDA 2Z0ZA 2R8VA 3B3VA 2CIJA 3KGQA 2BO9A 3K9UA 1HEEA 2GLJA 4M6IA 4ZI6A 3IU1A 2RB7A 2DF5A 3RAMA 4KSFA 2WZNA 4MHYA 2F7VA 4K30A 2EWBA 2PJAA 2WPWA 1M4IA 3FH4A 3CPXA 4H2KA 5IX3A 3BI0A 3S6FA 4P4DA 5C88A 2ZEMA 4Z65A 1EE3P 4U9ZA 1MJAA 1TXRA 4B11A 3TFYA 3A9LA 3HUVA 3V8IA 4IAVA 1J4JA 2VZYA 3WC6A 3H8EA 2QJ8A 5EBVA 4IUSA 4PXBA 3SJXA 1QQ9A 1CJWA 2QECA 1XJOA 3BHXA 1S7NA 1WK4A 1XOVA 2PQ8A 5C82A 4UEFA 1OBRA 1XBUA 1Y7RA 2PJ7A 4ONUA 3S6HA 3LMSA 4KOXA 3V38A 4BBHA 3MGDA 1LFWA 2GIVA 2YGWA 2PVWA 1Y7EA 1AYEA 1Y9KA 3W6SA 4ZX9A 5ELYA 4MFKA 4HNXB 2CNSA 3FEEA 4ONWA 5BWAB 1QMUA 4YWYA 2EVNA 2HV2A 3S9MA 1YLOA 4OC5A 1A2ZA 1KUXA 3BI1A 4CGPA 3IGRA 5F48A 2PJ8A 4NEXA 1TF8A 4X8IA 1S3ZA 3E0KA 1IYKA 4OC3A 4QB9A 1Z2LA 3SJEA 4Q38A 4AG7A 4DNCA 4YU9A 4PK3A 4OIDA 1ZG8A 4UIBA 5HVHA 4FBEA 2X7BA 4KS9A 5G20A 3D67A 2HQYA 3SI1A 2OU2A 2XEFA 2ZW6A 2PJBA 2CY2A 1RTQA 2WYRA 2Z3NA 4OC2A 5KTAA 2PR8A 2REFA 4C7IA 2JBJA 2FCKA 1B87A 2GU2A 3I9SA 4DJLA 1RO5A 4CYNA 2IJZA 3PB8X 4KOWA 2O28A 2PSWA 1ELLP 3IWGA 5CBMA 3R9GA 2BSWA 1PCAA 3WC7A 1FT7A 3IC1A 2I3CA 3D68A 3I3GA 3IU2A 1X12A 2BL1A 4JWPA 5AGEA 2CTBA 5LYFA 4R3LA 4UEZA 1PU9A 1S7LA 4UFVA 4B13A 1I21A 1QSOA 4MCPA 3DDDA 4W9YA 3KASA 1WWZA 1MJ9A 2J8RA 1YK3A 3QAHA 4UCPA 1CP6A 5DWNA 3SJGA 1FNOA 1ZLHA 4CYQA 3D2PA 2CNMA 4OC1A 2VL1A 4JXRA 4XNHB 3WR7A 1N71A 4NJRA 5JGFA 2PJ1A 4FD5A 3BJ7A 2R7HA 1Q2CA 2B5GA 3V7ZA 2IL4A 4C68A 4P4EA 3VATA 5ISVA 4ZY0A 2B3VA 2Q0YA 2Z11A 4AB7A 4AVCA 3T8WA 5K8MA 5E96A 1XE4A 3FYNA 1YW6A 3ZJ0A 4YFJA 4EMEA 4HNYB 3K9TA 1IY7A 1Q7LA 1S5KA 2AFSA 4JD6A 3T90A 4LUAA 4KSAA 3EO4A 4PSWA 3SXNA 3TOAA 1FY7A 4E2AA 1TIQA 1SQHA 2DPTA 6CPAA 2G3TA 1CG2A 2VZZA 2XEJA 4GS4A 3D3SA 2ZEGA 4MFPA 5KTCA 4MY0A 2XEIA 4PSXA 2P0WA 2PJ6A 2I00A 4OKOA 4PV6A 4CYPA 5LRKA 3B8GA 3GKRA 4R57A 1IICA 4HNWB 4NF1A 1XRYA 2OZUA 2HB6A 5JM6A 2AFZA 4X5KA 2OR4A 1CP7A 2JEWA 2O4HA 3GLJA 4QC6A 4A30A 3W91A 2F8HA 5AG4A 2ZEDA 1XIXA
chains in the Genus database with same CATH topology
4A2ZA 4R87A 2Q04A 3TO7A 4UFXA 3H4QA 5A27A 2ZPAA 2Z3LA 4KOUA 3CXPA 4UBRA 3S6KA 4MI4A 4KVOE 3EY5A 2P6FA 3R96A 5JQ4A 3S6GA 1YREA 4C2YA 3P2HA 4A33A 4EVYA 2B4DB 4CAXA 4UFWA 4CAFA 1S7FA 4UWJA 2R98A 3GYAA 4KLVA 4NXYA 2VQYA 4PK2A 2REEA 4C2XA 3DSBA 1YR0A 2G0BA 1B6BA 1YLEA 2GE3A 3DR8A 2H5MA 2VI7A 2HUZA 1YX0A 2PRBA 4UCNA 2P6GA 4L8AA 4R3KA 4FD4A 5DWMA 3FB3A 2FXFA 4CGLA 2ZXVA 3ZZIA 2FSRA 1RXTA 2QMLA 2YNCC 5F47A 3EXNA 3T9YA 4MFLA 5H84A 4FD7A 2FIWA 3LD2A 2BUEA 3EC4A 2KCWA 4KUBA 5J8CA 4M85A 1Q2DA 4UCMA 2OZGA 2D4PA 1YVOA 3TO6A 4H6UA 3LODA 1M1DA 1Z4EA 1P4NA 3F0AA 4MHDA 4E8OA 2D4OA 5IV0A 2RC4A 2VBQA 4FD6A 4U9YA 4CAWA 4CRZB 1KUVA 1M4DA 2NMTA 2FT0A 4B10A 2J8NA 1UFHA 4J3GA 4IF5A 1Y9WA 4H6ZA 4KVME 2OH1A 1QSRA 2A4NA 3F8KA 2DPSA 4XPDB 4KLWA 1GHEA 2K5TA 3VWEA 3CXQA 4B14A 4QVTA 1BOBA 1MK4A 4OAEA 4C7HA 4M3SA 4YGOA 4KOVA 3QB8A 2EUIA 2B4DA 3FXTA 4KZTA 4XNHC 2GANA 2C27A 4NSQA 4ZGYB 2YNCA 2WPXA 1ON0A 1M4GA 1LRZA 3JUWA 3D2MA 4AG9A 2ZW4A 1NE9A 4CYOA 5EC4A 5J8FA 3R95A 4XPKA 1XMTA 5A28A 1IIDA 4RI1A 2Y0MA 2OZHA 1KZFA 1XEBA 3R1KA 4MBUA 3C26A 3FRMA 4AVAA 4UWIA 4CGMA 2Q44A 4KOTA 1YGHA 4A95A 3TT2A 3GY9A 4C2ZA 1QSMA 4OADA 3VWDA 4CAVA 3SXOA 3PZJA 3P2FA 1IYLA 3TTHA 2B5GB 5H86A 4CGNA 4JLYA 1VKCA 2G3AA 5GCNA 3FIXA 3W6XA 5AG7A 1L0CA 3R9EA 2ATRA 2PR1A 2Q4VA 1CM0A 2ARHA 2FS5A 4B5PB 2ZW7A 3TE4A 3F5BA 3OWCA 2DXQA 3DNSA 4CS0B 1NSLA 1KUYA 4I49A 3FNCA 4LX9A 1I1DA 4B5OA 1P0HA 2QIRA 1XF8A 3TCVA 2VEZA 1QSTA 4B12A 1MJBA 2VXKA 4U5YA 1K4JA 3N7ZA 5HMNA 2AJ6A 5AG6A 2YNEA 4F0YA 1OZPA 3JTKA 4MFZA 4Q36A 2R1IA 4L89A 4KOSA 1M44A 4HKFA 1I12A 5G1ZA 2PDOA 4A31A 4E0AA 1S7KA 2J8MA 4NCZA 1R57A 3RYOA 2JDCA 3IWEA 4JXQA 4MFJA 3TO9A 5F46A 4R9MA 2WUUA 2JDDA 4KOYA 4MFQA 2JEVA 1YVKA 4II9A 3PP9A 2PC1A 3BLNA 4H89A 1IB1E 3DR6A 5IB0A 4MJ8A 1Z4RA 2JLMA 1NMTA 2AE6A 4F6AA 4CAEA 3KKWA 1S60A 5FVJA 4RS2A 3D8PA 4JJXA 3H5ZA 2CXAA 5G21A 5HH1A 4MY3A 3EFAA 1Z9UA 2Z3KA 4QBJA 3G3SA 2Q7BA 3NE7A 1U6MA 3CXSA 4ZBGA 4KORA 4A32A 5F49A 4XPLA 5JPHA 5CNPA 3FBUA 3JVNA 1BO4A 2F5IA 5AG5A 4Y49B 2P6EA 3R9FA 5G22A 2Z3MA 2Z3OA 3PGPA 4KVXA 3G8WA 4ORFA 4CGOA 4QUSA 2B3UA 3UY5A 2Z3PA 4B5PA 2FE7A 4F0XA 4OLLA 2FIAA 4UA3A 3TOBA 1PUAA 4XPDC 1QSNA 2WSAA 4KUAA 2Z10A 2BEIA 2Q4YA 4BMHA 1V0CA 2FL4A 2OB0A 4AVBA 1ZO0A 5KTDA 2I79A 1Q2YA 1VHSA 2B58A 3BJ8A 2ZW5A 5I0CA 4Y49C 4CRYB 4YRHA 2B4BA 3SHPA 2YNDA 2Z0ZA 2R8VA 3K9UA 3IU1A 4KSFA 4K30A 2WPWA 1M4IA 5IX3A 3S6FA 5C88A 4U9ZA 1MJAA 4B11A 3TFYA 3A9LA 3V8IA 1J4JA 2VZYA 5EBVA 4IUSA 1CJWA 2QECA 1S7NA 1WK4A 5C82A 2PQ8A 1Y7RA 3S6HA 4ONUA 4BBHA 4KOXA 3MGDA 2GIVA 2YGWA 1Y9KA 3W6SA 4MFKA 4HNXB 2CNSA 5BWAB 2EVNA 2HV2A 4CGPA 1KUXA 3IGRA 5F48A 4NEXA 1S3ZA 3E0KA 1IYKA 4QB9A 4AG7A 4Q38A 4DNCA 4PK3A 2X7BA 4KS9A 5G20A 2HQYA 2OU2A 2ZW6A 2CY2A 2Z3NA 5KTAA 2PR8A 2REFA 4C7IA 2FCKA 1B87A 3I9SA 1RO5A 4CYNA 4KOWA 2O28A 2PSWA 3IWGA 3R9GA 2BSWA 3I3GA 3IU2A 2BL1A 4JWPA 5AGEA 4R3LA 1PU9A 1S7LA 4UFVA 4B13A 1I21A 1QSOA 3DDDA 1WWZA 1MJ9A 2J8RA 1YK3A 3QAHA 4UCPA 5DWNA 4CYQA 3D2PA 2CNMA 4JXRA 4XNHB 3WR7A 1N71A 4FD5A 3BJ7A 2R7HA 1Q2CA 2B5GA 2IL4A 4C68A 5ISVA 2B3VA 2Q0YA 2Z11A 4AB7A 4AVCA 5E96A 1XE4A 3FYNA 4YFJA 3ZJ0A 4HNYB 1S5KA 4JD6A 3T90A 4LUAA 4KSAA 3EO4A 4PSWA 3SXNA 3TOAA 1FY7A 4E2AA 1TIQA 1SQHA 2DPTA 2G3TA 2VZZA 4GS4A 3D3SA 4MFPA 5KTCA 4MY0A 4PSXA 2P0WA 2I00A 4PV6A 4CYPA 3B8GA 3GKRA 4R57A 1IICA 4HNWB 4NF1A 2OZUA 4X5KA 4QC6A 4A30A 3W91A 2CNTA 5AG4A 1XIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R87 A;  2Q04 A;  3TO7 A;  3H4Q A;  2ZPA A;  4KOU A;  3CXP A;  4UBR A;  3S6K A;  4MI4 A;  4KVO E;  3EY5 A;  2P6F A;  3R96 A;  5JQ4 A;  3S6G A;  1YRE A;  4EVY A;  3P2H A;  2B4D B;  4CAX A;  1S7F A;  4UWJ A;  2R98 A;  3GYA A;  4KLV A;  4NXY A;  2VQY A;  4PK2 A;  2REE A;  3DSB A;  1YR0 A;  2G0B A;  1B6B A;  1YLE A;  2GE3 A;  3DR8 A;  2H5M A;  2VI7 A;  2HUZ A;  1YX0 A;  2PRB A;  2P6G A;  4L8A A;  4R3K A;  4FD4 A;  5DWM A;  3FB3 A;  2FXF A;  2ZXV A;  3ZZI A;  2FSR A;  1RXT A;  2QML A;  5F47 A;  3EXN A;  3T9Y A;  5H84 A;  4FD7 A;  2FIW A;  3LD2 A;  4KUB A;  2BUE A;  3EC4 A;  2KCW A;  5J8C A;  4M85 A;  1Q2D A;  2OZG A;  2D4P A;  1YVO A;  3TO6 A;  4H6U A;  3LOD A;  1M1D A;  1Z4E A;  1P4N A;  3F0A A;  4MHD A;  4E8O A;  2D4O A;  5IV0 A;  2RC4 A;  2VBQ A;  4FD6 A;  4U9Y A;  4CAW A;  4CRZ B;  1KUV A;  1M4D A;  2NMT A;  2FT0 A;  2J8N A;  1UFH A;  4J3G A;  4IF5 A;  1Y9W A;  4H6Z A;  4KVM E;  2OH1 A;  1QSR A;  2A4N A;  3F8K A;  4XPD B;  4KLW A;  1GHE A;  2K5T A;  3VWE A;  3CXQ A;  4QVT A;  1BOB A;  1MK4 A;  4OAE A;  4M3S A;  4YGO A;  4KOV A;  3QB8 A;  2EUI A;  2B4D A;  3FXT A;  4KZT A;  4XNH C;  2GAN A;  2C27 A;  4NSQ A;  2WPX A;  1ON0 A;  1M4G A;  1LRZ A;  3JUW A;  3D2M A;  4AG9 A;  2ZW4 A;  1NE9 A;  5EC4 A;  5J8F A;  3R95 A;  4XPK A;  1XMT A;  1IID A;  4RI1 A;  2Y0M A;  2OZH A;  1KZF A;  1XEB A;  3R1K A;  4MBU A;  3C26 A;  3FRM A;  4AVA A;  4UWI A;  2Q44 A;  4KOT A;  1YGH A;  3TT2 A;  3GY9 A;  1QSM A;  4OAD A;  3VWD A;  4CAV A;  3SXO A;  3PZJ A;  3P2F A;  1IYL A;  3TTH A;  2B5G B;  5H86 A;  4JLY A;  1VKC A;  2G3A A;  5GCN A;  3FIX A;  3W6X A;  1L0C A;  3R9E A;  2ATR A;  2PR1 A;  2Q4V A;  1CM0 A;  2ARH A;  2FS5 A;  4B5P B;  2ZW7 A;  3TE4 A;  3F5B A;  3OWC A;  2DXQ A;  3DNS A;  4CS0 B;  1NSL A;  1KUY A;  4I49 A;  3FNC A;  4LX9 A;  1I1D A;  4B5O A;  1P0H A;  2QIR A;  1XF8 A;  3TCV A;  2VEZ A;  1QST A;  1MJB A;  2VXK A;  4U5Y A;  1K4J A;  3N7Z A;  5HMN A;  2AJ6 A;  4F0Y A;  1OZP A;  2R1I A;  4L89 A;  4KOS A;  1M44 A;  4HKF A;  1I12 A;  2PDO A;  4E0A A;  1S7K A;  2J8M A;  4NCZ A;  1R57 A;  3RYO A;  2JDC A;  4JXQ A;  3TO9 A;  5F46 A;  4R9M A;  2JDD A;  4KOY A;  2JEV A;  1YVK A;  4II9 A;  3PP9 A;  2PC1 A;  3BLN A;  4H89 A;  1IB1 E;  3DR6 A;  5IB0 A;  4MJ8 A;  1Z4R A;  2JLM A;  1NMT A;  2AE6 A;  4F6A A;  3KKW A;  1S60 A;  5FVJ A;  4RS2 A;  3D8P A;  4JJX A;  5HH1 A;  4MY3 A;  3EFA A;  1Z9U A;  4QBJ A;  3G3S A;  2Q7B A;  3NE7 A;  1U6M A;  3CXS A;  4ZBG A;  4KOR A;  5F49 A;  4XPL A;  5JPH A;  5CNP A;  3FBU A;  3JVN A;  1BO4 A;  2F5I A;  4Y49 B;  2P6E A;  3R9F A;  3PGP A;  4KVX A;  3G8W A;  4ORF A;  4QUS A;  2B3U A;  3UY5 A;  4B5P A;  2FE7 A;  4OLL A;  2FIA A;  4UA3 A;  3TOB A;  1PUA A;  4XPD C;  1QSN A;  4KUA A;  2Z10 A;  2BEI A;  2Q4Y A;  4BMH A;  1V0C A;  2FL4 A;  2OB0 A;  4AVB A;  5KTD A;  2I79 A;  1Q2Y A;  1VHS A;  2B58 A;  3BJ8 A;  2ZW5 A;  5I0C A;  4Y49 C;  4CRY B;  4YRH A;  2B4B A;  3SHP A;  2Z0Z A;  2R8V A;  3K9U A;  4K30 A;  2WPW A;  1M4I A;  5IX3 A;  3S6F A;  5C88 A;  4U9Z A;  1MJA A;  3TFY A;  3V8I A;  1J4J A;  2VZY A;  5EBV A;  4IUS A;  1CJW A;  2QEC A;  1S7N A;  1WK4 A;  5C82 A;  2PQ8 A;  1Y7R A;  3S6H A;  4ONU A;  4KOX A;  3MGD A;  2GIV A;  1Y9K A;  3W6S A;  4HNX B;  2CNS A;  2EVN A;  2HV2 A;  1KUX A;  3IGR A;  5F48 A;  4NEX A;  1S3Z A;  3E0K A;  1IYK A;  4QB9 A;  4AG7 A;  4DNC A;  4PK3 A;  2X7B A;  2HQY A;  2OU2 A;  2ZW6 A;  2CY2 A;  5KTA A;  2PR8 A;  2REF A;  2FCK A;  1B87 A;  3I9S A;  1RO5 A;  4KOW A;  2O28 A;  2PSW A;  3IWG A;  3R9G A;  2BSW A;  3I3G A;  2BL1 A;  4JWP A;  4R3L A;  1PU9 A;  1S7L A;  1I21 A;  1QSO A;  3DDD A;  1WWZ A;  1MJ9 A;  2J8R A;  1YK3 A;  3QAH A;  5DWN A;  3D2P A;  2CNM A;  4JXR A;  4XNH B;  3WR7 A;  1N71 A;  4FD5 A;  3BJ7 A;  2R7H A;  1Q2C A;  2B5G A;  2IL4 A;  5ISV A;  2B3V A;  2Q0Y A;  2Z11 A;  4AB7 A;  4AVC A;  5E96 A;  1XE4 A;  3FYN A;  4YFJ A;  3ZJ0 A;  4HNY B;  1S5K A;  4JD6 A;  3T90 A;  4LUA A;  3EO4 A;  4PSW A;  3SXN A;  3TOA A;  1FY7 A;  4E2A A;  1TIQ A;  1SQH A;  2G3T A;  2VZZ A;  4GS4 A;  3D3S A;  5KTC A;  4MY0 A;  4PSX A;  2P0W A;  2I00 A;  4PV6 A;  3B8G A;  3GKR A;  4R57 A;  1IIC A;  4HNW B;  4NF1 A;  2OZU A;  4X5K A;  4QC6 A;  3W91 A;  2CNT A;  1XIX A; 
#chains in the Genus database with same CATH topology
 4A2Z A;  2PRQ A;  4R87 A;  2Q04 A;  3TO7 A;  3PRT A;  2C6G A;  2ZOF A;  4NFR A;  4UFX A;  1CBX A;  3B35 A;  4K3N A;  3H4Q A;  3DLJ A;  5D8N A;  5A27 A;  2ZPA A;  2Z3L A;  4KOU A;  1CPX A;  3CXP A;  4GXH A;  4FWU A;  4FAI A;  4UBR A;  2ODF A;  3S6K A;  4MI4 A;  3SI0 A;  2ABZ A;  2AFO A;  4G1P A;  4KVO E;  3EY5 A;  1R43 A;  2P6F A;  3R96 A;  2HC9 A;  2G9D A;  3I1U A;  3B7I A;  4P4I A;  2EO8 A;  5JQ4 A;  3S6G A;  1YRE A;  4C2Y A;  3P2H A;  4A33 A;  4EVY A;  1Z5R A;  2B4D B;  3S9L A;  5K8P A;  3NE8 A;  4P45 A;  2PJ2 A;  4CAX A;  1F57 A;  2C6P A;  3S9N A;  2ZEE A;  4ZY1 A;  4UIA A;  4P10 A;  4UFW A;  4BIN A;  2DEA A;  4CAF A;  1S7F A;  4UWJ A;  2AFU A;  2R98 A;  4HPS A;  1JWQ A;  3NFZ A;  3GYA A;  4KLV A;  4P4F A;  5LYI A;  1F2O A;  4NXY A;  4A94 A;  2VQY A;  3PFE A;  4PK2 A;  2Q43 A;  2REE A;  8CPA A;  5HVG A;  4C2X A;  5LYL A;  3NH4 A;  3DSB A;  1XFO A;  1YR0 A;  2G0B A;  3D7F A;  2C1C A;  1B6B A;  1YLE A;  2Q51 A;  1VGY A;  2GE3 A;  2J9A A;  3DR8 A;  2H5M A;  2CTC A;  2VI7 A;  2HUZ A;  3D7H A;  1YX0 A;  4RN7 A;  2PRB A;  2QYV A;  4R7M A;  3H8F A;  4UCN A;  2P6G A;  4L8A A;  4R3K A;  4F8Z A;  4FD4 A;  1HDQ A;  5DWM A;  3FB3 A;  2FXF A;  4CGL A;  2V8H A;  2CF4 A;  2ZXV A;  3ZZI A;  4OIW A;  2FSR A;  4B6Z A;  5K8N A;  1RXT A;  2QML A;  2YNC C;  2NYQ A;  5F47 A;  3EXN A;  3T9Y A;  4MFL A;  3WAB A;  1H8L A;  3JRU A;  5H84 A;  1LCP A;  3FMC A;  3IO1 A;  4FD7 A;  4A37 A;  2FIW A;  2BUE A;  3EC4 A;  2KCW A;  3LD2 A;  4KUB A;  5J8C A;  4M85 A;  1YME A;  1Q2D A;  4UCM A;  2OZG A;  2D4P A;  3ISZ A;  4Q7A A;  3LWU A;  4F9V A;  1YVO A;  4UF4 A;  3TO6 A;  4H6U A;  3LOD A;  1M1D A;  1ELM P;  4MCR A;  1VHE A;  3PB6 X;  1Z4E A;  2EK8 A;  1P4N A;  2O53 A;  3F0A A;  4MHD A;  4E8O A;  3GUX A;  4JYW A;  4R6T A;  2V8G A;  2D4O A;  4NGQ A;  5IV0 A;  2RC4 A;  5THW A;  3D7D A;  1JQG A;  1TKH A;  2VBQ A;  1Z8W A;  4X3R A;  4FD6 A;  4U9Y A;  4CAW A;  4CRZ B;  2PJ5 A;  2IQ6 A;  2RFH A;  1KUV A;  4MHN A;  3FVL A;  1M4D A;  1ARL A;  2NMT A;  2FT0 A;  3KR4 A;  3RO0 A;  4B10 A;  1IOF A;  3H8G A;  3QNV A;  2J8N A;  2ZOG A;  2ZEN A;  1UFH A;  4PPZ A;  5LRG A;  4J3G A;  2GRE A;  4IF5 A;  1Y9W A;  4H6Z A;  3CPA A;  4KVM E;  2OH1 A;  1QSR A;  2A4N A;  4MHP A;  1BPN A;  3F8K A;  3IFE A;  2DPS A;  2EBJ A;  4XPD B;  5J1Q A;  4KSI A;  4AXV A;  4MHZ A;  4KLW A;  1GHE A;  2K5T A;  3VWE A;  3CXQ A;  4NGN A;  3IIB A;  4B14 A;  4QVT A;  4EWT A;  1BOB A;  1MK4 A;  1ZLI A;  4OAE A;  5HXD A;  4C7H A;  4M3S A;  4YGO A;  4KOV A;  3QB8 A;  4X2T A;  3KQZ A;  1LAM A;  2EUI A;  4F9U A;  2B4D A;  3FXT A;  3MRU A;  4KZT A;  4EFD A;  1KWM A;  3MN8 A;  4XNH C;  3KHZ A;  2ZEL A;  2GAN A;  2PJ9 A;  2C27 A;  3CZX A;  4PXD A;  4NSQ A;  3KL9 A;  4ZGY B;  2YNC A;  1ARM A;  2WPX A;  1ON0 A;  4FUU A;  4P44 A;  4R8F A;  1M4G A;  1LRZ A;  3JUW A;  3D2M A;  2NSM A;  3KQX A;  4AG9 A;  2ZW4 A;  3KR5 A;  4OC4 A;  3GB0 A;  1NE9 A;  2V8V A;  2V8D A;  4P4J A;  2OOT A;  4CYO A;  4A39 A;  4NJQ A;  5EC4 A;  5J8F A;  3R95 A;  4XPK A;  3D66 A;  1AMP A;  4DUK A;  3D4U A;  1XMT A;  3KHX A;  5A28 A;  1IID A;  4RI1 A;  4ZYQ A;  1M4L A;  2PE3 A;  2Y0M A;  2OZH A;  1KZF A;  1XEB A;  1VHO A;  2ZEH A;  3R1K A;  4MBU A;  1PYT B;  3C26 A;  3FRM A;  4AVA A;  1Y0Y A;  4UWI A;  2GLF A;  2Q44 A;  1BLL E;  4CGM A;  4KOT A;  2PJ4 A;  1YGH A;  4A95 A;  4TWE A;  3TT2 A;  1BAV A;  3PFO A;  4NGP A;  3GY9 A;  4C2Z A;  1QSM A;  4OAD A;  2AFW A;  3VWD A;  3SXO A;  4CAV A;  3PZJ A;  1DE4 C;  3WT4 A;  3P2F A;  1IYL A;  3TTH A;  3D7G A;  2B5G B;  5H86 A;  4CGN A;  2PCU A;  4JLY A;  4NGM A;  3PB7 X;  3WC5 A;  3PB9 X;  3FED A;  1VKC A;  2G3A A;  3GIU A;  3B3W A;  5GCN A;  1UWY A;  1NSA A;  3FIX A;  5D29 A;  3W6X A;  5AG7 A;  2QVP A;  1L0C A;  3DGV A;  2ATR A;  3FF3 A;  2PR1 A;  2Q4V A;  3R9E A;  1CM0 A;  2C6C A;  1IOI A;  2Q7S A;  5HVF A;  2ARH A;  2FS5 A;  2PJ3 A;  4NGR A;  2ZW7 A;  4B5P B;  3TE4 A;  4M6G A;  4MXU A;  2ANP A;  3F5B A;  1TF9 A;  3OWC A;  2DXQ A;  3DNS A;  3PBE A;  4JZ0 A;  4CS0 B;  1NSL A;  1KUY A;  3NH5 A;  1ZG7 A;  1LAN A;  2POK A;  4I49 A;  3LAC A;  3FNC A;  1Z8L A;  1AUG A;  4LX9 A;  1I1D A;  2EK9 A;  4B5O A;  4GM5 A;  1P0H A;  1YSJ A;  1XF8 A;  2QIR A;  3B3C A;  3TCV A;  2PVV A;  2VEZ A;  1QST A;  5LRJ A;  5LYD A;  4B12 A;  1Z8T A;  1MJB A;  2VXK A;  3ISX A;  1K4J A;  4U5Y A;  3RBU A;  3N7Z A;  5HMN A;  5K8O A;  3QAY A;  1Z8X A;  2AJ6 A;  3B3S A;  5AG6 A;  2YNE A;  4F0Y A;  1OZP A;  3JTK A;  3FJU A;  2ZEP A;  4MFZ A;  2GFQ A;  4IHM A;  4Q36 A;  2R1I A;  4L89 A;  4KOS A;  1M44 A;  4HKF A;  1I12 A;  3VH9 A;  5G1Z A;  4NGT A;  2PDO A;  4A31 A;  4E0A A;  1S7K A;  2J8M A;  4NCZ A;  1R57 A;  2JBK A;  4R76 A;  3VAR A;  4DYO A;  1DTD A;  4NGS A;  1LOK A;  4ZY2 A;  3TC8 A;  1CX8 A;  3RYO A;  2JDC A;  3IWE A;  3FEC A;  4JXQ A;  4MFJ A;  3TO9 A;  4OME A;  5F46 A;  4R9M A;  2Q4Z A;  2WUU A;  3N5F A;  4UEE A;  2JDD A;  3IJ3 A;  3NA6 A;  4KOY A;  2BOA A;  3PEI A;  4MFQ A;  2JEV A;  4A38 A;  3FX6 A;  1YVK A;  4IK2 A;  4II9 A;  3PP9 A;  2PC1 A;  4PXE A;  3BLN A;  4H89 A;  1IB1 E;  3B2Y A;  3DR6 A;  4MCS A;  5IB0 A;  4MJ8 A;  4PXC A;  1Z4R A;  2JLM A;  1NMT A;  2AE6 A;  2PJ0 A;  3KI9 A;  3SJF A;  4F6A A;  4CAE A;  3KKW A;  1S60 A;  5FVJ A;  2CNT A;  1LAP A;  2ZEO A;  4RS2 A;  3D8P A;  4JJX A;  4RUH A;  3H5Z A;  2CXA A;  1TKF A;  5CPA A;  1IGB A;  3BXM A;  5G21 A;  3HLP A;  5EMI A;  5HH1 A;  3TX8 A;  4TNU A;  4MY3 A;  7CPA A;  3EFA A;  1Z9U A;  4MRI A;  4OP4 A;  2Z3K A;  4QBJ A;  3G3S A;  1GYT A;  3NE7 A;  2Q7B A;  5DS0 A;  1U6M A;  3CXS A;  1BPM A;  4ZBG A;  4KOR A;  4A32 A;  1F2P A;  3KZW A;  1CPS A;  5F49 A;  4XPL A;  2IMO A;  5JPH A;  1ZG9 A;  2ZEF A;  5F09 A;  5CNP A;  3FBU A;  4P4B A;  3JVN A;  4WWV A;  4PQA A;  1BO4 A;  1XMB A;  3CDX A;  5I4M A;  1YW4 A;  2F5I A;  2AFX A;  1X10 A;  4Y49 B;  5AG5 A;  3SI2 A;  2P6E A;  4WJB A;  3R9F A;  5G22 A;  2Z3M A;  2Z3O A;  1YQE A;  3PGP A;  3NH8 A;  3B3T A;  4KVX A;  3G8W A;  4ORF A;  4CGO A;  3L2N A;  4QUS A;  3IEH A;  2PIY A;  2B3U A;  1HDU A;  3UY5 A;  2Z3P A;  2AFM A;  2FE7 A;  4O23 A;  4OLL A;  2FIA A;  4UA3 A;  4B5P A;  2PIZ A;  4F0X A;  2XEG A;  4OC0 A;  3TOB A;  1PUA A;  3CT9 A;  4XPD C;  2V77 A;  4BD9 A;  1QSN A;  4CPA A;  1Y0R A;  2WSA A;  4LQ6 A;  4KUA A;  2BCO A;  1IU8 A;  2BEI A;  2Q4Y A;  2Z10 A;  4BMH A;  1V0C A;  2FL4 A;  2OB0 A;  3PB4 X;  3RZA A;  4AVB A;  5JH9 A;  1R3N A;  1ZO0 A;  5IB9 A;  4ZX8 A;  1VIX A;  4MMO A;  2I79 A;  5KTD A;  2FVG A;  3PBB A;  1Q2Y A;  1VHS A;  2B58 A;  4M6H A;  2PJC A;  3BJ8 A;  1TKJ A;  3IWW A;  2ZW5 A;  5I0C A;  4LQG A;  4Y49 C;  4CRY B;  3K2K A;  4YRH A;  2B4B A;  3SHP A;  3RNZ A;  4MCQ A;  4P6Y A;  2YND A;  2Z0Z A;  2R8V A;  3B3V A;  2CIJ A;  3KGQ A;  2BO9 A;  3K9U A;  1HEE A;  2GLJ A;  4M6I A;  4ZI6 A;  3IU1 A;  2RB7 A;  2DF5 A;  3RAM A;  4KSF A;  2WZN A;  4MHY A;  2F7V A;  4K30 A;  2EWB A;  2PJA A;  2WPW A;  1M4I A;  3FH4 A;  3CPX A;  4H2K A;  5IX3 A;  3BI0 A;  3S6F A;  4P4D A;  5C88 A;  2ZEM A;  4Z65 A;  1EE3 P;  4U9Z A;  1MJA A;  1TXR A;  4B11 A;  3TFY A;  3A9L A;  3HUV A;  3V8I A;  4IAV A;  1J4J A;  2VZY A;  3WC6 A;  3H8E A;  2QJ8 A;  5EBV A;  4IUS A;  4PXB A;  3SJX A;  1QQ9 A;  1CJW A;  2QEC A;  1XJO A;  3BHX A;  1S7N A;  1WK4 A;  1XOV A;  2PQ8 A;  5C82 A;  4UEF A;  1OBR A;  1XBU A;  1Y7R A;  2PJ7 A;  4ONU A;  3S6H A;  3LMS A;  4KOX A;  3V38 A;  4BBH A;  3MGD A;  1LFW A;  2GIV A;  2YGW A;  2PVW A;  1Y7E A;  1AYE A;  1Y9K A;  3W6S A;  4ZX9 A;  5ELY A;  4MFK A;  4HNX B;  2CNS A;  3FEE A;  4ONW A;  5BWA B;  1QMU A;  4YWY A;  2EVN A;  2HV2 A;  3S9M A;  1YLO A;  4OC5 A;  1A2Z A;  1KUX A;  3BI1 A;  4CGP A;  3IGR A;  5F48 A;  2PJ8 A;  4NEX A;  1TF8 A;  4X8I A;  1S3Z A;  3E0K A;  1IYK A;  4OC3 A;  4QB9 A;  1Z2L A;  3SJE A;  4Q38 A;  4AG7 A;  4DNC A;  4YU9 A;  4PK3 A;  4OID A;  1ZG8 A;  4UIB A;  5HVH A;  4FBE A;  2X7B A;  4KS9 A;  5G20 A;  3D67 A;  2HQY A;  3SI1 A;  2OU2 A;  2XEF A;  2ZW6 A;  2PJB A;  2CY2 A;  1RTQ A;  2WYR A;  2Z3N A;  4OC2 A;  5KTA A;  2PR8 A;  2REF A;  4C7I A;  2JBJ A;  2FCK A;  1B87 A;  2GU2 A;  3I9S A;  4DJL A;  1RO5 A;  4CYN A;  2IJZ A;  3PB8 X;  4KOW A;  2O28 A;  2PSW A;  1ELL P;  3IWG A;  5CBM A;  3R9G A;  2BSW A;  1PCA A;  3WC7 A;  1FT7 A;  3IC1 A;  2I3C A;  3D68 A;  3I3G A;  3IU2 A;  1X12 A;  2BL1 A;  4JWP A;  5AGE A;  2CTB A;  5LYF A;  4R3L A;  4UEZ A;  1PU9 A;  1S7L A;  4UFV A;  4B13 A;  1I21 A;  1QSO A;  4MCP A;  3DDD A;  4W9Y A;  3KAS A;  1WWZ A;  1MJ9 A;  2J8R A;  1YK3 A;  3QAH A;  4UCP A;  1CP6 A;  5DWN A;  3SJG A;  1FNO A;  1ZLH A;  4CYQ A;  3D2P A;  2CNM A;  4OC1 A;  2VL1 A;  4JXR A;  4XNH B;  3WR7 A;  1N71 A;  4NJR A;  5JGF A;  2PJ1 A;  4FD5 A;  3BJ7 A;  2R7H A;  1Q2C A;  2B5G A;  3V7Z A;  2IL4 A;  4C68 A;  4P4E A;  3VAT A;  5ISV A;  4ZY0 A;  2B3V A;  2Q0Y A;  2Z11 A;  4AB7 A;  4AVC A;  3T8W A;  5K8M A;  5E96 A;  1XE4 A;  3FYN A;  1YW6 A;  3ZJ0 A;  4YFJ A;  4EME A;  4HNY B;  3K9T A;  1IY7 A;  1Q7L A;  1S5K A;  2AFS A;  4JD6 A;  3T90 A;  4LUA A;  4KSA A;  3EO4 A;  4PSW A;  3SXN A;  3TOA A;  1FY7 A;  4E2A A;  1TIQ A;  1SQH A;  2DPT A;  6CPA A;  2G3T A;  1CG2 A;  2VZZ A;  2XEJ A;  4GS4 A;  3D3S A;  2ZEG A;  4MFP A;  5KTC A;  4MY0 A;  2XEI A;  4PSX A;  2P0W A;  2PJ6 A;  2I00 A;  4OKO A;  4PV6 A;  4CYP A;  5LRK A;  3B8G A;  3GKR A;  4R57 A;  1IIC A;  4HNW B;  4NF1 A;  1XRY A;  2OZU A;  2HB6 A;  5JM6 A;  2AFZ A;  4X5K A;  2OR4 A;  1CP7 A;  2JEW A;  2O4H A;  3GLJ A;  4QC6 A;  4A30 A;  3W91 A;  2F8H A;  5AG4 A;  2ZED A;  1XIX A; 
#chains in the Genus database with same CATH homology
 4A2Z A;  4R87 A;  2Q04 A;  3TO7 A;  4UFX A;  3H4Q A;  5A27 A;  2ZPA A;  2Z3L A;  4KOU A;  3CXP A;  4UBR A;  3S6K A;  4MI4 A;  4KVO E;  3EY5 A;  2P6F A;  3R96 A;  5JQ4 A;  3S6G A;  1YRE A;  4C2Y A;  3P2H A;  4A33 A;  4EVY A;  2B4D B;  4CAX A;  4UFW A;  4CAF A;  1S7F A;  4UWJ A;  2R98 A;  3GYA A;  4KLV A;  4NXY A;  2VQY A;  4PK2 A;  2REE A;  4C2X A;  3DSB A;  1YR0 A;  2G0B A;  1B6B A;  1YLE A;  2GE3 A;  3DR8 A;  2H5M A;  2VI7 A;  2HUZ A;  1YX0 A;  2PRB A;  4UCN A;  2P6G A;  4L8A A;  4R3K A;  4FD4 A;  5DWM A;  3FB3 A;  2FXF A;  4CGL A;  2ZXV A;  3ZZI A;  2FSR A;  1RXT A;  2QML A;  2YNC C;  5F47 A;  3EXN A;  3T9Y A;  4MFL A;  5H84 A;  4FD7 A;  2FIW A;  3LD2 A;  2BUE A;  3EC4 A;  2KCW A;  4KUB A;  5J8C A;  4M85 A;  1Q2D A;  4UCM A;  2OZG A;  2D4P A;  1YVO A;  3TO6 A;  4H6U A;  3LOD A;  1M1D A;  1Z4E A;  1P4N A;  3F0A A;  4MHD A;  4E8O A;  2D4O A;  5IV0 A;  2RC4 A;  2VBQ A;  4FD6 A;  4U9Y A;  4CAW A;  4CRZ B;  1KUV A;  1M4D A;  2NMT A;  2FT0 A;  4B10 A;  2J8N A;  1UFH A;  4J3G A;  4IF5 A;  1Y9W A;  4H6Z A;  4KVM E;  2OH1 A;  1QSR A;  2A4N A;  3F8K A;  2DPS A;  4XPD B;  4KLW A;  1GHE A;  2K5T A;  3VWE A;  3CXQ A;  4B14 A;  4QVT A;  1BOB A;  1MK4 A;  4OAE A;  4C7H A;  4M3S A;  4YGO A;  4KOV A;  3QB8 A;  2EUI A;  2B4D A;  3FXT A;  4KZT A;  4XNH C;  2GAN A;  2C27 A;  4NSQ A;  4ZGY B;  2YNC A;  2WPX A;  1ON0 A;  1M4G A;  1LRZ A;  3JUW A;  3D2M A;  4AG9 A;  2ZW4 A;  1NE9 A;  4CYO A;  5EC4 A;  5J8F A;  3R95 A;  4XPK A;  1XMT A;  5A28 A;  1IID A;  4RI1 A;  2Y0M A;  2OZH A;  1KZF A;  1XEB A;  3R1K A;  4MBU A;  3C26 A;  3FRM A;  4AVA A;  4UWI A;  4CGM A;  2Q44 A;  4KOT A;  1YGH A;  4A95 A;  3TT2 A;  3GY9 A;  4C2Z A;  1QSM A;  4OAD A;  3VWD A;  4CAV A;  3SXO A;  3PZJ A;  3P2F A;  1IYL A;  3TTH A;  2B5G B;  5H86 A;  4CGN A;  4JLY A;  1VKC A;  2G3A A;  5GCN A;  3FIX A;  3W6X A;  5AG7 A;  1L0C A;  3R9E A;  2ATR A;  2PR1 A;  2Q4V A;  1CM0 A;  2ARH A;  2FS5 A;  4B5P B;  2ZW7 A;  3TE4 A;  3F5B A;  3OWC A;  2DXQ A;  3DNS A;  4CS0 B;  1NSL A;  1KUY A;  4I49 A;  3FNC A;  4LX9 A;  1I1D A;  4B5O A;  1P0H A;  2QIR A;  1XF8 A;  3TCV A;  2VEZ A;  1QST A;  4B12 A;  1MJB A;  2VXK A;  4U5Y A;  1K4J A;  3N7Z A;  5HMN A;  2AJ6 A;  5AG6 A;  2YNE A;  4F0Y A;  1OZP A;  3JTK A;  4MFZ A;  4Q36 A;  2R1I A;  4L89 A;  4KOS A;  1M44 A;  4HKF A;  1I12 A;  5G1Z A;  2PDO A;  4A31 A;  4E0A A;  1S7K A;  2J8M A;  4NCZ A;  1R57 A;  3RYO A;  2JDC A;  3IWE A;  4JXQ A;  4MFJ A;  3TO9 A;  5F46 A;  4R9M A;  2WUU A;  2JDD A;  4KOY A;  4MFQ A;  2JEV A;  1YVK A;  4II9 A;  3PP9 A;  2PC1 A;  3BLN A;  4H89 A;  1IB1 E;  3DR6 A;  5IB0 A;  4MJ8 A;  1Z4R A;  2JLM A;  1NMT A;  2AE6 A;  4F6A A;  4CAE A;  3KKW A;  1S60 A;  5FVJ A;  4RS2 A;  3D8P A;  4JJX A;  3H5Z A;  2CXA A;  5G21 A;  5HH1 A;  4MY3 A;  3EFA A;  1Z9U A;  2Z3K A;  4QBJ A;  3G3S A;  2Q7B A;  3NE7 A;  1U6M A;  3CXS A;  4ZBG A;  4KOR A;  4A32 A;  5F49 A;  4XPL A;  5JPH A;  5CNP A;  3FBU A;  3JVN A;  1BO4 A;  2F5I A;  5AG5 A;  4Y49 B;  2P6E A;  3R9F A;  5G22 A;  2Z3M A;  2Z3O A;  3PGP A;  4KVX A;  3G8W A;  4ORF A;  4CGO A;  4QUS A;  2B3U A;  3UY5 A;  2Z3P A;  4B5P A;  2FE7 A;  4F0X A;  4OLL A;  2FIA A;  4UA3 A;  3TOB A;  1PUA A;  4XPD C;  1QSN A;  2WSA A;  4KUA A;  2Z10 A;  2BEI A;  2Q4Y A;  4BMH A;  1V0C A;  2FL4 A;  2OB0 A;  4AVB A;  1ZO0 A;  5KTD A;  2I79 A;  1Q2Y A;  1VHS A;  2B58 A;  3BJ8 A;  2ZW5 A;  5I0C A;  4Y49 C;  4CRY B;  4YRH A;  2B4B A;  3SHP A;  2YND A;  2Z0Z A;  2R8V A;  3K9U A;  3IU1 A;  4KSF A;  4K30 A;  2WPW A;  1M4I A;  5IX3 A;  3S6F A;  5C88 A;  4U9Z A;  1MJA A;  4B11 A;  3TFY A;  3A9L A;  3V8I A;  1J4J A;  2VZY A;  5EBV A;  4IUS A;  1CJW A;  2QEC A;  1S7N A;  1WK4 A;  5C82 A;  2PQ8 A;  1Y7R A;  3S6H A;  4ONU A;  4BBH A;  4KOX A;  3MGD A;  2GIV A;  2YGW A;  1Y9K A;  3W6S A;  4MFK A;  4HNX B;  2CNS A;  5BWA B;  2EVN A;  2HV2 A;  4CGP A;  1KUX A;  3IGR A;  5F48 A;  4NEX A;  1S3Z A;  3E0K A;  1IYK A;  4QB9 A;  4AG7 A;  4Q38 A;  4DNC A;  4PK3 A;  2X7B A;  4KS9 A;  5G20 A;  2HQY A;  2OU2 A;  2ZW6 A;  2CY2 A;  2Z3N A;  5KTA A;  2PR8 A;  2REF A;  4C7I A;  2FCK A;  1B87 A;  3I9S A;  1RO5 A;  4CYN A;  4KOW A;  2O28 A;  2PSW A;  3IWG A;  3R9G A;  2BSW A;  3I3G A;  3IU2 A;  2BL1 A;  4JWP A;  5AGE A;  4R3L A;  1PU9 A;  1S7L A;  4UFV A;  4B13 A;  1I21 A;  1QSO A;  3DDD A;  1WWZ A;  1MJ9 A;  2J8R A;  1YK3 A;  3QAH A;  4UCP A;  5DWN A;  4CYQ A;  3D2P A;  2CNM A;  4JXR A;  4XNH B;  3WR7 A;  1N71 A;  4FD5 A;  3BJ7 A;  2R7H A;  1Q2C A;  2B5G A;  2IL4 A;  4C68 A;  5ISV A;  2B3V A;  2Q0Y A;  2Z11 A;  4AB7 A;  4AVC A;  5E96 A;  1XE4 A;  3FYN A;  4YFJ A;  3ZJ0 A;  4HNY B;  1S5K A;  4JD6 A;  3T90 A;  4LUA A;  4KSA A;  3EO4 A;  4PSW A;  3SXN A;  3TOA A;  1FY7 A;  4E2A A;  1TIQ A;  1SQH A;  2DPT A;  2G3T A;  2VZZ A;  4GS4 A;  3D3S A;  4MFP A;  5KTC A;  4MY0 A;  4PSX A;  2P0W A;  2I00 A;  4PV6 A;  4CYP A;  3B8G A;  3GKR A;  4R57 A;  1IIC A;  4HNW B;  4NF1 A;  2OZU A;  4X5K A;  4QC6 A;  4A30 A;  3W91 A;  2CNT A;  5AG4 A;  1XIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...