2Q7SA

Crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
280
structure length
271
Chain Sequence
IAPFTLALPEGEALPLVCDSPHSGTFYPADFGAVVAPERLRGGEDTHVDALWEAVPRVGGTLLAATFPRVYIDPNRMLDDIDPAQLEGPWPTPLAPGTGLIWSNVDAPIYDRKLTVAEVQRRINRYYRPYHAALTEAVEGAYQRFGAVWHLNLHSMPNNAYERLKIQSPRPLADFVLGDRDGTTCEPGLVDLVERELREKGYTVARNDPYKGQLIAQIGRPAERRNSLQIEIRRPLYMEEGTRERNEGFATLQRDLTLLTLRIAEYVRRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-formylglutamate amidohydrolase
publication title Crystal structure of N-formylglutamate amidohydrolase (YP_297560.1) from Ralstonia eutropha JMP134 at 2.00 A resolution
rcsb
source organism Ralstonia eutropha
total genus 94
structure length 271
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05013 FGase N-formylglutamate amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 2q7sA00
1JWQA 4RN7A 5EMIA 4LQ6A 4M6HA 4M6GA 3QAYA 4M6IA 4BINA 3NE8A 2Q7SA 2ODFA 3CZXA 1XOVA
chains in the Genus database with same CATH superfamily
1M1DA 4MHDA 4CAWA 5IX3A 5LRGA 4HNYB 4BMHA 2REEA 1TKHA 4H6ZA 5C88A 3CXPA 4CPAA 2AFUA 4MY0A 3W91A 3HUVA 2Z3LA 3D2MA 2OZGA 1L0CA 5IV0A 2CXAA 1NE9A 2GIVA 4YWYA 1R43A 4M3SA 5LYIA 3I1UA 4W9YA 3JUWA 5AG4A 1EE3P 3H8GA 4PQAA 5HMNA 4PXEA 1P0HA 4B5PA 3FYNA 2IMOA 1MJ9A 2PIYA 3WR7A 4Y49C 1ON0A 3S6HA 4FAIA 4UEFA 3B3SA 2FCKA 2CTCA 2PJ2A 1B6BA 2ZENA 2ZEOA 3IU1A 3EFAA 3FXTA 4H6UA 2IJZA 3FECA 3FF3A 3GUXA 4OAEA 2J8MA 4FD6A 4P4JA 1XOVA 4AVAA 3EY5A 5K8PA 2CNSA 3RZAA 4NSQA 1JQGA 5JPHA 3B8GA 2YNEA 3S6GA 4C2ZA 4KVXA 2EO8A 3R1KA 1A2ZA 4DNCA 1IGBA 3NH5A 4KOTA 5F47A 4A30A 1TXRA 4JZ0A 3TFYA 3KASA 2V8DA 3FVLA 4R3KA 2G3TA 5KTAA 3P2FA 1S7KA 2CNMA 3IC1A 3ZZIA 4UEEA 1TF8A 3FB3A 5G1ZA 3HLPA 1YVKA 4CGPA 4UBRA 2YGWA 4OIDA 2ZEMA 2PJ6A 1Z8XA 2GE3A 5KTCA 3KHXA 4NGMA 4HNWB 4A2ZA 3DLJA 4MRIA 3N5FA 3KGQA 2CY2A 1YLOA 1Z4RA 2QVPA 4Z65A 5ISVA 1RXTA 5BWAB 2NYQA 3S9MA 3BI0A 3KR4A 5LRKA 1Q2YA 4AG9A 4DYOA 4R8FA 1LAMA 4UWJA 1F57A 3GLJA 3JTKA 4GM5A 4UFVA 2Q4VA 3VARA 4ZY0A 2J8NA 1Q2CA 2JBKA 2PRQA 2EK9A 2RB7A 3IGRA 2PJAA 4YU9A 1QSRA 3TX8A 4P4FA 1TKJA 2VZYA 1KUVA 2EBJA 3BHXA 1Y9KA 3FBUA 1QSTA 1OZPA 2I3CA 4Q38A 2V77A 4R7MA 3B3VA 4GS4A 3PRTA 1X12A 4P10A 2B3VA 4PSXA 2B4DA 4MFPA 4KOYA 3DR8A 2Z3OA 2Q0YA 1B87A 4ONWA 3E0KA 1IIDA 4Y49B 4A94A 4JXRA 2R98A 1VHEA 3SJGA 1YW4A 2V8VA 1Z4EA 5H84A 5EMIA 2OH1A 4R76A 2ZXVA 4QUSA 2BCOA 3V8IA 2ZW6A 3CZXA 2Z0ZA 3FIXA 2HQYA 2JLMA 4CYQA 4F6AA 1QQ9A 3PGPA 4RN7A 1QMUA 4IHMA 4F0YA 3SI2A 4B12A 2RC4A 2PIZA 4MHZA 3F8KA 3TO6A 4LUAA 2AFMA 2GFQA 4BINA 3CXSA 1M44A 2FVGA 2J9AA 2FT0A 2XEJA 4MFKA 4CAXA 2F7VA 8CPAA 1P4NA 4U9ZA 4LQ6A 2DXQA 3TO7A 2KCWA 3H8EA 2VZZA 2YNDA 1IOFA 4B5OA 4HKFA 4OADA 2CIJA 3BXMA 1Z2LA 3N7ZA 1DTDA 2PJCA 2QMLA 3VWDA 2WYRA 4I49A 4C7IA 1GYTA 4PSWA 3B35A 5A28A 2JEVA 3S9LA 2HV2A 2B4DB 5J8FA 1BAVA 2EVNA 4XPLA 2BSWA 2OZUA 4UFWA 2P6GA 3R9EA 4UFXA 3TE4A 1VHSA 3S9NA 2PSWA 3BI1A 4IAVA 1S3ZA 2DPSA 4MHNA 2O53A 4PXDA 4L89A 4U5YA 5CNPA 2FL4A 3I3GA 1Y7EA 2IQ6A 3D8PA 2F5IA 4P4IA 4NGRA 2R1IA 1YX0A 2GLFA 4CYNA 3PB8X 4ZI6A 4A37A 4QBJA 1IU8A 3K2KA 1DE4C 3KZWA 3LWUA 1Z8TA 2AFXA 4MXUA 4MFJA 1HDUA 4KZTA 4CYPA 3CT9A 4P44A 1YSJA 3D68A 3IU2A 2Z3MA 1PYTB 4X8IA 3FEEA 4IF5A 1BPNA 5DWNA 1XIXA 2BL1A 1PUAA 2R7HA 3JVNA 1IB1E 3PB9X 5CBMA 4ZX8A 2J8RA 4OC5A 2NSMA 3D2PA 2DPTA 5JQ4A 4AXVA 3GKRA 2WPXA 3WABA 3NE7A 4X5KA 4XPDC 2Z3NA 5ELYA 5K8MA 3B3TA 3V7ZA 2B3UA 4U9YA 2ABZA 4CAFA 3IWEA 5H86A 4NGNA 4M6HA 2PDOA 4NJQA 2PJ9A 3R95A 3WC6A 4B10A 3K9TA 3CXQA 2POKA 2VQYA 4KOXA 1NSLA 4JXQA 1CG2A 2P0WA 2QECA 2Z3KA 4JYWA 3TT2A 3W6SA 1LOKA 4CS0B 1I12A 3EC4A 4JJXA 2V8HA 2ZEPA 4HNXB 4PK2A 3T8WA 3G3SA 4ZYQA 2WUUA 1XMBA 4UCNA 5C82A 4IUSA 1QSNA 1LANA 1Y7RA 2Q4ZA 1ARLA 4XPKA 1Z8LA 5D8NA 5AGEA 1M4IA 2VI7A 2AFSA 1VGYA 5JM6A 4MCSA 1FNOA 3V38A 3R9FA 5LYFA 2PQ8A 3QAYA 2Q51A 3NE8A 4R9MA 4CAEA 1KZFA 3KHZA 1HEEA 5DS0A 1KWMA 3FNCA 4FBEA 3KQXA 4OC4A 3NFZA 1VIXA 4M6IA 3PFEA 4B5PB 2X7BA 4OC0A 2C27A 1YMEA 1Z8WA 2QYVA 3KI9A 1ZG9A 1ZLIA 3PB4X 1PCAA 4JWPA 2K5TA 5CPAA 3RAMA 4F0XA 1NSAA 3TOAA 2V8GA 3KQZA 3FJUA 1XBUA 1RTQA 1PU9A 1XRYA 2A4NA 5K8NA 3F5BA 5G21A 1XFOA 4CRYB 3MN8A 2B58A 5F46A 3A9LA 4ONUA 3TOBA 4OC1A 4H89A 3NH4A 5AG6A 3TO9A 2B4BA 4MI4A 1I1DA 5G22A 4J3GA 1ZG8A 4DJLA 3T9YA 4G1PA 4L8AA 5DWMA 1IICA 4WWVA 4KORA 3B2YA 3WC5A 3BLNA 2ARHA 4E0AA 3S6KA 4O23A 4P4EA 4UIAA 1HDQA 4KOUA 3QAHA 1BLLE 3KR5A 5J1QA 1IOIA 3PFOA 2GLJA 4OC3A 3S6FA 4UCPA 2XEFA 5AG7A 3D66A 4KLWA 4ORFA 4CGNA 4PXCA 1Y9WA 2C6PA 2PRBA 4X3RA 2I00A 5I0CA 4R57A 1QSMA 5EBVA 4X2TA 2D4PA 1K4JA 1LFWA 3H4QA 4KOVA 4RI1A 1CPSA 3DSBA 3FX6A 2CTBA 4ZY1A 2DEAA 1M4LA 3ZJ0A 2PCUA 4UIBA 3SJEA 1AYEA 4JD6A 5F48A 4HPSA 4UWIA 4BD9A 1S5KA 4KSFA 2BEIA 2QIRA 1YREA 1TF9A 2IL4A 2JEWA 3DDDA 4LX9A 4NEXA 4TNUA 4A32A 2BUEA 3B3CA 3EO4A 2C6CA 4NF1A 2Y0MA 2FSRA 1Y0RA 4EWTA 5F49A 2D4OA 3D7FA 2Q4YA 5THWA 2JBJA 3H8FA 3IEHA 2JDDA 4XNHC 2FXFA 3TC8A 1XE4A 2PVVA 4Q36A 3RO0A 3ISZA 3UY5A 2YNCC 4NCZA 5HVGA 4FD5A 3DNSA 3GB0A 3I9SA 5LYLA 4H2KA 1LAPA 3T90A 2WPWA 3IFEA 2Q44A 4K30A 4PPZA 1MK4A 4QB9A 5JGFA 2Z3PA 5IB0A 3K9UA 2PR1A 4F9VA 2VL1A 4AG7A 4TWEA 5G20A 1SQHA 3SJFA 3WC7A 1WK4A 4CGMA 2G0BA 1M4GA 3KKWA 1XF8A 2ZW4A 2OOTA 5KTDA 1YW6A 4CGOA 3PP9A 4GXHA 1ELLP 1Z9UA 3D67A 1YLEA 4MFZA 3SI1A 3P2HA 2ZEFA 3D4UA 4OMEA 1FY7A 4MMOA 3R96A 2DF5A 2PR8A 2GU2A 3G8WA 4MFQA 3WT4A 4UCMA 2YNCA 4M85A 4ZY2A 1S7LA 4ZGYB 2P6FA 1OBRA 2AFWA 4PXBA 3LACA 3QNVA 3D3SA 1IYLA 4K3NA 4MHYA 4C2XA 1ZLHA 1VKCA 2ODFA 2OR4A 5A27A 4AB7A 2VEZA 1YQEA 3C26A 5LYDA 4KVOE 5K8OA 1XMTA 2ZW7A 2VXKA 4KLVA 3IWGA 3H5ZA 1CJWA 2CNTA 1J4JA 4NGPA 4YFJA 4UEZA 4A31A 3PB7X 1KUXA 2EUIA 2WSAA 1ZG7A 3PZJA 4MFLA 4CYOA 4UF4A 4E8OA 1BOBA 4NXYA 4P6YA 4MJ8A 1U6MA 2HB6A 4P45A 3PB6X 2Q04A 3LD2A 3FRMA 4R6TA 2C6GA 1YVOA 6CPAA 4R87A 3SHPA 2OZHA 3SI0A 4KUAA 4KSIA 4EMEA 2BOAA 2PC1A 3DR6A 3CPXA 5D29A 2XEGA 4KVME 1X10A 4M6GA 3RNZA 1LRZA 2CF4A 1UFHA 4P4BA 1Y0YA 1CBXA 2PJ5A 4F8ZA 4XNHB 5FVJA 1ZO0A 4KS9A 2PJ8A 2O28A 3EXNA 2G3AA 4YRHA 2FS5A 2VBQA 4EFDA 2JDCA 1S60A 2PE3A 3GYAA 3PBBA 3RYOA 5JH9A 3MRUA 3QB8A 5HXDA 1AMPA 4EVYA 1ARMA 1TIQA 1VHOA 4KOSA 4ZX9A 5E96A 3VH9A 5EC4A 1R57A 3W6XA 2H5MA 2ZEHA 2BO9A 5HH1A 1Q2DA 3CDXA 2ZOFA 4KSAA 3IWWA 4MCRA 5HVHA 4ZBGA 1WWZA 3RBUA 1QSOA 4A33A 2OB0A 2HUZA 3D7DA 1CM0A 1TKFA 2ZOGA 2FE7A 3D7HA 3BJ8A 4Q7AA 5J8CA 1V0CA 3GY9A 3B3WA 4A39A 5GCNA 4IK2A 4QC6A 4P4DA 4MCQA 1FT7A 2Q7SA 1MJAA 2AFOA 3OWCA 4NGSA 3FH4A 4C7HA 4OC2A 2B5GA 4OIWA 2ZEGA 4AVCA 2ATRA 3JRUA 1Z5RA 4AVBA 2XEIA 4PV6A 4MHPA 3CPAA 4A38A 4XPDB 1KUYA 4NGQA 2AJ6A 3LMSA 4R3LA 2R8VA 4B11A 3D7GA 4WJBA 3TCVA 1Q7LA 2PJ4A 1H8LA 4MBUA 3SXOA 3SXNA 1IY7A 4NFRA 4KUBA 4C68A 1F2OA 1LCPA 2ZEEA 3FMCA 2NMTA 2ZELA 2Z10A 2C1CA 1YK3A 4JLYA 4MY3A 2QJ8A 2REFA 1RO5A 3BJ7A 1AUGA 5I4MA 5HVFA 3IIBA 5LRJA 4A95A 4OLLA 2I79A 2PJBA 4B6ZA 2HC9A 2GANA 2Q7BA 1S7NA 4II9A 7CPAA 1JWQA 1XEBA 4FUUA 1M4DA 4E2AA 3ISXA 3NA6A 2OU2A 2RFHA 3F0AA 4NJRA 1I21A 2Q43A 4OKOA 4F9UA 1UWYA 1YGHA 1YR0A 4QVTA 2WZNA 3R9GA 1IYKA 1R3NA 2ANPA 1CPXA 2ZW5A 2PJ3A 3FEDA 4KOWA 1ELMP 2GREA 2ZEDA 3IO1A 3L2NA 4NGTA 3TTHA 1XJOA 2PJ1A 2B5GB 4B13A 4BBHA 3KL9A 1S7FA 1BO4A 1NMTA 1F2PA 3PBEA 4B14A 4MCPA 2PJ0A 2PJ7A 2G9DA 2PVWA 4FD7A 2O4HA 4OP4A 2EK8A 1GHEA 4DUKA 3IJ3A 4PK3A 1BPMA 3GIUA 4CRZB 2ZPAA 2AFZA 3B7IA 2FIAA 4YGOA 3NH8A 4FWUA 1MJBA 3PEIA 4CAVA 4LQGA 5F09A 4UA3A 4RUHA 3SJXA 4RS2A 1N71A 4FD4A 5IB9A 2EWBA 5AG5A 3VWEA 3LODA 3DGVA 1CP7A 2F8HA 3VATA 3MGDA 1CX8A 2Z11A 1CP6A 2FIWA 2P6EA 4C2YA 4CGLA 2AE6A
chains in the Genus database with same CATH topology
2HC9A 2HB6A 1JWQA 4RN7A 5EMIA 4LQ6A 4M6HA 4M6GA 3QAYA 4M6IA 4BINA 3NE8A 2ODFA 2Q7SA 4EFDA 3CZXA 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWQ A;  4RN7 A;  5EMI A;  4LQ6 A;  4M6H A;  4M6G A;  3QAY A;  4M6I A;  4BIN A;  3NE8 A;  2Q7S A;  2ODF A;  3CZX A;  1XOV A; 
#chains in the Genus database with same CATH topology
 1M1D A;  4MHD A;  4CAW A;  5IX3 A;  5LRG A;  4HNY B;  4BMH A;  2REE A;  1TKH A;  4H6Z A;  5C88 A;  3CXP A;  4CPA A;  2AFU A;  4MY0 A;  3W91 A;  3HUV A;  2Z3L A;  3D2M A;  2OZG A;  1L0C A;  5IV0 A;  2CXA A;  1NE9 A;  2GIV A;  4YWY A;  1R43 A;  4M3S A;  5LYI A;  3I1U A;  4W9Y A;  3JUW A;  5AG4 A;  1EE3 P;  3H8G A;  4PQA A;  5HMN A;  4PXE A;  1P0H A;  4B5P A;  3FYN A;  2IMO A;  1MJ9 A;  2PIY A;  3WR7 A;  4Y49 C;  1ON0 A;  3S6H A;  4FAI A;  4UEF A;  3B3S A;  2FCK A;  2CTC A;  2PJ2 A;  1B6B A;  2ZEN A;  2ZEO A;  3IU1 A;  3EFA A;  3FXT A;  4H6U A;  2IJZ A;  3FEC A;  3FF3 A;  3GUX A;  4OAE A;  2J8M A;  4FD6 A;  4P4J A;  1XOV A;  4AVA A;  3EY5 A;  5K8P A;  2CNS A;  3RZA A;  4NSQ A;  1JQG A;  5JPH A;  3B8G A;  2YNE A;  3S6G A;  4C2Z A;  4KVX A;  2EO8 A;  3R1K A;  1A2Z A;  4DNC A;  1IGB A;  3NH5 A;  4KOT A;  5F47 A;  4A30 A;  1TXR A;  4JZ0 A;  3TFY A;  3KAS A;  2V8D A;  3FVL A;  4R3K A;  2G3T A;  5KTA A;  3P2F A;  1S7K A;  2CNM A;  3IC1 A;  3ZZI A;  4UEE A;  1TF8 A;  3FB3 A;  5G1Z A;  3HLP A;  1YVK A;  4CGP A;  4UBR A;  2YGW A;  4OID A;  2ZEM A;  2PJ6 A;  1Z8X A;  2GE3 A;  5KTC A;  3KHX A;  4NGM A;  4HNW B;  4A2Z A;  3DLJ A;  4MRI A;  3N5F A;  3KGQ A;  2CY2 A;  1YLO A;  1Z4R A;  2QVP A;  4Z65 A;  5ISV A;  1RXT A;  5BWA B;  2NYQ A;  3S9M A;  3BI0 A;  3KR4 A;  5LRK A;  1Q2Y A;  4AG9 A;  4DYO A;  4R8F A;  1LAM A;  4UWJ A;  1F57 A;  3GLJ A;  3JTK A;  4GM5 A;  4UFV A;  2Q4V A;  3VAR A;  4ZY0 A;  2J8N A;  1Q2C A;  2JBK A;  2PRQ A;  2EK9 A;  2RB7 A;  3IGR A;  2PJA A;  4YU9 A;  1QSR A;  3TX8 A;  4P4F A;  1TKJ A;  2VZY A;  1KUV A;  2EBJ A;  3BHX A;  1Y9K A;  3FBU A;  1QST A;  1OZP A;  2I3C A;  4Q38 A;  2V77 A;  4R7M A;  3B3V A;  4GS4 A;  3PRT A;  1X12 A;  4P10 A;  2B3V A;  4PSX A;  2B4D A;  4MFP A;  4KOY A;  3DR8 A;  2Z3O A;  2Q0Y A;  1B87 A;  4ONW A;  3E0K A;  1IID A;  4Y49 B;  4A94 A;  4JXR A;  2R98 A;  1VHE A;  3SJG A;  1YW4 A;  2V8V A;  1Z4E A;  5H84 A;  5EMI A;  2OH1 A;  4R76 A;  2ZXV A;  4QUS A;  2BCO A;  3V8I A;  2ZW6 A;  3CZX A;  2Z0Z A;  3FIX A;  2HQY A;  2JLM A;  4CYQ A;  4F6A A;  1QQ9 A;  3PGP A;  4RN7 A;  1QMU A;  4IHM A;  4F0Y A;  3SI2 A;  4B12 A;  2RC4 A;  2PIZ A;  4MHZ A;  3F8K A;  3TO6 A;  4LUA A;  2AFM A;  2GFQ A;  4BIN A;  3CXS A;  1M44 A;  2FVG A;  2J9A A;  2FT0 A;  2XEJ A;  4MFK A;  4CAX A;  2F7V A;  8CPA A;  1P4N A;  4U9Z A;  4LQ6 A;  2DXQ A;  3TO7 A;  2KCW A;  3H8E A;  2VZZ A;  2YND A;  1IOF A;  4B5O A;  4HKF A;  4OAD A;  2CIJ A;  3BXM A;  1Z2L A;  3N7Z A;  1DTD A;  2PJC A;  2QML A;  3VWD A;  2WYR A;  4I49 A;  4C7I A;  1GYT A;  4PSW A;  3B35 A;  5A28 A;  2JEV A;  3S9L A;  2HV2 A;  2B4D B;  5J8F A;  1BAV A;  2EVN A;  4XPL A;  2BSW A;  2OZU A;  4UFW A;  2P6G A;  3R9E A;  4UFX A;  3TE4 A;  1VHS A;  3S9N A;  2PSW A;  3BI1 A;  4IAV A;  1S3Z A;  2DPS A;  4MHN A;  2O53 A;  4PXD A;  4L89 A;  4U5Y A;  5CNP A;  2FL4 A;  3I3G A;  1Y7E A;  2IQ6 A;  3D8P A;  2F5I A;  4P4I A;  4NGR A;  2R1I A;  1YX0 A;  2GLF A;  4CYN A;  3PB8 X;  4ZI6 A;  4A37 A;  4QBJ A;  1IU8 A;  3K2K A;  1DE4 C;  3KZW A;  3LWU A;  1Z8T A;  2AFX A;  4MXU A;  4MFJ A;  1HDU A;  4KZT A;  4CYP A;  3CT9 A;  4P44 A;  1YSJ A;  3D68 A;  3IU2 A;  2Z3M A;  1PYT B;  4X8I A;  3FEE A;  4IF5 A;  1BPN A;  5DWN A;  1XIX A;  2BL1 A;  1PUA A;  2R7H A;  3JVN A;  1IB1 E;  3PB9 X;  5CBM A;  4ZX8 A;  2J8R A;  4OC5 A;  2NSM A;  3D2P A;  2DPT A;  5JQ4 A;  4AXV A;  3GKR A;  2WPX A;  3WAB A;  3NE7 A;  4X5K A;  4XPD C;  2Z3N A;  5ELY A;  5K8M A;  3B3T A;  3V7Z A;  2B3U A;  4U9Y A;  2ABZ A;  4CAF A;  3IWE A;  5H86 A;  4NGN A;  4M6H A;  2PDO A;  4NJQ A;  2PJ9 A;  3R95 A;  3WC6 A;  4B10 A;  3K9T A;  3CXQ A;  2POK A;  2VQY A;  4KOX A;  1NSL A;  4JXQ A;  1CG2 A;  2P0W A;  2QEC A;  2Z3K A;  4JYW A;  3TT2 A;  3W6S A;  1LOK A;  4CS0 B;  1I12 A;  3EC4 A;  4JJX A;  2V8H A;  2ZEP A;  4HNX B;  4PK2 A;  3T8W A;  3G3S A;  4ZYQ A;  2WUU A;  1XMB A;  4UCN A;  5C82 A;  4IUS A;  1QSN A;  1LAN A;  1Y7R A;  2Q4Z A;  1ARL A;  4XPK A;  1Z8L A;  5D8N A;  5AGE A;  1M4I A;  2VI7 A;  2AFS A;  1VGY A;  5JM6 A;  4MCS A;  1FNO A;  3V38 A;  3R9F A;  5LYF A;  2PQ8 A;  3QAY A;  2Q51 A;  3NE8 A;  4R9M A;  4CAE A;  1KZF A;  3KHZ A;  1HEE A;  5DS0 A;  1KWM A;  3FNC A;  4FBE A;  3KQX A;  4OC4 A;  3NFZ A;  1VIX A;  4M6I A;  3PFE A;  4B5P B;  2X7B A;  4OC0 A;  2C27 A;  1YME A;  1Z8W A;  2QYV A;  3KI9 A;  1ZG9 A;  1ZLI A;  3PB4 X;  1PCA A;  4JWP A;  2K5T A;  5CPA A;  3RAM A;  4F0X A;  1NSA A;  3TOA A;  2V8G A;  3KQZ A;  3FJU A;  1XBU A;  1RTQ A;  1PU9 A;  1XRY A;  2A4N A;  5K8N A;  3F5B A;  5G21 A;  1XFO A;  4CRY B;  3MN8 A;  2B58 A;  5F46 A;  3A9L A;  4ONU A;  3TOB A;  4OC1 A;  4H89 A;  3NH4 A;  5AG6 A;  3TO9 A;  2B4B A;  4MI4 A;  1I1D A;  5G22 A;  4J3G A;  1ZG8 A;  4DJL A;  3T9Y A;  4G1P A;  4L8A A;  5DWM A;  1IIC A;  4WWV A;  4KOR A;  3B2Y A;  3WC5 A;  3BLN A;  2ARH A;  4E0A A;  3S6K A;  4O23 A;  4P4E A;  4UIA A;  1HDQ A;  4KOU A;  3QAH A;  1BLL E;  3KR5 A;  5J1Q A;  1IOI A;  3PFO A;  2GLJ A;  4OC3 A;  3S6F A;  4UCP A;  2XEF A;  5AG7 A;  3D66 A;  4KLW A;  4ORF A;  4CGN A;  4PXC A;  1Y9W A;  2C6P A;  2PRB A;  4X3R A;  2I00 A;  5I0C A;  4R57 A;  1QSM A;  5EBV A;  4X2T A;  2D4P A;  1K4J A;  1LFW A;  3H4Q A;  4KOV A;  4RI1 A;  1CPS A;  3DSB A;  3FX6 A;  2CTB A;  4ZY1 A;  2DEA A;  1M4L A;  3ZJ0 A;  2PCU A;  4UIB A;  3SJE A;  1AYE A;  4JD6 A;  5F48 A;  4HPS A;  4UWI A;  4BD9 A;  1S5K A;  4KSF A;  2BEI A;  2QIR A;  1YRE A;  1TF9 A;  2IL4 A;  2JEW A;  3DDD A;  4LX9 A;  4NEX A;  4TNU A;  4A32 A;  2BUE A;  3B3C A;  3EO4 A;  2C6C A;  4NF1 A;  2Y0M A;  2FSR A;  1Y0R A;  4EWT A;  5F49 A;  2D4O A;  3D7F A;  2Q4Y A;  5THW A;  2JBJ A;  3H8F A;  3IEH A;  2JDD A;  4XNH C;  2FXF A;  3TC8 A;  1XE4 A;  2PVV A;  4Q36 A;  3RO0 A;  3ISZ A;  3UY5 A;  2YNC C;  4NCZ A;  5HVG A;  4FD5 A;  3DNS A;  3GB0 A;  3I9S A;  5LYL A;  4H2K A;  1LAP A;  3T90 A;  2WPW A;  3IFE A;  2Q44 A;  4K30 A;  4PPZ A;  1MK4 A;  4QB9 A;  5JGF A;  2Z3P A;  5IB0 A;  3K9U A;  2PR1 A;  4F9V A;  2VL1 A;  4AG7 A;  4TWE A;  5G20 A;  1SQH A;  3SJF A;  3WC7 A;  1WK4 A;  4CGM A;  2G0B A;  1M4G A;  3KKW A;  1XF8 A;  2ZW4 A;  2OOT A;  5KTD A;  1YW6 A;  4CGO A;  3PP9 A;  4GXH A;  1ELL P;  1Z9U A;  3D67 A;  1YLE A;  4MFZ A;  3SI1 A;  3P2H A;  2ZEF A;  3D4U A;  4OME A;  1FY7 A;  4MMO A;  3R96 A;  2DF5 A;  2PR8 A;  2GU2 A;  3G8W A;  4MFQ A;  3WT4 A;  4UCM A;  2YNC A;  4M85 A;  4ZY2 A;  1S7L A;  4ZGY B;  2P6F A;  1OBR A;  2AFW A;  4PXB A;  3LAC A;  3QNV A;  3D3S A;  1IYL A;  4K3N A;  4MHY A;  4C2X A;  1ZLH A;  1VKC A;  2ODF A;  2OR4 A;  5A27 A;  4AB7 A;  2VEZ A;  1YQE A;  3C26 A;  5LYD A;  4KVO E;  5K8O A;  1XMT A;  2ZW7 A;  2VXK A;  4KLV A;  3IWG A;  3H5Z A;  1CJW A;  2CNT A;  1J4J A;  4NGP A;  4YFJ A;  4UEZ A;  4A31 A;  3PB7 X;  1KUX A;  2EUI A;  2WSA A;  1ZG7 A;  3PZJ A;  4MFL A;  4CYO A;  4UF4 A;  4E8O A;  1BOB A;  4NXY A;  4P6Y A;  4MJ8 A;  1U6M A;  2HB6 A;  4P45 A;  3PB6 X;  2Q04 A;  3LD2 A;  3FRM A;  4R6T A;  2C6G A;  1YVO A;  6CPA A;  4R87 A;  3SHP A;  2OZH A;  3SI0 A;  4KUA A;  4KSI A;  4EME A;  2BOA A;  2PC1 A;  3DR6 A;  3CPX A;  5D29 A;  2XEG A;  4KVM E;  1X10 A;  4M6G A;  3RNZ A;  1LRZ A;  2CF4 A;  1UFH A;  4P4B A;  1Y0Y A;  1CBX A;  2PJ5 A;  4F8Z A;  4XNH B;  5FVJ A;  1ZO0 A;  4KS9 A;  2PJ8 A;  2O28 A;  3EXN A;  2G3A A;  4YRH A;  2FS5 A;  2VBQ A;  4EFD A;  2JDC A;  1S60 A;  2PE3 A;  3GYA A;  3PBB A;  3RYO A;  5JH9 A;  3MRU A;  3QB8 A;  5HXD A;  1AMP A;  4EVY A;  1ARM A;  1TIQ A;  1VHO A;  4KOS A;  4ZX9 A;  5E96 A;  3VH9 A;  5EC4 A;  1R57 A;  3W6X A;  2H5M A;  2ZEH A;  2BO9 A;  5HH1 A;  1Q2D A;  3CDX A;  2ZOF A;  4KSA A;  3IWW A;  4MCR A;  5HVH A;  4ZBG A;  1WWZ A;  3RBU A;  1QSO A;  4A33 A;  2OB0 A;  2HUZ A;  3D7D A;  1CM0 A;  1TKF A;  2ZOG A;  2FE7 A;  3D7H A;  3BJ8 A;  4Q7A A;  5J8C A;  1V0C A;  3GY9 A;  3B3W A;  4A39 A;  5GCN A;  4IK2 A;  4QC6 A;  4P4D A;  4MCQ A;  1FT7 A;  2Q7S A;  1MJA A;  2AFO A;  3OWC A;  4NGS A;  3FH4 A;  4C7H A;  4OC2 A;  2B5G A;  4OIW A;  2ZEG A;  4AVC A;  2ATR A;  3JRU A;  1Z5R A;  4AVB A;  2XEI A;  4PV6 A;  4MHP A;  3CPA A;  4A38 A;  4XPD B;  1KUY A;  4NGQ A;  2AJ6 A;  3LMS A;  4R3L A;  2R8V A;  4B11 A;  3D7G A;  4WJB A;  3TCV A;  1Q7L A;  2PJ4 A;  1H8L A;  4MBU A;  3SXO A;  3SXN A;  1IY7 A;  4NFR A;  4KUB A;  4C68 A;  1F2O A;  1LCP A;  2ZEE A;  3FMC A;  2NMT A;  2ZEL A;  2Z10 A;  2C1C A;  1YK3 A;  4JLY A;  4MY3 A;  2QJ8 A;  2REF A;  1RO5 A;  3BJ7 A;  1AUG A;  5I4M A;  5HVF A;  3IIB A;  5LRJ A;  4A95 A;  4OLL A;  2I79 A;  2PJB A;  4B6Z A;  2HC9 A;  2GAN A;  2Q7B A;  1S7N A;  4II9 A;  7CPA A;  1JWQ A;  1XEB A;  4FUU A;  1M4D A;  4E2A A;  3ISX A;  3NA6 A;  2OU2 A;  2RFH A;  3F0A A;  4NJR A;  1I21 A;  2Q43 A;  4OKO A;  4F9U A;  1UWY A;  1YGH A;  1YR0 A;  4QVT A;  2WZN A;  3R9G A;  1IYK A;  1R3N A;  2ANP A;  1CPX A;  2ZW5 A;  2PJ3 A;  3FED A;  4KOW A;  1ELM P;  2GRE A;  2ZED A;  3IO1 A;  3L2N A;  4NGT A;  3TTH A;  1XJO A;  2PJ1 A;  2B5G B;  4B13 A;  4BBH A;  3KL9 A;  1S7F A;  1BO4 A;  1NMT A;  1F2P A;  3PBE A;  4B14 A;  4MCP A;  2PJ0 A;  2PJ7 A;  2G9D A;  2PVW A;  4FD7 A;  2O4H A;  4OP4 A;  2EK8 A;  1GHE A;  4DUK A;  3IJ3 A;  4PK3 A;  1BPM A;  3GIU A;  4CRZ B;  2ZPA A;  2AFZ A;  3B7I A;  2FIA A;  4YGO A;  3NH8 A;  4FWU A;  1MJB A;  3PEI A;  4CAV A;  4LQG A;  5F09 A;  4UA3 A;  4RUH A;  3SJX A;  4RS2 A;  1N71 A;  4FD4 A;  5IB9 A;  2EWB A;  5AG5 A;  3VWE A;  3LOD A;  3DGV A;  1CP7 A;  2F8H A;  3VAT A;  3MGD A;  1CX8 A;  2Z11 A;  1CP6 A;  2FIW A;  2P6E A;  4C2Y A;  4CGL A;  2AE6 A; 
#chains in the Genus database with same CATH homology
 2HC9 A;  2HB6 A;  1JWQ A;  4RN7 A;  5EMI A;  4LQ6 A;  4M6H A;  4M6G A;  3QAY A;  4M6I A;  4BIN A;  3NE8 A;  2ODF A;  2Q7S A;  4EFD A;  3CZX A;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...