2Q7SA

Crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
280
structure length
271
Chain Sequence
IAPFTLALPEGEALPLVCDSPHSGTFYPADFGAVVAPERLRGGEDTHVDALWEAVPRVGGTLLAATFPRVYIDPNRMLDDIDPAQLEGPWPTPLAPGTGLIWSNVDAPIYDRKLTVAEVQRRINRYYRPYHAALTEAVEGAYQRFGAVWHLNLHSMPNNAYERLKIQSPRPLADFVLGDRDGTTCEPGLVDLVERELREKGYTVARNDPYKGQLIAQIGRPAERRNSLQIEIRRPLYMEEGTRERNEGFATLQRDLTLLTLRIAEYVRRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-formylglutamate amidohydrolase
publication title Crystal structure of N-formylglutamate amidohydrolase (YP_297560.1) from Ralstonia eutropha JMP134 at 2.00 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Hydrolase
total genus 94
structure length 271
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05013 FGase N-formylglutamate amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 2q7sA00
2Q7SA 1JWQA 3NE8A 5EMIA 4BINA 3CZXA 4LQ6A 2ODFA 1XOVA 4M6HA 4M6GA 4RN7A 4M6IA 3QAYA
chains in the Genus database with same CATH superfamily
2PJ6A 2VZZA 3B2YA 1XJOA 3F0AA 4P4DA 4QC6A 5DS0A 1S3ZA 4BMHA 4F0YA 2B3UA 4GS4A 4CYOA 2PSWA 3PB9X 3SXNA 3DR8A 3KL9A 2Z0ZA 3G3SA 2ZXVA 3H8GA 3NE7A 2V8VA 5F47A 2Z3NA 3KZWA 3CZXA 2VZYA 3QB8A 2D4OA 1M1DA 2V8GA 2AFXA 4IUSA 1M4GA 2OB0A 3JTKA 4Q38A 4QBJA 1YK3A 2AJ6A 2PJ7A 3CXPA 3D7HA 4UCNA 5KTAA 2F8HA 4Q36A 1RO5A 1XF8A 1BLLE 2XEFA 2ARHA 1KUXA 1R57A 1XMTA 1ON0A 2OZHA 2VQYA 4NXYA 2X7BA 2QVPA 1TF8A 1Y0YA 3EC4A 4P44A 3H5ZA 3GY9A 1Q2DA 4EWTA 3WC5A 1XFOA 4P10A 2IJZA 4MJ8A 2PQ8A 4P6YA 2AFUA 2AFOA 3WC7A 1OBRA 3EO4A 1FNOA 5IX3A 1TKHA 2FT0A 4FD4A 4AG7A 1VGYA 4A39A 4MHYA 2C6PA 1CBXA 4E2AA 4UWIA 2AFSA 2PJCA 1Z8LA 4H2KA 3DDDA 2GE3A 2J9AA 5H84A 2A4NA 3FF3A 4NGTA 5E96A 5I4MA 1HDQA 3B3SA 4KVXA 4JXQA 4ZY2A 4RI1A 4YGOA 2QMLA 4B10A 2Z3OA 2ZOFA 4P4BA 2FL4A 2HQYA 4KOYA 4B13A 2JEVA 4B5PB 2Z11A 1IYLA 1L0CA 2JDCA 3GUXA 3PFOA 2PJ8A 4IHMA 4H6UA 4JJXA 3B7IA 2GU2A 4ZGYB 3H8FA 2JLMA 1PU9A 3SI2A 3RBUA 2PJ0A 3TO7A 1MJAA 4ZY1A 3V8IA 4KORA 2PJ2A 4LX9A 2B4DA 2AFZA 4KSFA 3V38A 4X5KA 3QNVA 1YVKA 3D7DA 2ANPA 4A95A 2GLJA 3T90A 1HEEA 4KOUA 4M6HA 4M6GA 1DE4C 1X12A 2WSAA 3LODA 4MHNA 1CG2A 1Z9UA 1QMUA 3HUVA 3KHXA 1JQGA 4AVAA 4O23A 1BPNA 3CT9A 4NF1A 4U9ZA 3NH4A 5H86A 4DUKA 4UWJA 4E0AA 1YVOA 3S6KA 4AG9A 1GHEA 2FSRA 2I3CA 2R7HA 5DWMA 5EBVA 1ELMP 5G22A 4A32A 2G9DA 1Y0RA 4F9VA 1CM0A 4EFDA 1PYTB 4MFJA 4OC3A 3PB6X 4RUHA 5AGEA 5KTDA 2Q4VA 4PSWA 3BHXA 3D68A 4MCSA 2V8HA 4CAFA 4FD7A 3LMSA 1XOVA 4F6AA 1LANA 1QQ9A 4WWVA 4OAEA 3PEIA 4KVOE 4MMOA 5CBMA 2CXAA 2ZEDA 4CAVA 3S6GA 1R3NA 1IGBA 2YNEA 4IAVA 4OMEA 4OC4A 2JBKA 1Y7EA 3BJ7A 2RB7A 4NGMA 1LOKA 1ZG9A 4UEZA 1V0CA 3PZJA 5F09A 1Z4RA 3V7ZA 4B12A 1ZO0A 2QYVA 1QSNA 3FNCA 4UCMA 2AFMA 2ZPAA 4FBEA 2HV2A 4KOTA 2VXKA 4L8AA 3JVNA 2FS5A 3FVLA 4JYWA 4OP4A 5A28A 2JBJA 4CYPA 1RXTA 1KUVA 4H89A 2C6GA 2Q0YA 2YNCA 3CXQA 5G21A 2REEA 3JRUA 2CNMA 2B58A 1H8LA 3KKWA 2HB6A 1XE4A 1WK4A 4MCRA 4C68A 1I21A 4MHDA 4P45A 4QVTA 2GANA 5ELYA 3RO0A 3WT4A 4UIBA 4ZY0A 4Z65A 4NGPA 3PFEA 4OLLA 1Q7LA 2G0BA 4LUAA 2Z10A 3MRUA 2Z3MA 1NE9A 4KOXA 4YWYA 4FAIA 2B5GA 4AB7A 2GFQA 2I79A 2ZW5A 4MCPA 1NSLA 4E8OA 1IY7A 3CPAA 1U6MA 3OWCA 1BOBA 1CPXA 3GYAA 1LRZA 2EVNA 3B3CA 1P4NA 4M6IA 4CAWA 1XEBA 3TX8A 3CDXA 2DXQA 2RC4A 2Y0MA 5F49A 3R9GA 3PRTA 1ZLHA 4MBUA 1CJWA 1EE3P 2FIAA 4HKFA 4R3LA 4AVBA 2PE3A 4R7MA 3IU1A 3NE8A 1IYKA 1VHSA 4X2TA 3FECA 4MY3A 4F9UA 2XEJA 2C1CA 2NMTA 1ELLP 2ZEMA 3IC1A 5BWAB 2Q44A 3VH9A 3KASA 4PK2A 4ZX9A 3IU2A 2PRQA 3W6XA 1BAVA 2PJ5A 4B5OA 2ZEPA 3W6SA 5J1QA 2XEIA 4CAXA 2CIJA 2ODFA 2J8MA 3FH4A 3NFZA 4XPLA 3W91A 4P4EA 4A30A 2PVWA 4F0XA 2P6EA 4NCZA 5JQ4A 3FB3A 1UFHA 3JUWA 1TF9A 3HLPA 4CGNA 5HH1A 2YNDA 4QUSA 2EO8A 4CYQA 5K8PA 2JDDA 2V77A 4Y49B 4YRHA 4B11A 1NSAA 3MN8A 3VATA 4OIDA 2XEGA 4KVME 3I1UA 5HMNA 2O28A 4HNYB 4MHPA 5LRGA 3LD2A 4XPKA 1HDUA 5CPAA 2Z3PA 4JXRA 3TO6A 1PUAA 3F5BA 4ONWA 3WR7A 3R9EA 2AE6A 3BLNA 4EVYA 2I00A 3BJ8A 3KQXA 4NGSA 2Z3KA 3P2HA 3R9FA 3SI0A 3VARA 4I49A 3SI1A 3VWEA 2PJ9A 4BD9A 3FEDA 1IOIA 4UFVA 5D29A 1YR0A 1QSRA 1J4JA 2PJ1A 4ORFA 1MJ9A 2CY2A 2PJAA 5K8NA 4NJRA 3N5FA 2QJ8A 4LQ6A 4PQAA 1SQHA 2C27A 2AFWA 2BCOA 4FUUA 4GM5A 1X10A 1YMEA 1XRYA 4K30A 4UA3A 1S7LA 2OZGA 4PXCA 3S6FA 1AMPA 1KUYA 4CYNA 1IB1E 1QSTA 3DR6A 4M3SA 2P0WA 1BPMA 2PR8A 4C2XA 4MFKA 4C2YA 1Y7RA 2GLFA 1FT7A 2RFHA 3EFAA 3F8KA 4PSXA 3TC8A 1S7NA 2WUUA 1M4DA 1Q2YA 1YW6A 4UIAA 5I0CA 2C6CA 3KQZA 2ZW4A 3K9UA 2OZUA 1CPSA 4H6ZA 2ZEOA 1I12A 1LFWA 2ZEFA 3PP9A 1IU8A 2B4DB 1GYTA 1M4LA 2J8NA 4B14A 2BL1A 4PPZA 4UCPA 1Y9KA 3DGVA 5EC4A 4HNWB 4ONUA 4PV6A 4KOWA 5AG7A 3PB8X 1TIQA 2HUZA 3GB0A 4C2ZA 1NMTA 3FJUA 3PB7X 4KLVA 2BOAA 1I1DA 2FCKA 2FIWA 4A33A 4CPAA 5G1ZA 5AG4A 3BI0A 5HVHA 4II9A 4JLYA 2Q4ZA 2ZEGA 3PGPA 5J8CA 3CPXA 2VI7A 3D4UA 1B6BA 2OR4A 3H8EA 2PIYA 3D7FA 4MFLA 3DNSA 3EXNA 4KS9A 3IO1A 4OC2A 1M4IA 3GLJA 3SJGA 2G3TA 1TKJA 1A2ZA 2KCWA 3FX6A 4CGOA 4KOVA 2GREA 4BBHA 2R98A 4OC0A 1JWQA 1QSMA 2CTBA 4UEEA 4R8FA 4OC1A 3FEEA 1Z8TA 3DSBA 1YX0A 2VL1A 4Y49C 4J3GA 1VHEA 1UWYA 4CAEA 4A38A 3MGDA 3ZZIA 3D2MA 2DPTA 2EUIA 4NJQA 5LYFA 3T9YA 4IF5A 5ISVA 1LAMA 2OOTA 3BI1A 1CX8A 1VHOA 1P0HA 1YW4A 4KOSA 4MRIA 5LRKA 2EBJA 5FVJA 5LYLA 4UF4A 3D67A 1RTQA 1Z8WA 2Z3LA 4NSQA 4NGNA 3P2FA 4JD6A 4X3RA 5G20A 4B6ZA 1YSJA 1Z5RA 2PRBA 3TOAA 2DEAA 2DPSA 3FMCA 1M44A 2QECA 3FRMA 3IFEA 4R3KA 3D8PA 3PBBA 2FXFA 1F57A 4UFWA 4C7IA 3IWGA 1N71A 4M85A 4XNHB 3RNZA 2JEWA 4CRZB 4A2ZA 2Q43A 1Z8XA 1S7FA 2ZW7A 4YFJA 3TOBA 7CPAA 2BUEA 1FY7A 1LAPA 3S6HA 3SJEA 1YQEA 3SHPA 4L89A 2O4HA 4MCQA 4MI4A 2CNTA 2PR1A 2P6FA 3R1KA 1XMBA 2POKA 5K8OA 5C82A 4ZYQA 1R43A 5AG5A 2F5IA 2B5GB 3D7GA 3WC6A 4PXEA 2PIZA 4CGPA 1S5KA 2Q51A 4KZTA 2ZENA 2ZELA 4B5PA 2PCUA 1BO4A 2EK8A 3PBEA 4KLWA 4MFZA 4KSAA 4A37A 3TFYA 4K3NA 3VWDA 5LRJA 2G3AA 2HC9A 4MXUA 2EWBA 4NGQA 4PK3A 1Y9WA 3LWUA 1Q2CA 3UY5A 5JGFA 2BO9A 4JWPA 2B4BA 3B3TA 1S7KA 1Z2LA 3S9MA 5K8MA 3NA6A 4U9YA 3E0KA 3KGQA 4XPDB 3H4QA 2IMOA 3C26A 1IICA 4ZX8A 4A94A 2H5MA 4MY0A 1IIDA 5D8NA 5A27A 4BINA 3BXMA 3IJ3A 3S9NA 2Q4YA 4R6TA 5J8FA 4C7HA 3NH8A 3IWWA 4R76A 3T8WA 5JH9A 4DJLA 1YGHA 1YLOA 4ZBGA 3ISXA 2WPWA 5C88A 1S60A 2PC1A 3B3VA 4AVCA 2P6GA 4MFQA 4UFXA 4UEFA 2CNSA 4TWEA 8CPAA 2Q7BA 1F2PA 3SJFA 1XIXA 2O53A 1MJBA 3I9SA 2R8VA 1YLEA 2ZEEA 5LYIA 2Q04A 3WABA 4DNCA 3S9LA 3GIUA 2BEIA 4IK2A 3KI9A 4X8IA 5GCNA 4R9MA 4W9YA 4YU9A 1OZPA 1Z4EA 1B87A 4CGLA 2VBQA 3KR4A 3SXOA 1XBUA 2NSMA 2BSWA 3G8WA 1LCPA 4RN7A 3ZJ0A 2PJBA 2Q7SA 4OC5A 5DWNA 4GXHA 4HNXB 5F46A 1ARMA 3B3WA 2OH1A 3D2PA 3L2NA 1PCAA 4CRYB 4R87A 4RS2A 3TE4A 2PDOA 2R1IA 2ZEHA 2EK9A 3DLJA 3RAMA 2QIRA 3RZAA 3TCVA 4OIWA 1AYEA 3B8GA 2OU2A 4NEXA 3EY5A 1WWZA 3D3SA 3TO9A 2WPXA 6CPAA 2REFA 3QAHA 4JZ0A 4HPSA 4FD5A 1YREA 2PVVA 5JPHA 2ZOGA 3IIBA 3GKRA 1QSOA 1AUGA 1KWMA 2FVGA 3D66A 3K2KA 2K5TA 3B35A 3K9TA 3KHZA 3NH5A 2YNCC 4XNHC 3RYOA 4AXVA 3FYNA 4MFPA 3QAYA 4PXDA 4TNUA 2YGWA 3R96A 5EMIA 3LACA 2B3VA 1MK4A 4Q7AA 1ARLA 4EMEA 4PXBA 3FIXA 1DTDA 4MHZA 4QB9A 4U5YA 5THWA 4WJBA 3CXSA 1IOFA 4OADA 3A9LA 1CP7A 2PJ4A 5JM6A 4FD6A 5AG6A 1F2OA 2J8RA 2CF4A 2WZNA 4A31A 3IWEA 3I3GA 5IB0A 1VIXA 3FXTA 3IEHA 2D4PA 1ZG8A 2GIVA 1K4JA 2NYQA 3ISZA 3N7ZA 5HXDA 4P4JA 4LQGA 2VEZA 5HVFA 4KUAA 2FE7A 3KR5A 1TKFA 4F8ZA 4KSIA 2ABZA 4CS0B 2WYRA 2DF5A 4FWUA 4DYOA 4OKOA 3TT2A 2ATRA 1TXRA 2IQ6A 2ZW6A 5CNPA 3IGRA 2IL4A 1KZFA 4NFRA 3PB4X 1ZG7A 2F7VA 4XPDC 5HVGA 2PJ3A 5IB9A 4UBRA 5F48A 4P4IA 4CGMA 2CTCA 4R57A 3SJXA 5LYDA 4KUBA 4P4FA 1ZLIA 3FBUA 3R95A 1CP6A 4G1PA 4NGRA 1VKCA 2V8DA 4ZI6A 5KTCA 5IV0A 3TTHA
chains in the Genus database with same CATH topology
2Q7SA 1JWQA 3NE8A 5EMIA 4BINA 3CZXA 4LQ6A 2ODFA 2HC9A 4EFDA 3QAYA 1XOVA 4M6HA 4M6GA 4RN7A 4M6IA 2HB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7S A;  1JWQ A;  3NE8 A;  5EMI A;  4BIN A;  3CZX A;  4LQ6 A;  2ODF A;  1XOV A;  4M6H A;  4M6G A;  4RN7 A;  4M6I A;  3QAY A; 
#chains in the Genus database with same CATH topology
 2PJ6 A;  2VZZ A;  3B2Y A;  1XJO A;  3F0A A;  4P4D A;  4QC6 A;  5DS0 A;  1S3Z A;  4BMH A;  4F0Y A;  2B3U A;  4GS4 A;  4CYO A;  2PSW A;  3PB9 X;  3SXN A;  3DR8 A;  3KL9 A;  2Z0Z A;  3G3S A;  2ZXV A;  3H8G A;  3NE7 A;  2V8V A;  5F47 A;  2Z3N A;  3KZW A;  3CZX A;  2VZY A;  3QB8 A;  2D4O A;  1M1D A;  2V8G A;  2AFX A;  4IUS A;  1M4G A;  2OB0 A;  3JTK A;  4Q38 A;  4QBJ A;  1YK3 A;  2AJ6 A;  2PJ7 A;  3CXP A;  3D7H A;  4UCN A;  5KTA A;  2F8H A;  4Q36 A;  1RO5 A;  1XF8 A;  1BLL E;  2XEF A;  2ARH A;  1KUX A;  1R57 A;  1XMT A;  1ON0 A;  2OZH A;  2VQY A;  4NXY A;  2X7B A;  2QVP A;  1TF8 A;  1Y0Y A;  3EC4 A;  4P44 A;  3H5Z A;  3GY9 A;  1Q2D A;  4EWT A;  3WC5 A;  1XFO A;  4P10 A;  2IJZ A;  4MJ8 A;  2PQ8 A;  4P6Y A;  2AFU A;  2AFO A;  3WC7 A;  1OBR A;  3EO4 A;  1FNO A;  5IX3 A;  1TKH A;  2FT0 A;  4FD4 A;  4AG7 A;  1VGY A;  4A39 A;  4MHY A;  2C6P A;  1CBX A;  4E2A A;  4UWI A;  2AFS A;  2PJC A;  1Z8L A;  4H2K A;  3DDD A;  2GE3 A;  2J9A A;  5H84 A;  2A4N A;  3FF3 A;  4NGT A;  5E96 A;  5I4M A;  1HDQ A;  3B3S A;  4KVX A;  4JXQ A;  4ZY2 A;  4RI1 A;  4YGO A;  2QML A;  4B10 A;  2Z3O A;  2ZOF A;  4P4B A;  2FL4 A;  2HQY A;  4KOY A;  4B13 A;  2JEV A;  4B5P B;  2Z11 A;  1IYL A;  1L0C A;  2JDC A;  3GUX A;  3PFO A;  2PJ8 A;  4IHM A;  4H6U A;  4JJX A;  3B7I A;  2GU2 A;  4ZGY B;  3H8F A;  2JLM A;  1PU9 A;  3SI2 A;  3RBU A;  2PJ0 A;  3TO7 A;  1MJA A;  4ZY1 A;  3V8I A;  4KOR A;  2PJ2 A;  4LX9 A;  2B4D A;  2AFZ A;  4KSF A;  3V38 A;  4X5K A;  3QNV A;  1YVK A;  3D7D A;  2ANP A;  4A95 A;  2GLJ A;  3T90 A;  1HEE A;  4KOU A;  4M6H A;  4M6G A;  1DE4 C;  1X12 A;  2WSA A;  3LOD A;  4MHN A;  1CG2 A;  1Z9U A;  1QMU A;  3HUV A;  3KHX A;  1JQG A;  4AVA A;  4O23 A;  1BPN A;  3CT9 A;  4NF1 A;  4U9Z A;  3NH4 A;  5H86 A;  4DUK A;  4UWJ A;  4E0A A;  1YVO A;  3S6K A;  4AG9 A;  1GHE A;  2FSR A;  2I3C A;  2R7H A;  5DWM A;  5EBV A;  1ELM P;  5G22 A;  4A32 A;  2G9D A;  1Y0R A;  4F9V A;  1CM0 A;  4EFD A;  1PYT B;  4MFJ A;  4OC3 A;  3PB6 X;  4RUH A;  5AGE A;  5KTD A;  2Q4V A;  4PSW A;  3BHX A;  3D68 A;  4MCS A;  2V8H A;  4CAF A;  4FD7 A;  3LMS A;  1XOV A;  4F6A A;  1LAN A;  1QQ9 A;  4WWV A;  4OAE A;  3PEI A;  4KVO E;  4MMO A;  5CBM A;  2CXA A;  2ZED A;  4CAV A;  3S6G A;  1R3N A;  1IGB A;  2YNE A;  4IAV A;  4OME A;  4OC4 A;  2JBK A;  1Y7E A;  3BJ7 A;  2RB7 A;  4NGM A;  1LOK A;  1ZG9 A;  4UEZ A;  1V0C A;  3PZJ A;  5F09 A;  1Z4R A;  3V7Z A;  4B12 A;  1ZO0 A;  2QYV A;  1QSN A;  3FNC A;  4UCM A;  2AFM A;  2ZPA A;  4FBE A;  2HV2 A;  4KOT A;  2VXK A;  4L8A A;  3JVN A;  2FS5 A;  3FVL A;  4JYW A;  4OP4 A;  5A28 A;  2JBJ A;  4CYP A;  1RXT A;  1KUV A;  4H89 A;  2C6G A;  2Q0Y A;  2YNC A;  3CXQ A;  5G21 A;  2REE A;  3JRU A;  2CNM A;  2B58 A;  1H8L A;  3KKW A;  2HB6 A;  1XE4 A;  1WK4 A;  4MCR A;  4C68 A;  1I21 A;  4MHD A;  4P45 A;  4QVT A;  2GAN A;  5ELY A;  3RO0 A;  3WT4 A;  4UIB A;  4ZY0 A;  4Z65 A;  4NGP A;  3PFE A;  4OLL A;  1Q7L A;  2G0B A;  4LUA A;  2Z10 A;  3MRU A;  2Z3M A;  1NE9 A;  4KOX A;  4YWY A;  4FAI A;  2B5G A;  4AB7 A;  2GFQ A;  2I79 A;  2ZW5 A;  4MCP A;  1NSL A;  4E8O A;  1IY7 A;  3CPA A;  1U6M A;  3OWC A;  1BOB A;  1CPX A;  3GYA A;  1LRZ A;  2EVN A;  3B3C A;  1P4N A;  4M6I A;  4CAW A;  1XEB A;  3TX8 A;  3CDX A;  2DXQ A;  2RC4 A;  2Y0M A;  5F49 A;  3R9G A;  3PRT A;  1ZLH A;  4MBU A;  1CJW A;  1EE3 P;  2FIA A;  4HKF A;  4R3L A;  4AVB A;  2PE3 A;  4R7M A;  3IU1 A;  3NE8 A;  1IYK A;  1VHS A;  4X2T A;  3FEC A;  4MY3 A;  4F9U A;  2XEJ A;  2C1C A;  2NMT A;  1ELL P;  2ZEM A;  3IC1 A;  5BWA B;  2Q44 A;  3VH9 A;  3KAS A;  4PK2 A;  4ZX9 A;  3IU2 A;  2PRQ A;  3W6X A;  1BAV A;  2PJ5 A;  4B5O A;  2ZEP A;  3W6S A;  5J1Q A;  2XEI A;  4CAX A;  2CIJ A;  2ODF A;  2J8M A;  3FH4 A;  3NFZ A;  4XPL A;  3W91 A;  4P4E A;  4A30 A;  2PVW A;  4F0X A;  2P6E A;  4NCZ A;  5JQ4 A;  3FB3 A;  1UFH A;  3JUW A;  1TF9 A;  3HLP A;  4CGN A;  5HH1 A;  2YND A;  4QUS A;  2EO8 A;  4CYQ A;  5K8P A;  2JDD A;  2V77 A;  4Y49 B;  4YRH A;  4B11 A;  1NSA A;  3MN8 A;  3VAT A;  4OID A;  2XEG A;  4KVM E;  3I1U A;  5HMN A;  2O28 A;  4HNY B;  4MHP A;  5LRG A;  3LD2 A;  4XPK A;  1HDU A;  5CPA A;  2Z3P A;  4JXR A;  3TO6 A;  1PUA A;  3F5B A;  4ONW A;  3WR7 A;  3R9E A;  2AE6 A;  3BLN A;  4EVY A;  2I00 A;  3BJ8 A;  3KQX A;  4NGS A;  2Z3K A;  3P2H A;  3R9F A;  3SI0 A;  3VAR A;  4I49 A;  3SI1 A;  3VWE A;  2PJ9 A;  4BD9 A;  3FED A;  1IOI A;  4UFV A;  5D29 A;  1YR0 A;  1QSR A;  1J4J A;  2PJ1 A;  4ORF A;  1MJ9 A;  2CY2 A;  2PJA A;  5K8N A;  4NJR A;  3N5F A;  2QJ8 A;  4LQ6 A;  4PQA A;  1SQH A;  2C27 A;  2AFW A;  2BCO A;  4FUU A;  4GM5 A;  1X10 A;  1YME A;  1XRY A;  4K30 A;  4UA3 A;  1S7L A;  2OZG A;  4PXC A;  3S6F A;  1AMP A;  1KUY A;  4CYN A;  1IB1 E;  1QST A;  3DR6 A;  4M3S A;  2P0W A;  1BPM A;  2PR8 A;  4C2X A;  4MFK A;  4C2Y A;  1Y7R A;  2GLF A;  1FT7 A;  2RFH A;  3EFA A;  3F8K A;  4PSX A;  3TC8 A;  1S7N A;  2WUU A;  1M4D A;  1Q2Y A;  1YW6 A;  4UIA A;  5I0C A;  2C6C A;  3KQZ A;  2ZW4 A;  3K9U A;  2OZU A;  1CPS A;  4H6Z A;  2ZEO A;  1I12 A;  1LFW A;  2ZEF A;  3PP9 A;  1IU8 A;  2B4D B;  1GYT A;  1M4L A;  2J8N A;  4B14 A;  2BL1 A;  4PPZ A;  4UCP A;  1Y9K A;  3DGV A;  5EC4 A;  4HNW B;  4ONU A;  4PV6 A;  4KOW A;  5AG7 A;  3PB8 X;  1TIQ A;  2HUZ A;  3GB0 A;  4C2Z A;  1NMT A;  3FJU A;  3PB7 X;  4KLV A;  2BOA A;  1I1D A;  2FCK A;  2FIW A;  4A33 A;  4CPA A;  5G1Z A;  5AG4 A;  3BI0 A;  5HVH A;  4II9 A;  4JLY A;  2Q4Z A;  2ZEG A;  3PGP A;  5J8C A;  3CPX A;  2VI7 A;  3D4U A;  1B6B A;  2OR4 A;  3H8E A;  2PIY A;  3D7F A;  4MFL A;  3DNS A;  3EXN A;  4KS9 A;  3IO1 A;  4OC2 A;  1M4I A;  3GLJ A;  3SJG A;  2G3T A;  1TKJ A;  1A2Z A;  2KCW A;  3FX6 A;  4CGO A;  4KOV A;  2GRE A;  4BBH A;  2R98 A;  4OC0 A;  1JWQ A;  1QSM A;  2CTB A;  4UEE A;  4R8F A;  4OC1 A;  3FEE A;  1Z8T A;  3DSB A;  1YX0 A;  2VL1 A;  4Y49 C;  4J3G A;  1VHE A;  1UWY A;  4CAE A;  4A38 A;  3MGD A;  3ZZI A;  3D2M A;  2DPT A;  2EUI A;  4NJQ A;  5LYF A;  3T9Y A;  4IF5 A;  5ISV A;  1LAM A;  2OOT A;  3BI1 A;  1CX8 A;  1VHO A;  1P0H A;  1YW4 A;  4KOS A;  4MRI A;  5LRK A;  2EBJ A;  5FVJ A;  5LYL A;  4UF4 A;  3D67 A;  1RTQ A;  1Z8W A;  2Z3L A;  4NSQ A;  4NGN A;  3P2F A;  4JD6 A;  4X3R A;  5G20 A;  4B6Z A;  1YSJ A;  1Z5R A;  2PRB A;  3TOA A;  2DEA A;  2DPS A;  3FMC A;  1M44 A;  2QEC A;  3FRM A;  3IFE A;  4R3K A;  3D8P A;  3PBB A;  2FXF A;  1F57 A;  4UFW A;  4C7I A;  3IWG A;  1N71 A;  4M85 A;  4XNH B;  3RNZ A;  2JEW A;  4CRZ B;  4A2Z A;  2Q43 A;  1Z8X A;  1S7F A;  2ZW7 A;  4YFJ A;  3TOB A;  7CPA A;  2BUE A;  1FY7 A;  1LAP A;  3S6H A;  3SJE A;  1YQE A;  3SHP A;  4L89 A;  2O4H A;  4MCQ A;  4MI4 A;  2CNT A;  2PR1 A;  2P6F A;  3R1K A;  1XMB A;  2POK A;  5K8O A;  5C82 A;  4ZYQ A;  1R43 A;  5AG5 A;  2F5I A;  2B5G B;  3D7G A;  3WC6 A;  4PXE A;  2PIZ A;  4CGP A;  1S5K A;  2Q51 A;  4KZT A;  2ZEN A;  2ZEL A;  4B5P A;  2PCU A;  1BO4 A;  2EK8 A;  3PBE A;  4KLW A;  4MFZ A;  4KSA A;  4A37 A;  3TFY A;  4K3N A;  3VWD A;  5LRJ A;  2G3A A;  2HC9 A;  4MXU A;  2EWB A;  4NGQ A;  4PK3 A;  1Y9W A;  3LWU A;  1Q2C A;  3UY5 A;  5JGF A;  2BO9 A;  4JWP A;  2B4B A;  3B3T A;  1S7K A;  1Z2L A;  3S9M A;  5K8M A;  3NA6 A;  4U9Y A;  3E0K A;  3KGQ A;  4XPD B;  3H4Q A;  2IMO A;  3C26 A;  1IIC A;  4ZX8 A;  4A94 A;  2H5M A;  4MY0 A;  1IID A;  5D8N A;  5A27 A;  4BIN A;  3BXM A;  3IJ3 A;  3S9N A;  2Q4Y A;  4R6T A;  5J8F A;  4C7H A;  3NH8 A;  3IWW A;  4R76 A;  3T8W A;  5JH9 A;  4DJL A;  1YGH A;  1YLO A;  4ZBG A;  3ISX A;  2WPW A;  5C88 A;  1S60 A;  2PC1 A;  3B3V A;  4AVC A;  2P6G A;  4MFQ A;  4UFX A;  4UEF A;  2CNS A;  4TWE A;  8CPA A;  2Q7B A;  1F2P A;  3SJF A;  1XIX A;  2O53 A;  1MJB A;  3I9S A;  2R8V A;  1YLE A;  2ZEE A;  5LYI A;  2Q04 A;  3WAB A;  4DNC A;  3S9L A;  3GIU A;  2BEI A;  4IK2 A;  3KI9 A;  4X8I A;  5GCN A;  4R9M A;  4W9Y A;  4YU9 A;  1OZP A;  1Z4E A;  1B87 A;  4CGL A;  2VBQ A;  3KR4 A;  3SXO A;  1XBU A;  2NSM A;  2BSW A;  3G8W A;  1LCP A;  4RN7 A;  3ZJ0 A;  2PJB A;  2Q7S A;  4OC5 A;  5DWN A;  4GXH A;  4HNX B;  5F46 A;  1ARM A;  3B3W A;  2OH1 A;  3D2P A;  3L2N A;  1PCA A;  4CRY B;  4R87 A;  4RS2 A;  3TE4 A;  2PDO A;  2R1I A;  2ZEH A;  2EK9 A;  3DLJ A;  3RAM A;  2QIR A;  3RZA A;  3TCV A;  4OIW A;  1AYE A;  3B8G A;  2OU2 A;  4NEX A;  3EY5 A;  1WWZ A;  3D3S A;  3TO9 A;  2WPX A;  6CPA A;  2REF A;  3QAH A;  4JZ0 A;  4HPS A;  4FD5 A;  1YRE A;  2PVV A;  5JPH A;  2ZOG A;  3IIB A;  3GKR A;  1QSO A;  1AUG A;  1KWM A;  2FVG A;  3D66 A;  3K2K A;  2K5T A;  3B35 A;  3K9T A;  3KHZ A;  3NH5 A;  2YNC C;  4XNH C;  3RYO A;  4AXV A;  3FYN A;  4MFP A;  3QAY A;  4PXD A;  4TNU A;  2YGW A;  3R96 A;  5EMI A;  3LAC A;  2B3V A;  1MK4 A;  4Q7A A;  1ARL A;  4EME A;  4PXB A;  3FIX A;  1DTD A;  4MHZ A;  4QB9 A;  4U5Y A;  5THW A;  4WJB A;  3CXS A;  1IOF A;  4OAD A;  3A9L A;  1CP7 A;  2PJ4 A;  5JM6 A;  4FD6 A;  5AG6 A;  1F2O A;  2J8R A;  2CF4 A;  2WZN A;  4A31 A;  3IWE A;  3I3G A;  5IB0 A;  1VIX A;  3FXT A;  3IEH A;  2D4P A;  1ZG8 A;  2GIV A;  1K4J A;  2NYQ A;  3ISZ A;  3N7Z A;  5HXD A;  4P4J A;  4LQG A;  2VEZ A;  5HVF A;  4KUA A;  2FE7 A;  3KR5 A;  1TKF A;  4F8Z A;  4KSI A;  2ABZ A;  4CS0 B;  2WYR A;  2DF5 A;  4FWU A;  4DYO A;  4OKO A;  3TT2 A;  2ATR A;  1TXR A;  2IQ6 A;  2ZW6 A;  5CNP A;  3IGR A;  2IL4 A;  1KZF A;  4NFR A;  3PB4 X;  1ZG7 A;  2F7V A;  4XPD C;  5HVG A;  2PJ3 A;  5IB9 A;  4UBR A;  5F48 A;  4P4I A;  4CGM A;  2CTC A;  4R57 A;  3SJX A;  5LYD A;  4KUB A;  4P4F A;  1ZLI A;  3FBU A;  3R95 A;  1CP6 A;  4G1P A;  4NGR A;  1VKC A;  2V8D A;  4ZI6 A;  5KTC A;  5IV0 A;  3TTH A; 
#chains in the Genus database with same CATH homology
 2Q7S A;  1JWQ A;  3NE8 A;  5EMI A;  4BIN A;  3CZX A;  4LQ6 A;  2ODF A;  2HC9 A;  4EFD A;  3QAY A;  1XOV A;  4M6H A;  4M6G A;  4RN7 A;  4M6I A;  2HB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...