2Q7SA

Crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
280
structure length
271
Chain Sequence
b'IAPFTLALPEGEALPLVCDSPHSGTFYPADFGAVVAPERLRGGEDTHVDALWEAVPRVGGTLLAATFPRVYIDPNRMLDDIDPAQLEGPWPTPLAPGTGLIWSNVDAPIYDRKLTVAEVQRRINRYYRPYHAALTEAVEGAYQRFGAVWHLNLHSMPNNAYERLKIQSPRPLADFVLGDRDGTTCEPGLVDLVERELREKGYTVARNDPYKGQLIAQIGRPAERRNSLQIEIRRPLYMEEGTRERNEGFATLQRDLTLLTLRIAEYVRRGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-formylglutamate amidohydrolase
molecule tags Hydrolase
source organism Ralstonia eutropha
publication title Crystal structure of N-formylglutamate amidohydrolase (YP_297560.1) from Ralstonia eutropha JMP134 at 2.00 A resolution
rcsb
total genus 94
structure length 271
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05013 FGase N-formylglutamate amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 2q7sA00
2ODFA 1XOVA 2Q7SA 1JWQA 4RN7A 3QAYA 4M6IA 4M6GA 5EMIA 4M6HA 3NE8A 4BINA 3CZXA 4LQ6A
chains in the Genus database with same CATH superfamily
1Y9WA 4CAVA 1CJWA 4Y49B 1ZLHA 5J8CA 4KUBA 4RS2A 2AE6A 1X12A 3B3WA 5F49A 1TXRA 4UCNA 5DWMA 4ZBGA 5CBMA 1VGYA 4CRYB 3PP9A 3EC4A 2GFQA 4R8FA 2Q51A 3B8GA 3FBUA 4KOWA 4MHNA 5KTCA 1CG2A 5EC4A 4UFWA 4NGTA 1K4JA 1Z8WA 2PJ2A 1KUXA 4ZY0A 5JGFA 3B3SA 4L89A 1MK4A 2V8DA 1CX8A 3RBUA 5DS0A 3S9NA 3SJGA 2ZENA 4PPZA 3WC6A 4HNXB 1LCPA 2Q4ZA 5GCNA 4OC4A 1XE4A 2OZHA 4FD7A 4QUSA 2PJCA 6CPAA 3IU1A 4OMEA 4WWVA 1ZG9A 2J8RA 4NGMA 1KUYA 1XIXA 4ZY2A 4G1PA 3IWEA 5LYDA 3GYAA 1ELMP 1VIXA 3S6FA 4OC3A 2QECA 3PB6X 3FEDA 1J4JA 2QYVA 4UA3A 4F6AA 5D8NA 4IAVA 3RAMA 4UCPA 3PEIA 2FCKA 1M4DA 2QMLA 3BHXA 5CNPA 3D7GA 3VWDA 2Z11A 3D68A 1Y9KA 1FY7A 3GIUA 2DXQA 4KVME 4MFZA 3RZAA 2Z3OA 3IU2A 2R7HA 1BLLE 3BJ7A 1YLEA 4MMOA 4B12A 3PRTA 3PB4X 2VEZA 1M44A 2ZXVA 1U6MA 1S7FA 4HNYB 4KS9A 5G21A 4E8OA 4GM5A 5HXDA 3D7FA 4KOVA 4MCSA 4CAXA 2G3AA 3CZXA 4KVOE 2PJ1A 4B10A 4YU9A 4ZYQA 1YQEA 5AG7A 5I0CA 4MI4A 3LACA 2X7BA 2G3TA 4OP4A 4TWEA 4FD6A 4R87A 4R6TA 4W9YA 3S9LA 2Q4YA 2FIWA 2HB6A 4JXRA 4UWJA 3KQZA 5AGEA 2BCOA 5EBVA 3GUXA 4MY3A 5AG4A 2BO9A 4R57A 2WSAA 4I49A 5LRKA 2AFUA 3LD2A 3CDXA 2KCWA 1Z5RA 3CXPA 4ONUA 1WWZA 1MJBA 1Q2DA 2PIYA 4PV6A 5LRJA 5A28A 3PB9X 2HV2A 3RO0A 2NYQA 5G20A 4FD4A 5LRGA 4JWPA 3TO9A 3TT2A 4CS0B 1CM0A 3MGDA 3H4QA 2PJ7A 1LAPA 4R3LA 4XPDC 1NMTA 5AG6A 4A31A 4QBJA 5HVHA 3EXNA 2JDDA 4OIDA 5LYIA 1TKFA 2VI7A 4NGRA 4JLYA 2K5TA 2EUIA 2CY2A 3KR4A 3D7HA 2PQ8A 4KOSA 4PQAA 1TF9A 3IFEA 3QNVA 1JWQA 4JYWA 4UIAA 4A95A 4Z65A 4EVYA 1EE3P 4UFXA 3R9GA 3S6KA 3SI1A 4A38A 5IB9A 4PSWA 1XBUA 3B7IA 4H6UA 4EWTA 5JH9A 3SI2A 4ZI6A 1QSTA 2YNCA 4YWYA 4AG7A 2QIRA 1DTDA 3PB8X 3FEEA 2JEVA 2AFOA 3FXTA 2DEAA 3JRUA 4J3GA 5LYLA 5F46A 1KZFA 2YNDA 3EY5A 4OC1A 2F5IA 5KTAA 2JLMA 1Y7RA 4LUAA 1XEBA 2ZEOA 3E0KA 2Y0MA 4C7IA 3IJ3A 1LRZA 3FIXA 4X3RA 1I21A 4A37A 1YLOA 3D2PA 5KTDA 2ATRA 2I79A 4ZGYB 1PUAA 2C1CA 3GB0A 3IIBA 3W91A 1GHEA 3V7ZA 4KZTA 2FS5A 2FVGA 3K9UA 4MRIA 4NGSA 1HDQA 1BO4A 1YGHA 5IV0A 2D4OA 5BWAB 2D4PA 3BI0A 1KWMA 1H8LA 1S3ZA 4KOUA 2B3UA 3JTKA 3NH4A 3DNSA 2V8VA 1ZO0A 2RFHA 4MCPA 1M4LA 2AFWA 3CXQA 4NGQA 4AVCA 4CYOA 3SXOA 1Z2LA 2O4HA 3GKRA 1R3NA 3CPXA 2ZOFA 3TO7A 2B58A 3KKWA 5C88A 2GU2A 4OIWA 1Y7EA 2P6EA 2EO8A 2BOAA 2VZYA 4Y49C 3D8PA 4H6ZA 2BSWA 4A39A 4XNHC 1IIDA 1M1DA 1Z4EA 2H5MA 2Q0YA 3DLJA 1F57A 2B5GB 2PR8A 2CIJA 2PVWA 2QVPA 4NJQA 4F9UA 2ZEDA 3JUWA 2Z0ZA 5E96A 1LANA 2PJ4A 4MJ8A 1BPMA 4E2AA 5JPHA 1TF8A 1YVKA 2CNSA 1QSNA 4MY0A 4UF4A 4R76A 3WC7A 2GLFA 4XPKA 4KOTA 4LX9A 5EMIA 2J8MA 2ZW7A 2EK8A 4ZY1A 4K30A 3WT4A 4XPDB 4UEZA 3PFOA 3A9LA 3NFZA 4PXEA 1MJAA 4IK2A 3UY5A 1VKCA 4BBHA 5ISVA 1NSLA 4CGOA 2Z3NA 4MFJA 5A27A 2GREA 5F47A 4CYPA 1R43A 2AJ6A 1YW4A 3HUVA 3GY9A 4F8ZA 1NE9A 2GIVA 3PBBA 2B5GA 2PCUA 2VZZA 1R57A 2O53A 3B3TA 4M3SA 1M4GA 4FAIA 4R9MA 2PJAA 4A30A 4BD9A 2VXKA 1S7NA 2EVNA 1RO5A 2ZW4A 4MCRA 4WJBA 4B11A 2R8VA 2PJ5A 3KGQA 2FIAA 4MHPA 2IJZA 4U5YA 4UIBA 4CRZB 2Z3LA 5K8MA 4HNWB 3RYOA 2AFMA 2ZEHA 2OB0A 4AB7A 4FBEA 4MFPA 2AFZA 3QB8A 4KLVA 3FECA 4O23A 2Q4VA 2ZELA 4NEXA 5K8PA 2YNCC 1X10A 3FB3A 4XNHB 4MHDA 4EFDA 3WC5A 2FXFA 3PGPA 4P4IA 2PSWA 3I3GA 4HPSA 4P45A 1YVOA 3NH5A 4E0AA 4QVTA 2I3CA 2XEFA 1S7KA 3B3CA 3RNZA 4DJLA 3V8IA 1TKJA 1Y0RA 4CAWA 2EBJA 1IICA 2PJ8A 3IGRA 1BAVA 2XEJA 4NF1A 4Q7AA 4XPLA 2DPSA 4C2ZA 4A33A 2A4NA 3V38A 1Z8LA 4A2ZA 4KORA 3FRMA 1A2ZA 1N71A 1XMBA 1DE4C 2ZEPA 3B35A 4U9YA 3F0AA 2EK9A 2V8GA 4MFKA 1FT7A 4R3KA 3JVNA 3G3SA 4II9A 1UFHA 1VHOA 3G8WA 1XFOA 2REFA 4PK2A 1AUGA 1QSRA 4CGMA 4F0YA 2ANPA 5I4MA 2PC1A 3BI1A 3R9EA 3TTHA 4ZX9A 1IB1E 4DYOA 1GYTA 4IF5A 3PFEA 4HKFA 3NH8A 5J1QA 2GANA 4C7HA 7CPAA 3C26A 4MBUA 4OADA 3BXMA 4JJXA 4PK3A 1QMUA 3S9MA 1Q2YA 2IL4A 2C27A 2IMOA 4MXUA 1S60A 2CNMA 2OR4A 3FMCA 3PBEA 3SJXA 3BLNA 3K2KA 3D66A 1XF8A 4MHYA 3SJEA 4C68A 1OZPA 2VL1A 1Q2CA 4KLWA 3F8KA 1PYTB 2C6CA 4A32A 3FX6A 2REEA 4JXQA 3FF3A 3WABA 2GLJA 4ONWA 2Q44A 4NSQA 1B87A 2VQYA 3R96A 4JZ0A 4FD5A 4AG9A 3KL9A 2J9AA 2Z3PA 3TX8A 2WUUA 4UBRA 5FVJA 4FUUA 3ISZA 4KVXA 3BJ8A 3L2NA 4MFQA 4PXCA 4NGPA 1IYLA 4KSIA 3LWUA 3TFYA 4CPAA 5G1ZA 1I12A 1S5KA 4NJRA 4UFVA 2OU2A 2F7VA 2P6GA 3W6XA 3W6SA 1QSOA 4P6YA 3P2FA 4DNCA 4TNUA 1Z9UA 4M6GA 2CTBA 2DF5A 1S7LA 1CP7A 1XRYA 2B4DA 4RN7A 4GXHA 3EO4A 2FL4A 8CPAA 2HUZA 3KR5A 2PJBA 2ODFA 1Q7LA 1IU8A 1QSMA 3VWEA 3SXNA 4B5PA 2ZEGA 1IOFA 1LAMA 1P4NA 4CAFA 2O28A 4K3NA 1P0HA 1M4IA 5G22A 2Q7SA 1CPSA 5HVGA 4NCZA 1HEEA 4CGPA 3FJUA 5K8OA 2EWBA 3KZWA 4QC6A 4FWUA 3LODA 2FE7A 3P2HA 3H8EA 5DWNA 1Z4RA 1Z8XA 3ZZIA 4MFLA 3NE8A 3OWCA 4NFRA 3R95A 3KHXA 4P4BA 1I1DA 2RC4A 2Q43A 4ZX8A 1IGBA 3DSBA 1VHEA 2HC9A 2PJ0A 3D4UA 1XJOA 1LOKA 4B5PB 3FNCA 4Q38A 5IB0A 1QQ9A 1YX0A 4AXVA 1OBRA 2PDOA 3N7ZA 4M6HA 2YGWA 2NSMA 4KSAA 5C82A 1IOIA 2B4DB 1PU9A 1TKHA 2J8NA 2XEIA 3H5ZA 3VATA 3VH9A 5F09A 1BPNA 5K8NA 2I00A 2G9DA 2R98A 2V8HA 3LMSA 1IYKA 3S6HA 3DGVA 3GLJA 1ELLP 2RB7A 1V0CA 4CAEA 4OC2A 4P4EA 3S6GA 2VBQA 4QB9A 1AYEA 3H8GA 2JEWA 2ZOGA 3ZJ0A 1RTQA 4UEFA 2PVVA 3FH4A 2PJ9A 3MRUA 2WPWA 2Z3KA 3IWGA 5IX3A 3I9SA 1CBXA 4C2XA 4MCQA 1WK4A 2ARHA 1ARMA 2OZUA 2WYRA 3EFAA 3CPAA 2B4BA 1B6BA 3TC8A 4U9ZA 4OKOA 1XMTA 2V77A 2P6FA 1MJ9A 2AFXA 4CYQA 1VHSA 4RI1A 4LQGA 4X2TA 2ZPAA 4Q36A 5D29A 3IO1A 3D67A 1NSAA 3T9YA 4OC5A 1ZG7A 2JDCA 2HQYA 2WPXA 4DUKA 1ZLIA 1UWYA 4JD6A 2PRBA 4P4DA 4OC0A 2OOTA 3HLPA 5J8FA 4OAEA 2C6PA 4F0XA 1HDUA 2B3VA 4ORFA 1FNOA 4OLLA 4UCMA 5AG5A 3TE4A 3DR6A 2ZW5A 3PB7X 3CXSA 1KUVA 3FYNA 2CF4A 2ZEFA 4PXBA 4A94A 2NMTA 3TO6A 3T8WA 3KQXA 4M6IA 2IQ6A 3TCVA 3MN8A 5ELYA 1TIQA 4NXYA 3SJFA 1ARLA 2GE3A 2QJ8A 3FVLA 2R1IA 2XEGA 2Z10A 3F5BA 3I1UA 2CXAA 2F8HA 4IHMA 3KASA 4X8IA 4B5OA 3NE7A 3SHPA 4KOXA 4X5KA 1BOBA 2BUEA 3B3VA 1L0CA 2Q7BA 4R7MA 2FT0A 3R1KA 3VARA 2YNEA 1PCAA 3CT9A 1AMPA 4IUSA 4KUAA 3KI9A 5HH1A 2Q04A 5HMNA 2PJ3A 3T90A 4UEEA 1LFWA 3N5FA 4P4FA 4B13A 5CPAA 4C2YA 4PXDA 2P0WA 3QAHA 3DR8A 4KSFA 3DDDA 4H2KA 2PIZA 2G0BA 4PSXA 1Y0YA 3H8FA 1F2PA 2PJ6A 4NGNA 4UWIA 4MHZA 1CP6A 5F48A 2FSRA 1JQGA 2BEIA 3TOAA 1YK3A 1YR0A 1F2OA 2PE3A 3D2MA 1YREA 4YGOA 4H89A 3NA6A 4B14A 3ISXA 4CGLA 5THWA 2ZEMA 2AFSA 2BL1A 4CGNA 5JQ4A 2JBJA 1XOVA 5HVFA 2OZGA 3D7DA 2C6GA 4AVAA 3QAYA 4GS4A 4AVBA 3R9FA 2POKA 4F9VA 2PR1A 2ZW6A 5H86A 2JBKA 3SI0A 3K9TA 4B6ZA 2CTCA 2Z3MA 4YRHA 5LYFA 1IY7A 4BMHA 3PZJA 4P44A 3KHZA 2ZEEA 4BINA 2WZNA 3D3SA 2CNTA 4LQ6A 2OH1A 3WR7A 4YFJA 4M85A 3TOBA 1YW6A 1CPXA 1RXTA 1ON0A 4RUHA 4P10A 3IWWA 3IEHA 3B2YA 2DPTA 1YSJA 2PRQA 4L8AA 4P4JA 4CYNA 1YMEA 5JM6A 4EMEA 1SQHA 3IC1A 2ABZA 1ZG8A 1Z8TA 5H84A 4KOYA
chains in the Genus database with same CATH topology
2ODFA 1XOVA 1JWQA 2Q7SA 4EFDA 4RN7A 3QAYA 3CZXA 4M6IA 4M6GA 5EMIA 2HC9A 4M6HA 3NE8A 4BINA 2HB6A 4LQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODF A;  1XOV A;  2Q7S A;  1JWQ A;  4RN7 A;  3QAY A;  4M6I A;  4M6G A;  5EMI A;  4M6H A;  3NE8 A;  4BIN A;  3CZX A;  4LQ6 A; 
#chains in the Genus database with same CATH topology
 1Y9W A;  4CAV A;  1CJW A;  4Y49 B;  1ZLH A;  5J8C A;  4KUB A;  4RS2 A;  2AE6 A;  1X12 A;  3B3W A;  5F49 A;  1TXR A;  4UCN A;  5DWM A;  4ZBG A;  5CBM A;  1VGY A;  4CRY B;  3PP9 A;  3EC4 A;  2GFQ A;  4R8F A;  2Q51 A;  3B8G A;  3FBU A;  4KOW A;  4MHN A;  5KTC A;  1CG2 A;  5EC4 A;  4UFW A;  4NGT A;  1K4J A;  1Z8W A;  2PJ2 A;  1KUX A;  4ZY0 A;  5JGF A;  3B3S A;  4L89 A;  1MK4 A;  2V8D A;  1CX8 A;  3RBU A;  5DS0 A;  3S9N A;  3SJG A;  2ZEN A;  4PPZ A;  3WC6 A;  4HNX B;  1LCP A;  2Q4Z A;  5GCN A;  4OC4 A;  1XE4 A;  2OZH A;  4FD7 A;  4QUS A;  2PJC A;  6CPA A;  3IU1 A;  4OME A;  4WWV A;  1ZG9 A;  2J8R A;  4NGM A;  1KUY A;  1XIX A;  4ZY2 A;  4G1P A;  3IWE A;  5LYD A;  3GYA A;  1ELM P;  1VIX A;  3S6F A;  4OC3 A;  2QEC A;  3PB6 X;  3FED A;  1J4J A;  2QYV A;  4UA3 A;  4F6A A;  5D8N A;  4IAV A;  3RAM A;  4UCP A;  3PEI A;  2FCK A;  1M4D A;  2QML A;  3BHX A;  5CNP A;  3D7G A;  3VWD A;  2Z11 A;  3D68 A;  1Y9K A;  1FY7 A;  3GIU A;  2DXQ A;  4KVM E;  4MFZ A;  3RZA A;  2Z3O A;  3IU2 A;  2R7H A;  1BLL E;  3BJ7 A;  1YLE A;  4MMO A;  4B12 A;  3PRT A;  3PB4 X;  2VEZ A;  1M44 A;  2ZXV A;  1U6M A;  1S7F A;  4HNY B;  4KS9 A;  5G21 A;  4E8O A;  4GM5 A;  5HXD A;  3D7F A;  4KOV A;  4MCS A;  4CAX A;  2G3A A;  3CZX A;  4KVO E;  2PJ1 A;  4B10 A;  4YU9 A;  4ZYQ A;  1YQE A;  5AG7 A;  5I0C A;  4MI4 A;  3LAC A;  2X7B A;  2G3T A;  4OP4 A;  4TWE A;  4FD6 A;  4R87 A;  4R6T A;  4W9Y A;  3S9L A;  2Q4Y A;  2FIW A;  2HB6 A;  4JXR A;  4UWJ A;  3KQZ A;  5AGE A;  2BCO A;  5EBV A;  3GUX A;  4MY3 A;  5AG4 A;  2BO9 A;  4R57 A;  2WSA A;  4I49 A;  5LRK A;  2AFU A;  3LD2 A;  3CDX A;  2KCW A;  1Z5R A;  3CXP A;  4ONU A;  1WWZ A;  1MJB A;  1Q2D A;  2PIY A;  4PV6 A;  5LRJ A;  5A28 A;  3PB9 X;  2HV2 A;  3RO0 A;  2NYQ A;  5G20 A;  4FD4 A;  5LRG A;  4JWP A;  3TO9 A;  3TT2 A;  4CS0 B;  1CM0 A;  3MGD A;  3H4Q A;  2PJ7 A;  1LAP A;  4R3L A;  4XPD C;  1NMT A;  5AG6 A;  4A31 A;  4QBJ A;  5HVH A;  3EXN A;  2JDD A;  4OID A;  5LYI A;  1TKF A;  2VI7 A;  4NGR A;  4JLY A;  2K5T A;  2EUI A;  2CY2 A;  3KR4 A;  3D7H A;  2PQ8 A;  4KOS A;  4PQA A;  1TF9 A;  3IFE A;  3QNV A;  1JWQ A;  4JYW A;  4UIA A;  4A95 A;  4Z65 A;  4EVY A;  1EE3 P;  4UFX A;  3R9G A;  3S6K A;  3SI1 A;  4A38 A;  5IB9 A;  4PSW A;  1XBU A;  3B7I A;  4H6U A;  4EWT A;  5JH9 A;  3SI2 A;  4ZI6 A;  1QST A;  2YNC A;  4YWY A;  4AG7 A;  2QIR A;  1DTD A;  3PB8 X;  3FEE A;  2JEV A;  2AFO A;  3FXT A;  2DEA A;  3JRU A;  4J3G A;  5LYL A;  5F46 A;  1KZF A;  2YND A;  3EY5 A;  4OC1 A;  2F5I A;  5KTA A;  2JLM A;  1Y7R A;  4LUA A;  1XEB A;  2ZEO A;  3E0K A;  2Y0M A;  4C7I A;  3IJ3 A;  1LRZ A;  3FIX A;  4X3R A;  1I21 A;  4A37 A;  1YLO A;  3D2P A;  5KTD A;  2ATR A;  2I79 A;  4ZGY B;  1PUA A;  2C1C A;  3GB0 A;  3IIB A;  3W91 A;  1GHE A;  3V7Z A;  4KZT A;  2FS5 A;  2FVG A;  3K9U A;  4MRI A;  4NGS A;  1HDQ A;  1BO4 A;  1YGH A;  5IV0 A;  2D4O A;  5BWA B;  2D4P A;  3BI0 A;  1KWM A;  1H8L A;  1S3Z A;  4KOU A;  2B3U A;  3JTK A;  3NH4 A;  3DNS A;  2V8V A;  1ZO0 A;  2RFH A;  4MCP A;  1M4L A;  2AFW A;  3CXQ A;  4NGQ A;  4AVC A;  4CYO A;  3SXO A;  1Z2L A;  2O4H A;  3GKR A;  1R3N A;  3CPX A;  2ZOF A;  3TO7 A;  2B58 A;  3KKW A;  5C88 A;  2GU2 A;  4OIW A;  1Y7E A;  2P6E A;  2EO8 A;  2BOA A;  2VZY A;  4Y49 C;  3D8P A;  4H6Z A;  2BSW A;  4A39 A;  4XNH C;  1IID A;  1M1D A;  1Z4E A;  2H5M A;  2Q0Y A;  3DLJ A;  1F57 A;  2B5G B;  2PR8 A;  2CIJ A;  2PVW A;  2QVP A;  4NJQ A;  4F9U A;  2ZED A;  3JUW A;  2Z0Z A;  5E96 A;  1LAN A;  2PJ4 A;  4MJ8 A;  1BPM A;  4E2A A;  5JPH A;  1TF8 A;  1YVK A;  2CNS A;  1QSN A;  4MY0 A;  4UF4 A;  4R76 A;  3WC7 A;  2GLF A;  4XPK A;  4KOT A;  4LX9 A;  5EMI A;  2J8M A;  2ZW7 A;  2EK8 A;  4ZY1 A;  4K30 A;  3WT4 A;  4XPD B;  4UEZ A;  3PFO A;  3A9L A;  3NFZ A;  4PXE A;  1MJA A;  4IK2 A;  3UY5 A;  1VKC A;  4BBH A;  5ISV A;  1NSL A;  4CGO A;  2Z3N A;  4MFJ A;  5A27 A;  2GRE A;  5F47 A;  4CYP A;  1R43 A;  2AJ6 A;  1YW4 A;  3HUV A;  3GY9 A;  4F8Z A;  1NE9 A;  2GIV A;  3PBB A;  2B5G A;  2PCU A;  2VZZ A;  1R57 A;  2O53 A;  3B3T A;  4M3S A;  1M4G A;  4FAI A;  4R9M A;  2PJA A;  4A30 A;  4BD9 A;  2VXK A;  1S7N A;  2EVN A;  1RO5 A;  2ZW4 A;  4MCR A;  4WJB A;  4B11 A;  2R8V A;  2PJ5 A;  3KGQ A;  2FIA A;  4MHP A;  2IJZ A;  4U5Y A;  4UIB A;  4CRZ B;  2Z3L A;  5K8M A;  4HNW B;  3RYO A;  2AFM A;  2ZEH A;  2OB0 A;  4AB7 A;  4FBE A;  4MFP A;  2AFZ A;  3QB8 A;  4KLV A;  3FEC A;  4O23 A;  2Q4V A;  2ZEL A;  4NEX A;  5K8P A;  2YNC C;  1X10 A;  3FB3 A;  4XNH B;  4MHD A;  4EFD A;  3WC5 A;  2FXF A;  3PGP A;  4P4I A;  2PSW A;  3I3G A;  4HPS A;  4P45 A;  1YVO A;  3NH5 A;  4E0A A;  4QVT A;  2I3C A;  2XEF A;  1S7K A;  3B3C A;  3RNZ A;  4DJL A;  3V8I A;  1TKJ A;  1Y0R A;  4CAW A;  2EBJ A;  1IIC A;  2PJ8 A;  3IGR A;  1BAV A;  2XEJ A;  4NF1 A;  4Q7A A;  4XPL A;  2DPS A;  4C2Z A;  4A33 A;  2A4N A;  3V38 A;  1Z8L A;  4A2Z A;  4KOR A;  3FRM A;  1A2Z A;  1N71 A;  1XMB A;  1DE4 C;  2ZEP A;  3B35 A;  4U9Y A;  3F0A A;  2EK9 A;  2V8G A;  4MFK A;  1FT7 A;  4R3K A;  3JVN A;  3G3S A;  4II9 A;  1UFH A;  1VHO A;  3G8W A;  1XFO A;  2REF A;  4PK2 A;  1AUG A;  1QSR A;  4CGM A;  4F0Y A;  2ANP A;  5I4M A;  2PC1 A;  3BI1 A;  3R9E A;  3TTH A;  4ZX9 A;  1IB1 E;  4DYO A;  1GYT A;  4IF5 A;  3PFE A;  4HKF A;  3NH8 A;  5J1Q A;  2GAN A;  4C7H A;  7CPA A;  3C26 A;  4MBU A;  4OAD A;  3BXM A;  4JJX A;  4PK3 A;  1QMU A;  3S9M A;  1Q2Y A;  2IL4 A;  2C27 A;  2IMO A;  4MXU A;  1S60 A;  2CNM A;  2OR4 A;  3FMC A;  3PBE A;  3SJX A;  3BLN A;  3K2K A;  3D66 A;  1XF8 A;  4MHY A;  3SJE A;  4C68 A;  1OZP A;  2VL1 A;  1Q2C A;  4KLW A;  3F8K A;  1PYT B;  2C6C A;  4A32 A;  3FX6 A;  2REE A;  4JXQ A;  3FF3 A;  3WAB A;  2GLJ A;  4ONW A;  2Q44 A;  4NSQ A;  1B87 A;  2VQY A;  3R96 A;  4JZ0 A;  4FD5 A;  4AG9 A;  3KL9 A;  2J9A A;  2Z3P A;  3TX8 A;  2WUU A;  4UBR A;  5FVJ A;  4FUU A;  3ISZ A;  4KVX A;  3BJ8 A;  3L2N A;  4MFQ A;  4PXC A;  4NGP A;  1IYL A;  4KSI A;  3LWU A;  3TFY A;  4CPA A;  5G1Z A;  1I12 A;  1S5K A;  4NJR A;  4UFV A;  2OU2 A;  2F7V A;  2P6G A;  3W6X A;  3W6S A;  1QSO A;  4P6Y A;  3P2F A;  4DNC A;  4TNU A;  1Z9U A;  4M6G A;  2CTB A;  2DF5 A;  1S7L A;  1CP7 A;  1XRY A;  2B4D A;  4RN7 A;  4GXH A;  3EO4 A;  2FL4 A;  8CPA A;  2HUZ A;  3KR5 A;  2PJB A;  2ODF A;  1Q7L A;  1IU8 A;  1QSM A;  3VWE A;  3SXN A;  4B5P A;  2ZEG A;  1IOF A;  1LAM A;  1P4N A;  4CAF A;  2O28 A;  4K3N A;  1P0H A;  1M4I A;  5G22 A;  2Q7S A;  1CPS A;  5HVG A;  4NCZ A;  1HEE A;  4CGP A;  3FJU A;  5K8O A;  2EWB A;  3KZW A;  4QC6 A;  4FWU A;  3LOD A;  2FE7 A;  3P2H A;  3H8E A;  5DWN A;  1Z4R A;  1Z8X A;  3ZZI A;  4MFL A;  3NE8 A;  3OWC A;  4NFR A;  3R95 A;  3KHX A;  4P4B A;  1I1D A;  2RC4 A;  2Q43 A;  4ZX8 A;  1IGB A;  3DSB A;  1VHE A;  2HC9 A;  2PJ0 A;  3D4U A;  1XJO A;  1LOK A;  4B5P B;  3FNC A;  4Q38 A;  5IB0 A;  1QQ9 A;  1YX0 A;  4AXV A;  1OBR A;  2PDO A;  3N7Z A;  4M6H A;  2YGW A;  2NSM A;  4KSA A;  5C82 A;  1IOI A;  2B4D B;  1PU9 A;  1TKH A;  2J8N A;  2XEI A;  3H5Z A;  3VAT A;  3VH9 A;  5F09 A;  1BPN A;  5K8N A;  2I00 A;  2G9D A;  2R98 A;  2V8H A;  3LMS A;  1IYK A;  3S6H A;  3DGV A;  3GLJ A;  1ELL P;  2RB7 A;  1V0C A;  4CAE A;  4OC2 A;  4P4E A;  3S6G A;  2VBQ A;  4QB9 A;  1AYE A;  3H8G A;  2JEW A;  2ZOG A;  3ZJ0 A;  1RTQ A;  4UEF A;  2PVV A;  3FH4 A;  2PJ9 A;  3MRU A;  2WPW A;  2Z3K A;  3IWG A;  5IX3 A;  3I9S A;  1CBX A;  4C2X A;  4MCQ A;  1WK4 A;  2ARH A;  1ARM A;  2OZU A;  2WYR A;  3EFA A;  3CPA A;  2B4B A;  1B6B A;  3TC8 A;  4U9Z A;  4OKO A;  1XMT A;  2V77 A;  2P6F A;  1MJ9 A;  2AFX A;  4CYQ A;  1VHS A;  4RI1 A;  4LQG A;  4X2T A;  2ZPA A;  4Q36 A;  5D29 A;  3IO1 A;  3D67 A;  1NSA A;  3T9Y A;  4OC5 A;  1ZG7 A;  2JDC A;  2HQY A;  2WPX A;  4DUK A;  1ZLI A;  1UWY A;  4JD6 A;  2PRB A;  4P4D A;  4OC0 A;  2OOT A;  3HLP A;  5J8F A;  4OAE A;  2C6P A;  4F0X A;  1HDU A;  2B3V A;  4ORF A;  1FNO A;  4OLL A;  4UCM A;  5AG5 A;  3TE4 A;  3DR6 A;  2ZW5 A;  3PB7 X;  3CXS A;  1KUV A;  3FYN A;  2CF4 A;  2ZEF A;  4PXB A;  4A94 A;  2NMT A;  3TO6 A;  3T8W A;  3KQX A;  4M6I A;  2IQ6 A;  3TCV A;  3MN8 A;  5ELY A;  1TIQ A;  4NXY A;  3SJF A;  1ARL A;  2GE3 A;  2QJ8 A;  3FVL A;  2R1I A;  2XEG A;  2Z10 A;  3F5B A;  3I1U A;  2CXA A;  2F8H A;  4IHM A;  3KAS A;  4X8I A;  4B5O A;  3NE7 A;  3SHP A;  4KOX A;  4X5K A;  1BOB A;  2BUE A;  3B3V A;  1L0C A;  2Q7B A;  4R7M A;  2FT0 A;  3R1K A;  3VAR A;  2YNE A;  1PCA A;  3CT9 A;  1AMP A;  4IUS A;  4KUA A;  3KI9 A;  5HH1 A;  2Q04 A;  5HMN A;  2PJ3 A;  3T90 A;  4UEE A;  1LFW A;  3N5F A;  4P4F A;  4B13 A;  5CPA A;  4C2Y A;  4PXD A;  2P0W A;  3QAH A;  3DR8 A;  4KSF A;  3DDD A;  4H2K A;  2PIZ A;  2G0B A;  4PSX A;  1Y0Y A;  3H8F A;  1F2P A;  2PJ6 A;  4NGN A;  4UWI A;  4MHZ A;  1CP6 A;  5F48 A;  2FSR A;  1JQG A;  2BEI A;  3TOA A;  1YK3 A;  1YR0 A;  1F2O A;  2PE3 A;  3D2M A;  1YRE A;  4YGO A;  4H89 A;  3NA6 A;  4B14 A;  3ISX A;  4CGL A;  5THW A;  2ZEM A;  2AFS A;  2BL1 A;  4CGN A;  5JQ4 A;  2JBJ A;  1XOV A;  5HVF A;  2OZG A;  3D7D A;  2C6G A;  4AVA A;  3QAY A;  4GS4 A;  4AVB A;  3R9F A;  2POK A;  4F9V A;  2PR1 A;  2ZW6 A;  5H86 A;  2JBK A;  3SI0 A;  3K9T A;  4B6Z A;  2CTC A;  2Z3M A;  4YRH A;  5LYF A;  1IY7 A;  4BMH A;  3PZJ A;  4P44 A;  3KHZ A;  2ZEE A;  4BIN A;  2WZN A;  3D3S A;  2CNT A;  4LQ6 A;  2OH1 A;  3WR7 A;  4YFJ A;  4M85 A;  3TOB A;  1YW6 A;  1CPX A;  1RXT A;  1ON0 A;  4RUH A;  4P10 A;  3IWW A;  3IEH A;  3B2Y A;  2DPT A;  1YSJ A;  2PRQ A;  4L8A A;  4P4J A;  4CYN A;  1YME A;  5JM6 A;  4EME A;  1SQH A;  3IC1 A;  2ABZ A;  1ZG8 A;  1Z8T A;  5H84 A;  4KOY A; 
#chains in the Genus database with same CATH homology
 2ODF A;  1XOV A;  1JWQ A;  2Q7S A;  4EFD A;  4RN7 A;  3QAY A;  3CZX A;  4M6I A;  4M6G A;  5EMI A;  2HC9 A;  4M6H A;  3NE8 A;  4BIN A;  2HB6 A;  4LQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...