3CT9A

Crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
353
structure length
346
Chain Sequence
YDIPTMTAEAVSLLKSLISIPSISREETQAADFLQNYIEAEGMQTGRKGNNVWCLSPMFDLKKPTILLNSHIDTVKPVFTPREENGKLYGLGSNDAGASVVSLLQVFLQLCRTSQNYNLIYLASCEEEVSGKEGIESVLPGLPPVSFAIVGEPTEMQPAIAEKGLMVLDVTATGKAGHAARDEGDNAIYKVLNDIAWFRDYRFEKESPLLGPVKMSVTVINAGTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNSSRIDEKHPFVQKAVKMGRIPFGSPTLSDQALMSFASVKIGPGRSSRSHTAEEYIMLKEIEEAIGIYLDLLDGLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylornithine deacetylase
publication title Crystal structure of a Putative Zinc Peptidase (NP_812461.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.31 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
total genus 101
structure length 346
sequence length 353
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ct9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ct9A01
1LFWA 1HDUA 4F9UA 2PCUA 3KL9A 4MHZA 4DUKA 1Y0RA 3NH4A 2IQ6A 3PRTA 4FAIA 5ELYA 1LAPA 4IHMA 1CP6A 1NSAA 5LYLA 3NA6A 2ANPA 2BCOA 5K8OA 2EK9A 1KWMA 4UEZA 1LANA 3IO1A 3K2KA 2GU2A 3LMSA 4W9YA 1BAVA 2F7VA 3WC7A 4NJQA 2ABZA 4P6YA 1JQGA 1TF9A 4X8IA 4R76A 4P4JA 2CTBA 1IGBA 4PQAA 4OC2A 3LWUA 3SI1A 2PJ3A 4OIDA 2PJAA 1AYEA 4A37A 1Y7EA 4TNUA 7CPAA 4P4FA 1CP7A 2PJBA 3PB6X 4ZY0A 4YWYA 5LRGA 4ZY1A 1VHEA 3T8WA 1ELMP 4X3RA 3PEIA 3D66A 1F2OA 2OR4A 3D7HA 3B35A 2PJ2A 4AXVA 3TX8A 4UEEA 4NJRA 4ZY2A 3IC1A 2GLFA 4OC4A 3D4UA 1CBXA 2ZEMA 2C6GA 2AFOA 3D7FA 1VHOA 2CF4A 2PIZA 4NGNA 2ZOFA 2CTCA 1DTDA 3KGQA 2QYVA 2PJ6A 4EWTA 2EWBA 2PJ4A 3FVLA 2QJ8A 3FMCA 3IWWA 3D7DA 2ZENA 2GLJA 1YW6A 5THWA 1XFOA 4OC3A 3ISZA 1YMEA 2PRQA 2AFMA 3KI9A 3WC5A 1HEEA 2C6PA 1ARLA 2Q43A 1CG2A 4MHNA 3VATA 3IEHA 3WABA 2ZEEA 1LOKA 3KHZA 4MHYA 1BPNA 5I4MA 1AMPA 4R8FA 3QNVA 2WYRA 4OKOA 2V8GA 3FJUA 3RZAA 2G9DA 1YW4A 5IB9A 2IMOA 3VH9A 1Z5RA 1TXRA 3CPAA 2PJ9A 1GYTA 2CIJA 2POKA 2XEGA 3KQZA 4MHPA 1M4LA 2RB7A 4A38A 2XEIA 3PB9X 3WC6A 4R6TA 1YLOA 2XEFA 4OIWA 1EE3P 4NGPA 5HXDA 4MXUA 5HVFA 1CPXA 1PCAA 3CPXA 1LAMA 2ZEFA 3H8EA 3FX6A 3IIBA 3I1UA 1UWYA 2EK8A 5K8MA 4UEFA 1RTQA 2JBJA 4Q7AA 2PJ0A 4OC0A 5LYDA 2PE3A 2XEJA 1Q7LA 3BXMA 4JZ0A 4PPZA 4NGSA 3FECA 1TKJA 3BI0A 5JH9A 4TWEA 3NFZA 5HVHA 1DE4C 4MCRA 5LRJA 4PXEA 1VIXA 3K9TA 3HUVA 3HLPA 4NGRA 1R43A 4ZYQA 3SJXA 3V7ZA 2ZEGA 2BO9A 2Q51A 2PJ7A 3FH4A 2C6CA 5LRKA 3KASA 2NYQA 4ZX9A 1FT7A 2AFXA 4YU9A 4LQGA 8CPAA 3RAMA 3FEDA 2V8DA 4B6ZA 2HB6A 2WZNA 4DJLA 2O4HA 3B3WA 4P45A 4JYWA 3L2NA 2ZEOA 2OOTA 3SJEA 1XJOA 1CX8A 5J1QA 3S9LA 3KR5A 2DEAA 3B3VA 1QMUA 4UIBA 4P44A 4MCQA 3DLJA 3PB8X 4IAVA 4O23A 4P4IA 3PFEA 1ZLIA 4DYOA 4Z65A 2AFWA 5JGFA 2AFUA 3NH5A 3GUXA 3SI2A 1H8LA 1ZG7A 4EMEA 2J9AA 2ZEHA 4CPAA 1IY7A 5D29A 3RBUA 4UIAA 3DGVA 3PFOA 5K8PA 3MRUA 1Z8LA 3B3SA 1ZG8A 2V77A 4NFRA 5DS0A 1TF8A 2ZOGA 4ZX8A 1XMBA 2PJ1A 3S9MA 3TC8A 2ZELA 3D7GA 4K3NA 3B2YA 4RUHA 4WJBA 5CPAA 3IJ3A 3SJGA 3B7IA 4FBEA 3SI0A 3B3TA 2GREA 1F57A 2F8HA 1VGYA 1FNOA 4ZI6A 2BOAA 3MN8A 3FF3A 4MRIA 3S9NA 2ZEDA 4G1PA 2PJ5A 4FWUA 5D8NA 2JEWA 4R7MA 4A94A 4BD9A 4OC1A 1BLLE 4NGQA 2PJCA 4P4DA 2IJZA 4MMOA 3KZWA 3KR4A 4FUUA 1TKFA 1QQ9A 4GM5A 4P10A 3VARA 2Q4ZA 1ELLP 3WT4A 4MCPA 3D68A 1Z2LA 3H8FA 1PYTB 5F09A 3V38A 3GLJA 3H8GA 4UF4A 2PIYA 1ARMA 4PXDA 3CDXA 2O53A 2ZEPA 4PXCA 1ZLHA 2AFSA 3B3CA 2V8VA 4H2KA 4OC5A 4P4BA 1OBRA 3IFEA 1YSJA 1CPSA 1TKHA 1R3NA 6CPAA 1XRYA 5CBMA 5LYFA 1LCPA 2I3CA 2HC9A 3KQXA 4EFDA 2PVWA 4KSIA 4NGTA 2C1CA 1XBUA 3PBEA 2RFHA 3CT9A 4A39A 1BPMA 3BI1A 1ZG9A 2AFZA 2JBKA 2NSMA 3BHXA 3FEEA 4MCSA 3PB7X 4F8ZA 4P4EA 2VL1A 1Y0YA 3NH8A 1F2PA 4X2TA 4NGMA 3SJFA 5K8NA 3GB0A 3JRUA 5HVGA 4F9VA 4OMEA 2QVPA 3PB4X 4WWVA 4OP4A 5JM6A 2PVVA 3D67A 3ISXA 1HDQA 3KHXA 3N5FA 2FVGA 2V8HA 4ONWA 5LYIA 2PJ8A 4PXBA 3PBBA 4IK2A
chains in the Genus database with same CATH superfamily
2Q44A 2PFDA 1VQOS 3AODA 4B02A 3KL9A 3CXSA 2HRYA 2RC4A 1JJHA 5HO4A 5GAEU 4ILLA 4MI4A 5KFWA 1CJTA 5LYLA 4LREA 2IBKA 4QYZK 4B3TJ 1J2VA 3FCHA 1IICA 3W60A 2Y1JA 2W8KA 4UEZA 1SL0A 4GKKF 3N6NA 1L5UA 2AKWB 3BJ8A 2B5JA 3FBCA 7AT1B 4RU2A 2J8AA 3M2UA 3PG9A 4OX6A 2MKJA 3O8WA 3EUNA 4OIDA 3CCMS 1KD1T 3L7PA 4LRAA 2LQ5A 1IUJA 3DOMB 4TNUA 2KJWA 4JP8A 3MTJA 2A2CA 3WBZA 3CJ3A 1ELMP 4WK1A 2BW2A 4F25A 2OEKA 2CQIA 1GAOA 3B35A 3NWGA 4H4OB 1LEOA 3GIUA 4CAXA 3TAQA 3D4UA 4H6ZA 1FD2A 2GQCA 1IQZA 1ZAVA 1ZTWA 3ILIA 1YREA 1QSYA 2L48A 4DSKA 1XC9A 4DV5F 3T1HJ 2XY7A 1YVKA 5J8FA 3AB2B 3NS6A 4BCAA 2DNNA 2WHOA 4XPDC 2OEJA 2DNMA 1UEKA 1SJ4P 1EHWA 1BQMA 3K5MA 4OX9J 4B5PB 1NZ8A 3ZC4A 2DHHA 3DSBA 1G1XA 3OFFA 2ZWPA 1U45A 3Q86A 2R7VA 4GVBA 3FYNA 1YLXA 4ZHRA 2OO4A 3QQCD 2W7OA 2DO4A 4ED5A 1RYRA 5AG5A 2DRAA 3LAKA 3U27A 3ILLA 1VRTA 4HH1A 2UVVA 1P0HA 4GKKJ 1YVFA 1GHEA 5B09A 1EE3P 1LWCB 1NSQA 4PWWA 4RW7A 1ZO0A 2K1RB 4B3RJ 5HVFA 3PW7A 4P71A 1C0UB 3MAAA 5K8MA 5KG2A 1RWVB 2JBJA 2G2OA 5HBMA 5HN0A 5MAOA 3GWCA 4MFLA 5A8WA 2XNRA 3WDOA 2QL9B 2BA9A 2DEJA 3IBFB 3QAHA 2VA3A 1B6BA 4F2SA 3H2VE 3QT5A 3MEGB 3ENVA 3B4MA 4O4GA 2REFA 2BO9A 2F5IA 4EU0A 2CG8A 2I5JA 2J8NA 2LXIA 3I0SB 3J81U 3K9UA 4DV5J 3HHDA 2DHAA 3LWLA 4Y65A 2LU1A 3WIVA 1XN9A 1ZAXA 4YY3F 2D4OA 4ZJLA 3IP0A 1KHWA 3CCQS 1Q2DA 2H5IB 2AE6A 3T5JA 4P45A 4JYWA 2YQ3A 3D0HE 1MMNA 3W2WA 4J5OA 2H5EA 4DF8A 1RACB 2FQQB 4MKBA 1SKWA 2R7XA 2UVRA 4Z65A 4IRDA 2Z0GA 3EXYA 3VF0B 3VR1A 3OUYA 4EMEA 1PIEA 4UFWA 1A0OB 1LW2A 3GTYX 4FDFA 3FZBA 1FEEA 3ADAC 2OPPA 1PILA 3ULHA 3FCWA 1TF8A 3GY9A 4XPKA 4KHMA 4R0EA 2AGQA 3AA8A 1PC5A 1LWFA 1XMBA 2PJ1A 2L3MA 4I56A 5F9NA 4IRKA 4CH1A 4TYAA 2WSCC 4DL7A 3DRPA 1WORA 4LF2A 4HNYB 1N34F 5HQMA 3DNCA 2W1BA 4HHHA 1WC0A 4AQYJ 4X5KA 4CRZB 1MMLA 2C1EB 4ZPCA 2BOAA 2V6AA 1WTFA 3GMGA 2C3MA 2MY7A 2Y0SD 1RHJB 1U1PA 4ED2A 3SXNA 5L1JA 3MUTP 2PJCA 3THVA 3UDCA 3TJ8A 2OTJS 2K3KA 5ETNA 4FD5A 2IJNA 4OLPA 4EFAC 1YQEA 3KLHB 2GAHC 1FE0A 1IBCB 1FKAF 3OL9A 2G0BA 1N48A 3VGSA 2YNIA 3Q22A 5HATA 5KG3A 4QIGA 3KLGB 1KTQA 4YY3J 1GMWA 1IKYA 2HHXA 1XWLA 3GQCA 5LXYA 3MFHA 1UJ5A 2HPUA 4CS0B 1JX4A 3ITHA 3MMCB 4N8OA 3DLHA 3I87A 6FDRA 1RCOB 4U7CA 4OI3A 4NYPA 2CQ3A 3CO9A 5K5MA 4QW8A 1R0AB 4C48A 2HNYB 5GADU 3H5ZA 2FC9A 2RKIA 3HVRA 5D0GA 4OJ3A 1BMQB 4K7QA 4ZLJA 2LQJA 4P4EA 2OJ3A 1PBUA 2DGTA 7FD1A 3KLIA 3C46A 3JQJA 4EZ6A 1N34J 4KOVA 1T05A 2PVVA 3G8SA 1PAEX 2RRAA 3F44A 4KGKA 3IMQJ 4USVA 4EUVA 1V6HA 2E1CA 4UY8T 4A8KA 4B3SF 3CJ0A 3NXZA 3HF5A 3MMJA 4DL3A 1N33F 1F9FA 1VMBA 2VG7A 4CLKA 3CCES 1UW4A 5E3PA 2AYGA 1HHSA 2AGOA 4LUAA 1X4GA 3NS7B 4C4WA 2C2OB 1EP4A 3CD6S 3TAPA 4USIA 1AA1B 4K4WA 4QZVB 1V0CA 4B13A 1RJJA 4XPCA 2J6UA 2AHOB 3PRBA 1SQGA 4DQQA 3KUGA 1WDTA 1RTJB 1NMEB 4OZ2A 4WE1B 2E1RA 4AB7A 3BB5A 4ZVQB 4HI1A 2CJYB 1HNZF 3CWJA 1WEXA 1SV5B 4U6PA 4K4YA 5LRGA 1RTZA 1R8BA 4O3RA 5HSPA 1AFIA 4LSNA 3TT2A 1HNVA 1HL6A 2J0XA 1QVGR 2UUAF 4R8UB 3D0GE 3I0RA 1WNEA 4X62F 3K5OA 2B3VA 4AFFA 4HNXB 3PYFA 1FKPB 1Y11A 3HCXA 3M30B 2GVDB 4NI2B 4EWTA 2EWBA 4KOSA 2QT7A 4J9OA 1S4FA 2VFSA 4WK3A 1APSA 4HI2A 2FHOB 4P9SA 2E66A 2XSJB 5AE2A 3M6UA 2QA4G 4DL6A 1HA1A 1YJUA 4U67Q 4NZ6A 4CAEA 5L8RC 2Q3PA 4IO1A 3T9NA 1NK0A 4B3SJ 1AZSB 1AMPA 4FYVB 1VYAA 1A2ZA 3NAIA 4LQ3A 1N33J 4H4MB 1NEEA 3VCDA 4NCGB 2QGFB 4F0XA 2HUZA 3MEEB 1RT5B 1TL7B 1S0MA 3SXOA 5LSRA 2CZVC 2LYVA 5IQQA 3KQZA 1FFSB 4DX8H 4ED7A 1LW0A 1CBKA 3SCJE 2RVJA 2H4WB 2HVEA 2J7WA 1K4JA 1CSJA 3BGRA 5J2NA 3Q8SB 3VGVA 1FXLA 4I6YA 1NK5A 1B0PA 1HNZJ 4XDDA 1X9MA 4A95A 4LUBA 3N4WA 3K5LA 3BXMA 2EXUA 2VC0A 1IXKA 1PJ7A 2YH0A 4ZBGA 4PXEA 4KOYA 2D69A 4OL8A 1R43A 1U2CA 2OP5A 1MJ9A 2UUAJ 1FK9B 4EBEA 3DHWC 2P6TA 2HW3A 4X62J 4KV8A 2YH1A 5B0DA 3MAQA 4CRJA 4QWAA 4ZP9A 2HVHA 1FY7A 4WTYA 4MFPA 3CSKA 2CZ9A 2DNPA 1U1OA 5D3GB 2RQMA 2I9SA 1YJVA 1IKWB 2CQ2A 1ZPVA 3TE4A 4ZVHA 2YKAA 5J2QA 6FD1A 2AGPA 2BL1A 1B4SA 3PJ9A 3KHHA 1K73T 4ZP7A 1RLCL 3TUZC 2I38A 2B4OA 3EVOA 4CLPA 1PAUB 1B99A 2CQ1A 1Z8LA 3BO2A 5L1LA 1X4HA 4F4XA 3KWMA 5FDLB 3C3LA 4WP3A 4P73A 2MLXA 5KT5A 2PE8A 1P4NA 1T9TA 4DU8A 1KHVA 1VQKS 2IDLA 3KK1B 1RAGB 2CPZA 1JLBB 2M4MA 1OYEA 2JNJA 4MFBA 2W2MP 1A7GE 1JK9B 2CKWA 4ITSA 1P1TA 5KFAA 2BKNA 3LPEA 2YGWA 1VRUB 4MT1A 3OR2A 4Q44A 2YQ1A 1YIJS 3F56A 4KKOB 1U48A 3RYOA 1UEUA 3OSNA 1Q82T 1TL3B 3EX7B 4HT5A 3BGFA 4LRBA 4CT9A 2XSFA 4ETZA 3R9EA 2IA0A 4B9NA 2PIYA 4KH1B 1EAYC 4Q36A 5ETOA 2GX8A 3QGHA 3NGUA 2HGNA 1SC1B 5I0CA 4CLZA 4B3OB 3T1AA 4V19X 2DY1A 2NXUA 4O44A 4OX7A 2H3EB 2VD3A 3BV8A 1MJBA 2FL4A 3NRBA 5J2PB 2VOPA 3CEDA 3J7ZT 3L7OA 5E41A 3SCIE 2Y3YA 4KSIA 3VAKA 1T7PA 4U5YA 4ZCLA 3MUVP 4YDDB 2F3JA 4DSIA 3HM9A 4UWIA 3H42A 3B4DA 4RW6A 5CD4H 4NCBA 3CIZA 2V5HG 4LFAF 3R2CJ 3AOAA 2LQBA 3PGPA 4UBRA 4OMEA 2X1GA 1HQEB 3RNZA 4NEYA 4MHDA 4DSLA 4IG0A 4A8YA 5F8IA 3IGRA 3W5XA 3PBBA 1HARA 2B4UA 1IJEB 4JB8B 5AT1B 4CQ1A 2WB4A 5B0GA 4F9UA 4F6AA 5IXUA 4DCOB 1YLEA 1NK4A 1RU2A 1J5EF 1GEHA 2O3DA 4RWXA 3UN2A 5SUHA 1HBMA 4KHPF 3UPFA 3BH7B 5KT2A 2GIQA 3NCQA 4NXMF 4QWCA 4J9KA 5KFMA 3WX8A 3WC7A 2XEXA 1JQGA 4KOWA 3EICA 1TVRB 1Y7EA 2I8EA 2B5GA 4ZY0A 4FS1A 1VHEA 1LWXA 4CO2A 4X3RA 3V5RA 1DAXA 3D66A 4R3KA 4CO0A 5I3UB 1HWJA 4G1QA 4ZIVA 1ZA2B 4C8OA 3I4PA 3KHLA 4I6WA 4TN2A 1FWLA 3Q24A 4UZBA 2QZ8A 3PJWA 2R7OA 2IPOB 3CMQA 3GFZA 4LFAJ 5F0UA 2UUTA 3SIPB 3DFEA 4DF4A 4WU3A 4H4KA 4CLSA 1HNIA 1TKTB 2XZTB 4EK2A 2B0GA 3MPUB 4PG6A 1YW6A 2YNFB 3K8VA 3HFZB 2XLIA 2H5JB 3JQMA 4QYRA 4OYBA 1RXOB 4ZJOA 4X4PA 4D3GA 3MTKA 4A2ZA 3WABA 3ZTOA 2RU3A 2YWFA 2MZ1A 3NNCA 3KXDA 2G9DA 4JI1F 1YW4A 3VALA 1Q78A 1J5EJ 3QIDA 1KNZA 2BJ7A 4B11A 2AJ6A 3ZZPA 4KHPJ 1R8PA 1Q0NA 3BSCA 1CQNA 3L4BC 4V19J 4B5PA 2P0WA 1VHFA 3M1VA 4NXMJ 3W6SA 5G4DA 2KRBA 3SDEA 2Q0YA 2E5LF 4FD7A 1RAIB 5BYRA 5IT0A 3AT1B 1XERA 3GFYA 4XO0A 2DGQA 5D6GA 3KG0A 5CYQA 3MPDA 3OTDA 1GT8A 2FIUA 2YPYA 5F9LA 4LSLA 2WSEC 3QGGA 1KFSA 2JOQA 2YKMB 5HVHA 1DE4C 4TY8A 2NZ4A 4NLYA 2M9KA 1S5KA 4ZYQA 5GAHI 3HZEA 3S6HA 4G65A 1S1XB 1SC4B 3VAIA 3NAHA 1C0UA 2WRMA 4HEA9 4CO5A 2H48B 4J9QA 5LRKA 5J2MA 3W8PA 3TVZA 3JVNA 1S97A 5KFNA 1HBNA 2HHTA 4YRHA 2LDYA 3LP0A 4WFZA 1FEHA 4P44A 2F4VF 1VQ8S 4PKDB 4MCQA 2AYBA 1S1TA 2V69A 2D9PA 4X64F 1JLAA 2D3ZA 1U49A 1NDKA 3ZTQA 3JB9k 4WFYA 3IM8A 3SI2A 1ZG7A 2OD4A 4JI1J 1GMVA 3QBCA 3GG0A 5EBVA 4YOEA 3MMAA 3BR8A 2D3OR 1S6QA 2YKNB 2ZBRA 1YJ7A 2B4VA 1S7KA 1WC3A 2ZZMA 1UAWA 2ZELA 2E5LJ 1I51B 3UFCX 2IY5B 4DLEA 3EDRB 4ECRA 2GMJA 4FBEA 4U9RA 1R27B 4TQSA 3TYTA 1YKWA 4OJGA 2P6FA 5T7LB 3AXKA 4QBUA 1SBRA 4DS5A 2CNSA 2QA1A 4AYBD 4PUOB 4FWUA 2Q7SA 2DPJA 2DPTA 4OC1A 3GCXP 1ZPWX 3MR5A 4ED8A 1NK6A 2ZDOA 4JI5F 1ITPA 3DM2A 1QQ9A 4NLQA 4ZP8A 3UVJA 2OU2A 2B8PA 1HW9A 1VQNS 2KXNB 1N5QA 5F09A 4CH0S 3CPWR 3M8PA 3N6MA 3MURP 4O3QA 3M32B 2XNQA 2F4VJ 1U6ZA 2GANA 3CJQA 4CTAB 8ATCB 3PV8A 1RTHB 2OFHX 4X64J 4OADA 1YJWS 3MM5A 2HC9A 3QAEA 2BACA 4E98A 3EYZA 3CT9A 4LRCA 2AT1B 4CO4A 2NSMA 3EPGA 3OL7A 1MU2A 1VQLS 4WFXA 4MCSA 4HKFA 2J6SA 1WF0A 4ZS6A 3B78A 4KOTA 2L9DA 4RWWA 1VLOA 3LUYA 3T6BA 2ZXVA 2ZJPQ 2E7VA 1B0VA 5HMYA 2NCKL 2WOMB 5KG4A 1R0AA 5D0HA 3RRKA 5EDWA 2EW9A 1N5VA 1R31A 2GV1A 5H9EJ 3ISND 1IR1A 4KGZB 2KFZA 2IQ6A 3SSQA 3I9ZA 1LAPA 5RUBA 2QMWA 4C2XA 4IH7A 4JI5J 5LXRA 1RT7A 2QA4S 1KRPA 4GC7A 2EK9A 2XYHB 4MK9A 3IWXA 2D9OA 3LAMA 4ZVFA 2D74B 2DNKA 2OFGX 2PR8A 4F0YA 4DN0A 1QLNA 1FJGF 2HHSA 1CJUB 3ET6B 3NWRA 3LWUA 1DFDA 5IV4A 3HHLD 1ZM4A 4ZN3A 1HD0A 3UE2A 4X2BA 5IWAF 5KT7A 3PB6X 2P9GA 4NLXA 1UA1A 2OLWA 3KJFB 1S3ZA 1F2OA 4PCQA 4KORA 4ZY2A 1XEZA 2GLFA 2JVOA 5DGAA 3DOKB 1JIHA 4WE1A 4DR2F 3PW5A 1UTAA 4ZVRB 4MTPA 3OPKA 2L9WA 4X4VA 4I7FB 2ASLA 4JV0A 2KFNA 3FVLA 3KK2A 3DOLB 2ZENA 1Z9UA 4KS9A 2ASYA 2VPZB 5KG1A 1QSRA 1FT8A 2NR0A 3FBBA 3G2XA 4FPIA 2R1IA 1S57A 2KXHA 2Z3KA 3HKWA 3BQ0A 1RTDB 3C2PA 1BWVA 4EYIB 3PY8A 1YJ9S 1N0UA 3CJ5A 1S10A 1Q8LA 2QG9B 5IFMA 1FKPA 3QNVA 4OIXA 3FJUA 3RZAA 4F4WA 1K47A 1Q7LB 2MKKA 1TUWA 1Y9WA 3I82A 3CJRA 3W9JA 2X7IA 2RE1A 3H5SA 4FVCA 4UUXA 4J9UE 4M1KA 4W90B 1KP6A 2J0QD 3F41A 4JWPA 4RNNA 2GNKA 4XK8C 3SCLE 4QYZJ 3LF0A 2FT0A 1JLGB 3CXQA 2UUWA 3DLEB 2XEFA 4OI4A 1Z8TA 3AOCA 1G4CA 1FJGJ 2ZEFA 1XNRF 3GIRA 3MUMP 1HMVB 3HSDA 2JDCA 5HQLA 1YX0A 3TOBA 2DISA 4ECYA 1H3DA 4PPZA 3EJMA 3LA0A 1N54B 5IWAJ 1MWZA 1RT5A 4J3GA 1QDUB 1ZA1B 1TL1B 4AXJA 2EG1A 5DG9A 2Q04A 3VVUA 3H5YA 2OD6A 5CYJA 2HNZA 2CQBA 2W9CA 3D6FB 3KLFB 4DR2J 5J1EB 5L1IA 1NHVA 1FT7A 2AFXA 2OGUA 2V0NA 1S0NA 1WEYA 3L2NA 5A6WA 3IRXA 4XPEA 4R5PB 2RRBA 4MYUA 1LK7A 2R4FA 2JL9A 3S9LA 4NLSA 2N3LA 2FVSA 2RNEA 4I2PB 1KVIA 3OVBA 3DCAA 4LF7F 3GFHA 3ZNUA 2I2YA 3H90A 3GV7B 1C1CA 4USJC 4DV6F 4OZ3A 2E44A 1U1LA 3X3UA 1VJQA 3EC4A 1H2TZ 2GJ2A 4ZX8A 2FB0A 2F9DA 4Y2KA 5F41A 5B0FA 3D6MB 3PKMA 1ZM9A 4WJBA 1PGZA 3OL6A 4UT4A 1UA0A 9ATCB 1CS4B 2O67A 1F57A 1XNRJ 4WYWA 2MXYA 4FNIA 3VTIA 4KLVA 5KG6A 2K7JA 3CJKB 2HIYA 5DRKA 3UDEA 2CPEA 2GC8A 4HACB 4ZKAA 1IM4A 1YG0A 2NMTA 4KOUA 5C42A 2V8PA 3A8KA 5HLFB 1LK5A 5DWMA 3HVAA 4NASA 4UCPA 1N5YA 4OHXA 3PX6A 4C7IA 4X4OA 1BQNA 4QUSA 2R3VA 2HQFA 3AOBA 5JQ4A 1F1BB 3WT4A 1YDLA 5GMDA 1TIQA 4DR4J 2RDJA 1NK9A 2DGOA 3GV5B 2Z0ZA 2RQKA 2DVIA 3SXLA 1IR2A 2ZC3A 5G1ZA 3IM9A 2I00A 3FXTA 4JXRA 3PEJA 2PSZA 2PIIA 2XYGB 6CPAA 2HAIA 2R7QA 4CLTA 5CBMA 1HYSB 3I96A 2CPFA 1RCXB 4LF7J 1RHUB 3LWMA 2DNHA 3KQXA 4L3KA 1RSCA 4GKJF 2HK2A 1SKUB 5GAGI 3WC0A 4X66F 2VIHA 1RADB 4DV6J 2M2BA 3SFUA 5HL7Q 3SYZA 2AFZA 1NDLA 2FHJA 4DPWA 2QEXS 2Y1RI 1S12A 3PB7X 3O44A 1Y0YA 5E0OA 4AUKA 3GSIA 2JH3A 4F50A 3D1OA 2ZD1B 4NLTA 2WCXA 4N8NA 5M2RA 5J2PA 2ZDPA 3WHIA 3WC2A 1KR4A 4C97A 1V3RA 1NH7A 1HFEL 1QSTA 4MIWA 3JSBA 2HZVA 2QIFA 3ZZ0A 1S1WA 4EO6A 5AG7A 3W6XA 1PBAA 3VAFA 3ZZTA 4M85A 3HHLB 1N5TA 3V6DA 2FJDB 4WWSA 4I64A 1YHQS 1NK7A 5AG6A 1HQEA 4L8AA 2CNOB 5KFEA 1T02A 2ZW4A 2F7VA 1RWPB 4NJQA 3MR2A 5AG4A 4FF2A 4P4JA 3R5JB 3L3CA 1OPZA 4MH8A 4OV1A 4M5DB 2IRYA 3SEOA 2IYGA 2HQYA 1BXNA 3RBXA 5EX3A 3QPIA 1V5VA 5E3QA 3AJ2A 2C3PA 1UWBB 3D7HA 4BC9A 5AJ3F 2YNEA 1MMDA 2DNRA 4A8QA 4X66J 4Y6IA 4CAWA 1LWEB 2VJVA 1GK8A 3SFGA 4JI8F 1TVRA 1U1NA 2IM0A 3BGUA 2NYIA 2PJ4A 2MZJA 2A6MA 2CQGA 1WHWA 2P6GA 1JKHB 4D3HA 4OC3A 2RUGA 4I6AA 3IRWP 2NQPA 1ARLA 2Q43A 2MLYA 3M2VB 4X4QA 3F5BA 3M8ZA 3NMAA 1Z4RA 1JLCA 2DBBA 2ZEEA 2X51A 5CYMA 2QL7B 4OKOA 3KG1A 4USMA 4A30A 3Q2SC 4PQUB 2GVZA 3OWCA 1RAEB 2BRKA 3NEKA 9RUBA 3UR3C 4F4AA 3C6TA 3ISNC 1S49A 2CIJA 4RNFA 1YVOA 3OV7A 4Y34A 3AH6A 2CNMA 2VBQA 5EWGA 2GE3A 4CZCA 2DXDA 1X4FA 2ZW6A 5JVHQ 3G82B 1KBRA 3HHKA 3NOGA 1GX6A 3FRMA 4NLRA 3OTOF 1TKXB 2QLJB 3QIPA 3TA0A 3E2EA 3M9NB 1KVKA 3PVXA 4DWIA 4Q7AA 4OAEA 2XY6A 4NLPA 5LJ3Y 3QJLA 4Y2MA 1AW0A 3W2VA 1U0HB 1GXTA 3HHLC 4RN7A 2IC3A 2J76E 3RUBL 3BR9A 2Z10A 5LRJA 3J7YU 2ZKTA 2R42A 5AJ3J 3MFIA 4YEAA 3V4IB 1NSLA 2ZEGA 2BM1A 3PHEA 1Z4EA 4JI8J 5KFRA 2LA6A 4TKTA 5DG8A 3KK3A 4IG3A 2C2ZB 5A0YA 5A6PA 1R57A 2HMIB 2LFVA 3GJSB 3D4JA 1UL3A 2WZNA 3L09A 1MNEA 3CIMA 2ZEOA 2OOTA 2YKMA 2QFJA 4RR5A 1I94F 4ED3A 3H40A 3VWSA 2VQYA 3W9IA 4ORFA 2AQ4A 2ABYA 3M8QA 4IR1A 2HHPA 2ALYB 2ASJA 1DTTA 1L3KA 3Q8RB 1YJTA 2DR7A 4CAFA 1J5OA 1KQGB 3PFOA 3MRUA 1SPBP 1FJCA 1ZG8A 1HQUA 1GTEA 2HBZB 3ZZIA 2FPHX 2ZOGA 4DL0C 4IFVA 5C24B 4DQRA 2WB1D 4CRYB 2MHNA 2W4DA 3P8BB 5F8GA 1NJIT 1S6PA 3NBPA 1WOSA 2O1PA 3CUNA 3OJSA 3R1HA 3OTOJ 3CJ8A 2IYIA 3TJAA 1HPZB 3JYTA 3K7RA 1M90T 1D09B 1XMQF 4NEXA 2I6WA 2FJAB 2QSWA 3DXSX 5DZ7A 3FNNA 3T19A 3QJPA 1SIWB 3GG1A 2BV3A 4FF3A 1BLLE 3BH6B 4WCEQ 8AT1B 1FFGB 2VC1A 2XWXA 3KZWA 1FCAA 4ZVSB 4GMKA 4P10A 2GCFA 2VG5B 4RNOA 2B9EA 1Z2LA 2P9EA 4ZK7M 1TAUA 2B6AB 1CEZA 2W2OP 2VG6B 2NSCA 3T3FA 3HFVA 2DH9A 3CDXA 1VDHA 1D1UA 2MJUA 2YNCA 4OC5A 1YSJA 1TKHA 3CD5A 3WIUA 4KJIA 5LYFA 2MKYA 1WI6A 5C25A 1DTQA 3R7NB 2AJ2A 4F4KA 4Y2AA 1XJWB 3ZNJ1 2FIAA 3G4SS 2PA3A 2C3YA 4A39A 2IBOA 2DHGA 4QIWD 5ETMA 3KFWX 3W5YA 4ECTA 2XS7A 3FEEA 3HD1A 3SV4A 3SJFA 4RLEA 5HVGA 4F9VA 2DITA 2Z8QA 3EGWB 4L6V3 3G71S 3FFIA 1TAQA 4I0WA 5JM6A 5D4NA 3RR8A 1UFHA 4AVBA 1YITS 3GJTB 2FVCA 2FLLA 2FVGA 4IDKB 1XMQJ 3DYAB 1JB0C 2BUEA 2D4PA 2NUUG 1PG5B 4NLWA 3D0IE 4NA3A 2FSRA 3BN4A 3LOUA 1GFWB 3TVKA 4DUKA 4ID5B 3T9ZA 4YDXA 5ELYA 4IHMA 4KLWA 1VOMA 3DU6A 1VQ4S 1ZS6A 4U8VA 2KU7A 1ZOTA 2WOMA 4DR5F 3V6JA 2XMAA 4W9YA 5KFKA 3VWDA 3DDIA 1SH0A 3AXMA 1SL1A 3QRPA 3CJTA 2FTRA 1AYEA 2UUCF 3WX4A 2MQMA 3NNHA 1TKDA 1BQXA 3PZJA 3DKDA 3PEIA 3RR7A 1FKOA 4C98A 3IR6B 3NGSA 4DSJA 2CQ4A 3OLAA 3W61A 3WQPA 4NE9C 1FDBA 4DJBA 3UO0A 1XNQF 2DGXA 4C8YA 1XQIA 3AJDA 2RSQA 2CPXA 1T9WA 3DLGB 3ET6A 1SL2A 2CF4A 2PIZA 2R8KA 2I1RA 1QE1A 3TQ1A 2X3GA 1B7FA 1S99A 5DG7A 1IJFB 2V68A 1Q86T 4IFYB 5J1NA 2WK4A 1RO5A 1WHVA 4PWDA 3CZXA 3IEHA 3DOKA 4A8XA 5HMZA 1M4GA 5DS7A 1A9NB 3CC2S 1NDCA 3OFGA 5FIIA 1MN7A 3BSNA 3FSYA 3CPAA 1RU1A 1RAHB 2VONA 1VQYA 4X84A 1KTVA 3PNIA 1M4LA 3THTA 2HZCA 4DR5J 3WC6A 4WP9A 2VJUA 3FK4A 4I69A 2HHHF 5F8JA 1Q8KA 3RTVA 1U47A 3I1UA 1RT2A 4U7UK 5F8HA 3M7VA 4OQJA 3DC2A 1S9FA 2UUCJ 4ZJQA 1Q7LA 1QSOA 2CPJA 4ZVPB 1SC3B 2DRDA 3M8WA 3FSIA 1HBUB 3MMBB 4G3IA 2VH7A 3C19A 1TK8A 3EXNA 3NCRA 3RAQA 1VC6A 4M5GA 4NGRA 2IVMA 4CYPA 3DLEA 1XNQJ 3N01A 1FRMA 2J9EA 4JI3F 3TO9A 1U2FA 2QO3A 2ZFHA 3QSIA 4KB7A 2MGZA 1LFPA 4CYNA 2BMBA 5KFDA 3IN5A 2GFFA 4DXLA 3KNGA 2YNHB 4OFZA 5I42B 1TV6B 2BJDA 8CPAA 3OFEA 1XF8A 1X31C 3OVAA 2O4HA 3DMJB 1TL1A 2OAUA 2HRUA 5F3ZA 4OHZA 1IVZA 1FA0A 5KFBA 5HMXA 2BYCA 2CQHA 4F04B 3BQ1A 1Q8BA 3GE9A 4P4IA 4DYOA 3IR5B 3OSPA 2RHQB 3BZQA 2AYMA 4QC6A 3KLFA 1H8LA 4PK2A 2C3UA 4ONUA 2HQCA 3Q0AA 1QAIA 3KKWA 1ZZFA 2CG4A 3LP1A 2DGVA 1PJ6A 2XG8A 3TC8A 4Q43A 4I2PA 1N6QA 5LOQA 2LQ8A 4ZCKA 4ZITA 4F02A 2HHHJ 4OV6A 2VDIA 4ZA1A 5HROB 2O5DA 2GREA 3MD1A 3DRRA 2RDDA 2XMTA 3U1LA 5E7OB 2BRLA 2KTQA 5B0AA 5CNPA 3MCSA 2RUSA 1H6KX 2DHXA 2BABA 1UVIA 4PG5A 2YWEA 3OXLA 2KT3A 2CXEA 2GGPB 2VQEF 5KFLA 4C8ZA 1CJKA 4JI3J 2MQOA 3ZFVA 2HVIA 3P6YC 1KDNA 2AU0A 3KKFA 2PD1A 3PACA 3QATA 2FY1A 4JI6F 2BANB 3DLBA 4LFBF 3H8GA 1GXUA 1TP7A 1ARMA 1QSSA 2C3OA 4WYLA 2V9WA 1O8BA 2KB2A 1MW7A 2ROGA 2NS1B 4LBHA 2YKPA 4NPOA 2R7SA 5KFUA 3P2HA 1S7NA 3R96A 1Y0HA 4LBPA 4DOZA 4HR2A 1OY9A 1Y9OA 2IM1A 1DZ5A 4K4TA 3OTEA 1RQ0A 1HBOB 2BSWA 4NMLA 1YBTA 2C2NA 1ZG9A 1BUXA 4A46A 1CJVA 3MOZA 2W25A 3U7JA 3TCVA 2J8SA 4TY9A 2CNTA 5KOXA 2Q79A 2KVIA 2Z2MA 4BBYA 3F0NA 2BE2B 2FCKA 1H2VZ 3W63A 1HI0P 4UQTA 5DDRC 2FVPA 2R7RA 4PWUA 1U2RA 2E7XA 3PCOB 4R3LA 4A4JA 4GC6A 4TLRA 2ZUAA 3EVMA 3A12A 3FUYA 3F8KA 4HH0A 1LFWA 2DNQA 4DV2F 2J0SD 2PMZD 2GO8A 2E1MC 3IG1B 3KDOA 3B6BA 3PYEA 2VQEJ 2OPQB 1NSAA 3LD2A 2LU2A 2ZBQA 3E3XA 1VBXA 2OKQA 2ZVSA 5K8OA 3A4TA 2W2QP 1LANA 1E6VB 1U24A 1Y3JA 5A8RB 3M05A 3ZZOA 4KO0B 1EIYB 4ANDA 4JI6J 1RT1A 1SUQB 4LFBJ 2GMLA 3P4UB 1RXTA 1MSWD 2Z57B 2PC1A 2PJAA 2KHDA 2DXFA 2B43A 4R0JA 3T5LA 2IAJB 4LIWA 3DU5A 1HD1A 2PJBA 1R8CA 1RWOB 4KPYA 3D28A 4UTGA 1FX2A 1Q5YA 5GAEI 2OR4A 1GQEA 4EO8A 3KJNB 4P2MA 1FRIA 5ITHA 3KHGA 2WTFA 4CAVA 5BYQA 4DR7F 1G7CB 2EFGA 2MJNA 4B9UA 2XGPA 1CBXA 4KBIA 4OYWA 4QIVA 5G20A 1RWWB 3DGPB 3P5TL 2BJ8A 4QQBA 4JV5F 2VBYA 1TK5A 3EPIA 3QFHA 3ELHA 5KFHA 1VCTA 4IOBA 3CW2C 3C16A 3QO9B 4BS2A 3OD2A 4M6IA 2KT2A 2OELA 1DJ0A 2B9WA 1F5CA 2KN4A 1L3SA 2MZTA 2A0FB 4K2JA 2ZH8A 1JJCB 4DV2J 2KG0A 3TOAA 3NG8A 1M5OC 5IB9A 3H5UA 4DSFA 3D9BA 4M95A 1LXJA 4CDIA 2EKNA 1TXRA 1H2UX 1ZZNA 3W62A 3TJ9A 1F6TA 5A8KB 2A2DA 1YRXA 2V4QA 1JKHA 3R97A 2CAJA 3MM8A 5H9FK 1SJRA 2BE7D 4P72A 4KFBA 1EKRA 3LACA 2ZJQQ 2V2KA 1IWAA 2L9NA 3BS9A 2P6EA 5LMNF 2VODA 4KUAA 4O3SA 4J7CA 4C8MA 1RT4B 1YBUA 3OHAA 4KGVB 2MPUA 4NGSA 3Q23A 2UUBF 5FJ4A 2R2RA 1V3ZA 1GNKA 3OL8A 4DR7J 5D0RA 2ZH3A 1NKCA 2EBEA 3MCOA 3QLHB 1S9EA 3P3DA 2DNGA 4RNMA 2FJVA 1M1DA 1F60B 3E01B 3I9V9 2OHDA 1FD8A 1H7XA 3I55S 5E2QA 1AUGA 4UOHA 1V9OA 4ZIWA 2V9KA 4UFXA 4JV5J 1M1KT 4ZPDA 2DO0A 1Q8IA 2Q6CA 3PW4A 4Z7YA 3SBMA 2A18A 5EX0A 3TANA 3NP5A 4O3NA 1X7VA 5DM6Q 1IB1E 4NEZA 2YWKA 3RG6A 4HTJA 3QZ8A 2FD2A 2W7AA 2UVUA 2WW4A 1YJNS 2RF2A 1UMJA 3DLJA 2JC1A 3SQGB 1K0VA 4NRTA 2AFWA 2RMLA 2XI2A 4F0KA 2MQQA 3T9YA 3VGUA 2JWNA 2E5IA 4AL6A 5IZHA 1KS2A 2OSQA 1JXVA 2ZE2A 1MJAA 3BEGB 4RW8B 4P2FA 3P5BP 4I67A 2UXBF 3J81j 3HK2A 3ETOA 1S1UA 3C14B 4WBFA 4RBVA 1C0TB 1YR0A 2MSSA 1S0OA 1VS3A 4K4VA 3MR7A 3R7SB 5E33A 2C2MB 5LMNJ 4YFJA 2RS8A 3HSJA 2F8HA 3FNCA 4DG1B 5C7PA 4NYZA 2QMXA 4PYAA 4MRIA 2MZSA 4ED1A 3S9NA 2HWHA 4G1PA 2UUBJ 2CDRB 1JLEA 2AP6A 3HFKA 3TAMA 3QMQA 4IR9A 4M94A 1K1SA 3OTBA 4Z37A 2HS0A 2WONB 1BLUA 4B3RF 3MECB 3V81B 1T9VA 1BY9A 2FHKA 4DFJA 2CJBA 1TMMA 3PX4A 1AROP 4GXHA 3NCPA 2G2YA 2KM8B 5B08A 2M0GB 4FD4A 4UCNA 1CPSA 1IKVB 3H25A 1R3NA 4O3OA 2WW8A 4HVZA 4USWA 1VQSA 3CJSA 3OW2R 4WXOA 4KAIA 3TO8A 1ROFA 1RT6A 4WF9Q 2Z3OA 3S7RA 4P6QA 2F9JA 2Y1IA 5MLCV 2WVCA 5KFYA 3BI1A 3QGIA 4DPXA 3BHXA 3DRSB 4KY3A 2UXBJ 3D2WA 3TEGA 2VL1A 4I1TA 3NH8A 1T8EA 4DI6A 4DFMA 3QRQA 4A8SA 4CYUA 4CI0B 5L39A 2QVPA 4ZLPA 4LVNP 5C82A 3MM6B 4DHVA 4DNCA 4CH7A 3ISXA 1HDQA 3GV8B 1KVJA 3GIJA 2EK6A 2HV2A 1D9AA 2PJ8A 1P8GA 1AB8A 1HDUA 3ZZYA 1C1BB 2OPSA 5GADI 2YX7A 4YMEA 4CGOA 1CP6A 4Q0BA 3G8TA 3BKFA 2Q66A 3FBFA 3IO1A 3K2KA 2GU2A 3N6LA 4FYDA 4AQYF 3EGNA 1BAVA 4UFVA 3DYAA 2B4DB 5KT3A 1CVJA 4ZCIA 4X8IA 4R76A 4ZVGA 2A6OA 2BKPA 1GMWD 2CTBA 3KUHA 1UKUA 2IFXA 2ZM6F 4M5MA 3KJVA 4R57A 2GO9A 2MMYA 3A3NB 1CP7A 1RHMB 2G3AA 4ICLA 4XAKA 3HSGA 5DO2A 1BOBA 3VGTA 1IKXB 5KG5A 4ECSA 4YB1P 4FBUA 4MKAA 3LQVA 1Q79A 1Y5NB 2ZBIA 1YI2S 3RW6A 3DDKA 3D7FA 1SKSA 4NGNA 2ZOFA 3UI3A 3KGQA 4W4MA 1VQ6S 2XHCA 1WOPA 2EVZA 1ZH5A 4I49A 1BHNA 3GFXA 2KM8C 1C2PA 1CJTB 1QD1A 5JPHA 2CRLA 1D0EA 1HEEA 2HS3A 4ETXA 3VATA 4KR0B 2QLBB 2G0IA 2G9OA 2EFOA 4XIUA 2B5JB 5I4MA 1IYKA 3IGNA 2YBVA 2V8GA 1VKCA 3M2UB 3OBIA 3S1TA 5CA5A 4C11A 3G6YA 4XTTA 4DPOA 4PRFA 2QL5B 4IYQA 3R7BB 2GHWA 3D3BJ 1AUSL 2XEGA 1WHXA 1YLOA 4OIWA 3OXFA 3OJUA 2CPIA 2CJXB 2V4JA 3QT8A 3FX6A 2HGLA 2GJFA 2DD8S 2ZM6J 4C8NA 1N32F 1RAAB 1Z1ZA 2PE3A 3ENWA 2W8LA 6AT1B 5GMKa 4ZPAA 1TFYA 2DB1A 4AD6A 4PPDA 2Z3NA 4KSEB 1WHYA 3K57A 3GCWP 3NFZA 2MQ8A 1X4CA 3RRGA 1KLMA 3BLNA 4DBQA 3QYYA 2BQUA 1NJXA 3VAJA 3GYGA 3SJXA 3BN7A 2J9DA 4YB7A 2CWXA 2ZH4A 1S1VA 2FC8A 1H74A 1JLFA 4OYXA 2EKYA 3N5BA 3JSMB 1JLQA 2C28A 3D2PA 4GVBB 1VISA 1YJRA 2K8GA 5IV0A 1UETA 4DQIA 3FEDA 4LF4F 4ZHRB 3KOAA 4TVAB 1PKUA 2HEKA 1GX5A 4I2QA 2EBJA 4DPYA 5DETA 3PEHA 4P2SA 3AD7C 3B3VA 3D1QA 2DGUA 1I3OB 4IAVA 2O01C 2W4CA 1VRTB 3FRYA 5JGFA 3R5DA 2CXAA 1CULA 4RW7B 4RW9A 5EC4A 2DCUB 5E96A 3MAAB 4CLFA 1S60A 2V77A 2JEVA 5HBMB 2XMKA 1NNDA 4WZMA 3POTA 5A8WB 4RKUC 3EZOA 4B9SA 2VPYB 1FERA 1I12A 3GR1A 3M8SA 4HT7A 2CUYA 2VBWA 1LKZA 4QWBA 3LW5C 4O4GB 4U95A 3JAMU 2FXFA 3V4MA 3QGPA 1N32J 4II9A 2BQRA 2DNLA 3DR8A 2I5JB 4DL4A 4TU7A 5A27A 5KTAA 1SB6A 4ER8A 3ZJ0A 4DL2A 2RU9A 1NHKL 4CP5A 2LP4A 2WVFA 4R7MA 3VV2B 1Z4UA 4ECWA 4ES2A 4Y2CA 4DS4A 4MAKA 3A9LA 4P4DA 2NREA 3LH2S 1ICEB 1UEVA 2D3UA 1QY7A 5HROA 1UVMA 3ZZUA 3DLKA 1U7LA 2XMVA 3CNQP 4FN5A 2Q4ZA 1XOVA 1YQHA 1K44A 3QAYA 1EX8A 1PYTB 3MXHP 1YK9A 1Z2ZA 3H5XA 3BBCA 3TI0A 3QJJA 4L3NA 4LF4J 3OUYB 2DK2A 3ILJA 4CLYA 3DRXA 1LW2B 3KNAA 5DWNA 3DNSA 1ZLHA 3OR1A 3IS9A 2PDOA 4ZCMA 2OPPB 1IYLA 3JTOA 5HAOA 1RA6A 1E6YA 1LWFB 3LGNA 1U25A 4AE5A 1VIOA 4JI0F 1FF2A 2U1AA 1BO4A 4EFDA 2PVWA 2BBEA 4NL5A 3DRPB 1WD6A 2LCWA 2GQ2A 4UUWA 1JXLA 2CJQA 4Q8EA 4UA3A 2ADBA 2KL8A 1NMTA 2XWYA 2X7BA 2K06A 3EO4A 3KYLA 1RKJA 4X2TA 3Q8VA 4YFUA 3GB0A 3IAM9 3MM7A 1ZYQA 5DGBA 4FXWA 4ZPWR 1VBZA 4AL5A 2JHEA 1RTIA 2VFRA 3CCSS 4F0MA 5LYIA 2LEPA 1PYOB 4QWEA 3HZGA 5D4PA 4NGQA 2YNIB 1N8RT 4LBIA 1UFKA 1MROA 4MHZA 3N28A 4CGLA 1H0HB 1IKYB 4JUZA 2YTCA 1F5BA 2DR8A 3LODA 1RISA 3NA6A 1OSDA 2AV5A 2ANPA 2BCOA 2H4YB 3ITHB 2B4BA 2E9TA 3LP2A 4KVOE 3W64A 1YGYA 3AB4B 4PEOA 3ZTPA 4ED4A 2IRXA 1Q5VA 2RT3A 3PYDA 1OYDA 3ENAA 3GIIA 3E0KA 2DR6A 1IGBA 1YRTA 2PJ3A 2CPDA 1F0XA 2RKIB 5ETSA 1YX2A 4KE5A 2A3JA 4FXVA 1URNA 1RAOA 1U1RA 2OPQA 2D41A 2MKIA 3T5KA 5H1SV 4DMZA 3OTCA 3GZ7A 2WSAA 2W2NP 3K0JA 1TUGB 4JI0J 2VA2A 1E6VA 5C88A 2C2KB 3KLIB 1T03A 3FC9A 1U1KA 1T05B 4EMDA 1SUQA 2XBPA 2ZOMA 1DTDA 3OFHA 1IOIA 1V3SA 2GZOA 2QJ8A 3A8IA 3FMCA 4QIFA 1OQ6A 4DV1F 4PSXA 2VASA 3QWUA 2VG7B 5K14A 1KC8T 4DPTA 4OYOA 1U02A 2R7WA 2PRQA 2CVEA 1EP4B 1LV5A 3N9UC 4IQXA 4AG9A 2KYXA 3EDQB 4JI7F 1IWGA 1UPPA 2HQDA 1ZETA 2YNGA 3U02A 2IMOA 1EQMA 2HRTA 2HBYB 3D5MA 1CM0A 2AZ1A 3PJXA 1FTCA 4UY85 4MHPA 1Y3KA 5AXNA 1OWXA 4RL1A 3NNAA 2WUUA 4C6AA 3PB9X 1RAJA 1WKLA 4PYDA 3HT3A 2FE7A 4LSNB 3P96A 4LR8A 1HNVB 1GH8A 3MGDA 4M5NA 3EXCX 4UEFA 3I0RB 1RBOB 1DLOA 1RHKB 5KFOA 2CJ9A 1TKZA 1PUAA 1TL5A 5KFGA 2PSWA 1UVLA 3UDVA 1RHQB 1WKJA 3HT0A 3M2RA 3TOQA 5KT6A 3HHNB 2LVWA 2G0CA 3RYLA 5CABA 2ZHBA 2B58A 4Y00A 4X4TA 3K2YA 2UP1A 2E1AA 2HFOA 4TYBA 4J9RA 5ETQA 4TU8A 3H7HB 4DV1J 2E29A 3RW7A 2GMHA 2ROPA 2WAQD 1QUPA 3BKUA 1XJOA 5KTQA 2FLNA 3HSZA 3HXMA 3MR6A 1WF2A 4WFAQ 3G86A 1NRKA 1EETA 4C9DA 1X10A 4NLOA 1LW0B 4KPCA 4E0AA 2JDJA 2KG1A 2E7WA 3PYGA 4TLQA 2XULA 4JI7J 4MKVA 5L1KA 3MEDA 1RT3A 2J9AA 2ZEHA 1IBKF 4IH5A 1KKHA 3NL0A 5ETTA 4KVME 4EI2A 4U96A 4WFBQ 3CE8A 1R6VA 1M5HA 3S9MA 4TQRA 1KFDA 1NO8A 4ZPTR 3D6HB 4KUBA 1U8SA 3N7ZA 5AXLA 3G8WA 2CY2A 3R1LA 2BE9B 4KTQA 3BDPA 2VICA 3FEZA 4NXNF 1FNOA 3FF3A 4KV8B 5CCLA 2F65A 2Z56B 3H59A 2ZH5A 3CCJS 3CC4S 2JLGA 3UCGA 2ZW7A 1TL4A 3E8OA 4DCPB 1AFJA 2OH2A 1U6FA 4KSAA 3QZ7A 1C4AA 1VC0A 1K0TA 3DR6A 4MYTA 2RDIA 4MJ8A 2XS5A 3CD0A 2CJKA 2G3TA 8RUCA 5J2QB 5D8HB 3O5TB 2ATRA 1J27A 4BLGA 2G1HA 3JUWA 3TVYA 3PHTA 1L3VA 1N56A 2UV8G 1RP5A 4AVAA 4PG4A 1CJWA 1HHTP 4ZGYB 2DEIA 5KFVA 1REGX 3HI9A 1LCPA 2EFPA 2VZ9A 3CVKA 5IT9Y 1R8HA 3R9GA 1M5KC 2I79A 1JWWA 1XBUA 1IBKJ 3UDLA 4DL5A 2GIVA 1ULRA 4B08A 4TXSA 3DOMA 4DV4F 4MFBB 2W24A 2JDDA 1VK3A 4LF8J 4Y2IA 3NGRA 2EVNA 1X4DA 1SIZA 2XTJP 1YWXA 3LANA 3OR2B 4Q2MA 4H4OA 4ELVA 4JXQA 3PB4X 4OLOA 3C6UB 2BEIA 1S6UA 3ZO7A 2ROEA 4A47A 5FD1A 4NXNJ 4C7HA 1MN9A 5BYSA 4PXBA 2V50A 4A8MP 3B8HA 4Q38A 3OHBA 2PC6A 3NH4A 5H9EK 2AZ3A 1K9MT 2W7PA 1RWUA 2EC2A 4JI2F 3ZZRA 3V6HA 1KWMA 5D4LA 3TZXA 1J4JA 2E5JA 1WC1A 4FXDA 1RZMA 1X5PA 4K0KF 1Q95G 2FUG9 4P6YA 3ZTSA 1H73A 2B56A 2YKQA 1SJ3P 2ATCB 2ZZTA 4J9PA 4P4FA 2F40A 2KVQE 4K2XA 4RW6B 3SSRA 3DN9A 2C22A 4RJVA 2KFYA 1LWCA 3BO3A 4RPFA 4P7VA 2K1RA 1RWMB 2AEMA 3O1LA 3TX8A 3R6LB 3CDUA 3ENQA 1CC7A 1SQEA 5CXTA 3FKBA 2AFOA 3RB0A 4DV4J 1S7LA 2J9DE 2W9AA 4IG0B 2Z3LA 2MEWA 4TU9A 1TQLA 2QFIA 3LTOA 2PJ6A 3BYPA 2VI7A 2Y1LB 3D7DA 3JQKA 4NX9A 3PRVA 2N7CA 3AJ1A 1DURA 3MEGA 5D0EA 1HBMB 4IRCA 2BQ3A 3OQ2A 1O51A 3I0SA 4LRFA 5JMNA 2QSFA 1LOKA 3O2IA 4QW9A 4IQMA 2VZYA 1X60A 3IAS9 4I4BA 2MKCA 5DLGA 4YR3A 4RNHA 1I1GA 2PI5A 1X9WA 3G3SA 4RS2A 3MDFA 4Y3CA 4ILRA 2K2PA 4K50A 4JI2J 1HWLA 2DXEA 2IJRA 2B5GB 2R7UA 5U47A 1V5IB 1FDAA 1I5OB 1S77D 2QJ3A 2O66A 4R6TA 2D3O1 2XCAA 3K5NA 4G1QB 4K0KJ 5G22A 4ZVUB 2FYXA 3FEYB 1SJQA 1UWYA 1M5SA 2PFFB 4MFQA 2V94A 4WTOB 4FS2A 5KTCA 3G87A 3NKYA 1I21A 2BX6A 5EGYA 1C4CA 1LQ9A 5JH9A 2ILYA 1HNIB 1VIXA 2B7BB 2ZH9A 4AXIA 4M5HA 4NSQA 3K8WA 1RBAA 2REEA 4PZVA 2LEAA 5I3QA 5ETKA 1QM9A 3V7ZA 3EE3A 1SC6A 4MY0A 3US5A 4G1IA 2BZ2A 5KT4A 1XMOF 3H4QA 2QLWA 2NYQA 2DRBA 3CGIA 4N76A 2V8DA 4CIOA 4OX8A 3RGIA 3Q89A 1RK8A 4S0MA 3SJEA 3BM7A 4RBTA 4ZLLA 5BXIA 4IF5A 2QYCA 2AEFA 3KLHA 4M5LA 4UIBA 1HKAA 3NE8A 2P9CA 1UP1A 1RE1B 2M88A 3EMTA 3CJ2A 3M1VB 3SDEB 3KLGA 3BF4A 3ZZZA 3D2MA 4OYMA 3JSMA 3S6GA 2UU9F 3B8GA 3H8YA 2W9BB 3AA9A 5CYQB 4YUDA 4Y49B 5K8PA 1LRZA 3MMCA 3CD7A 1OQ3A 4LSLB 2ALZA 3D7GA 2CQCA 1IM6A 1NXIA 1Y4ZB 4HLBA 2ACMA 4PR6A 3SJGA 5KG7A 4TY8B 3NGKA 5H9FJ 1RBLA 2HNYA 3G96A 3V2UC 2VFVA 5EN1A 1SI9A 1SH2A 4URQU 3C8YA 1RUSA 1AXQA 1XR6A 3OLBA 5HMWA 2HGMA 1WWHA 5J2MB 4BD9A 2V2QA 4LQ9A 4M6GA 2H1YA 1HBNB 2FZGB 1WSRA 3BO4A 3W1YC 5C2CA 1EJ7L 1F3VA 3LP0B 2F8MA 2M8HA 4FUUA 4P2XA 4RW4B 4USTA 5SZTA 1M4IA 4GM5A 4DLGA 1S1TB 3H8FA 4CYQA 1JLAB 3KJQB 2XMUA 2HBRB 4DPUA 2Y0BB 1XMOJ 3PX0A 1G6BA 3A3PB 3F73A 4ES3A 5BJRA 4PXDA 4NZ0A 5A28A 2CYYA 2G1DA 4FKYA 3MMAB 1S6QB 4NCZA 4H4KC 1XRYA 3TTHA 1SVDA 1IN0A 2CQPA 3FGVA 4DR6F 1RTJA 2DPIA 2L08A 3H4BA 2FDNA 3PIOQ 1PYTA 2ZPAA 2Z30B 4PV6A 1F9HA 4C8KA 3CCLS 2B9XA 2UU9J 2DIUA 1SV5A 4C2MA 1FDNA 4MBUA 2OTLS 1TUVA 5AGEA 2RHSB 1YTYA 3J7AN 2DYAA 1F2PA 3IBWA 3M8RA 2OUGA 2VV5A 2KZZA 3MZIA 4OYPA 5D77A 1NAQA 3LGHA 4R8UA 4HKQA 2EEYA 1FRHA 1G3OA 2P8IA 3DM2B 4L74A 5HJXA 2V8HA 4HNWB 5J8CA 2OB0A 1FRKA 3M30A 4C3KA 4Z2XA 2GVDA 3IGVA 4NI2A 4IK2A 1HR0F 3UVJB 1VFJA 2JVRA 4Z7CA 4IUSA 3AD8C 3R8YA 2KH9A 4C68A 1WEZA 1NHUA 2M3DA 4Y49C 1HWIA 1W26A 3FCVA 1Q16B 2XSJA 2AJQA 3PRTA 4FAIA 4K5RA 3M8PB 4DEZA 4NRUA 1MG7A 1X8DA 1X9SA 2B3TB 3D54A 4O0IA 4K4UA 3GYAA 1AZSA 4ILMA 2A4NA 3MM5B 3H20A 2FZKB 5ADZA 4H4MA 4NCGA 1FRLA 4F4YA 3MEEA 4B10A 4PQAA 1TL7A 1FHTA 2DHSA 3IWLA 3SCKE 4NLDA 1XBWA 7CPAA 4J9MA 1WTBA 3MI7X 1MU2B 2YY3A 4ZY1A 3R9FA 1UJ4A 1R0CB 1X0PA 3H98A 1WK4A 4AXVA 4DR6J 1NPKA 2LQ9A 1LXNA 5EWFA 3IWEA 4CGMA 4DR4F 2C6GA 1Q7YT 3D3SA 4N77A 2BVZA 3HX9A 2ZVIA 4F3OA 4U8YA 4DUZF 2FHJD 1T9UA 2FZCB 1H72C 3JAMY 3DXBA 4O0NA 1BGXT 1LNQA 2KYZA 4RUCA 2GLJA 2JFKA 3J7A1 4WPAA 1FK9A 1FNXH 4CLWA 3KI9A 2E9RX 3TEHB 2J8MA 1U8WA 1RT7B 2FVRA 5EWEA 4C0BA 4DU7A 3QSYB 2KHCA 1IU8A 1HR0J 3TWZA 3KHZA 1R0BG 3S6EA 1VBKA 4YGOA 4DQSA 2H9ZA 5D3GA 4E0DA 1NB2A 1Z5RA 3D3CJ 1IKWA 5E3AA 4KRWA 5ETRA 2O28A 3GYNA 4R87A 2IM3A 4DX5A 2R7HA 1CPXA 2A10A 2M8DB 2VXKA 3A1YG 3K58A 5DZ6A 4QR2A 1S7HA 4C0OC 1B87A 4OC0A 5FDLA 4HTIA 5JXSA 2VPWB 4K4ZA 4TWEA 2GHPA 4CNZA 3S01A 1WG1A 3KK2B 3KK1A 5KFXA 2K5TA 1JLBA 2Q4VA 3BQ2A 3ETMA 5ETVA 3AHPA 2PJ7A 3L9ZA 3KMQA 1YBAA 1VRUA 4DUZJ 3EGVA 2DNOA 1KZFA 4AG7A 4ZX9A 4X4UA 1KQKA 4GVLA 4KKOA 3B82A 1KLNA 2J6TA 5DLFA 2H5MA 2XMJA 1TL3A 1CX8A 2BJ1A 4CNYA 3J7YI 1RWXB 3JS9A 4MJKA 1NH8A 2AFUA 4YP3A 5L9XA 1XK8A 2DR9A 4QCLA 2M5YA 3CCZA 2MQLA 3DGVA 1VHIA 3SZ2A 5G21A 2C2EA 4B3OA 4UZCA 1TMJA 2PDAA 3PW0A 4J9NA 5DS0A 2OI2A 4J9LA 1BD6A 3AQOA 5HJYA 3IJ3A 3B3TA 4NA2A 3NGTA 3NLCA 2YX4A 2XLKA 5IV3A 2X1BA 2HNZB 4ZI6A 2W9CB 2N4CA 4C7QA 3L95X 1NB7A 2PN6A 2B51A 3T1YF 1OSCA 3DHXA 4L72B 3PKYA 1T9YA 2PEHA 2W2PP 4OHWA 2ZHAA 3V6KA 3IRXB 2PR1A 3VARA 4Q5VA 1BC6A 2ZBCA 1XE4A 5CH7B 5LMUF 1WG5A 1VJWA 3V38A 1Q2YA 3J80Y 3CC7S 3B54A 3BPDA 4J90A 1OS5A 1C1CB 2O53A 2AJ1A 4PXCA 2AFSA 4H2KA 3SHPA 1FJ7A 1FX4A 2CNLB 2FJXA 2QECA 3MHYA 2B9YA 3PO4A 4B9TA 1HHQA 3AD9C 2R8GA 3TZWA 2PMHA 3PBEA 2EK1A 1T9XA 3JSYA 2HHQA 5F8MA 4LX9A 2HSEB 1OY6A 2FGOA 2VFUA 2GW8A 3A8EA 1YGHA 3M9OB 3PO5A 1K1QA 4U7UD 5I3UA 1SKRA 4PG7A 5C42B 1VQ7S 1DQ9A 1PYSB 4OP4A 3V8IA 4ZVTB 1N5YB 2AJ4A 3RBEA 1UZHA 1CQMA 2KZMA 1U26A 3D67A 2E9ZA 1BQNB 1KOHA 2QYGA 1SJ1A 5C2GA 4FNHA 2JEJA 4A8FA 2Z4PA 2IVFB 1PU9A 4KGXB 2GIFA 5IM0B 1UWAA 2PCUA 2WBRA 1TKTA 3T1YJ 3IU1A 2YNFA 3GR0A 4I68A 1NCLA 3T6JA 2K3IA 3G6ES 4ECUA 1NJYA 2BJ3A 3I4HX 4HHJA 2Y0MA 3C6UA 5F8LA 2HQIA 2HFZA 1QJHA 3NE7A 3NS5A 5B0BA 2QLXA 1FRJA 5LMUJ 3TO7A 3VQSA 2JC0A 1Y5IB 2CIMA 2G0JA 3VZHA 4L89A 4A48A 1H38A 1D8YA 4A37A 4MIBA 2ZH7A 5DQIA 1XEBA 2CZ4A 5L9NA 2G13A 3D6TB 3HKZD 5BR8F 4A8WA 1H7WA 3PDNA 1Y7PA 1NBEB 3PW2A 5K9FA 4DN9A 1FO1A 2A1BA 1VHOA 3FIXA 4OI1A 2CTCA 1KN6A 1WDDA 4YR2A 4FD6A 4ZPVR 1S1WB 1OIAA 3MF5A 3MPVA 2VU5A 4NLVA 3CMES 4LR9A 4ELTA 3P45B 5THWA 3V6DB 2VHGA 2AFMA 1UCNA 2P2CB 4OZ1A 3W65A 2C6PA 1DRZA 1S1XA 4YB6A 4MFJA 4OI6A 2PT0A 3AAWB 2YKOA 3PTWA 1BPNA 4R8FA 2I0XA 2HFUA 4QOTA 2WYRA 2BDPA 3KDNA 2OIHA 3PR4A 3VH9A 4UCMA 2PJ9A 4Y0FA 1F2GA 2NXNA 2R98A 5FLXY 4USUA 1NUEA 3S8SA 3O3LA 4LF9F 4KH0B 2RB7A 4DX6A 1Y00A 3HVWA 3CXCR 2M52A 1JJ2R 1I6JA 4HL9A 5KFJA 4NMXA 2GA7A 4DZDA 4FF1A 3CPXA 2WVDA 2IM2A 2UV8A 1LAMA 3H8EA 2GS8A 4QPTA 1BWEA 3R5BA 2YKNA 2PJ0A 2IL4A 4JZ0A 3C26A 3ICLA 2ZWOA 4URGA 2XO7A 2Z11A 4LQ6A 3MM9B 3BI0A 5BR8J 2J9CA 4L75A 4QB9A 5A2QY 3HUVA 3HLPA 2DGWA 4K30A 2ZW5A 3CDWA 2CNNB 1VQ9S 1URRA 1R7IA 2Q51A 2WVEA 5T7LA 1M5PC 3K17A 2FS5A 1JLCB 4PUOA 2DY9A 5JUMA 3KASA 5CYMB 1CC8A 4DJLA 4CYOA 2RRNA 4H89A 4CM0A 2GVZB 1ZAWA 5CCMA 3TR5A 2DR5A 2ERRA 1WWZA 2DEAA 4K4SA 4R9MA 3C6TB 2M7SA 1T0TV 2WSFC 2XC9A 3PFEA 4Q2LA 2Q1LA 1MWYA 1WKKA 3LGMA 5IX3A 4A32A 2OPRB 5IB0A 3OT9A 2XO6A 2H65B 1KUXA 4E8OA 2CJAA 2BXJA 3QIPB 1M44A 3M32A 4OZ0A 1P1LA 1S0VA 2MY8A 4CTAA 3HO1A 4K8RA 4LF9J 5F49A 1RTHA 1U6BA 2ZNZA 3RBZA 3W2VB 3D8PA 2W01A 2IC3B 4RUHA 4QR0A 5CPAA 1LOUA 3B7IA 1TU0B 2EFVA 1N4LA 2FJEB 4BHQA 5D4OA 4B12A 2XGQA 2GFQA 2HLTA 2W9BA 4NOHA 3KK3B 1W25A 4ZPBA 2E5GA 4NZ7A 4IG3B 5A0YB 3JSRA 2ADCA 1WG4A 5KOWA 4QIEA 2V2VA 1DY3A 2IJZA 4MMOA 1SJFA 4ES1A 3GIMA 5EUHA 2WBMA 1ELLP 1M1HA 3GSDA 3M8QB 3VQTA 4LR7A 1M0SA 3Q8PB 3GILA 3RBDA 4FBTA 1DTTB 4X65F 3AFGA 2CQDA 4Y28C 3GLJA 3HLUA 2QLFB 1S48A 4NLGA 2PGCA 1J5OB 1VK8A 2V8VA 2GIRA 2Z3PA 1HQUB 4CGPA 3CTRA 2YXLA 4MK8A 3M4XA 4IFVB 3M6WA 4RW4A 4YR0A 1DBDA 2NUHA 1CJUA 2C2RA 1S6PB 3NBPB 2N82B 4QWDA 3DRYA 2RFHA 3MWBA 2VKZG 3JYTB 2R8IA 2VDHA 3VAGA 2AD9A 3EY5A 4NGMA 3BJ7A 2AMCB 4ZDNA 3CXPA 2KT5A 3H4DA 4CLLA 4DV7F 1UVKA 1QAJA 1U1QA 3KHXA 2JRSA 4IKAA 4K5SA 4I7FA 3M6XA 3DOLA 1KQSR 1Y0RA 4FKXA 4F8RA 2HG4A 4KSFA 4DV0F 1RTDA 2DNYA 3LMSA 4IOCQ 4B5OA 5C25B 3CF5Q 4P52A 1DTQB 4X65J 5D78A 2LECA 2IIHA 2IRUA 3TW0A 1IIDA 1Z8WA 4UW2A 5KFQA 1RDRA 1NKBA 1TR0A 2NZCA 1NM2A 2MB0B 1WC4A 1IBMF 1JLGA 2NPFA 2VB6A 3QT7A 1VQ5S 3EWGA 2DH8A 1IR0A 4J9SA 4DX7A 1VHSA 3FFIB 3IWGA 3IC1A 4O3PA 1HMVA 1UVNA 2HZAA 1FRXA 2FJWA 5GCNA 3QNWB 2XMWA 3BYRA 2F1FA 4ZN1A 4JLYA 4U9YA 3GIKA 4YB5A 3FQKA 4V1Ak 2QYVA 3NMRA 2YWGA 3KG4A 2DH7A 1S7FA 2CQ0A 1WELA 4UWJA 4F67A 4DV7J 4C2ZA 2HQGA 3ISZA 3UNYA 3HJFA 5M2PA 4MHNA 2FY8A 2HYIB 5J1EA 2Y8YA 4QJVA 2KCWA 4BC7A 4QVTA 1NU4A 1G2EA 3GJQB 2XHWA 3GYXB 3RB4A 5HH1A 1NZAA 2VUGA 4R5PA 4DV0J 5LSLA 5B0EA 2HFSA 1GYTA 3J81Y 5EMIA 4EEYA 3U1MA 4OI2A 4HPSA 2POKA 1ELOA 5GAHU 2PQ8A 3GPAA 1N36F 1FKOB 3UCZP 5HXDA 4MXUA 1WC6A 1PCAA 3CDBA 7FDRA 2R2UA 2ZH1A 1RI7A 4P7TA 2OZUA 5LYDA 1D9DA 2XEJA 2OMOA 3W66A 1NKEA 3FECA 3TRGA 2Z2ZA 1QE1B 1TKJA 5H86A 3IA0A 2BR0A 1IBMJ 2ASDA 4LJMA 4ZVEA 2LXFA 1HI8A 3MPYA 3JTNA 3JTKA 3TQEA 3K9TA 4X4RA 4KZTA 2YNCC 1CS4A 1JWQA 4RX6A 1QSNA 2JEFA 3CJKA 4HACA 4PWDB 3UQSA 3FH4A 1N0VC 2NXCA 3QFWA 4M3SA 1H98A 4OZNA 2JSXA 2UZAA 5HLFA 2BOPA 2HB6A 4NF1A 3BSAA 3EZ5A 1T3OA 1SQHA 1CLFA 1X4AA 2B3UA 1QMUA 4B9LA 3S6KA 3K59A 5IQ6A 3R6GB 5LT5A 4KQZA 2VBXA 2QX0A 5CZXA 5KFZA 3I5AA 1YRUA 3NH5A 1S4EA 1QTNB 4WIQA 4CPAA 2M70A 1IY7A 2N7YA 3TX0A 2ZKUA 3W5ZA 1RT2B 1AUDA 2HWTA 1XIXA 1XMTA 2RD5C 4WKYA 2AW0A 1HYSA 2KO1A 5HMNA 3TARA 2GAGC 1N36J 3B2YA 1D3WA 1KQFB 2DCLA 2HWIA 1RWKB 2XYPB 2FGCA 1XR7A 2MGZB 5F46A 3MN8A 4UOFA 2PO4A 4KOXA 5B7WA 2GQQA 1FDDA 4ED6A 5D8NA 3DDDA 4A94A 4MFKA 2ZD1A 4W92B 1X12A 2LA4A 2FVQA 2MQNA 5BWAB 4QU6A 4OYZA 4CO3A 4M5KA 2ZJRQ 2JLFA 4OLLA 1JNRB 2J5AA 2RS2A 1X0FA 4YN3B 2YQ0A 1UW9A 1EKSA 2QE5A 2VFTA 4BBHA 4MCPA 3GJRB 3PRDA 5AE3A 2J8RA 4F2RA 2NXEA 2QTWA 1P6TA 4LMZA 1N88A 3CCUS 3HHLA 4MFZA 2L41A 1NSPA 1IOFA 1HWUA 2ZEPA 1WI8A 4F4ZA 5E5NA 3A13A 3B3CA 1KOOA 4P4BA 2HHUA 1OBRA 2ATLA 1GMUA 5AE1A 3PR5B 4RI1A 2ZH6A 3LP1B 1S7IA 3RU0A 3D1HA 4RO0A 4E8UA 3R1KA 1IBLF 2HK3A 1N6QB 4FPRA 5IC6B 4NGTA 4M5DA 3DRRB 2B8QA 1U0SA 5HK4A 3SQOP 5KFCA 1RKIA 2EO8A 3AQPA 4F8ZA 1UWBA 4HYKA 2CADA 2HAFA 3M8YA 2B7CB 5E3CA 2N3OA 5KFIA 1HW8A 3K89A 1LWEA 1CJKB 1FE4A 2EFNA 2LKZA 2HBQB 1N5SA 2YVSA 1W2BR 2AEJA 3C15B 4N7TA 4C3MA 5IT9U 2ZC4A 1HQ2A 2HFVA 4RZRA 5GVQA 3MCMA 3RRHA 2HIQA 3M2VA 1Q81T 4KYZA 3KTQA 4JYAF 1L3UA 1OO0B 3KMSA 4HDGA 3RO0A 2H54B 4PQUA 3KHRA 2R2SA 3NOCA 5KAKA 3HHEA 1TF9A 4J37A 3LO3A 3HVTB 5IM0A 2COLA 4OMFG 4OC2A 2HNDB 2Z58B 2Q6BA 2W4PA 2QN6B 3VHQA 1CJVB 1T95A 3FDSA 3Q8UA 5L38A 3UD5A 3T8WA 4B3MF 3HD2A 5T14A 1IBLJ 2Z2YB 2PJ2A 3G82A 2XM3A 2DKOB 1TKXA 4UOCA 3I31A 3T5HA 4OC4A 2ZEMA 3THPA 4ZMMA 5JVGQ 4BWJA 4DV3F 3CCTA 3JXOA 1S72S 2E5HA 3IWNC 1OJ4A 1NPPA 1U0HA 2RH3A 3NGDA 2MSTA 1QVFR 1RWNB 4USKA 2OZHA 1YZ7A 3W9HA 3QWPA 3V4IA 4OYAA 3WZ0A 3WC5A 1FVQA 1ZM2A 1O6XA 2XQCA 5F48A 2F4FA 2HMIA 2DPSA 2X1FA 1RT1B 4F26A 4JV1A 3RB6A 1REVB 4FP9A 3W7BA 3VVTA 3MOJB 4KHRA 2LLZA 4IH6A 4H54A 3PXGa 4FF4A 5ETLA 3N79A 2XEIA 5HP1B 3G6XA 4JYAJ 1U1MA 1WJ9A 2AX0A 2BM0A 3TA1A 3PZPA 2ZITA 2CNKB 3ILOA 2IDEA 4IUFA 2HLUA 2JLMA 4M5IA 2FLOA 5C24A 3BJYA 1DARA 3TA2A 4B3MJ 4C8LA 2MZQA 1VBYA 2XZDB 2DGSA 2R9LA 5IS2A 1FWKA 3C16B 2VQFF 1HPZA 3DI6B 3UR0A 2ILZA 4GKJJ 1HLWA 3UW1A 3KLEB 2KI2A 4DV3J 4X4SA 4M5JA 3CCVS 1U4BA 2NYHA 5F0WA 2J7UA 5IOLA 4B6ZA 1N52B 3TO6A 2MQPA 4NYOA 4ED0A 2RIJA 2K7KA 2VEZA 1RGVA 3MM9A 4BWMA 3QAUA 3TUIC 1TK0A 2DXQA 1JMTA 2VG5A 4L73A 1Y9KA 3MM8B 1Q1KA 5IC4B 2IMWP 2MHEA 2B6AA 2ZEJA 2OZGA 2PI4A 1O0PA 4F36A 4KFBB 4R25A 1A6LA 3GUXA 2VG6A 5LSOA 2QV6A 5D29A 2YWHA 3EM1A 2G2ZA 1P9YA 3W8GA 5KFPA 4NFRA 3HP6A 2QIRA 4CCHA 1TELA 1N71A 4RUBA 3HULA 4ANEA 3CJ4A 5CD4A 2GHVC 4CLUA 3SMZA 4DR1F 5G0RB 2AYEA 1UJ6A 2DJWA 2OPRA 1S9EB 1VGYA 4YQWA 1TTHB 5LM7E 2OSRA 5FVJA 1KUYA 2PJ5A 2JEWA 4JV2A 3G9CA 1R8AA 1JNZB 2B4PA 1Y7RA 2DTJA 5H84A 2VQFJ 1NJZA 3SV3A 4GRSA 4IDKA 5GAGU 1AT1B 3FMWA 3T41A 2RF2B 3D68A 1NE9A 1PC4A 1XTZA 4ID5A 1S9GB 1W7WA 1QUVA 1S5ZA 4UF4A 2BUNA 5C5JA 1EZZB 3ZXWA 1NLKL 2FHMA 5F47A 5ETPA 3IFEA 2ZE2B 2LDIA 4DCJB 3VAHA 3QT6A 4PG8A 4F0HA 1X5SA 4N47A 1OMSA 1S1UB 3CDAA 2RAQA 3UD4P 4ERDA 3N0VA 4J9VA 2MKSA 3H2LA 1FWPA 1FXRA 3GKRA 4AT1B 3L7UA 4GO7X 2ARHA 2X1AA 4CO1A 4RU9A 1T3NA 1SQFA 3MR3A 3JRUA 3IBCB 1M4DA 1JLEB 2N4DA 4OZJA 1ZM3A 3TAMB 4DR1J 4ZVOB 2PMWA 1XIQA 1F5AA 4F3QA 3DLGA 4C3LA 3FMBA 3N5FA 2Q4YA 2U2FA 1TZ0A 3UD3P 2BW7A 3H0PA 3ZTRA 4OI0A 1QTMA 4B14A 2QA2A 5GMEA 2JEGA 3T90A 4FYYB 4IFYA 3I6PA 2ACYA 4EGLA 3W3SA 4X4NA 1X4BA 4A31A 2DF5A 3EVWA 4P74A 3A8JA 5AXKA 1RT6B 2ABZA 2ZNYA 3MCNA 2MLZA 1NDPA 5CAAA 1CPZA 3D7SB 4W98A 3MEKA 2HKEA 4YWYA 1ACMB 4NLUA 1HWKA 2EWHA 5KG0A 1I94J 4PAAA 1BQMB 1OY8A 2HHWA 3I3GA 1P27B 2WPWA 3CCWA 4CYUB 3Q8YA 4NJRA 4BMHA 4NWBA 2CWKA 1FVSA 3FVYA 3DDNA 2Y8WA 4LVOP 2HURA 2QMUB 1HBUA 3MMBA 1MLAA 4MK7A 3TZZA 4UQGA 1DQ8A 2OPSB 3JTPA 4MKYA 3MD3A 1WF1A 3HDSA 1XFOA 1FFWB 4Q0BB 2C2DA 4KC5A 1CG2A 4QU7A 2VZZA 2YNHA 2EUIA 5I42A 1TV6A 5K20B 4AVCA 2WPXA 4H6UA 4LF1A 1WC5A 3DMJA 2QRRA 3TP2A 4N56A 2EI5A 1TFWA 3DLLQ 3KJVB 4AL7A 4YS2A 1UFWA 4ICLB 3P2FA 4WZQA 4JJXA 4EVYA 5EHHA 1VC5A 2DT9A 4NGPA 3W91A 3FEXB 5HQ8A 4Q8FA 4K59A 3SI8A 3IIBA 5DJBA 4M6HA 5D15A 2EK8A 1RTQA 2KDOA 3U1NA 2OH1A 3A3OB 2F5GA 3BGOP 1F3FA 2APOA 2P5VA 4EYHB 4DFKA 3W2WB 4J91A 3GU0A 2LMIA 2RILA 2F8EX 4N5SA 4ZOSA 3UWTA 1B7YB 1D8ZA 4QPXA 3EGZA 2Z2LA 3KUEA 1VRQC 1SXLA 3F0AA 2C6CA 1L3TA 1GTHA 1FJEB 1NJWA 2ZZNA 4YU9A 2GGPA 3H2UB 3FRZA 3CB4A 5DQHA 2OEMA 2PA8D 4C11B 3MGJA 3KR5A 2KJVA 5F8NA 5ISVA 2UXCF 3R95A 3I56S 2JZ5A 2JJ4D 2RQCA 4JI4F 4PK3A 4OZLA 2V67A 4DZ6A 4ECZA 1Y5LB 2BANA 2KXFA 2IJFA 4OHYA 3O6QA 4ECVA 1X5TA 2V4JB 2OMLA 3VZIA 1X4EA 4EBDA 3RBUA 1HI1A 4UIAA 3CO0P 2EG2A 3B3SA 4FYWB 3R27A 4CM2A 4KT0C 1YK3A 4NXYA 2AF6A 4NCAA 3C66A 3SI0A 4EZ9A 1HBOA 1KLMB 2ODFA 3UN5A 4OZ5A 5I3PA 1S6OA 3HPOA 2IVYA 1VI7A 1S1VB 1SH3A 3I5BA 1JLFB 3G6VA 1FNMA 5A76A 1M5VC 1JLQB 3M9MB 2ZEDA 1S59A 4RUAA 5DQGA 2BE2A 2DIVA 3UCUP 2XY5A 4LIRA 2UXDF 4WFNQ 2KKHA 1NK8A 2LXUA 3EFAA 4I2QB 4HDHA 3KR4A 1YZ6A 4PABA 1KONA 1FTRA 2FLPA 1X5OA 4FVMA 3I5CA 4ANCA 3IG1A 1HNXF 2HVZA 1CULB 5CZVA 4RW9B 2F63A 4K4XA 1L0CA 2Z3MA 1FXDA 2NXJA 3IU2A 5A8RA 2UXCJ 4JI4J 1WACA 1I1DA 4KVXA 4KO0A 3BPSP 3POTB 4BDPA 2WVBA 2I3CA 2V4RA 2MTLA 3IXQA 2IHR1 4DUYF 2C1CA 3CCRS 1KUVA 2Q7BA 2MDAA 5IT4A 1BPMA 2IAJA 4LRDA 2JBKA 1S79A 1D9FA 3FQLA 3R9LA 3TNVA 2AJFE 2EBGA 1T94A 3ONQA 4ID8A 3I9SA 4WIIA 4WKRA 4MY3A 3LALA 2G4BA 2FIWA 1M1GA 2VKRA 2WZ1A 2J7KA 3J80U 3DGPA 4ONWA 2VPXB 3DLKB 4XNHB 3TZYA 2R8HA 1KSPA 5CQGA 5HI7A 1NSKL 4IOAQ 3OXGA 1U6MA 2YWWA 4JBCA 3VAMA 1VQMS 2UXDJ 4CWBA 1R6YA 3QO9A 3QRRA 4ECXA 1UZDA 2NLWA 2PRBA 4MIAA 1UVJA 2ZBPA 4XDCA 4YHHF 3OR1B 1T11A 3IS9B 3PP9A 1OZPA 2ZHOA 2XMMA 2E1PA 4C2YA 1E6YB 2QC3A 2V63A 2C42A 4ZLNA 5KFTA 1HNXJ 1QAXA 3IR7B 1U09A 4F3MA 3FZ2A 5DM7Q 1ON0A 4LF5F 3P49B 1UPMB 3SI1A 4Q45A 1P9QC 5A8KA 3C15A 1JJ4A 1F2HA 1RA7A 3KLVA 4ATNA 4USHA 2HFNA 3PM9A 1BE4A 3BKTA 3BDEA 2HVDA 3MM7B 4UEEA 2EC0A 4OJ1A 5KFSA 4DUYJ 5E3RA 5J1PA 3CDEA 1B3TA 4HHUA 1RTIB 4DFPA 1RT4A 3G8QA 3AY0A 3HVTA 3Q2TC 2XB2D 2HNDA 2DNZA 4FZVA 3IWWA 1MROB 3FBEA 4BINA 4M63A 1O5JA 1Q2CA 4CT8A 3QLHA 4DR3F 2RJZA 1YMEA 3E01A 2X3DA 2BKOA 3SSSA 1Z8XA 4TNOA 5L46A 3LP2B 3BGRB 5J2NB 1VLYA 4KIAA 1R89A 1FI4A 1QAYA 4MHYA 2CPYA 1RAFB 1RB0A 4CGNA 2ZUGA 3Q8QB 5DDQC 4LF8F 2HHVA 1DHMA 3UNGC 3GONA 2D7SA 4QR1A 2XI3A 4LF6F 3CMAS 4E2AA 4KGMA 4YHHJ 2AX1A 4LT6A 5B0CA 3GP9A 1B70B 4GO5X 4RBUA 3SQGA 4A38A 2KRRA 4EBCA 1VR6A 3BBFA 2BJEA 4FYXB 1Y10A 2BEFA 4XNHC 1T03B 3I32A 2VBZA 3MAHA 1WSVA 5DDPC 4LF5J 2UVWA 3M6VA 4P75A 1MWQA 2R8VA 4B17A 4RW8A 1REVA 4QBJA 1UFLA 5F3TA 1JXEA 3R5GA 2EFQA 2VOOA 3C14A 2PEBA 1C0TA 1OPIA 2MYFA 1PO6A 2JFDA 4JD6A 4U9ZA 4MCRA 5HP1A 4B9VA 2CPHA 3S6FA 5KFFA 4NA1A 5K14B 2ZH2A 1Q4RA 4DG1A 1PJ5A 3QB8A 3CULA 2R8JA 4OYIA 1RLDA 2CVIA 2J0WA 4IO9Q 5FLXU 2XS2A 4ZP6A 3R2DJ 4LQGA 4PSWA 2SXLA 3RAMA 3HMJG 4URSA 5LJ5Y 1HNWF 3UN3A 2YNGB 5KTDA 3B3WA 2MZRA 3RB3A 2H51B 1W2IA 4DR3J 4DUTA 2HS4A 4E2FB 2WONA 1S76D 5J1QA 3MECA 3V81A 2D1CA 3DI6A 2RQ4A 3PB8X 4O23A 1ZLIA 3R3TA 4ALZA 3PIPQ 3KLEA 4G6VB 1RABB 2CFXA 1IQTA 4ELUA 2XCPA 5A2QU 3TUJC 5JJBA 4DSEA 1DLOB 1IKVA 3FB3A 4LF6J 5T41A 1Q53A 1TKZB 4LFCF 2V34A 4K3NA 1SCJB 3FSXA 3M2RB 1QSMA 3RAXA 1ZTTA 1EB0A 3R5AA 3BGLA 4WU2A 3NY0A 3DRSA 2Y9HA 1WOOA 3UY5A 2AIRB 2GJIA 4ENOA 1GXLA 2V2ZA 3RJMB 3VWEA 1B64A 4XPLA 5AXMA 2QMLA 3EZUA 1K8AT 3MM6A 4ECQA 2HQ3A 3HJVA 4OHVA 4N41A 2NPIA 4B3TF 4O44B 2AWZA 4DQPA 1TKFA 5G0RA 2MKHA 1EETB 2IA6A 1C1BA 2R7TA 4OJHA 2VF3A 1DQAA 2R2TA 3MEDB 1RT3B 1HNWJ 4LSZB 1QSLA 4A8OA 1VQPS 1HIYA 5DDOC 4O4RA 4M8LA 3WR7A 4XPDB 4DDFA 3OVSA 4WXWA 3X1LB 2YX1A 1WUUA 2BJ9A 4C0HA 1EQ0A 3E51A 2FJBB 2CDQA 2JEIA 3BSOA 5HANA 3TFYA 3MPWA 5LL6d 5CHCB 4F7VA 2AJ0A 3FJ2A 3LPYA 3BBBA 2B4DA 4UOGA 1EARA 2YPZA 4A33A 1RHRB 3FBUA 2YNDA 1XR5A 1PSDA 1F9EB 4JOUA 2EPIA 5M2UA 1S9GA 3J7Z5 2P6SA 3BREA 2XZWA 3T1HF 1FESA 1B0TA 3K5PA 3R5CA 4B9MA 2JX2A 1KEKA 1NPRA 2LEBA 4LFCJ 4WP8A