3CT9A

Crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
353
structure length
346
Chain Sequence
YDIPTMTAEAVSLLKSLISIPSISREETQAADFLQNYIEAEGMQTGRKGNNVWCLSPMFDLKKPTILLNSHIDTVKPVFTPREENGKLYGLGSNDAGASVVSLLQVFLQLCRTSQNYNLIYLASCEEEVSGKEGIESVLPGLPPVSFAIVGEPTEMQPAIAEKGLMVLDVTATGKAGHAARDEGDNAIYKVLNDIAWFRDYRFEKESPLLGPVKMSVTVINAGTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNSSRIDEKHPFVQKAVKMGRIPFGSPTLSDQALMSFASVKIGPGRSSRSHTAEEYIMLKEIEEAIGIYLDLLDGLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative Zinc Peptidase (NP_812461.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.31 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
molecule keywords Acetylornithine deacetylase
total genus 101
structure length 346
sequence length 353
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ct9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ct9A01
3S9LA 2IJZA 2OR4A 3S9MA 1YW4A 4ZY2A 3MRUA 3FX6A 5D29A 3RBUA 4A94A 3D7HA 3GLJA 4IHMA 1BLLE 4EFDA 3D68A 3VH9A 2PJ9A 2PJAA 2O4HA 2ZENA 1ZG9A 4F9VA 2G9DA 3KGQA 2EK9A 3KASA 4FWUA 1TKJA 1DTDA 4NGSA 3FEEA 2QVPA 3PB7X 2ZEDA 4CPAA 4P4JA 3I1UA 4NGRA 1CBXA 1TF9A 2QJ8A 4ZX8A 2ZEEA 4DUKA 1KWMA 1ZLIA 4ZX9A 3B2YA 1CPSA 4UF4A 3K9TA 3VATA 4P44A 3ISZA 4R76A 2CTBA 4K3NA 3IC1A 4P10A 1ARLA 1CPXA 1DE4C 1ZG7A 1XRYA 2JBJA 1VGYA 2PJ1A 2PJ8A 2F7VA 1Z8LA 2PJ2A 4RUHA 3D7GA 4P4IA 4PXEA 2PE3A 3SJGA 4Z65A 2ZEGA 1F57A 3FJUA 4PXDA 4X2TA 3B3WA 2OOTA 3FEDA 5JM6A 4OC2A 1R43A 2C1CA 4YU9A 4YWYA 4MCRA 1LOKA 3HUVA 1HDUA 3PRTA 2PJ5A 3IIBA 2ZOGA 3S9NA 2V8VA 4R7MA 2PJ4A 3PB8X 4OIDA 2RFHA 3KZWA 3L2NA 2POKA 4DJLA 4MHYA 3D7DA 4A39A 1ZG8A 4G1PA 3PFEA 5I4MA 4MHNA 5LRKA 2WYRA 3B3CA 1F2OA 2PJ7A 4P4FA 2PJ3A 2EWBA 3KL9A 3BI0A 3PB9X 2PVVA 2GREA 1AYEA 1Q7LA 4Q7AA 4OKOA 3NH5A 1CX8A 3KHXA 4ZI6A 3PBBA 3FVLA 2Q4ZA 1HEEA 2AFXA 4MRIA 2AFWA 2XEJA 1BAVA 2NSMA 2PJ0A 2V8DA 3KR5A 3T8WA 1Y0RA 2IQ6A 1BPMA 3WC7A 2C6PA 4MHPA 1ARMA 1TXRA 3FMCA 5CBMA 7CPAA 2ZEPA 1AMPA 2CTCA 1TKFA 3LMSA 2XEGA 2JBKA 1CP6A 3FH4A 4ZY1A 2I3CA 2HB6A 2PVWA 2EK8A 1NSAA 3ISXA 1CP7A 1VIXA 2V77A 2ZEHA 4PPZA 2BOAA 2AFSA 5LYDA 1H8LA 2PJCA 4DYOA 1LAPA 5K8PA 2C6GA 3IFEA 3TX8A 2PIYA 3PFOA 3KQZA 1YLOA 3WT4A 3PEIA 1Z2LA 1BPNA 3D4UA 5LRGA 4PXCA 1M4LA 3KQXA 4AXVA 4MMOA 4OP4A 5DS0A 1ZLHA 2ZEFA 4NJRA 2GU2A 2PJBA 3BHXA 3QNVA 5JGFA 2VL1A 4H2KA 4TWEA 4F8ZA 3B35A 4PQAA 2C6CA 5HVHA 3IJ3A 3WABA 3H8FA 3TC8A 4R8FA 6CPAA 3B3VA 2Q43A 5HVGA 3BI1A 4MCQA 3K2KA 1YSJA 2Q51A 1VHOA 3SJFA 1XMBA 3V7ZA 1UWYA 4MCSA 2ANPA 1F2PA 1Y7EA 3CT9A 5J1QA 1LFWA 5THWA 3B3SA 3BXMA 4NJQA 1XFOA 5LYIA 3KR4A 3GUXA 2WZNA 8CPAA 2AFZA 2ABZA 2QYVA 4A38A 4BD9A 4MCPA 1TKHA 2J9AA 4UIAA 4GM5A 5HXDA 5LYFA 4OC1A 3RAMA 4WJBA 3N5FA 1LCPA 2V8GA 2NYQA 5LYLA 4PXBA 3FECA 1Y0YA 1JQGA 2AFUA 3KI9A 1QMUA 2GLFA 2PRQA 4IAVA 1ELLP 4EMEA 4P4EA 2AFMA 4NGPA 4W9YA 3IEHA 4IK2A 1Z5RA 2IMOA 4MXUA 3LWUA 3B3TA 3NH4A 3SJEA 4F9UA 3H8GA 1TF8A 4O23A 4OC0A 4P45A 5K8MA 4NGMA 2GLJA 1PCAA 5CPAA 1XJOA 1R3NA 3RZAA 3CPXA 3D7FA 3KHZA 1QQ9A 4NFRA 2BO9A 5ELYA 2HC9A 2FVGA 4EWTA 3CPAA 5K8OA 4TNUA 1VHEA 3B7IA 5F09A 1CG2A 4OC5A 2AFOA 2ZEOA 3DGVA 3CDXA 1HDQA 2PIZA 4FUUA 4P6YA 1FT7A 3SI1A 4B6ZA 4FAIA 4JYWA 4JZ0A 4NGQA 1OBRA 2DEAA 4MHZA 5LRJA 4OMEA 2CF4A 3HLPA 3PB6X 1GYTA 1LANA 5IB9A 3SJXA 4WWVA 3D66A 3FF3A 4R6TA 4P4BA 2V8HA 4ZY0A 3PB4X 1YW6A 3NA6A 4UEFA 5K8NA 1PYTB 4P4DA 3DLJA 4UEEA 3JRUA 4ZYQA 1IGBA 4NGTA 3WC6A 3GB0A 2PCUA 4KSIA 3SI0A 4OC3A 1RTQA 3SI2A 3IO1A 2PJ6A 3PBEA 2RB7A 3H8EA 2XEIA 2CIJA 2JEWA 4UIBA 4X8IA 4OIWA 2XEFA 4OC4A 2F8HA 3IWWA 1FNOA 2ZOFA 1ELMP 1LAMA 4ONWA 1YMEA 2O53A 4LQGA 2ZELA 2BCOA 4UEZA 4FBEA 1IY7A 3V38A 5JH9A 5HVFA 3VARA 3D67A 3NFZA 4X3RA 3WC5A 5D8NA 4A37A 1XBUA 4NGNA 3MN8A 1EE3P 3NH8A 2ZEMA
chains in the Genus database with same CATH superfamily
1S7KA 3ZTQA 1NB7A 1VCTA 2GVDB 2L9DA 1UZHA 2O1PA 4CO3A 4TKTA 4UY8T 3ICLA 1S6UA 1S6QA 5KT6A 4F9VA 1WKJA 1X4GA 2RS2A 2Z3KA 1JLBB 3BR8A 1TKXA 3ZZTA 3DRRA 2FVQA 1U09A 1LK7A 3NBPB 4Q0BA 2HPUA 5G0RA 2B9XA 1ZM3A 4HDGA 5C7PA 2ERRA 1RAHB 1S9GB 3VGVA 4IRDA 2RAQA 4NYPA 5CD4H 1WK4A 2FIAA 4RW8B 3H4QA 3K0JA 3A4TA 4YFUA 5KFXA 4RW6A 3UVJB 2JJ4D 1FDDA 5HANA 1PYTA 4OLLA 3F73A 3QO9B 3HKZD 4DV2F 2C2DA 1MJ9A 3SYZA 2BV3A 4V1Ak 1HBMA 3DHXA 1MJBA 5IV0A 1R8AA 1IKVB 4RPFA 5E3PA 4OIDA 4DN9A 2QA4S 3IWXA 2DNQA 3WIVA 3WX4A 1TQLA 5DDRC 3D4JA 2A2CA 2ZW4A 3MR7A 3MM5B 3PFEA 4U95A 4A8XA 1TV6B 3EY5A 3SSRA 1OZPA 3TZXA 1K0VA 4CRJA 1EQ0A 1MN7A 2EWBA 3TOAA 4DPUA 3A3OB 1Q7LA 2JC1A 4DPWA 3QQCD 1Y5LB 4NL5A 2B4UA 1JX4A 4JI3F 1D0EA 2OEJA 4EMDA 3DSBA 1S9FA 3NGDA 2UVUA 2F65A 2D4OA 5D77A 4HNWB 2YNFB 2HHTA 5FVJA 1HBUB 2H54B 2CNNB 2XBPA 1SJ1A 1DTQA 4C2MA 2V8DA 1RT6B 3UWTA 5DG7A 3IA0A 4C68A 1S7FA 1B7YB 4DF4A 5CNPA 3K5LA 1K1QA 5DJBA 5AE2A 2KH9A 3N6NA 2C2OB 4ZN1A 2DD8S 3KHHA 1KVJA 1RTHB 4XIUA 2CNSA 1CULB 5A6PA 4PK2A 4PWWA 2M8HA 5MAOA 3L7UA 3MPYA 1RACB 3KJFB 2KRBA 3S8SA 3IGNA 2FJWA 4L75A 1FXRA 3QO9A 2BKPA 2RRNA 3BB5A 3RGIA 1ZLHA 4ZK7M 1KS2A 4CP5A 4DI6A 4J3GA 5JGFA 2WSEC 4QYRA 3CCUS 4LRBA 1SKWA 2DNRA 3R1LA 2QN6B 1KSPA 2R8GA 2DHSA 3NG8A 3VAIA 1IR2A 2IVMA 2L08A 2H5MA 4LFAJ 3CXSA 3RAQA 1SIWB 4YN3B 1HYSA 1LFWA 2VODA 2UUBJ 2BUNA 2V9KA 3M6VA 5B0CA 3BXMA 4MYUA 2OPRB 4KHPJ 5G4DA 1UTAA 1VC0A 3PZPA 2XC9A 2E7VA 2HMIB 2YGWA 1F9HA 3N5FA 3IG1B 3O6QA 3KKWA 3B82A 4IAVA 3D0HE 5H9EJ 1K4JA 4GC6A 4RS2A 3NAIA 4QPXA 5AXKA 5KG4A 3H25A 1VMBA 3PACA 4CYPA 4OHXA 3CJQA 2LECA 3MWBA 2EW9A 1QQ9A 2FLNA 2FQQB 3S6GA 1NK7A 1XN9A 5HP1B 2P0WA 1PC5A 5KFPA 5L39A 4USIA 2RU9A 2F8EX 4TNUA 3QRQA 3B7IA 2IC3A 3KK2A 4R0EA 3CDXA 3FBBA 4FUUA 5DGBA 1Y5IB 4JLYA 4JYWA 1R0AA 4E0AA 4DZ6A 5CQGA 4Q5VA 2AEJA 4UOFA 3CJSA 4F3OA 1XK8A 5G22A 4AD6A 2KZZA 3PB6X 3L7OA 3LAMA 5IM0A 3CO9A 3HHDA 3KK1B 3HJVA 5LMUF 2OD4A 3G87A 2XMVA 1M5OC 3QT5A 3QJPA 3ZZYA 3CD0A 4TNOA 2DXQA 2UP1A 1IGBA 4WZQA 2V5HG 1HA1A 3ETOA 4OHYA 5AE3A 3OJSA 3V6KA 3SI0A 1D3WA 2JX2A 4C3MA 1WTBA 4UIBA 3OV7A 4C7QA 1S72S 3RYOA 4G65A 4NZ0A 2VASA 1SJRA 1ROFA 4X64J 1Q4RA 4UEZA 6FDRA 1X4AA 2WK4A 4DMZA 1NJIT 4M5DB 4A37A 4EU0A 1RCXB 1T11A 2AX1A 4K4SA 5GADI 3R95A 3LACA 2IA6A 1F0XA 3TARA 2VB6A 1WACA 4P72A 1WC1A 2Y0MA 4MFLA 5KFRA 1ZG9A 2HGNA 4JI4J 2D3ZA 3DYAB 5IV4A 3UVJA 4KGZB 1N8RT 3QZ7A 3KLFB 4B3OA 1N34J 4WU2A 4P4JA 4FDFA 2D9OA 2AT1B 2J6SA 2L48A 2GHVC 1RT2A 1LXNA 1FFGB 2EG1A 2UUTA 1HBMB 4DFJA 2Z11A 4O4RA 4P44A 1M1HA 3H4DA 2CTBA 3IC1A 2FPHX 1JLBA 3GG0A 4N7TA 1R31A 3QAHA 4A48A 3SCJE 4MFZA 2F7VA 3DM2A 1DTTA 1FKOB 5E41A 2ILZA 4RUHA 4RI1A 4P4IA 1U8WA 3BBCA 1VBZA 3C46A 3DOLB 3B3WA 4O3NA 1JNZB 2E66A 1HBNA 1ZETA 1RZMA 4OZLA 1CQNA 5EN1A 4JI7J 1YX2A 2PJ5A 4ZVTB 1PYSB 3ISND 2K7JA 1T9UA 1RWWB 2IIHA 3L3CA 2HHHJ 4A39A 1VRUB 3R2DJ 1NEEA 3W2WA 1OPIA 1RQ0A 9ATCB 1X5OA 2J0WA 3H40A 3TUPA 2W9AA 3KL9A 1FVSA 3I4HX 5LT5A 4LF7F 1DRZA 2W9CB 4AVAA 4UFVA 2H4WB 3M2UB 3JUWA 1HBNB 2JFKA 4M5HA 2ZBPA 3ADAC 2OELA 1UAWA 3BPDA 2LXIA 3PRDA 4NI2A 2NSMA 4A47A 3SXOA 4JOUA 1Y0RA 1U26A 4DV3F 5HP1A 1RK8A 2ROEA 4PG5A 4NLSA 2JBKA 3W2WB 1GTHA 4KOWA 1RCOB 1VLYA 1F9EB 1U6MA 4KV8B 3OXGA 3QAYA 2XZDB 3MZIA 2I79A 3O2IA 3V6JA 4PV6A 1Q16B 2LDYA 3VWDA 4WFBQ 5LMNF 2FLOA 1H8LA 1RP5A 5DG9A 2C6GA 1T9XA 2HRYA 5D3GA 1IKVA 2YKQA 4NZ7A 1V3RA 2CY2A 1BWEA 1PSDA 5DS0A 3W6XA 2B5GA 2FD2A 4NI2B 2ZBQA 2B8PA 1NK9A 2G1DA 4KC5A 4Q38A 1Q86T 4UUWA 3EVWA 3CDBA 3LP0B 3C14A 2CA9A 1HYSB 1FK9B 4C0HA 4RUAA 4A4JA 5F8GA 2U2FA 2REEA 4ZLNA 3D1HA 3PKYA 3CCLS 3BQ0A 4CLWA 4GKJJ 4X66J 4KLWA 2QSWA 4EUVA 3I4PA 4G1QB 4Q2LA 3IBWA 4L89A 3JSBA 4CRYB 3BZQA 3R6GB 3CXPA 2DRDA 4W90B 2RKIB 2ZDOA 2R2TA 1OYDA 2UV8G 4BD9A 2Z2LA 4KUBA 1I5OB 1PAEX 1NJZA 4FS1A 4WJBA 5C25A 1ITPA 4NLOA 3LA0A 4DV0J 3HHLC 3OD2A 2I6WA 3DDIA 4IDKB 4EMEA 2VFRA 3QYYA 2YNDA 2FUG9 2AX0A 1YJRA 2Z4PA 4DS4A 4MY3A 1N6QB 5BR8F 1UEKA 4OC0A 1IN0A 3T5JA 5H9FJ 3VTIA 1JLEB 1T3NA 3FSYA 2KVQE 2C2KB 5LSRA 4CGLA 3KJNB 3H20A 3LGMA 1N33F 3OXFA 5C42A 3AT1B 3CPAA 2VXKA 2F4FA 2Q6BA 2WVBA 3R5JB 2IAJA 3VQSA 2C2MB 2CJXB 4JI1J 4FBUA 2MQOA 2G2OA 4NYOA 4DSJA 4OMEA 5L46A 1NK6A 3CCES 1OIAA 3R7NB 3AXKA 4JV2A 2JVOA 4KGMA 4JJXA 1L3KA 4LIWA 1H3DA 2LA4A 2I38A 1RUSA 4FD7A 1WHXA 2F4VJ 4LRFA 2JH3A 3OTOJ 4DPYA 2JWNA 2ATRA 3J81j 2ACYA 4UWJA 2XYHB 3MEKA 3BH6B 1FDNA 1RBOB 3GB0A 3N4WA 1OWXA 3NOGA 5A6WA 2NPFA 3P2FA 1C1BB 3MAHA 4OL8A 1U1KA 1E6YA 3IWWA 2M4MA 1RO5A 4ZVRB 4DX5A 2LEPA 3KHGA 4AT1B 2CPFA 5DZ7A 5D0EA 3PR5B 2OP5A 1X9SA 4X3RA 3AB2B 5D8NA 1CJUA 4JD6A 4NGNA 3MN8A 4H4MB 1I1DA 3IR7B 1X60A 1B7FA 4ZY2A 1I3OB 4OZ2A 2WSAA 2ZH6A 1XWLA 3Q8YA 3DOKA 4FBTA 1ZAVA 2PJ9A 2JEVA 2O4HA 5IZHA 3HSGA 1QM9A 4LR8A 1R0AB 5J2PA 2QVPA 3PB7X 2ZEDA 2RRBA 4C8LA 4DL5A 5G20A 1LOUA 3R8YA 1BO4A 2KT5A 4X2BA 3B54A 1CQMA 1FWPA 3PX6A 1ZLIA 1NAQA 3D0GE 1W2IA 2HS3A 1D8ZA 1C1CA 1WD6A 2HFSA 4U96A 4P2SA 4C8OA 1DE4C 4P75A 3CC2S 2J7KA 1QY7A 2HS4A 1VGYA 2V4JA 1OPZA 3J81U 3KLHA 4AYBD 2B4DB 4BMHA 3TZZA 4DR3J 4WF9Q 1GQEA 4OYXA 1RT1A 4WFYA 3IN5A 2QO3A 3RBZA 1VIOA 2YNFA 3ZZOA 4KHPF 2XG8A 1VQ6S 3S6KA 2REFA 3KLGA 3QZ8A 2E1AA 1VJQA 1AZSA 4KT0C 1XNQJ 1QSSA 3OWCA 1MWZA 2PSWA 3CGIA 3CC4S 4X65J 2C3UA 2O3DA 4F26A 1RTJA 5DRKA 1AFJA 1K9MT 3ONQA 2C42A 3EZ5A 1FESA 5JPHA 4K5RA 1G7CB 4F02A 4K4YA 4QU6A 1VQ4S 3W3SA 2W9BA 3V4IB 2W2OP 3L4BC 4DU8A 1F2OA 2QLBB 2IBOA 2XGPA 1FKAF 3R7SB 3S6HA 2R8HA 3HO1A 2JDDA 4KYZA 4DPOA 3TJ9A 3NP5A 2RNEA 4O0IA 2OPSB 2ZUAA 3IP0A 4X4PA 3IU1A 3QAEA 1J5EJ 4I67A 4JI3J 4F4ZA 2IQ6A 4CCHA 3A8KA 3AA8A 3C15A 1FHTA 3EX7B 4BCAA 2DHHA 5L1IA 1YBUA 1ZA1B 2DCLA 4Y49B 3ZJ0A 2BEFA 3CZXA 1HWIA 4XNHB 2G0JA 2MPUA 3OL9A 3PIOQ 1DQ9A 2BM1A 2V8PA 4ZCLA 1UWAA 1IQTA 1L3SA 5E7OB 2RU3A 2GW8A 1F5AA 1TL4A 3OR2A 4DXLA 4FF2A 1WF2A 2PT0A 3KKFA 1FK9A 4CAWA 1T8EA 4RU9A 4GKKJ 3M2VB 4ED6A 4ALZA 2VU5A 3PYFA 3CMES 1L3VA 2M9KA 3QGPA 3LP0A 3M2RB 1S1XA 3P5TL 4CO5A 1N56A 4B11A 2ZEFA 2GU2A 2HQIA 4RBUA 2IM0A 4IUFA 4ZHRB 4DUYJ 3M05A 3CJ4A 4OHVA 5IT9U 2PDOA 2UXBF 1C0UA 1QE1A 3C6TB 3BI1A 2ZC3A 1VHOA 2BE2A 4N41A 1SH3A 2ANPA 3V6DB 4K4VA 2K5TA 2B51A 1F1BB 1IKXB 4B9VA 5C88A 5KTCA 1RADB 1UVJA 2DK2A 1U6FA 3VAGA 2PC1A 3NNAA 1J5EF 4MCPA 1VYAA 2VQFJ 1EKRA 4NLPA 2CIMA 4ZIVA 2Q1LA 1SPBP 1S1TA 1NKBA 1LW2A 3TA0A 1YJ9S 5EMIA 5DQIA 3CMAS 1Q8KA 3CULA 1Y0YA 1W7WA 2BMBA 1H0HB 2B5JB 5F48A 2V2ZA 2W9CA 1ZAXA 1FDBA 4QWEA 3JAMU 2FIWA 2DGVA 3M8PB 2XWXA 2O28A 4P45A 2PE8A 2HK3A 1IYKA 2DVIA 4ZPAA 2JC0A 4JV5J 4KAIA 1QAJA 3KDOA 3OVAA 2BJ3A 3KHLA 2C3MA 4P2MA 5U47A 4Z7CA 3O44A 4K4XA 4UCPA 4OZ3A 3MECA 1AUGA 4LSLB 1U45A 4RW7A 2Z3MA 5I0CA 2N3LA 1BUXA 3V5RA 1XMQJ 3D6HB 1X4FA 1V3SA 4B3TJ 2H4YB 1CJTB 1X31C 4CS0B 3I0RA 1URNA 1YRXA 2XMJA 5DETA 1GMVA 1LANA 2EI5A 2I1RA 3SJXA 3NGKA 4I56A 2W2NP 3VVUA 3I5CA 4R3LA 2PMZD 4CTAA 4CYNA 3MAAB 1VRTA 4IR1A 1Y11A 3LPYA 3NA6A 4KY3A 3OL6A 3LOUA 1HD0A 2R7WA 4NGTA 1NZ8A 2HRTA 4OI0A 2K06A 1B0PA 3PBEA 2F1FA 2XEIA 1HW9A 2PD1A 1FA0A 1IU8A 1I6JA 1XMOJ 4B13A 2MXYA 2UVVA 5JH9A 3FSIA 1S5KA 2KG0A 1HNXJ 3F41A 1MMLA 3K17A 3AY0A 1XC9A 5A8KA 4UQTA 1BOBA 1FDAA 4C3KA 1NJYA 3M8ZA 4WK3A 1FEHA 3RRGA 4QIEA 5D29A 4A94A 1HKAA 3GLJA 2PFFB 4WKRA 1EAYC 2HVDA 3G3SA 4J9KA 5HSPA 3Q8UA 4UUXA 2IPOB 2YNHA 3UR3C 4QIFA 2HGMA 4EO8A 2CQHA 3KGQA 3W2VA 2PFDA 1R8BA 5F8NA 1S9GA 4I2QB 4R57A 3R97A 5DM6Q 4P73A 1NDPA 4UCNA 3GR1A 3K5PA 4YGOA 2C2EA 1U2FA 2X51A 4P7VA 1VISA 3D5MA 4A32A 4I7FA 1WI6A 4ZVPB 1S0VA 2GMLA 1LWFA 2R7VA 1M1DA 3MM6B 4P10A 3GFYA 2XLIA 4JYAF 2QLJB 5H84A 3CCMS 2HHWA 2JBJA 1IJFB 1VQ7S 4QWAA 2MQLA 2RE1A 5KG2A 2QTWA 3TZYA 3TUZC 2GVZA 2KHDA 3KJVA 5J2QA 4EEYA 1BQXA 5BJRA 4JXRA 3TA1A 4P9SA 4C8MA 1H2TZ 1OMSA 4QWCA 2RD5C 4OX8A 4ELTA 3I9ZA 2C2RA 4RZRA 3VAHA 4ZVGA 4ZP6A 4P52A 3SV4A 2IC3B 3DCAA 1IBKJ 2ZW5A 2CPYA 1RT6A 3KFWX 1QSOA 3TNVA 5BYRA 4O3SA 5A0YB 1X9WA 3LWMA 5H9EK 1WF0A 1DTQB 1XF8A 1YZ6A 3KLIA 4YOEA 5KFUA 5IQQA 2DO0A 3LALA 2E5GA 2J0QD 2KXFA 4BC9A 4ES2A 1FKPB 1K73T 3BJ8A 1ELOA 5D0RA 4JI5F 1RHUB 2CG4A 4USJC 4ZVSB 1TXRA 1TTHB 4I2PB 2EFVA 4DQSA 4LBPA 2UUCF 4O44B 2Q6CA 4GO7X 3IM8A 1NSAA 3QIPB 4LRCA 3FJ2A 2B43A 2V77A 2RQKA 1FY7A 2RSQA 1LAPA 1XE4A 1YJVA 1TUGB 1B4SA 1YLOA 3ZZUA 4X4OA 2RDDA 3R2CJ 3D2PA 5KFKA 3AXMA 1WHWA 1XEBA 4NRTA 1RAIB 1NM2A 1ZTWA 2OTJS 3BHXA 3PZJA 1R57A 3CJTA 3LP1B 2UUCJ 3UN5A 4ORFA 2C6CA 5HVHA 4EBCA 4LF2A 4NLUA 2DEIA 3SI8A 5KTQA 1N88A 3MEEB 1Q81T 4KVME 1VHIA 3CJ8A 4F0MA 3I5AA 2Q43A 2P6EA 1UWBB 1Z4UA 2Q51A 4WU3A 2YNEA 1HIYA 1CJVA 2MZQA 3H42A 3G6ES 1X5PA 2BKOA 1FNMA 4DFMA 3HVTB 3HP6A 2NXCA 1KHVA 3W5ZA 4DL3A 1WORA 3RAMA 3D1OA 1RT4A 1LCPA 2IVFB 4G3IA 4IRCA 3MM8B 5CABA 3W1YC 4F0HA 1OO0B 2GLFA 4LT6A 5KFMA 3WQPA 4UWIA 4W9YA 2VG5B 5EWEA 3JQJA 4M6IA 1K44A 1N36J 4L73A 1CC8A 2QMLA 5E5NA 3UCUP 3JSMA 2GLJA 5EC4A 3K57A 1RLCL 3TO6A 1KTVA 1FERA 2HVEA 2A18A 3TVYA 4F4AA 3MFIA 2BO9A 3G8WA 3J7YU 2VFSA 2BABA 4ECQA 3QGGA 4J5OA 3OSPA 3UO0A 4PWUA 2R7SA 2YVSA 2MJNA 2N3OA 2MLYA 4FAIA 2C27A 2AEMA 2KB2A 5IX3A 1YZ7A 1U49A 3QB8A 1XTZA 2UU9F 3RTVA 1A9NB 4AVCA 4WWVA 2XS2A 2OU2A 3SIPB 2NXNA 3POTA 1YW6A 1RXOB 5C24A 1CVJA 1PYTB 3JQKA 5EGYA 5LMNJ 3VZHA 1UZDA 4IFVA 2PCUA 3RUBL 2RF2A 4C0OC 3ELHA 2RILA 2XMUA 1I1GA 3SDEB 2X7BA 2OPPB 1S57A 1B6BA 2AGPA 4B3RF 2G13A 4KOXA 1VQSA 4CO4A 2BCOA 3QT6A 1U25A 3WZ0A 1JXLA 2OGUA 1YDLA 2Y1LB 5L1JA 2VBZA 5T41A 3BGFA 1ZM4A 3JTNA 2VJUA 1Q8IA 2DCUB 3R6LB 4JBCA 1JKHB 1R7IA 2UZAA 2GZOA 1WC3A 3FX6A 3Q86A 4M5GA 1S7HA 5EX0A 1GX6A 4LJMA 4XDCA 3C26A 3L9ZA 3HPOA 2HLTA 1J5OB 3NCPA 1X8DA 4A31A 1GMWD 1RT5B 3NMRA 2AMCB 1XIXA 2CZ4A 5J8CA 4PRFA 1Q79A 3LPEA 4OX7A 2YTCA 4ZPVR 2DH9A 5HQMA 1KN6A 1LW0B 5ETSA 3T1HF 1WF1A 2Z3NA 2DGOA 4DPXA 3CCQS 2DNMA 2F9DA 3F56A 5E0OA 3P45B 1GHEA 4NLQA 2B3UA 4NGRA 1CBXA 3OTDA 2QJ8A 3TAQA 1TKDA 5J2NB 2DGTA 2LU1A 1X0PA 4ID5B 4UF4A 4A2ZA 4OI3A 4KGVB 4EK2A 3KLFA 2FJBB 4CIOA 4Y34A 2YNGA 4DL4A 2XYPB 2W8KA 4F25A 3JSYA 4WIQA 4C11B 4M5KA 1NRKA 3JQMA 2VOOA 1FD8A 4J9OA 2BVZA 2J8AA 4NA3A 3DDDA 3SJGA 4RNMA 3GV5B 4LQ9A 3HD1A 3THTA 3W6SA 2MY7A 4Q2MA 4C98A 2FHJA 2CFXA 2AJQA 3PRTA 4ZA1A 5A2QY 3IIBA 4CAVA 2V8VA 4KRWA 4RL1A 4DUZF 4LF8F 3PP9A 5HBMA 1KQSR 2B3VA 2VG7A 4A30A 3DLEA 1NMTA 3OJUA 4I6YA 4KGXB 3BKUA 4TN2A 1N5QA 1NB2A 2Q4VA 1XIQA 5LRKA 4NLWA 2WYRA 2MY8A 2PJ7A 2PJ3A 1X5TA 3AHPA 3EXCX 4OYAA 3RRKA 4JI4F 2MHNA 5DDPC 1NJWA 1RHQB 3CB4A 4PUOA 1FD2A 3FVLA 3MMAA 4RWXA 2R8VA 2AV5A 1DFDA 2XY5A 2F5IA 3IS9B 3CW2C 3R27A 3GFHA 3MM7B 2X1AA 4UZBA 4ECZA 4WP9A 1FX2A 3DRSB 2M88A 2WB4A 2HNDA 3TEGA 2I00A 3MGJA 2NZCA 2GS8A 4DS5A 2QL7B 4C8NA 4ZY1A 4WFNQ 1L5UA 1RA7A 4LFCF 4H6ZA 1IXKA 4FD5A 2A1BA 1RWKB 4RLEA 4C3LA 1VIXA 3IAS9 2Z2YB 4Y00A 5HN0A 5GMKa 1HMVB 3IR6B 4E8OA 3CDAA 2JHEA 1JLQB 3WT4A 3PEIA 4QYZK 2NXUA 1OS5A 3BKTA 2UUBF 3UR0A 5LMUJ 5AXNA 4DCPB 1Y00A 4LF8J 1RKJA 4LF5J 4RO0A 2YXLA 1NK5A 4YMEA 1LWXA 3MEDB 4TWEA 1TK5A 2YPZA 4BWMA 1TR0A 5A2QU 1WWHA 3Q22A 3PGPA 1IR0A 2HBZB 3WABA 3H8FA 3GIUA 3RR7A 2FHMA 3U02A 2Y8YA 1MU2A 1NPKA 1LV5A 1KOHA 1FJ7A 2IJRA 3T19A 4R87A 1AROP 3THPA 4MFBB 3QGHA 1YVKA 4H6UA 2O67A 3KLEB 2VA3A 3A1YG 5LYIA 3R9FA 2W2MP 1O8BA 4UBRA 4A38A 3JB9k 1HQ2A 2MHEA 4F7VA 4LBHA 4F0XA 3EICA 2BJEA 1FJGF 1CEZA 3CCSS 4KOYA 2IL4A 4CT9A 4CLLA 3FECA 4GVBA 3GPAA 4QIGA 3KNAA 1HI1A 3LTOA 3DLGA 2FZKB 3O3LA 3OW2R 2DKOB 5F3ZA 5KG6A 3G82A 3KK3B 3H5XA 3OBIA 1U0HA 5CPAA 1HLWA 1R3NA 1KRPA 3KHZA 2CPXA 5KFBA 3BO3A 2GCFA 1LK5A 2YPYA 2GGPB 3MMBB 5HLFA 1WOSA 4EWTA 5AXLA 4RJVA 3VGUA 3KXDA 2NREA 4DG1B 2WBRA 3Q23A 5F09A 1ZPWX 3KOAA 1RTIA 4A33A 4Y2IA 4DX7A 4DSKA 1N33J 3PW5A 1B87A 4KHRA 1FT7A 2XSJA 3T1AA 2QC3A 2CF4A 2VKRA 2EC2A 4H89A 2MQMA 1LQ9A 2ADCA 3FF3A 2BYCA 3FVYA 4B3TF 4ILRA 4ZY0A 1IIDA 1GK8A 2MQNA 1JLGB 3DLJA 2QIFA 1AB8A 1T05A 1C2PA 3IWNC 1OQ3A 1REVB 4JV1A 2GFFA 5DS7A 3GMGA 4OZNA 2OTLS 3EXYA 1REGX 3EJMA 5J1NA 1H74A 2ZD1A 3X1LB 4QIVA 4ZVFA 1T3OA 3EGZA 1TKTB 4CLPA 3DRPB 2R2UA 1MROB 1UW9A 2HIYA 3PCOB 4AXJA 3S9LA 2IA0A 4QPTA 4DCOB 3MRUA 5D0GA 4OYZA 3D7HA 3I56S 3TQEA 3NMAA 3FZ2A 3N0VA 2VIHA 4FYWB 3HHEA 2RMLA 4CLYA 1HBOA 3D68A 1SJFA 3B8GA 1TU0B 1U1MA 2DR6A 2YNHB 4EFAC 1VR6A 2DPIA 2OPQB 3V81A 2FSRA 2OAUA 4MIWA 4J9LA 3SCIE 4ZN3A 2YKOA 1DTDA 4CPAA 5KFJA 1NLKL 2NSBA 3NGTA 3J80Y 1UA1A 2YNGB 2J6UA 2MMYA 1BXNA 1KQKA 2LCWA 5KG7A 2J8SA 2V94A 5M2UA 4R76A 3G86A 2NSCA 1JWWA 1ARLA 3FNCA 2E1CA 4ETXA 4ZIWA 2ZHOA 1VQ8S 1SC1B 5C2CA 1HNIB 1X5SA 4ZJOA 2YWWA 2FGOA 1FE4A 4JV5F 2MQ8A 4LFCJ 3PNIA 3K5MA 1WC5A 2KFZA 4YRHA 2MLXA 3HSJA 4J9UE 3IRXB 5B7WA 4X62F 2J9EA 4HYKA 2J6TA 4ELUA 5I3UA 5GAHU 3H4BA 3MR3A 2DGQA 3BF4A 3DGPB 4OX6A 2Q79A 4BC7A 3MPWA 3OXLA 3QRRA 4K5SA 4ICLB 1FWKA 3S9NA 2PC6A 3GJQB 2EEYA 2GIQA 3AJ2A 2SXLA 4DZDA 2VG6B 4MHYA 1SC4B 3CPWR 5D6GA 2KFNA 4X4UA 4C97A 3K8VA 4MK7A 2X7IA 1N0VC 4ZDNA 2B6AB 5HQ8A 1QVFR 1N5YA 3KUGA 3Q8VA 4P4FA 2HLUA 1OQ6A 3JTOA 2PVVA 2CQ0A 3EVOA 4Q7AA 4XPDB 4ZI6A 4KZTA 3BSCA 4NCGB 1Z4RA 1C0UB 3VAMA 4CAXA 1TVRA 2JLEA 3FXTA 3I6PA 1XEZA 3PJ9A 2JLGA 5BYSA 1S5ZA 1CSJA 1ARMA 1S0OA 3Q89A 2VPWB 2YX1A 4IR9A 1AW0A 2VF3A 4IG3A 1FRKA 2J8MA 2HB6A 4R8UA 1S1UB 3PY8A 1YG0A 3DNSA 2FZCB 4DN0A 4TLRA 4NLXA 4TU8A 4CGOA 1XMQF 1GXUA 3VGSA 4F36A 2AFSA 5K8PA 4PCQA 3FIXA 1EETA 3GFZA 3M4XA 1SB6A 2YNIA 4QJVA 1O51A 5ETOA 2QFJA 1CLFA 3ZFVA 3D4UA 1YJUA 3TX0A 4IOBA 2B56A 5HBMB 4AXVA 4M5LA 4OZ1A 4GKKF 4IFYA 4ZCKA 3TOBA 3QNVA 2XLKA 4H2KA 2R7QA 3NS5A 2MTLA 1P8GA 3TCVA 4RNFA 4DQRA 1KTQA 4C8ZA 4ZPDA 3W7BA 6CPAA 1HFEL 2JL9A 2QLWA 2D41A 3I3GA 2R8KA 4MCQA 1PKUA 3TAMA 3TEHB 1B64A 1UWYA 2HFOA 2UV8A 3QGIA 1NNDA 1RWPB 1S1TB 5HMWA 2KJWA 1WKKA 4DL2A 2IY5B 1KUYA 2M5YA 4GM5A 3SSSA 1FO1A 4OX9J 1VQOS 3LP2B 5F8IA 2UUAF 2KZMA 4B3SJ 3BREA 3AFGA 3HXMA 1IBKF 2B4OA 2V67A 3T6BA 3HDSA 4IK2A 4ECUA 4NPOA 2CQ3A 2KL8A 3HFKA 4IYQA 3ISNC 4XPCA 3Q2TC 1TF8A 3PW7A 3QLHA 4O23A 3DLHA 4RNOA 5K8MA 2RVJA 4ECSA 2UXCJ 4NEYA 2B7BB 1UL3A 1HNIA 4PK3A 4QB9A 3LH2S 1CG2A 2XMWA 5GADU 1HDQA 3DXSX 2ZITA 1M1GA 1S1WB 2E1MC 2GJ2A 4JI5J 1FRXA 1REVA 1Q2YA 1TL1B 4ILLA 2OZGA 1SCJB 1R6YA 4KO0A 4CM0A 2OZUA 3R5CA 1YQHA 3I32A 3H2VE 2OI2A 2W7OA 2U1AA 3KTQA 4USVA 3PHEA 5GAEI 2AWZA 1WSVA 3FMWA 4X4SA 1YBTA 2OD6A 5E3QA 1HQEB 2IMWP 4HHJA 1H6KX 1ZTTA 2B58A 3SI2A 1QUVA 1HNWF 2VC1A 2AW0A 2DXEA 2ZE2B 2WOMB 3JSRA 3PW2A 3H7HB 3R5DA 4IH7A 2F8HA 1FNOA 4F4YA 1ELMP 2VEZA 4ONWA 4B9UA 3AJDA 3A3PB 1VDHA 1JNRB 2ZH7A 1AUDA 2PDAA 2J8RA 1S4FA 1EP4A 1WHVA 3R3TA 4MT1A 4A8MP 3DI6A 1YW4A 2LQBA 2CQCA 3EGVA 5C25B 1S12A 3TUIC 5J1EA 1BC6A 4A8YA 4IHMA 3MM7A 3VH9A 2PJAA 3SXLA 2B8QA 4P6QA 3RJMB 3I9V9 4O4GA 2KYZA 4GVBB 1S9EA 3FC9A 1U8SA 4ED3A 5IT9Y 4QCLA 5C5JA 4CYOA 1JB0C 2MZSA 2BQUA 2N82B 1EP4B 2AGQA 3VR1A 2VZYA 1YJWS 2H5JB 2XI3A 3P5BP 1CPSA 4EI2A 4KKOB 3HF5A 3M8QA 2CQ2A 2MZTA 3OUYA 3N79A 1HHTP 3MMBA 5HLFB 2G3AA 2PJ1A 2KXHA 2DR9A 1Z8LA 3LD2A 3M32A 2R3VA 4BBYA 2L41A 4MFQA 2KHCA 2UUWA 4Z65A 5ETVA 3LQVA 3FJUA 4X2TA 1Y4ZB 1IM6A 3PV8A 2OOTA 5K20B 1Z8WA 2RHQB 4H4OB 1S9EB 4O3PA 1R43A 1Z2ZA 4HLBA 1LOKA 2OH1A 1SQFA 1N0UA 2B4VA 3A8EA 1IKYB 2POKA 4ID5A 1U47A 2C28A 2KI2A 3TR5A 2HBYB 1DJ0A 3KNGA 4IH6A 4LR7A 2Q66A 1QSYA 2O66A 2WUUA 4MAKA 5DLFA 1HWLA 1RTDA 2HSEB 1VKCA 2V4RA 2KT3A 4G1IA 2WOMA 2P5VA 3EXNA 1GXTA 2OEKA 5K9FA 4Y0FA 3BSAA 2V9WA 5CYQA 1GFWB 3G82B 5KFVA 2HIQA 4BDPA 2ATLA 1IB1E 2IBKA 1UFHA 3ET6A 2Z2ZA 2HG4A 3HMJG 1AMPA 1Y7PA 3OHBA 3N9UC 3LMSA 3D6MB 3ZTOA 2CPDA 5T7LB 1ZO0A 3ZTRA 2HFNA 2JNJA 4F8RA 2APOA 1KHWA 2J9CA 2QRRA 4LSLA 3TANA 2QJ3A 3HKWA 4KKOA 1F2GA 1CP7A 3KLHB 4RW4A 4FYDA 4PSWA 2HEKA 1E6VB 2C2ZB 3IFEA 2LXUA 3TAMB 2ZH3A 5AG4A 1Z2LA 4HT5A 5F8HA 2ZNZA 4DCJB 5A8RA 2DRAA 4Y2AA 3ITHB 3R7BB 2KG1A 3NCQA 1S3ZA 2VKZG 5B0BA 2QV6A 3K2YA 3ZZ0A 3LANA 4PQAA 3JYTB 5C82A 1C4AA 4N76A 3D6TB 4YB1P 3G8SA 1G4CA 2LKZA 2IJNA 3R5BA 3M8WA 4NASA 3TJ8A 1ZM2A 1MWYA 4MCSA 2XHWA 5J1QA 2V0NA 5GMDA 4YP3A 1S7LA 1JLFB 1FVQA 3PX4A 3CNQP 3GUXA 2KVIA 2I5JA 1QAYA 2AFZA 3UDVA 3PO5A 2D9PA 3VZIA 4AL5A 3M1VA 2R7TA 2CQIA 2YKNB 1MLAA 3R5GA 3PEHA 4E0DA 2ZH1A 1TL5A 4PXBA 1RT7B 2RF2B 3U1MA 5AT1B 2IRUA 5KG5A 2Y8WA 1JJHA 3D6FB 2BW7A 1T03B 3K5NA 4QC6A 3ENVA 4F9UA 2ZH2A 2AE6A 5LSOA 3J80U 4DV3J 3KWMA 1VHFA 2DO4A 5JUMA 2ZM6J 3SZ2A 2HWTA 4RBTA 4O0NA 1JLFA 2FVCA 1JJ2R 2HK2A 2HVZA 1UW4A 2BR0A 3I31A 2N7YA 3K9UA 4JI7F 3RAXA 3CWJA 2R7OA 3R9EA 2A6MA 3O8WA 4M85A 4LF9F 2CQBA 2FIUA 3LW5C 3ET6B 1TP7A 1J4JA 1I21A 4AQYJ 3QBCA 2IM2A 5IB9A 2JEIA 2GJIA 2DHAA 3PX0A 1RI7A 1DBDA 3DDNA 3RB3A 4B14A 1IJEB 3KHRA 3Q8PB 4K4UA 4CYUB 4Y2MA 3ILLA 3WIUA 4S0MA 3AH6A 3I82A 3IRWP 2V2QA 3D2MA 2R8JA 4NCZA 2HFUA 2FL4A 3K8WA 3ILIA 3UNYA 1LAMA 1RHJB 2ZD1B 4NCBA 4AQYF 4CLZA 2NXEA 5HL7Q 1SI9A 4FBEA 5IB0A 5JQ4A 4FD4A 2P6FA 3GR0A 2LQ9A 4ED4A 3DLKA 4PKDB 3IBCB 2N4DA 2ZEMA 4YB6A 2HUZA 3NXZA 2M70A 1F5CA 2J7UA 2HZCA 2ZM6F 2E9TA 4MFKA 5J2MB 1HQUB 2O01C 4AG9A 1WJ9A 1WEXA 2VZZA 1AT1B 3W5XA 2ASYA 4C2ZA 1VI7A 4AB7A 2DJWA 2WHOA 3IAM9 3DI6B 4KPYA 4ECTA 1X9MA 3CUNA 4DV1J 1MROA 4KORA 3RB4A 4FNIA 1CJKB 1W26A 2ZEJA 4TYAA 2KO1A 4J9PA 4F4WA 3SHPA 2B6AA 2MZJA 2FVPA 2D4PA 1HQEA 3RNZA 3HJFA 2CDRB 8AT1B 2CJAA 2PJ8A 3GILA 5KFTA 4QVTA 3IWGA 5J1PA 1HQUA 1RT3A 4Z7YA 1HNVB 1SUQA 1FX4A 4YR3A 2F4VF 3ZC4A 1OYEA 2JLMA 1R8CA 2HVHA 3GV8B 1WG4A 1Y10A 4F67A 5HMNA 5B08A 1I51B 1XR5A 2RFHA 2QGFB 2VDIA 2QT7A 1M44A 1TKZA 3EE3A 2HMIA 2DNZA 3AD9C 1X7VA 1YI2S 1CJTA 4FXVA 3MHYA 3MD3A 2RH3A 5LSLA 2GREA 1AYEA 3M6WA 4X4TA 3KHXA 1U2CA 2CZVC 4F0YA 1NDCA 3W2VB 4HNXB 1SUQB 1DLOB 4DV5F 3TAPA 2D1CA 3EGNA 4EZ6A 2HGLA 2BJ9A 1QSMA 5G21A 5DQGA 1J27A 2LDIA 1BPMA 3W9IA 5J1EB 4DFKA 2AKWB 4YDXA 3FMCA 7CPAA 2Q7SA 2W2PP 1RTDB 2HS0A 4YB7A 3DR6A 1QJHA 3UNGC 2F9JA 2BQ3A 2PVWA 1SH2A 2PMHA 4K0KF 2PR1A 1G2EA 4OMFG 3SBMA 3JYTA 2WSCC 1KZFA 3LO3A 2FZGB 4EBDA 3PW4A 2PJCA 1LWEB 3S6FA 2MKJA 4ELVA 1WSRA 4ZPWR 4KH1B 3SCKE 2IVYA 3PHTA 5EDWA 5E33A 1SH0A 1IYLA 1G3OA 1KLMB 4MMOA 3U1NA 1N6QA 3MMCB 3LAKA 1HHSA 2W7PA 2RDIA 5DZ6A 4NJRA 3IU2A 1S7IA 2P9EA 3B35A 4OJGA 4KVXA 5KFGA 4KO0B 1M4DA 3M32B 3D0IE 3KMQA 5KFDA 2Z10A 4GXHA 1WTFA 2X1FA 4X5KA 1B0VA 1H2VZ 1BE4A 1YSJA 4RW9A 3CXQA 4PQUB 3NL0A 5CCLA 4XPEA 3B4MA 3H5YA 3C19A 2KJVA 2ABZA 3MTJA 5LM7E 4A8QA 2OHDA 1YJTA 2OZHA 3ZZPA 1I94F 3BSOA 1JLAA 2HHXA 3D7SB 3GP9A 3BSNA 3CE8A 1X0FA 1JQGA 1H98A 5HJYA 2KFYA 4U7UK 1SBRA 3WDOA 4EYHB 2AFMA 1HARA 1W2BR 1Q53A 2PI4A 4PG6A 5F8MA 2GAGC 2CVEA 4J9VA 2CPHA 4ECXA 4DV7F 2XCPA 2PQ8A 3H0PA 5GMEA 4PZVA 1P1TA 5A8KB 3HSZA 4B9LA 2OFGX 2XSJB 4DQIA 1RE1B 4OYMA 3UY5A 4WE1A 2FJXA 3Q24A 1YWXA 2XS7A 4OC5A 4LFBJ 4NX9A 1DY3A 3GTYX 4AL6A 4TY9A 2E1RA 3SI1A 3EDRB 1YLXA 4ETZA 4JZ0A 4TXSA 3N01A 4C9DA 1T0TV 4Q44A 4NWBA 3FYNA 2W2QP 1IQZA 4YR2A 1WDDA 2V8HA 3KMSA 4PWDB 2WVDA 3EZOA 3MXHP 1NO8A 1UPMB 2XNRA 2XY7A 4PAAA 2BM0A 2Z57B 1Z1ZA 5CXTA 1TKTA 4UW2A 5E3RA 2PJ6A 1X4HA 3CIMA 3W5YA 5D4LA 4HNYB 5FDLB 4NMLA 2FC9A 1NDLA 3DHWC 4DR1F 4K2JA 2EC0A 5KT7A 2CQ4A 3S01A 4CLUA 5T14A 2CJQA 4X4RA 1IKWB 5HJXA 5DDOC 2ZW7A 2QEXS 2VQFF 3H8YA 1U6BA 2UVRA 2DTJA 4XK8C 1ZPVA 1PU9A 1U2RA 2OPQA 3V81B 3V8IA 2IDEA 4EVYA 1D8YA 1DQ8A 4KOVA 2AJ0A 2ABYA 4PWDA 4UZCA 1G6BA 3GJSB 4F50A 2ZENA 3PKMA 4TYBA 1CC7A 4LSNB 2UXDJ 4DR2F 2EK9A 4JB8B 4O4GB 2K1RA 3IS9A 3FUYA 4FYYB 3JTKA 3B6BA 4M5MA 4KB7A 5JXSA 4PG7A 5CYJA 1S60A 1HNVA 1N32F 5F49A 1LEOA 3UE2A 1IKYA 3EUNA 5CHCB 3MR5A 4QWBA 4U8VA 1OSCA 4DUKA 4WCEQ 2AGOA 3KYLA 2RC4A 2NXJA 4AG7A 4JI6J 4E8UA 4QUSA 1DZ5A 1RAAB 3RBXA 5ETMA 1XBWA 4IH5A 1AXQA 2DNKA 5GAEU 1GT8A 4A8SA 2Y1JA 1V0CA 2C22A 4N77A 2MQPA 3DGPA 3MR2A 1V3ZA 4OLOA 3G6YA 4C6AA 4L74A 1NBEB 3HD2A 3UD3P 4YEAA 2ODFA 3GU0A 3D28A 2VI7A 1YX0A 3POTB 1FT8A 4YU9A 4KQZA 4QBUA 2DB1A 1RWMB 2FE7A 4DEZA 2B5JA 1HDUA 4KVOE 4IG0A 3PB8X 3KG0A 2C3PA 2M52A 4X66F 1VQKS 3I55S 1FF2A 2AJFE 1XMOF 2I5JB 2G2YA 3MD1A 2EKYA 3OTOF 4JI0F 2HFVA 2R7XA 3HCXA 3B3CA 3JVNA 2CNOB 4A8OA 2OUGA 4OAEA 1UFKA 3I87A 3CDWA 3W61A 4I6AA 1ZBTA 1XJWB 2UUAJ 3AJ1A 3X3UA 3IGVA 1U1PA 4I6WA 2GMJA 5FLXU 2OPSA 3ITHA 2PRBA 4MK8A 4O3RA 4L72B 1RYSA 5KFNA 2ZZTA 3TRGA 5KG0A 1U4BA 4UQGA 4F3QA 4JWPA 3WBZA 3OT9A 3OR1B 1VBKA 2ZEPA 2L9WA 2YKPA 2Y9HA 3IM9A 4LF6F 5IT4A 1S6PA 3M9OB 1XMTA 2DY9A 4RW4B 5F0UA 4RW6B 5CAAA 2WW4A 2FLPA 1S1VA 4O44A 2YKNA 1KEKA 3M9MB 2B9EA 4YB5A 5KT5A 5B0EA 2GX8A 1XR7A 3UI3A 4JXQA 2FJDB 3FKBA 1HI8A 3OL8A 2LXFA 2ATCB 1H38A 2HAIA 1HBOB 2Z30B 1FFWB 4V19X 1M0SA 1RA6A 4ED7A 4TU9A 5M2PA 1LNQA 3KLIB 3TO8A 3QPIA 1X4CA 1IWAA 2P9CA 3HZGA 5J2NA 4JI2J 4R5PB 1WWZA 3H5SA 4CYUA 2RS8A 2ALZA 3KLEA 2CNMA 1ZM9A 1SKUB 4NLYA 2MZRA 1RU2A 2V63A 4K50A 2E29A 4RUCA 8CPAA 1K47A 5JJBA 4UOGA 2NYHA 2ROGA 4BHQA 1SC3B 4F6AA 1FRHA 4W92B 2YQ3A 2ARHA 2VJVA 2P2CB 3EYZA 1H7WA 3FMBA 3BR9A 1UFWA 5F0WA 3T9ZA 1VC6A 1Y9KA 4DV0F 2BX6A 1ZOTA 2EUIA 4Y65A 3DLGB 3UN2A 4DL7A 3H8GA 3Q2SC 1HW8A 2HHPA 3V4MA 3C15B 4QU7A 2DNLA 3MPUB 1S77D 1S1WA 2H1YA 3MM8A 3C66A 3KDNA 5D4NA 3D7FA 3J7ZT 3AQPA 3G6VA 2E1PA 2FHOB 5KTAA 4I64A 4CQ1A 1K1SA 3M8YA 4GS4A 3TTHA 2ZEOA 1VS3A 2FHJD 2XULA 1RHKB 2MKIA 2K8GA 1CJWA 1N32J 4C2YA 1CJVB 2XYGB 2LMIA 3PXGa 1JLEA 3S7RA 1QAIA 4J9QA 2CJKA 5T7LA 3UCGA 5IQ6A 4P4BA 2AZ1A 3K59A 3M30B 4GKJF 2H65B 2GQQA 3R1KA 4NLRA 7FD1A 2QA4G 4UEEA 4ZPCA 4WTOB 4LQ6A 3WC6A 4NRUA 4FS2A 4LSZB 3P8BB 1T94A 2RQMA 3MMCA 3E01B 2V4JB 1S1VB 4C11A 5I3UB 2UVWA 2JEWA 4OIWA 4BLGA 4HKQA 3CJKA 4U6PA 1T9YA 2KDOA 2NPIA 4N8OA 1RT1B 1RKIA 4ES3A 1YMEA 4IQMA 7AT1B 2MDAA 4IOCQ 2QYGA 3V38A 2V2VA 4EO6A 2KKHA 2D3OR 3MMJA 3JSMB 1NUEA 4B9NA 1BY9A 2Z8QA 3N28A 2VFTA 2PSZA 3N6MA 3WC0A 4CLFA 1UVKA 4LSNA 3TO9A 3RB0A 1C1BA 1FJGJ 4K0KJ 1F60B 4JI0J 4KIAA 4EFDA 2FGCA 1YGYA 4TQRA 2GIVA 1NPPA 5F9LA 3UD5A 2BA9A 3FBCA 1IKWA 1VLOA 5ETKA 4NGSA 1N52B 5IXUA 4B08A 4NA1A 4PUOB 1TL1A 1MWQA 4CLSA 3GJRB 4QR0A 2QLFB 4WP8A 3SMZA 3AA9A 3HM9A 3NS7B 4W4MA 4R3KA 2DEJA 1WELA 5FIIA 3VF0B 4NSQA 3BGOP 1VFJA 3OHAA 3QT8A 4WFZA 5CZXA 1APSA 1AA1B 4OLPA 4IG0B 1HWKA 5DLGA 3RBDA 4K2XA 1O0PA 4MIAA 2C3YA 4H54A 1RWNB 3HVAA 1R27B 3LF0A 4LVOP 4L3KA 1FKPA 1EQMA 2B9WA 4C8YA 3FEDA 3D2WA 2XEXA 5JVGQ 1O5JA 4DUZJ 4P2FA 4Q8EA 3SEOA 2J76E 5IFMA 2ZOGA 2HFZA 2P6TA 1P4NA 3DFEA 3W9JA 4CM2A 1HWUA 1D9FA 3GIJA 4JV0A 2PJ4A 3FCHA 2VBXA 3KZWA 1JLQA 2HRUA 2ALYB 3D7DA 1SVDA 1Q8LA 1Q95G 1RB0A 3AODA 3OPKA 3SQGB 5F47A 2ZPAA 4UTGA 4ANCA 3M30A 1Q2DA 2JSXA 5AGEA 1N36F 1SL2A 4CAFA 1JK9B 3CMQA 3RW6A 1AZSB 1W25A 1GAOA 2GHWA 5IWAJ 5F46A 4F4KA 3LWLA 1KFSA 4OYOA 1R0BG 4TVAB 5ETQA 2GO8A 4R25A 2XEJA 1YVFA 1VK8A 4RUBA 3ZXWA 1B70B 4YFJA 1E6VA 4AFFA 5ADZA 3OUYB 1T7PA 5KFSA 2K3KA 2AJ1A 3P4UB 2PIIA 1MG7A 3VAKA 5EUHA 3QJJA 2ZOMA 1SQHA 5CBMA 4FN5A 2UXCF 2VFUA 1CPZA 2F40A 2ASLA 2O5DA 1WEZA 3SQGA 1CP6A 3FH4A 2UU9J 2G4BA 4B17A 1BWVA 3A8JA 1U7LA 3HULA 2RT3A 3DRPA 3K89A 5F9NA 4HDHA 5GAGI 5ETRA 4I68A 4TY8B 2N7CA 3D3BJ 4CO2A 5KG1A 5L1KA 3PFOA 3W65A 2IRXA 2XMMA 3CJ5A 3C16B 1UCNA 3VALA 3W66A 2Q3PA 2NR0A 2AYMA 1AUSL 3NWGA 1M4LA 1YVOA 3AOCA 2VG5A 1QVGR 1VJWA 2CPJA 3WHIA 4URSA 3QJLA 4J37A 4MJKA 4DFPA 3NS6A 3QLHB 3CF5Q 2C3OA 4XNHC 1QLNA 3TC8A 1KR4A 4ZKAA 1V5VA 3AOAA 4JI2F 4A8KA 3PYGA 4M5IA 3MF5A 2ZBCA 2I0XA 4GVLA 2R7RA 1PJ5A 4PQUA 5ETTA 4CH1A 4DR5F 1Y7RA 3W63A 3W60A 4LUAA 3QSYB 2WBMA 2JDJA 2HHQA 4Y6IA 2ZE2A 5BXIA 1SV5A 2DNGA 2J9AA 2AJ6A 2BL1A 3HK2A 5E2QA 3NNHA 3MR6A 5LYFA 4PG4A 1JLGA 3WC2A 3UD4P 2FLLA 3MCSA 3FCWA 1NE9A 1BMQB 3PYDA 1A0OB 5H1SV 2DF5A 2BE2B 2AFUA 2GANA 1ELLP 2G9OA 2OO4A 3HSDA 3LGHA 3GKRA 1N5SA 3RU0A 2IMOA 4F2SA 1TKXB 3T9NA 2CDQA 2NS1B 3GIIA 3N7ZA 4Z37A 3DLKB 3NNCA 3CPXA 1RLDA 5KAKA 2NCKL 1NH8A 4URGA 4X4VA 5ELYA 2R8IA 4LRDA 2QL5B 3N6LA 5K8OA 4DR7J 2PEBA 2AFOA 3NWRA 3KK3A 3AD7C 4B6ZA 2LQ5A 1YITS 3DNCA 3T90A 2VD3A 3D8PA 3AB4B 2JRSA 2CWKA 2HWHA 5BYQA 2HBRB 2NMTA 2BJ1A 4L8AA 2HQYA 2LP4A 3J81Y 2KCWA 3FSXA 4ECRA 1PJ6A 1FRIA 3MOZA 3MGDA 1PBAA 3PB4X 5HROA 1M5KC 1WC4A 5GAGU 1X4EA 3GFXA 3GONA 2Z3LA 5KOWA 1WI8A 2PEHA 3U27A 4KSIA 3CO0P 3F0AA 3CDEA 2DIUA 3C3LA 2EO8A 2CQ1A 4HI1A 2VDHA 1XNRF 1TFWA 4NLTA 2X1BA 2Y1RI 4MFJA 2CPZA 3VARA 2DGSA 2R7UA 2OIHA 1NMEB 2KM8C 2R7HA 5J2MA 4R0JA 2GQCA 3UDCA 2OR4A 3CCTA 4OJHA 3A9LA 4NOHA 1EJ7L 2J0XA 2UXDF 4CLTA 2VG6A 2WW8A 4JI8F 5EWFA 2EWHA 1RBAA 4LF7J 1N34F 2RIJA 1H72C 4DNCA 4FWUA 2ZH4A 2HHVA 2CQPA 4M5JA 2B7CB 2V2KA 3EZUA 1N71A 4KH0B 1CJKA 3NE8A 3TW0A 3LODA 2VBQA 2ZEEA 3P96A 4CGPA 5FJ4A 4L76A 2XI2A 4C4WA 3J7A1 1RWUA 2CJBA 1MK4A 3HHLD 5ETPA 2BANA 5I3QA 3IMQJ 3MCOA 1EKSA 4K4ZA 2JEGA 1BD6A 2FY1A 4ZPBA 2DNHA 2PJ2A 3Q83A 2Z0ZA 2X3DA 5AE1A 3GG1A 3D7GA 3MUTP 3MUVP 2XMTA 1OY6A 4N5SA 2EK1A 1GMUA 2J9DA 2ILYA 3MMAB 3A12A 1S6OA 4CH7A 1XNRJ 2HBQB 3VWEA 4M8LA 2MQQA 4HACA 4K59A 3BV8A 5A8WB 4CNZA 3NGUA 1X12A 1LWCA 2HQFA 4ERDA 1QD1A 1V5IB 3GV7B 2CZ9A 4AXIA 3DLEB 4ICLA 1LKZA 4CO0A 1GEHA 1RU1A 3BDPA 2HAFA 4MHDA 2CNLB 3JTPA 1YBAA 2RQCA 1FRMA 1DQAA 1UETA 3AAWB 2EKNA 3BS9A 1Q0NA 2A3JA 2WVFA 2F8MA 2ZZNA 2Y3YA 4B3MJ 5FD1A 1RT7A 3Q8SB 2HNZA 2QIRA 1UJ4A 1Q8BA 1JLCB 5K5MA 3PRBA 3T1YJ 2AFXA 4NLDA 4N47A 2IHR1 3M6UA 1NPRA 2VBYA 3M1VB 3A8IA 2NQPA 2D7SA 5E3CA 4UFXA 3T8WA 3DRXA 4D3GA 2HVIA 4QWDA 3EVMA 1M5SA 1D9DA 2ACMA 2W7AA 2W1BA 2YH0A 3HZEA 1S76D 1RABB 4H4KC 1KONA 2QLXA 1MMDA 4HKFA 3ZZRA 5L9XA 4EZ9A 4F0KA 1N4LA 2ZEHA 2EBEA 2ZJPQ 1FFSB 4DYOA 4UY85 1F6TA 3KQZA 2K1RB 2WVCA 1OY8A 5I3PA 3FBEA 5LRGA 2CRLA 4Q0BB 3CD7A 3KQXA 2DT9A 1LXJA 4J9MA 3K5OA 5H9FK 2R98A 1TFYA 3LGNA 2FVSA 4KE5A 3CIZA 2RUGA 2M2BA 1S59A 2B4BA 2E5HA 1IWGA 4Y2CA 3UPFA 4MK9A 5D15A 4ZJLA 1C0TB 3CJKB 3H2LA 3I96A 1IUJA 3D3SA 1F5BA 2XO7A 4NE9C 4ZP9A 4ECVA 3V7ZA 2FS5A 3NGSA 1SJ4P 2ZDPA 2KN4A 4DX8H 3O5TB 2B4PA 3E0KA 4B02A 1XFOA 3HLUA 1P1LA 3KR4A 3QT7A 5B0GA 4DUTA 4FD6A 4JP8A 1KNZA 1R8PA 1KDNA 2CJ9A 3MECB 2E9RX 1SKRA 4IG3B 2J0SD 4PYAA 2VONA 1Z9UA 2IRYA 2V8GA 5LYLA 1YKWA 1LW0A 1DAXA 4WZMA 4GRSA 4ID8A 3UQSA 2EG2A 5KFCA 3T9YA 4RKUC 4R9MA 2B9YA 4I0WA 4DOZA 2BEIA 4P7TA 1WUUA 1VRTB 1Y0HA 4RR5A 2OH2A 3HI9A 1LWEA 3MCMA 3ZTPA 3GYNA 4ED0A 1H7XA 4DL6A 3GSIA 1YRTA 3E01A 1UVNA 4CGNA 3CJRA 3DU6A 4NFRA 2HC9A 2XGQA 4UOCA 2DHGA 5HMYA 3DGVA 2PIZA 2NZ4A 4Q36A 3K58A 4XPDC 2EXUA 2DISA 2XLJA 3MFHA 2MYFA 1OBRA 3PW0A 1RAJA 1CBKA 2XSFA 5DM7Q 1HR0F 4LF4J 4FF1A 4MTPA 2WTFA 2PGCA 1N54B 4HTJA 3H98A 4ZHRA 3G71S 4P71A 4B9MA 4P4DA 3JRUA 4ZYQA 1JLAB 2DNYA 4ED5A 4U9RA 5KOXA 3LP2A 3A13A 4NCGA 2PR8A 2EVZA 4PYDA 4A8FA 2Z3PA 4CNYA 3BN7A 2ZOFA 3AD8C 1ZA2B 1FCAA 1NCLA 4LQGA 1FJCA 3GZ7A 3MURP 3OVSA 2ZJQQ 4U8YA 1RWOB 3MEGB 4M63A 1V6HA 4USHA 3FZBA 4O3QA 4ILMA 3FDSA 4ZVEA 5DDQC 2RKIA 4KHMA 2EFGA 4ED1A 2Y0SD 4DQQA 2CQDA 1N5VA 1GNKA 2CAJA 5G0RB 2ZZMA 3DMJA 1JWQA 1EZZB 3G8QA 4WKYA 4IKAA 1VQ5S 3KASA 4ZCMA 4N8NA 3M8QB 4DG1A 3ENAA 3CJ0A 3BDEA 1PILA 2YWEA 4DV6J 4FKXA 3BJYA 1U1LA 1NSKL 1MSWD 3MDFA 1RTIB 5LJ5Y 2GGPA 3FRMA 2M0GB 3B2YA 2ZHAA 1J5OA 5A8WA 4HACB 5FLXY 4K3NA 2YY3A 3SQOP 5MLCV 5F8LA 2KYXA 1SQEA 4GMKA 4OI2A 1T9WA 2ZEGA 4KOTA 4PXDA 1HI0P 4NXYA 4WFXA 4NLGA 4OC2A 2RUSA 3TYTA 2VC0A 4X65F 5B0AA 3VVTA 4MCRA 3U1LA 4EBEA 5L9NA 4X62J 5LJ3Y 1NK4A 4XPKA 1KOOA 5IC4B 4UA3A 3TI0A 2AIRB 5HAOA 1F3VA 4DUYF 1TKZB 1ZG8A 4BS2A 1IBCB 2HNZB 2DY1A 3FFIB 1URRA 2K2PA 2BKNA 2IM1A 3BI0A 1VQYA 1YJNS 2XB2D 1E6YB 3DR8A 4J7CA 3PBBA 4IRKA 2NYIA 3TZWA 1IOFA 3T1HJ 4DV6F 4ZLLA 4U9YA 3B8HA 1DLOA 2A10A 1KVKA 4IQXA 4HTIA 2AYBA 3NCRA 5EWGA 2H3EB 1RDRA 1X10A 1RT3B 1IBLF 1FWLA 1Q7LB 3L09A 3KUEA 1Y9WA 1FXDA 4L3NA 4E2FB 4IF5A 2EK6A 5GCNA 2L3MA 4AUKA 3E8OA 2ZNYA 3TFYA 4KTQA 2E44A 4PPZA 2BOAA 4DV5J 5LYDA 4OZ0A 1UMJA 4CLKA 4CYQA 4I2QA 2RRAA 2HNDB 2HQ3A 1NHUA 2MKCA 1IKXA 1U1QA 2QA2A 4WYLA 1YHQS 1NSQA 3PR4A 4IFYB 4NEXA 4X4NA 4OZ5A 1P9YA 2Z58B 2P6GA 4LF9J 1TK8A 4C2XA 3B4DA 4DR5J 1RYRA 1HMVA 4DL0C 5IOLA 3GCWP 4NA2A 2W01A 2QX0A 2GA7A 3SJFA 2VBWA 5C2GA 4ATNA 3T5LA 1S1UA 1F2PA 3P6YC 2WCXA 1KD1T 2DPSA 2VQEJ 2WZNA 4KJIA 3OR1A 1FTRA 4UIAA 1TKHA 4B3SF 1RWXB 2A6OA 4DR6J 2GAHC 1P0HA 1TVRB 3K7RA 3E2EA 2EFQA 4ENOA 4XAKA 3UW1A 5DG8A 4EGLA 4QBJA 2FB0A 4IDKA 4NGPA 2YWGA 3DOKB 2GVDA 3CCWA 1Z5RA 4F4XA 1S0NA 3B3TA 1RXTA 4L6V3 3HFVA 1UEUA 2XMKA 2W24A 4NGMA 2YWFA 4KR0B 4CZCA 2GE3A 1I94J 2FVGA 1FE0A 3SCLE 2ASDA 3GQCA 3EPIA 4DV4F 4DSLA 1RHMB 2BACA 2KTQA 1T03A 3MM5A 3VV2B 5CZVA 2ZXVA 3HLPA 3IGRA 1UA0A 4FPIA 3QFHA 1SC6A 2YX7A 1VBYA 4LX9A 1NDKA 4OYWA 2XWYA 2IFXA 1Z8TA 1SL1A 4DSFA 4UEFA 2M3DA 5B09A 5EBVA 4C8KA 1H73A 4DV4J 3L7PA 3KLGB 2RQ4A 4U7UD 4MJ8A 1RTQA 2CNKB 3IO1A 1YREA 1N5YB 2BJDA 1RGVA 4C7IA 1EARA 3H8EA 1LW2B 4CI0B 2O53A 1TV6A 4RWWA 1HD1A 2IDLA 2ZHBA 1WOOA 4Q45A 4J9NA 4P2XA 2M8DB 1JJCB 3D54A 3VQTA 1RTJB 4HH0A 2LQ8A 4X64F 3M8PA 1GTEA 3GJTB 3ZNUA 3BBBA 1EE3P 3CCJS 2R2RA 4PABA 4X4QA 2IJZA 4MBUA 3PYEA 4B3OB 5LL6d 1GH8A 3TJAA 5IT0A 1TAQA 3NE7A 3C14B 2N4CA 1BLLE 4NLVA 3F8KA 4UT4A 2MB0B 3NOCA 1YRUA 1OY9A 2P9GA 3ILJA 2G9DA 5KTDA 3RG6A 4LREA 4OHWA 4HVZA 2G0BA 3RR8A 1TKJA 4RW9B 3FEEA 4WE1B 1KLNA 4ZCIA 4F3MA 2C1EB 3DN9A 1UVLA 3ETMA 3UN3A 2YWKA 2JOQA 1T9VA 1UVMA 4JYAJ 1B0TA 4ZX9A 2FT0A 1DURA 1Q5YA 1MU2B 4K7QA 3G96A 3CJ2A 1R89A 1YTYA 3OLBA 3LP1A 3HT0A 2ZWOA 4B5PB 4DQPA 5HMXA 3W91A 2F63A 2FDNA 4B9TA 2V6AA 3ENQA 4PXEA 2PE3A 4FZVA 1FI4A 2L9NA 1VOMA 2PA3A 1K8AT 1CS4B 5A0YA 3ZTSA 1SQGA 3D9BA 4OHZA 4ZVOB 2ZVIA 1S1XB 3FEXB 2IYGA 2FJAB 2VPZB 2MLZA 3TVZA 2YNIB 1K0TA 1TK0A 2R42A 1HNZJ 5C42B 3PDNA 1L3TA 1Q1KA 1KC8T 4UOHA 1BGXT 1YR0A 2GMHA 3HT3A 4YR0A 4Z2XA 4A8WA 2YBVA 3GYGA 3NY0A 1ON0A 4G1PA 1A6LA 5HROB 4KUAA 4DLEA 3NGRA 4XO0A 1PUAA 2D3O1 4OJ3A 2IM3A 4ZBGA 2FVRA 1RSCA 3HX9A 1QTMA 3NH5A 4OKOA 2DRBA 4IFVB 4TLQA 4KPCA 3HFZB 3CDUA 5JVHQ 4OYBA 2W4CA 3TWZA 4MRIA 1ZS6A 5IM0B 2BXJA 2V68A 5IWAF 3KR5A 3HHKA 4DWIA 2FJVA 5A8RB 3THVA 4DJBA 4ZP7A 4FXDA 4JI6F 5KT3A 2Z56B 3MM6A 3ULHA 3TT2A 4MHPA 3F44A 6AT1B 1CJUB 2GQ2A 4HL9A 2VH7A 1TKFA 1A2ZA 2FTRA 4ZVQB 5KFEA 1B3TA 1DHMA 3VGTA 4MKBA 2Q44A 3FBUA 4J91A 2AQ4A 3R5AA 4MFBA 2XO6A 2GIFA 3R9LA 1O6XA 4NXMF 3IWEA 3WX8A 3RRHA 3DLLQ 2RDJA 1T05B 3TX8A 3AQOA 3B78A 1KQFB 4XPLA 1Q7YT 4FP9A 4MYTA 2YQ0A 4H4OA 1IICA 4M1KA 1BPNA 4WK1A 1EHWA 4PXCA 3S1TA 2ZH8A 2E5LF 1EETB 1EX8A 2QMWA 3CC7S 2LA6A 1M1KT 4DF8A 3KK1A 2K3IA 2YH1A 3KLVA 4QZVB 4WYWA 5LXRA 4OYIA 2OMLA 3E51A 2E7WA 3B3VA 2DBBA 2K7KA 5F41A 1Y7EA 3MTKA 4ANEA 2MEWA 4M3SA 5THWA 4NJQA 3OFGA 2W4PA 5CYMB 3OTBA 1U1NA 5AG6A 4IO9Q 2R9LA 2ZJRQ 3OTEA 4MH8A 1NK0A 3DXBA 4ZPTR 5K14B 3MPVA 4QOTA 3MEDA 4JUZA 2PN6A 2GHPA 3QNWB 4NXNF 3MEGA 2FCKA 5AG7A 1QMUA 1U48A 5A27A 5KFHA 2ZFHA 1UPPA 2DH7A 5SZTA 4MXUA 2V50A 2WONB 3G8TA 3NH4A 2J9DE 2EFOA 3RW7A 1UEVA 4X84A 2FYXA 2OB0A 3E3XA 3QWPA 4GO5X 5CH7B 4ZP8A 4OI4A 2A4NA 4LQ3A 1XJOA 2G0CA 2BDPA 1Q82T 2CG8A 1KP6A 5AXMA 4ES1A 1JJ4A 4I7FB 3TUJC 1FJEB 3KK2B 3NLCA 5EX3A 3G2XA 4F2RA 2E7XA 1ZAWA 4XTTA 3BPSP 3C8YA 4KSFA 2DEAA 5D4OA 3MPDA 4MHZA 1XR6A 5DO2A 4KGKA 2DR7A 3BO2A 3SV3A 1PJ7A 5EHHA 1PO6A 3ILOA 2Z3OA 1QUPA 3M2UA 1X4BA 2YNCC 3DDKA 1MMNA 2MJUA 2J5AA 2YKMA 2GVZB 3KJVB 5J2QB 2MKYA 2DITA 4QR1A 4RW8A 2DPJA 1VQNS 2H5IB 3BH7B 2OJ3A 2OEMA 3BQ1A 1RAGB 2HZAA 2V69A 4H4MA 3L95X 2XEFA 1CULA 1U1OA 2NUHA 4USKA 4DU7A 4DLGA 1FNXH 4ZVHA 3SSQA 5L1LA 3PM9A 2A2DA 1QDUB 4MI4A 3GIKA 3WR7A 3EM1A 5CYMA 4OZJA 3PJWA 4KV8A 1RTZA 1HNZF 5E96A 1TL3A 3FFIA 1H2UX 1PYOB 1RJJA 1DARA 3M2RA 4CTAB 5HO4A 3KG1A 2HYIB 4PG8A 2QL9B 4DR4J 5LOQA 3DOLA 2FC8A 2NLWA 5D8HB 4HEA9 2PMWA 2ZVSA 4K30A 1U0SA 4CAEA 3EMTA 1TUVA 3BM7A 3UCZP 4ONUA 4DV1F 1YGHA 4EYIB 5IC6B 4RU2A 2WSFC 5DWMA 3I1UA 3C2PA 1M5HA 5L8RC 5HMZA 4Y2KA 1TF9A 5DQHA 1RT2B 2B4DA 4ZX8A 3S6EA 1ACMB 1KWMA 3T41A 3V2UC 4G1QA 5SUHA 2DH8A 1V9OA 3VATA 4ECWA 3FB3A 2JDCA 3DKDA 4K4WA 3FRYA 1ZG7A 2DGWA 3FBFA 3M6XA 1ULRA 1PG5B 4ED2A 4Y49C 3MOJB 4DPTA 2CPIA 2FY8A 3OTCA 3GY9A 1IM4A 4QQBA 4NF1A 4YUDA 3KJQB 2HKEA 2CUYA 1M4IA 3G9CA 3EGWB 4MY0A 4YWYA 2QSFA 1M5VC 4DR6F 2BW2A 5KFWA 1FTCA 4IUSA 3BJ7A 4R7MA 2DGXA 4FVMA 5AJ3J 2ROPA 3L2NA 3KUHA 3FRZA 1P9QC 2FHKA 4QYZJ 5CD4A 5AG5A 1NSPA 1TMJA 4G6VB 2LU2A 4IOAQ 2AEFA 4DR1J 3IWLA 2BOPA 3BGLA 3EPGA 3R96A 4CH0S 1M4GA 1KBRA 2WRMA 3BGUA 4WWSA 1CX8A 2AU0A 4YY3F 3IRXA 4FVCA 5IS2A 1C0TA 1YQEA 4DR4F 3SFGA 1LRZA 4QW8A 1RT4B 4LFBF 2EVNA 2DIVA 3KG4A 3HVWA 3J7AN 5GVQA 1HPZB 2YNCA 3WC7A 1G1XA 2R4FA 3OVBA 3M2VA 5HQLA 2C6PA 2Q04A 4WFAQ 1HBUA 2HQGA 3EC4A 1EB0A 2XEGA 1YK3A 3QIDA 1Z4EA 2YQ1A 4UFWA 2Q7BA 2I3CA 4ITSA 4K8RA 4YDDB 1PIEA 2EK8A 2QZ8A 1IR1A 3VWSA 4LF1A 5M2RA 3IG1A 2OMOA 4JI1F 2XCAA 5BR8J 2DNOA 1MNEA 2ZWPA 1CM0A 3UFCX 5CYQB 8ATCB 3FCVA 4M95A 4KOUA 3MI7X 2PIYA 4QIWD 1S0MA 1S10A 2VICA 4CT8A 1Y3KA 3P3DA 4B9SA 3H2UB 3FK4A 4DX6A 2VA2A 4OP4A 4AE5A 4OIXA 3ZZZA 4WBFA 5C24B 4H4KA 1F3FA 3RB6A 3NEKA 4OX9F 2ASJA 2G3TA 1R8HA 1YLEA 2J8NA 4R8FA 1S48A 1BHNA 5D4PA 1U6ZA 1VHSA 5A76A 2VUGA 5HVGA 3ZNJ1 3GWCA 4PR6A 1U02A 1BLUA 4I2PA 4P74A 5KFQA 1VRUA 1KVIA 3FQLA 4RN7A 1RAOA 2QYVA 2NUUG 1OJ4A 2WPWA 2ZBRA 5ISVA 1N5TA 1I12A 1QE1B 3C6TA 7FDRA 1GX5A 2XHCA 4OC1A 4TY8A 2ZKTA 3SFUA 1NK8A 2PO4A 3NKYA 1UKUA 4NMXA 2DYAA 1RTHA 2AJ4A 4HPSA 4U67Q 5ITHA 2AYEA 4I1TA 4HR2A 1RT5A 2PRQA 2H48B 4LUBA 2VV5A 1NHKL 3W64A 2W25A 2GNKA 3NRBA 2GO9A 3SJEA 2QFIA 2ZBIA 3EWGA 2R1IA 2MSTA 2DXDA 3EO4A 2EFPA 4NZ6A 3RZAA 3IXQA 3US5A 4BWJA 1WC6A 4ZS6A 4I4BA 3MAQA 5A28A 4KSEB 3DRSA 4FKYA 2JEFA 3T5HA 4LVNP 4URQU 3FEZA 5HK4A 2KT2A 1RISA 2AHOB 4OV6A 5IV3A 4YHHJ 2CWXA 4P6YA 5I42B 4USMA 3OLAA 1D09B 2Y0BB 3QMQA 1Q78A 5LRJA 1BQNB 5F3TA 2EPIA 1S99A 4M6GA 2XQCA 1PBUA 1KLMA 2Q4YA 2WAQD 3D1QA 4QW9A 2IYIA 1RBLA 3R9GA 1Q5VA 4RNNA 3W8GA 4Y28C 4ZOSA 5K8NA 2I2YA 3U7JA 4JI8J 4MKAA 3BYRA 4M5DA 3DM2B 3Q8QB 4ZVUB 2M7SA 1CS4A 4FYXB 1HWJA 4K4TA 4X8IA 5HH1A 4OV1A 2J7WA 2RHSB 4LFAF 3DRRB 2GIRA 4KBIA 2MKSA 1ICEB 4AVBA 4ZJQA 3BKFA 5GAHI 2BRLA 4XDDA 2IJFA 1XNQF 2QA1A 3CD6S 4FF4A 2HHHF 3QRPA 2HHSA 1S79A 3S9MA 1B99A 1WC0A 5B0FA 2VOPA 1NXIA 3T3FA 5L38A 3NAHA 2ZUGA 3RBUA 2Z0GA 2AZ3A 5F8JA 1PAUB 4NCAA 1KFDA 2H9ZA 1QAXA 3M8RA 1MW7A 4OJ1A 4NXMJ 1BQMA 3I0SB 1WEYA 3ZZIA 2LFVA 2I9SA 2G1HA 4OFZA 2GC8A 2IAJB 1VQMS 1GMWA 1Z8XA 3T6JA 2WPXA 5HATA 4NEZA 3Q0AA 1DTTB 1FKOA 4BBHA 2A0FB 2EBJA 4DSIA 1NH7A 1S97A 1FEEA 1NZAA 3K9TA 3ISZA 2BRKA 2LVWA 4RNHA 2BJ7A 1XRYA 3P2HA 4YHHF 2KRRA 4TQSA 1JXEA 1JKHA 1Q2CA 4R5PA 2WVEA 3I0SA 3M8SA 2CXEA 3QAUA 1YJ7A 4DBQA 5JM6A 2QYCA 5KFYA 2C1CA 1IBMJ 4HHHA 5FDLA 3T1YF 3TOQA 1NHVA 2JFDA 3VAFA 1WHYA 4I69A 1UVIA 2ZH5A 2JVRA 2XM3A 1BQNA 3V6DA 3C6UB 1HL6A 1KQGB 4B5OA 2VG7B 2XMAA 2F3JA 4WXOA 1P27B 2W4DA 2BE9B 2OSRA 5I4MA 2W9BB 3OSNA 4MHNA 2QECA 2LEAA 3J7Z5 2XZWA 2Y1IA 3PB9X 2MGZA 1ZYQA 3CSKA 1VBXA 4M94A 4RX6A 5G1ZA 1M90T 2Q4ZA 4M5NA 1HEEA 2COLA 2W8LA 1S6QB 2D3UA 3QWUA 1UP1A 2JLFA 4DDFA 2B3TB 1QSTA 4LRAA 4J9SA 3BLNA 4OQJA 4MIBA 1FXLA 2GJFA 3TP2A 2BBEA 5J8FA 2DNNA 2CTCA 1U0HB 3VCDA 1N48A 4FPRA 4YQWA 3C16A 4OI6A 3OQ2A 2BSWA 1R0CB 5CCMA 4B3MF 1QSRA 3RO0A 3FEYB 3W9HA 2HV2A 2CYYA 2Q0YA 4DR2J 2KM8B 3CCRS 4LF5F 2DHXA 4B12A 1SJQA 4ZGYB 3SXNA 4USUA 1RAEB 2X1GA 1R6VA 5DGAA 1TELA 2JZ5A 2VL1A 1U1RA 4I49A 4F8ZA 3CEDA 3HVTA 5D3GB 3CXCR 3IJ3A 2WONA 3HHLA 2CVIA 3DMJB 3CJ3A 2BQRA 3TA2A 4ER8A 3K2KA 5LXYA 1ZZFA 1VK3A 4YS2A 2QMXA 4LR9A 3M9NB 2LQJA 2H51B 4LMZA 2ZC4A 4O3OA 4USWA 3TVKA 4UCMA 4ANDA 1TAUA 2DGUA 3MEEA 4NXNJ 5D0HA 2XS5A 5HXDA 2VQEF 1BQMB 1WG5A 1NJXA 4RBVA 3JS9A 4E2AA 2LEBA 4ZLJA 2HQCA 1T95A 5KFFA 2RJZA 4E98A 3G4SS 3J7YI 4P4EA 2E5IA 3PIPQ 3OFEA 4LF4F 2DXFA 4ED8A 1F2HA 2OSQA 1WOPA 4HHUA 4V19J 1PCAA 3FGVA 3DLBA 5BWAB 4WXWA 4DV7J 1Y9OA 2AF6A 3A3NB 3GIMA 4RW7B 1IVZA 4MFPA 4FYVB 1AFIA 1NU4A 1RWVB 5CA5A 2PI5A 5KT4A 1Y3JA 1SIZA 4CO1A 2CJYB 2YKAA 1VQLS 1GYTA 2UXBJ 2G0IA 2DR5A 3PG9A 3D66A 4R6TA 5KT2A 4C0BA 3VAJA 4DV2J 1S4EA 2JEJA 3PVXA 2VZ9A 9RUBA 2XY6A 1SJ3P 4USTA 2HWIA 5KFIA 4II9A 2QE5A 3ZO7A 5I42A 2D74B 4OADA 2C2NA 4KFBB 2RB7A 5DWNA 4FXWA 2WB1D 1L0CA 3QFWA 4KOSA 5E3AA 3P49B 2KXNB 4OC4A 2E5JA 1XERA 3OR2B 5KFAA 2E5LJ 2Z2MA 2VPXB 3QATA 3GE9A 3BQ2A 1D1UA 3DOMB 5KFOA 3D67A 3NFZA 3WC5A 1MJAA 2HZVA 3NH8A 1LWCB 3PEJA 3UDLA 2P8IA 4WPAA 5ETNA 1ZZNA 2HQDA 3H59A 2BZ2A 4GC7A 2YX4A 3PRVA 3DRYA 3GSDA 2VFVA 2P6SA 2MZ1A 2ADBA 1UJ5A 2LYVA 2EBGA 3V4IA 1T02A 2OKQA 3R1HA 1C1CB 1RHRB 4PEOA 2BANB 2ZW6A 1Y5NB 1VQPS 1JLCA 5JMNA 1L3UA 4HH1A 1HNXF 4U5YA 2CKWA 2AJ2A 4B5PA 4C48A 3H5ZA 1XQIA 2QMUB 3BGRA 2VPYB 4KS9A 3BEGB 4Y3CA 4DR3F 1SL0A 1CPXA 1JXVA 4AL7A 1WNEA 1VRQC 2MSSA 2XZTB 2HURA 3C6UA 1NSLA 4N56A 3CVKA 2DR8A 1TUWA 3VHQA 3GIRA 3G6XA 4FNHA 4HT7A 1NKEA 4CRZB 3MCNA 3T5KA 1HR0J 1F57A 3GYAA 5KFLA 2OLWA 2DNPA 1ZH5A 1VQ9S 3MUMP 4FF3A 4ZMMA 3HUVA 4A95A 3I5BA 2OPRA 2FJEB 2MKKA 4DJLA 2R2SA 1X4DA 2MGZB 3HHNB 1QSNA 3OFFA 4CWBA 3GCXP 1PGZA 4YY3J 1S7NA 4IO1A 3PO4A 3TO7A 1UWBA 4WP3A 2AP6A 5H86A 2V34A 1S49A 3MAAA 1TMMA 4DHVA 5KFZA 2DPTA 4KLVA 3LUYA 3F5BA 2H5EA 4W98A 2AFWA 3GYXB 1BAVA 3CCVS 2PJ0A 2AD9A 4TU7A 2ZKUA 3PTWA 3N5BA 1FRJA 2V4QA 1XOVA 4KSAA 4C7HA 4ZITA 3TE4A 1TL7A 1LWFB 3JXOA 2CQGA 3OL7A 4Q43A 3CTRA 1SV5B 3QIPA 1UFLA 3ISXA 3BGRB 3I9SA 1TL3B 1F9FA 2GV1A 3NBPA 4U9ZA 3BN4A 5B0DA 4QR2A 2CNTA 4LF6J 4WTYA 3Q8RB 4J90A 2BUEA 1GXLA 1RAFB 1JMTA 3IR5B 3UDEA 2XTJP 2HNYB 1FRLA 3CD5A 2BE7D 3AOBA 3JAMY 1HHQA 2EFNA 3TQ1A 1MN9A 4WIIA 2PJBA 3BO4A 2FXFA 3FQKA 1WG1A 2VQYA 2F5GA 3BYPA 3M7VA 4A46A 4R8UB 1J2VA 1QTNB 2ZH9A 1YK9A 2I8EA 3FNNA 3H90A 4MKVA 1XMBA 3CT9A 3PJXA 3H5UA 2HW3A 3B3SA 1KUXA 2B0GA 5HI7A 4LIRA 3RBEA 1A7GE 1QSLA 2OFHX 1C4CA 1IBLJ 2LLZA 4M6HA 1WDTA 6FD1A 4CGMA 2HNYA 4ECYA 4PPDA 1TIQA 1EIYB 3W8PA 5AJ3F 3HVRA 2NYQA 2B5GB 3MM9A 1OSDA 3KI9A 1UJ6A 2PA8D 2CADA 1T9TA 3CCZA 3IEHA 1VC5A 3EDQB 2D69A 3LWUA 2XNQA 2E9ZA 2KU7A 1M5PC 5RUBA 3V6HA 3W62A 3SDEA 1TL7B 1PC4A 4F04B 4OI1A 2X3GA 2VHGA 1TZ0A 2QG9B 5ETLA 2AYGA 2GFQA 2MKHA 1VHEA 1IBMF 1P6TA 3D3CJ 3DYAA 3DU5A 3RYLA 4U7CA 3OFHA 8RUCA 4PSXA 4KFBA 3HHLB 4B10A 1YIJS 3MM9B 2YKMB 4B3RJ 4NGQA 3EFAA 1S6PB 4DR7F 1WKLA 1D9AA 3F0NA 4HI2A 2CPEA 1KKHA 1HPZA 3DC2A 1HNWJ 2WZ1A 3I0RB 2YWHA 4OYPA 3O1LA 2HHUA 1LFPA 4Q8FA 1IOIA 1U24A 1SXLA 4ZLPA 4OC3A 1SKSA 5K14A 4LBIA 3QSIA 2CIJA 3DOMA 2OPPA 4J9RA 3ENWA 5J2PB 2CXAA 4BINA 1NKCA 2ZELA <