3CT9A

Crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
353
structure length
346
Chain Sequence
b'YDIPTMTAEAVSLLKSLISIPSISREETQAADFLQNYIEAEGMQTGRKGNNVWCLSPMFDLKKPTILLNSHIDTVKPVFTPREENGKLYGLGSNDAGASVVSLLQVFLQLCRTSQNYNLIYLASCEEEVSGKEGIESVLPGLPPVSFAIVGEPTEMQPAIAEKGLMVLDVTATGKAGHAARDEGDNAIYKVLNDIAWFRDYRFEKESPLLGPVKMSVTVINAGTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNSSRIDEKHPFVQKAVKMGRIPFGSPTLSDQALMSFASVKIGPGRSSRSHTAEEYIMLKEIEEAIGIYLDLLDGLKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylornithine deacetylase
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron vpi-5482
publication title Crystal structure of a Putative Zinc Peptidase (NP_812461.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.31 A resolution
rcsb
total genus 101
structure length 346
sequence length 353
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ct9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ct9A01
3VH9A 3KL9A 4CPAA 3TX8A 2O53A 4NGPA 5D8NA 4Q7AA 2V77A 2I3CA 5F09A 4PXCA 1F57A 5LYIA 3FECA 3FJUA 3NH4A 2HB6A 2PJCA 2PJ1A 4PQAA 1RTQA 2WYRA 4ZX8A 2PJBA 1UWYA 3IWWA 4OC4A 1YSJA 4MCPA 3SJGA 2C1CA 4NGSA 4F9VA 4NGQA 5I4MA 3IO1A 1Y7EA 2AFSA 3KI9A 4G1PA 1XBUA 2BCOA 1VHEA 3NFZA 4P45A 4X2TA 3FF3A 1FNOA 2JBKA 1ZG7A 4JYWA 4R76A 4R8FA 4BD9A 1CG2A 1PCAA 3ISXA 1F2OA 3K2KA 4OC3A 2CTBA 2G9DA 3PB7X 4OC2A 4WJBA 1ZG9A 2O4HA 1GYTA 3GLJA 1TF9A 4UEZA 7CPAA 2ZEDA 5K8PA 1ARMA 2ZENA 3BI0A 1YLOA 3BXMA 2PE3A 2Q4ZA 2ZEFA 4UF4A 4P6YA 3WC7A 2HC9A 2Q51A 4ZX9A 2PJ2A 3SI0A 4NJRA 3D66A 5LYDA 1TKJA 2ZOFA 3D7HA 3PB8X 4P4DA 2PIYA 1BAVA 3FVLA 4NGRA 3CT9A 5D29A 3FEDA 2NYQA 2VL1A 4MCSA 2XEGA 1KWMA 3LWUA 4FBEA 2PJ7A 2AFXA 3B7IA 2V8DA 4MXUA 1LANA 4IK2A 2ZEMA 5JM6A 3WC6A 4K3NA 1HEEA 5JH9A 2IQ6A 1IY7A 4FUUA 2QJ8A 3RBUA 5LRJA 4OP4A 4X8IA 3SI1A 3SJXA 3H8GA 3H8FA 4MHZA 2Q43A 3KR5A 2F7VA 1XFOA 2ZELA 3D7DA 3KHZA 3KGQA 3SI2A 1Z5RA 2PJ6A 8CPAA 6CPAA 4OMEA 4R7MA 3S9NA 3NH8A 2V8VA 4NGNA 3MN8A 3PB4X 4IAVA 1R3NA 3S9LA 3PFOA 1F2PA 2GREA 4A39A 4NFRA 4MHYA 1XJOA 2PVWA 2WZNA 4PXDA 3FX6A 2XEFA 4DJLA 1YW4A 2PJ5A 1NSAA 3B35A 4OC1A 5THWA 4DUKA 3GUXA 1VIXA 4MMOA 4R6TA 4JZ0A 2IJZA 1QQ9A 4YWYA 1BPMA 1LOKA 1Z2LA 4NGTA 2PJAA 4RUHA 3RAMA 1VHOA 1JQGA 1ARLA 2RFHA 1YW6A 2ZEGA 2PCUA 2OOTA 2PRQA 4O23A 1ZLHA 2AFWA 3B2YA 3JRUA 5HVFA 4ONWA 2V8HA 2J9AA 1TKFA 2DEAA 3D67A 4EFDA 5K8OA 1PYTB 2POKA 2CTCA 2JBJA 4KSIA 2ZEPA 3S9MA 2EK9A 2ANPA 1Z8LA 1ELMP 4MHPA 4DYOA 2ABZA 5IB9A 2RB7A 4EMEA 2PVVA 2BO9A 4A94A 4OC0A 2C6GA 2GLJA 3CDXA 3I1UA 4EWTA 5CPAA 4TNUA 4PPZA 3KQXA 5K8MA 4P4JA 1CPXA 4LQGA 3WC5A 4GM5A 4MCQA 1AMPA 4TWEA 4MHNA 2ZEHA 4UEFA 3PBEA 4NGMA 5HVGA 1CPSA 1OBRA 3IFEA 4UEEA 3MRUA 3B3SA 2CIJA 2PJ3A 2ZEOA 1XRYA 3PB9X 3DGVA 3NH5A 3D68A 2PJ4A 3PFEA 3NA6A 4P4FA 3BI1A 3IIBA 1LCPA 3CPXA 4P10A 1EE3P 4OIDA 3D7GA 3FH4A 4ZY2A 3ISZA 4P4IA 2XEIA 3IEHA 5DS0A 4FWUA 4P4BA 1BPNA 3SJEA 2XEJA 2CF4A 5J1QA 5LRGA 3V7ZA 2EWBA 1LFWA 3D7FA 1QMUA 2BOAA 4IHMA 1CP7A 3K9TA 1Q7LA 4F8ZA 3QNVA 2C6CA 1R43A 4ZY1A 3V38A 1AYEA 1TXRA 5LYLA 2GLFA 4YU9A 5K8NA 2AFOA 3KQZA 5JGFA 4FAIA 3HLPA 5HVHA 4PXBA 4F9UA 3PRTA 1DE4C 4MCRA 3CPAA 3FEEA 4OKOA 3BHXA 4WWVA 4ZY0A 4X3RA 4W9YA 4A37A 2GU2A 1TF8A 1FT7A 3L2NA 2PIZA 3GB0A 4OIWA 3D4UA 3PEIA 2PJ8A 1Y0YA 2F8HA 5LYFA 1ELLP 3KASA 3WABA 3TC8A 3N5FA 3B3CA 2QYVA 1VGYA 4A38A 3HUVA 2IMOA 3B3WA 3FMCA 4Z65A 3RZAA 1LAMA 5ELYA 3DLJA 5CBMA 2PJ0A 3VATA 4AXVA 1Y0RA 4PXEA 3KZWA 2FVGA 4P4EA 3SJFA 3PB6X 4MRIA 5LRKA 4H2KA 3T8WA 4UIAA 2C6PA 4ZYQA 3KR4A 4B6ZA 3KHXA 1M4LA 2QVPA 2NSMA 1BLLE 4OC5A 3WT4A 1ZLIA 1IGBA 1H8LA 1CP6A 3B3VA 4ZI6A 1HDUA 4P44A 3VARA 1DTDA 1YMEA 2ZEEA 1LAPA 2AFMA 2JEWA 5HXDA 3PBBA 2AFUA 2EK8A 1TKHA 1ZG8A 2V8GA 3LMSA 2PJ9A 3B3TA 4UIBA 1XMBA 2OR4A 4NJQA 3IJ3A 1CBXA 1HDQA 1CX8A 2AFZA 3H8EA 2ZOGA 3IC1A
chains in the Genus database with same CATH superfamily
4JYAF 2XQCA 3TVKA 3DI6B 4ZVOB 3HHKA 4X4SA 4C8ZA 3WX8A 2PJCA 2VZ9A 1D1UA 1NZ8A 3IS9B 3B8GA 2OHDA 3T1YJ 4DJBA 2AT1B 1U4BA 2VZZA 3POTA 3OXLA 4FPRA 4JJXA 3I56S 4CGOA 3PZJA 1IKVA 4YR3A 3HSZA 1FDAA 2XGQA 5I3PA 5GCNA 4DV1J 1TF9A 2Y0SD 1HI0P 4BS2A 4B9UA 4NLGA 2MDAA 3R7BB 1OY6A 4I6AA 5L39A 3EXYA 4RN7A 4DF8A 3WC7A 4LBHA 1HR0F 3D66A 1ZBTA 5KFPA 2NREA 2ILYA 2G2OA 3GJTB 1YLXA 2FLNA 5A27A 1NJYA 3M32A 3PV8A 4M5IA 5LSOA 2HFNA 4LF4F 1JLEA 2BKPA 4E0AA 2Z0ZA 4ED6A 3ET6A 5EX3A 3QMQA 4EBCA 1GMVA 3OTDA 5CD4A 4I6YA 2QJ8A 1CPZA 3NGSA 4OP4A 4AB7A 2K1RA 3CCLS 2Q6CA 4X84A 1TKDA 4RS2A 2F4VJ 3QJLA 3ZZ0A 1RTJA 2HAFA 4A8MP 2XHCA 2VQEJ 5KFJA 1AROP 4ANCA 3GONA 4K4YA 1F2PA 1WG1A 1D8ZA 2OZHA 4MHYA 2XMUA 4OX9J 3HSGA 4H4MA 3EUNA 4IRKA 4K30A 7FDRA 4CGMA 1KKHA 3T19A 4LVOP 2EFQA 5A28A 4RW7B 4PSWA 2BANA 1WDTA 1HW9A 4PG7A 5AXKA 4OZ0A 4UA3A 3W2VB 1UFKA 1ARLA 1YBTA 1S1VA 4OHVA 2XZTB 1C0TA 4Z7YA 2FS5A 2MQNA 5SUHA 5GADU 1Q2YA 3M8YA 1IM4A 3VAJA 4V19X 2Q6BA 1N33J 3S9MA 3OBIA 3CCUS 5IB9A 1ZOTA 2J0XA 4EMEA 3GIMA 3BDPA 5IM0B 3R2DJ 1KS2A 2WZ1A 3MUMP 4MIBA 2H4WB 5HK4A 3DR6A 3MR7A 1SV5B 4OYOA 1Q5VA 3VZIA 1SC3B 3VAMA 2MJUA 1KHWA 4DR1J 3QWUA 1AMPA 1FKAF 5E3AA 3GIUA 2FHMA 3KJNB 3CD7A 3KK1B 2FIAA 2PSZA 2HVHA 3ULHA 6FD1A 4ES2A 1TQLA 4CYNA 2YNEA 3AD8C 2R7TA 1TL7B 1CS4A 1Q5YA 5LT5A 1U8SA 1VC5A 4ZPAA 1GK8A 1R6VA 5JXSA 2AGQA 1FKPA 2D4PA 3BI1A 4OLOA 3OVSA 3R2CJ 2WBMA 4X2BA 4KUBA 1U1NA 3FNNA 3ILIA 2JZ5A 2FUG9 1NPPA 1RWXB 1SCJB 1TV6B 2Z2ZA 4OI4A 2G1DA 3DOMB 4KRWA 1VQLS 2EC0A 3M9OB 1F6TA 5JVGQ 4XPCA 3MPWA 2VODA 5F8GA 3V7ZA 4LRAA 2LA4A 4OX6A 3IG1B 1RHMB 2NXNA 2KM8C 4YB7A 1CJTA 3DLHA 1F9HA 3UCZP 2JDJA 3KLHB 2WPXA 1R43A 4KVOE 1HWKA 1RUSA 5LYLA 2JC1A 3EC4A 3T5KA 2MEWA 5J8FA 4FAIA 4NLDA 1CSJA 3J7A1 2FJEB 4F9UA 2EK1A 2BUNA 2FCKA 3I31A 2Z0GA 1XR5A 2F40A 1T05B 1NB7A 5G21A 1FJGF 3KJQB 4TN2A 1FKPB 3PW7A 2BYCA 2DRDA 2FSRA 2XBPA 5CNPA 2OI2A 2DXDA 3WBZA 1XEZA 2N4CA 1VHSA 2MY8A 5DDPC 2ZDPA 3N5FA 5FJ4A 3ZNUA 1QSRA 1TL3B 1RWMB 2MSSA 4CO0A 4NXNF 1DQAA 1S5ZA 4RL1A 2R7HA 2B7BB 5L8RC 4ZN3A 2B4DB 4NZ7A 4KOUA 5C88A 1GAOA 3P4UB 3UY5A 4DLGA 4DPUA 3OW2R 3SIPB 2GZOA 2C2RA 2MKSA 4AQYF 2HQYA 1ZTWA 4DV3J 2R98A 1B99A 2RUSA 1SJFA 2ABYA 2J7WA 2K1RB 5CZVA 1SQGA 2NYIA 4KO0A 4AL7A 1YR0A 2HHQA 2BE7D 4XTTA 3HD2A 4F0YA 2YKMA 1NSLA 3VCDA 3Q8QB 3QIPB 4UIBA 1X5PA 2EFPA 4RU9A 1MJBA 2AFZA 2O01C 4M5JA 1VJWA 4CWBA 2VOOA 3I4HX 1FFSB 2U1AA 4CPAA 3MZIA 1M5VC 5E2QA 3MR6A 2UXDF 2VB6A 3LOUA 2CJYB 4C8NA 4OC4A 2XWYA 5EMIA 5HI7A 2GIVA 3DI6A 2GJ2A 4QW9A 4P52A 4PQUB 1NBEB 1T9VA 2GNKA 3LP0B 3L09A 2HQIA 4C11B 3T5JA 3GYXB 1ZG7A 4R76A 2WSEC 1CG2A 3PB7X 4DUZF 5AXMA 4OZNA 4S0MA 3GMGA 1GYTA 5K8PA 3PO4A 3D28A 2OLWA 3K0JA 1REGX 1YI2S 4GC6A 1AT1B 1R31A 4ZVSB 4OV1A 3ETOA 2LEAA 4Y2CA 3M8QB 1TUGB 3GG0A 3SBMA 5RUBA 1HQUB 2C3YA 4HKQA 3FVLA 3D5MA 2P9GA 1V5VA 3CT9A 3C66A 3A3NB 3CJ4A 2VL1A 1IU8A 2YH1A 4FBEA 1SB6A 2P6SA 5JQ4A 3I3GA 4IK2A 1C1CA 3NKYA 4O3OA 3VAHA 3UDLA 1LW2A 1S6PB 1MG7A 4C98A 3FCVA 3K59A 2OPRB 3KHZA 4N77A 2ZJRQ 1FRKA 3VGTA 3M6VA 3M6WA 4R7MA 2E5IA 1LRZA 4DQSA 1YJTA 1E6YA 2W7AA 2N4DA 3IWXA 5FIIA 1YJUA 3R9EA 1HBOA 3MWBA 2MQ8A 1KRPA 3T3FA 5F3TA 3TQ1A 3CJ2A 3H5UA 1UEUA 4KH0B 1BQNA 4BWMA 4Q44A 3KHHA 5IV0A 1VC0A 4AVCA 1TIQA 2PR8A 2R1IA 4ED1A 4Y34A 4BINA 4GKKF 2RFHA 4RJVA 5EWGA 2FHOB 4NXNJ 1WSVA 3A13A 4P2FA 2D3UA 3B2YA 2AX1A 4KO0B 3D1QA 5F0UA 3WR7A 1EHWA 2NUHA 2YQ1A 4DV5F 4IFVB 3CO9A 4MFJA 4PWUA 1YRUA 2WVEA 2RKIB 3LW5C 4DR4F 1DTTA 2J6SA 2VICA 4ENOA 3WIUA 1TV6A 3IRXB 2KCWA 3TTHA 4A94A 4KYZA 3EVOA 2AQ4A 3KLFB 5CPAA 4EZ9A 5B0DA 1LWXA 2CUYA 4GVBB 3NGDA 3J80Y 4R5PA 3FNCA 4GM5A 2BZ2A 5KFCA 2WPWA 4EYIB 2MB0B 4PUOB 4NA1A 4DCPB 1ZM2A 3ENWA 5KFUA 3DLEA 2M52A 2GCFA 3SQGA 2DRBA 4OYPA 2IPOB 2PFFB 4MIWA 1U2FA 4OZ5A 2F3JA 4LQ3A 3QJJA 2HHWA 4MYUA 3LD2A 4FVCA 3K5MA 2Z3PA 2MQPA 3ZTPA 2OPSB 3MR5A 2YWGA 2CY2A 4ETZA 2XEJA 4USVA 3BBFA 1RBAA 4A8XA 3CCSS 2BOAA 4IHMA 3FYNA 2V9WA 1RAEB 1FJ7A 3KK1A 1RP5A 2RS8A 4ZY1A 1X31C 4USIA 1B0TA 4X64J 1MJ9A 2FPHX 3TJ9A 3CDWA 4RW4B 3M9NB 5HMZA 2MKIA 1X10A 4YOEA 2DGXA 1R0AA 4WWVA 4U7UK 4H6ZA 1U26A 3HD1A 2V2VA 4KTQA 4NCBA 1VI7A 1H2UX 2HBRB 1K8AT 4H54A 1SKRA 2LU1A 3KASA 5BJRA 3BO2A 1Q16B 3CCTA 1LKZA 3B3CA 4RPFA 2HBQB 2ASJA 3O5TB 1KVIA 3B3WA 2DRAA 4MIAA 1LAMA 3EICA 4N76A 5CYMA 1O0PA 4Y0FA 1RXTA 3ZJ0A 3ZZZA 5CBMA 2PJ0A 1Z4RA 4ZITA 3ENAA 4OZJA 3DRSB 4X4PA 2K06A 3MM9A 1VOMA 4KR0B 3KZWA 2M9KA 4ILMA 1IR2A 4RBUA 3UDEA 4I6WA 5BXIA 4C0OC 4R0EA 1JLEB 4YY3J 5HQMA 1EQ0A 2BL1A 4KGKA 1XIXA 2ASLA 3J7Z5 2X7IA 1NMEB 3CJ8A 2ZZMA 5IB0A 2CNNB 2NYHA 3GSIA 1BWEA 2VBYA 3D2WA 4IOAQ 4K2JA 3QATA 2H3EB 3BKUA 4Q2MA 2OR4A 5ETMA 1CX8A 4R5PB 1RCXB 1PJ6A 2QL9B 4X65J 4KLWA 5IV3A 4LIRA 3OVAA 4DOZA 4KIAA 4RWXA 3R5CA 4DLEA 3GYGA 4F4YA 1WG5A 2OSQA 2HNDA 1FNXH 4LF4J 2C1EB 3FEXB 1LWFB 2C1CA 4DFJA 3FCHA 2WTFA 4F9VA 2AFSA 3IM8A 4KC5A 1YJWS 1VHEA 1RJJA 1FNOA 2BANB 5GAHU 2IC3B 4USMA 3R3TA 1WWHA 2W8LA 4QWDA 2L9WA 1RT7A 5KFDA 2O4HA 4Q2LA 3MCSA 1BQMA 1UFWA 2ZEDA 3M8RA 2WW4A 2KZMA 3E3XA 1T02A 1AUDA 3GCWP 2VG5B 1RWNB 4JD6A 2K8GA 2BA9A 3C16A 2JDCA 1OY8A 3W8PA 1P27B 3R9GA 2IAJA 2RSQA 4CLPA 1FERA 4A46A 1VQMS 2ZOFA 2VG6A 2F8MA 2C3OA 5E33A 2DO0A 2FLOA 1C0UA 1U8WA 1IVZA 1N0UA 2C27A 3OXGA 4PZVA 4ILRA 3MPDA 1LNQA 3CCWA 3SI1A 4NEXA 3M30A 4O0IA 4MHZA 2MMYA 4KBIA 3CWJA 3ONQA 2CJXB 4O3QA 4B9VA 3NBPB 1NK0A 3DOLB 4LSNB 4QPXA 1YTYA 3MN8A 1A6LA 2IBKA 2Y1LB 4IAVA 1R3NA 1I1DA 4A31A 4ZGYB 4C0BA 5M2PA 4KS9A 2PC1A 1JLBB 2BE2A 1NK4A 2XULA 2CVIA 1S0VA 2XY7A 3HCXA 1NSAA 2HS3A 2ZVIA 2AW0A 2EFOA 2GVZB 2RMLA 3KUGA 2JX2A 3TUIC 4JV5J 1C0UB 4HHJA 5KG4A 4A8FA 2VBQA 5CXTA 5HH1A 3EVMA 1W25A 2EKNA 1ZLHA 4J9LA 1WJ9A 3VAFA 3GV8B 1WHXA 2HIYA 3OHAA 4OHYA 1N48A 4OX8A 3HVTA 5LXRA 1YRTA 3D54A 4QWEA 2PO4A 3OR2A 3US5A 5B0CA 2VA2A 4XO0A 3N6LA 1U1LA 1CLFA 3EZUA 4L89A 2CQPA 4WFAQ 1T94A 3WIVA 4ED2A 4WTOB 4PPDA 5C5JA 2XY5A 3T6JA 3MMBB 4ECYA 2ZHBA 3G6XA 5C2GA 1NJWA 3DDDA 4Y49C 3TO6A 4I64A 3KXDA 4X4NA 1DQ8A 2MZJA 5LJ5Y 2ZEHA 5D4PA 5HJXA 2DHAA 3W66A 2D3O1 3U27A 2CQCA 4CM2A 3GCXP 2OPQB 1W26A 1JJCB 5B08A 2PR1A 2CIJA 1Q8IA 5HP1A 2HBYB 3W6SA 3C19A 1U1QA 2HV2A 3C16B 4AYBD 4LFCJ 1R8HA 2OIHA 4WFZA 3BH6B 5DM6Q 1DURA 3BSCA 2YNDA 1PC4A 1YHQS 3O6QA 2W4CA 1TL4A 4B12A 4EYHB 1S9EB 1FRXA 3O1LA 3OD2A 2FD2A 2YKMB 2HBZB 2Y0BB 5I3UA 5B09A 1AFIA 2UXDJ 3EO4A 3D4JA 4W90B 3QT6A 3BSOA 2CKWA 1QMUA 5KG2A 3NGTA 1RHJB 2WCXA 4UOFA 3SDEB 3QPIA 3N4WA 1RU1A 5KT2A 1JK9B 4J9NA 2IY5B 3HULA 1WC3A 1HNIB 2YY3A 3HLPA 4ID5B 3HT0A 2R2UA 1F2GA 4IH7A 4IR9A 2YBVA 1M1GA 4JV0A 4JI5F 3TOBA 3GTYX 2ALZA 3TT2A 1U45A 4Y2MA 2W2PP 4H4OA 4OIXA 3M8WA 3P2FA 3W5YA 4W92B 4Q38A 5KOWA 1KOHA 2EW9A 2B5JA 5ETTA 3KG4A 1HNZF 3CTRA 2FT0A 1AW0A 3L7UA 4JXQA 2EPIA 4I2PB 1D09B 1YK9A 4OYAA 3KYLA 2E1CA 3CXCR 1NK5A 2R7SA 1FXLA 1PAUB 2LCWA 5J2PA 2C42A 2HHXA 2X1AA 1TMJA 3EWGA 3GFHA 5HSPA 1ROFA 3IR7B 3MAAA 4WFNQ 1V5IB 2GGPB 4KKOA 4ZLPA 1SQHA 4ICLA 4CNZA 2GMLA 4F7VA 2UUBJ 4LQ6A 4P9SA 5KFIA 4J90A 3LALA 1EJ7L 3G82B 2FE7A 1N34F 2HFZA 4JV2A 2DY9A 4E2FB 3BN4A 2DBBA 2RQKA 4OV6A 2R7VA 1AUGA 3DLLQ 3QQCD 4O4GB 3VZHA 1DHMA 3MGJA 3V8IA 3I5BA 2HGLA 2PJ9A 2E66A 1LWCA 1N33F 4NJQA 2GHWA 3BO3A 4IF5A 4IUSA 4C8OA 5C2CA 1QE1B 4UTGA 3ZZYA 1U47A 1RAAB 5KFOA 2WYRA 4ZJOA 3PIOQ 4IOCQ 5L9NA 1WKLA 4O4GA 3OL6A 1BOBA 5GAEU 2ZH8A 3G8SA 1MU2B 1TU0B 3T90A 1Y00A 3P8BB 3DLBA 3V6JA 3JVNA 1T9TA 4JYWA 3OPKA 2MLXA 1R8BA 4Y6IA 1JJHA 5AE3A 2VV5A 4OC2A 3MXHP 4EBDA 4UY85 2K5TA 1F2HA 2GIFA 2D4OA 1FVQA 4ES3A 3M8PA 1OZPA 2V94A 5ETQA 2YNGB 2GE3A 5KFLA 3CCES 3UE2A 3LPYA 1FY7A 3T9YA 2R7RA 1N8RT 3JTPA 3P5BP 4XPDC 4NJRA 1KFDA 3S7RA 3Q23A 4ZVPB 3G8WA 2ASYA 3GPAA 3FBUA 3QWPA 4KUAA 1IBMJ 3E0KA 2AEMA 2HRYA 1X4EA 3AT1B 3FRMA 2HYIB 4GRSA 5KFNA 5IQ6A 4ZPCA 5LJ3Y 1HMVA 2PJ7A 3VR1A 4MXUA 1VYAA 5A8RB 3SDEA 4O3RA 3GSDA 3JQKA 3S1TA 5DLGA 1JLAB 2CQ3A 1Q95G 2QIFA 4MHDA 3O3LA 2BQUA 3KGQA 4WP8A 2R2RA 4J9KA 3NH8A 3V6DB 4NGNA 3I82A 4PK2A 1YITS 3IWGA 2YNCA 2NXEA 2ZW7A 1ZH5A 1XJOA 5HLFB 4YHHF 3HHLD 2WZNA 5EBVA 2NSCA 2J76E 1SH0A 1MMLA 1IICA 2PJ5A 1YJVA 4OMFG 3RW7A 4Y65A 4CH7A 1VQKS 4YDDB 4DFMA 5D0EA 5C42B 3UPFA 3D0GE 4DSIA 2PJAA 4KE5A 3O2IA 4CRYB 3TUZC 1TKXB 3MM5A 3RO0A 2VH7A 4ZP8A 3V4IA 5LMNJ 4O23A 2ZE2B 3CDAA 3CCRS 1WNEA 3OLBA 2CPXA 1TKFA 3H25A 4E0DA 1N71A 3OXFA 2YVSA 2C2MB 2QYGA 5DGBA 1DTTB 1FWLA 2ROGA 4CLKA 4ZHRB 4UT4A 1S1WB 4LF8J 1ZAWA 4DSFA 4LQGA 3IMQJ 1CQNA 3SCIE 8RUCA 5KFEA 4WU3A 4CDIA 2N3OA 4FD4A 2KM8B 4KT0C 3UCGA 2XS7A 3EY5A 1OBRA 4C4WA 1MMDA 2PJ3A 3DGVA 1M5PC 3QNWB 5KFTA 3M8SA 1S1UA 4DG1A 3PFEA 4N47A 2C28A 4DN9A 2PMWA 1MLAA 3D7GA 4H4KA 2J0QD 2PEBA 3OSNA 3FH4A 4ZY2A 4DCOB 1S79A 3IEHA 3PYEA 4J9RA 5A2QU 2CF4A 1RHQB 2OO4A 3MMAA 3K9TA 2HLUA 3IBFB 3NLCA 3FSIA 1J27A 1HWLA 4NI2B 2I5JA 3ETMA 2ZNYA 5IC4B 4YU9A 3M2RA 3SMZA 3KQZA 2ZJPQ 1VLOA 2H65B 2DCUB 1XBWA 2KYZA 3CMQA 3FEYB 3RGIA 1Z8TA 3LO3A 3ENQA 5K20B 1NDCA 2X1GA 2Y9HA 1M1DA 2XMAA 1TF8A 3VQSA 3D4UA 3PEIA 4JBCA 3ZZUA 3W9HA 3TC8A 1RABB 3RB6A 3I5AA 2ZH7A 2O3DA 3C14B 2V67A 1UETA 5ETVA 4P2XA 1G2EA 1PJ7A 2LU2A 4ER8A 1EP4A 1E6VB 4PWDA 4DR5J 3RU0A 4V19J 3A12A 1SPBP 1VHIA 2CXAA 3FSYA 1RT2B 2FVGA 2IRYA 4GO5X 5LRKA 3TFYA 3BJ8A 1L3SA 3OR1A 4JI3J 2JEVA 3EVWA 1Q4RA 4QVTA 4JI3F 5L38A 4YR0A 4ZPTR 3Q83A 1RTZA 1DTQA 3PYFA 1URNA 3WT4A 1S7IA 3MCOA 3B3VA 2DEJA 4ED5A 3NOGA 2GIRA 1U2CA 2BEFA 3PBBA 5B0AA 2BKNA 2HHSA 1SIWB 2E1AA 3B3TA 2ZNZA 4U9ZA 3IC1A 2FJXA 4J9SA 2WUUA 2B5GA 1Q78A 2ZW6A 4KOYA 4PXCA 4X5KA 2UUTA 2HB6A 5F8IA 5AT1B 2QE5A 1NHVA 1AB8A 3I9V9 1Y11A 2M3DA 1X4DA 1N5SA 3GFXA 3LAMA 3G6YA 4IDKA 3HJFA 1YJ7A 3NFZA 1V0CA 2FTRA 2AYEA 1PCAA 1V3RA 1VK8A 1Z4UA 1F2OA 3V6DA 3KTQA 2PSWA 1TUVA 1Q0NA 3W63A 3EGWB 3PJ9A 2FY8A 4N41A 2XSJA 3M4XA 2HNYA 3BKFA 2BM1A 2ZC4A 4CNYA 2PA3A 5KTDA 1JXLA 4II9A 2PJ2A 2F4VF 2YPYA 4X62F 1VLYA 3NE8A 3FBEA 1Y5LB 4P74A 1X0FA 2JH3A 4B9LA 4P72A 3CD6S 1X4BA 4QZVB 4U8YA 3TEHB 1YIJS 3WHIA 4XPDB 3RR8A 5KTQA 2BW2A 3IP0A 4DI6A 1VBZA 3IG1A 3KJFB 1EKRA 3M2UA 1XFOA 3I96A 3H2LA 1RT6B 1S60A 3RAXA 3EGNA 2V8VA 3BGRB 1W2BR 1QAYA 2RH3A 2JFDA 3CJ5A 4KHPF 4N5SA 3OFGA 2CVEA 2LQ5A 1NJZA 4NFRA 4L6V3 2DGTA 2O5DA 3CXPA 2ZM6F 1S48A 1QLNA 4DV2J 4B9SA 1YW4A 1RI7A 1WACA 2CRLA 4ZVHA 4QIWD 1FDBA 4MMOA 3PCOB 3KOAA 2IJZA 1G6BA 1B87A 4U9RA 5IOLA 1DTQB 2JRSA 2MKCA 3IRWP 4NLSA 3AB4B 1NK6A 1L3KA 3JTOA 2IDLA 2HK2A 2K3IA 4Q8FA 1KN6A 1S6UA 1WC4A 4DFPA 3GE9A 3MMJA 2HEKA 4ZPWR 2OD4A 3HHNB 1N0VC 1YDLA 1PYTB 1U48A 2ZD1B 1Z1ZA 4QQBA 1Z8LA 2EBEA 2ABZA 4XIUA 2UV8A 4IH6A 1DJ0A 2RKIA 3R9FA 1XMQF 3M9MB 3R5DA 3NGUA 4J9PA 4CO3A 1SVDA 5DQHA 1UVKA 1NCLA 4KOSA 5JVHQ 4PPZA 1YQEA 4WTYA 5K8MA 4P4JA 1CQMA 1JMTA 4Y2IA 2NZ4A 2CQ2A 3JAMU 1MJAA 2EBGA 4FNIA 3B54A 2CXEA 3UN2A 2BABA 4HNYB 4YN3B 1S7NA 4LJMA 3B3SA 3H4DA 5FVJA 2CZ9A 1X60A 5EGYA 3QBCA 5HATA 2KXNB 2DR8A 3ET6B 3EMTA 3D68A 1KC8T 2P6FA 2QFJA 1RHUB 4PG4A 5DGAA 1GXLA 3D6FB 2GV1A 4P10A 3CPXA 4TQRA 4F25A 4IFYA 4DX7A 1UFHA 1RU2A 4PWDB 4A8WA 2DNNA 1JB0C 2AYGA 2QYCA 1VR6A 3LF0A 4CLLA 2GX8A 4DSJA 4U7CA 2QLXA 2MZTA 3H4BA 3NAHA 2AKWB 1B3TA 4OYZA 2VFVA 4FZVA 3V38A 2Y1JA 2B51A 5K8NA 1WC6A 3IS9A 2XYHB 4FYXB 4AQYJ 3M32B 2R8KA 2DJWA 4B9NA 4LR8A 3K5NA 2A2CA 1WOSA 4OKOA 2E5LJ 1EAYC 4K0KF 4QC6A 5K14A 3UD4P 2IRUA 4A33A 2XSFA 1S1TA 2CQBA 5LYFA 1HW8A 3OVBA 4CCHA 4GMKA 1SL2A 5EWFA 2VIHA 4DF4A 2HZVA 1IQZA 2E7VA 4LFAF 2VU5A 1I51B 1WC0A 3KFWX 3GR0A 2GQCA 5EX0A 4GKKJ 1CC8A 4LFBJ 1HBOB 5IT9U 1K47A 4IOBA 2HHPA 2VEZA 1Y0RA 3POTB 2DPSA 1ZETA 2GAHC 3MTJA 1S9GA 2LDYA 3BYPA 3RBXA 1HNZJ 1VC6A 5CQGA 1TP7A 3H59A 4DG1B 3VQTA 5BR8J 3T8WA 3HHEA 4OQJA 4UZCA 2CZ4A 2D7SA 4FVMA 2Q44A 1F5CA 4P75A 1X4GA 1H38A 3X3UA 3THPA 3FZ2A 4LRBA 2VZYA 1GEHA 3ITHA 3ZZIA 1HFEL 1D0EA 2GO9A 2JSXA 4UQGA 3AH6A 3ELHA 3PTWA 4ELVA 1BQXA 2PDOA 5J1EA 3EGVA 1YJNS 3JQJA 4CT9A 1GTEA 5J2MB 2RC4A 1TKXA 1CBXA 2ZOGA 4BC7A 4UFVA 3K8WA 3WC2A 5D8NA 1PGZA 3KK3A 1RKJA 3GY9A 4K5SA 2PJ1A 3QGIA 3TUJC 4GS4A 2WOMA 5AG4A 1M5OC 2ZFHA 3LGHA 5A8WB 3IU1A 1RT3A 1MWZA 4CH1A 4Y28C 4KFBB 2A1BA 1XMOF 2I6WA 1TL5A 3R9LA 2HRTA 1I3OB 5CABA 1R6YA 4XAKA 6FDRA 1FTRA 1HWUA 1X4FA 2QLBB 2B8QA 1FEHA 1T3OA 4BCAA 5D4LA 1XMQJ 3KDNA 2H5JB 4CAXA 2RD5C 1EETB 1YKWA 1K44A 3UD3P 4QB9A 2NPFA 5KG3A 2XMTA 2XC9A 3VGUA 3RYLA 2QL5B 1BAVA 4NGRA 1RT5B 2CPHA 2R4FA 2BJEA 3AA9A 1VQNS 3SI8A 3CO0P 2DH8A 3MEEB 3ZTRA 1WHYA 3CD5A 1KVKA 2FZCB 2IQ6A 3NRBA 4QYZJ 2MHEA 4RUCA 5A8RA 2KB2A 1JLGB 5DDOC 2ZELA 2RRBA 1T03A 4U8VA 4HTJA 4K4XA 1P1TA 2PJ6A 4X4VA 1NSPA 1UEKA 1Z2ZA 2CQGA 2MZSA 2GJFA 4ZP7A 2QTWA 3QT7A 1H74A 4PG6A 3PFOA 3DHWC 2CYYA 1WF0A 2PGCA 4JLYA 2B4DA 5HO4A 3W8GA 1RKIA 3K58A 4ES1A 1X5TA 2A10A 4CRJA 2Q0YA 3JAMY 4P2SA 4JZ0A 2EO8A 4N8OA 4CAWA 1FVSA 3QZ8A 3RAMA 1ZM4A 3PR5B 3ZTQA 1WKJA 3K89A 1ZA2B 3AODA 4N8NA 4OHZA 4UW2A 4XNHC 1T0TV 2A3JA 2ZITA 3N01A 4DZDA 1ZZNA 1OSDA 4TNOA 5A8KA 1CJUA 2QN6B 3NAIA 2ZBPA 1Q2CA 2XLKA 4F6AA 4HI2A 3S01A 4TU9A 3C46A 3D3CJ 2GA7A 3SSQA 1TTHB 4F4KA 2KU7A 1DY3A 4OI2A 4CO5A 4KQZA 3RTVA 2HQGA 2C6GA 3HI9A 4RWWA 1R8AA 3I1UA 4FF1A 1N5YB 1JLQB 3NCPA 3D9BA 2REFA 1S1XA 4DUTA 1EB0A 3P45B 4PV6A 1UJ6A 1CPXA 3LP1B 4OADA 1KP6A 4MCQA 3MECA 4B5OA 4B5PB 1X12A 3K7RA 4PR6A 1K0TA 4CGLA 2VQFJ 2XGPA 2YNCC 1SL1A 3PEHA 4MFBB 1HYSB 1KUVA 2QC3A 3R6LB 2ADBA 2ZHOA 1Y9WA 3MHYA 1IYKA 1U6BA 1MN9A 2J8AA 2YPZA 2GS8A 3KLFA 3QB8A 4P4IA 4RI1A 2P9EA 5AXNA 2L9NA 2Z11A 2VBWA 1HBNA 2JWNA 4KVXA 4ZVRB 3ZZRA 4DQQA 4IG0B 1RAGB 2C6CA 3FRZA 2Z10A 1S76D 2GFQA 2FB0A 5DS7A 1UKUA 1HL6A 2HWHA 2UUCF 1F5AA 5KT5A 4PXBA 4UBRA 5LSLA 5H9FK 3ZTSA 1T03B 2IBOA 4IDKB 2P6TA 5F8LA 4R9MA 2FJBB 4E8UA 1FDNA 3VWEA 1JXEA 3QRQA 2JVRA 1T95A 1QSOA 2HVDA 3D3BJ 4B02A 4LF2A 3G4SS 2PIZA 2P5VA 4YY3F 3BSAA 1GHEA 1SJ3P 3OT9A 3HF5A 2YWHA 2MSTA 1R0BG 3MURP 4OZ1A 2QMWA 3OLAA 5J2NA 1VQ5S 3ADAC 3WZ0A 1HNXF 1XC9A 4F8RA 3CIZA 4YMEA 1IJFB 2LKZA 1FT8A 1WI6A 5CCLA 2E5HA 3PJWA 2L3MA 3PB6X 4DX5A 1TK8A 4LSLA 3I4PA 1QAXA 2ZUAA 2JJ4D 2WK4A 1S49A 2LA6A 3TNVA 2CPEA 5LL6d 2DHHA 2ZKTA 2HFOA 5G0RA 5F41A 5KFRA 4OI0A 2AFMA 3M8QA 2APOA 2JEGA 4KOXA 2UUAJ 1TKHA 3ZZOA 3QO9A 5I3UB 3LMSA 2HHHF 3IJ3A 1VRTB 1ICEB 2PIIA 3WQPA 2HRUA 4TQSA 3AOBA 4B3TJ 4NGPA 5LYIA 4L73A 4PABA 3PKYA 4ZKAA 2PJBA 3IWWA 2BXJA 2OH1A 4B3OA 3IR6B 4OHXA 2J8SA 4OLLA 4IUFA 3C6UB 4CLZA 3MMBA 4DS4A 1LW2B 1S6PA 4RW8B 3W60A 3V6KA 3CSKA 1BO4A 4HL9A 2JLEA 4QIFA 3NCRA 4ID8A 4WJBA 4U9YA 4F26A 1S9EA 5K9FA 1S57A 2I5JB 3QFWA 2M70A 4RR5A 1QTNB 1YREA 4DR3J 4NZ6A 4LREA 3H90A 4M85A 2LEBA 2YQ0A 1TKTA 4P6YA 2J9DA 4LSNA 4DV3F 3IA0A 4NCGB 1IUJA 5LSRA 3VTIA 3KG1A 3I87A 2CJKA 4ZVUB 2PMZD 3PX4A 4F50A 4QUSA 4UUWA 1D9FA 3I55S 3LWUA 2R8GA 4X4UA 4UCNA 1PUAA 1LANA 1Q8BA 4DV7J 2VASA 3JSBA 3OFEA 3RB4A 5JH9A 1S7HA 3HXMA 2YWWA 1JLBA 2XZWA 4EVYA 4JYAJ 4IKAA 1X9SA 2F7VA 3CXQA 3CXSA 4J9QA 4C2XA 1Y9OA 3T1AA 2AX0A 3QRRA 3OR2B 2V8PA 4DV0J 1LK5A 3P2HA 4TVAB 2CPYA 3ILLA 1QSMA 2BJ1A 4HHHA 2J6UA 2GREA 4HH1A 4UFWA 1QUVA 3RB3A 1FX4A 4JI6J 1PC5A 4DPTA 2EFGA 4QR0A 2PVWA 3VGSA 4QBUA 4FF2A 3HP6A 4TY8A 2LFVA 4DJLA 3U02A 3LP2B 1NO8A 2G9OA 2XYPB 4LBIA 3HO1A 4DL2A 5CZXA 2J8MA 3Q8YA 4DL0C 4I2QB 2IJRA 5IT0A 1WF1A 2OOTA 2B3TB 4ECXA 3TP2A 4AL5A 5G0RB 4ONWA 4CGPA 2PDAA 2J9AA 3SYZA 4B3TF 3MR2A 5T7LA 5K8OA 4HI1A 4KSIA 2DPJA 4NCZA 2BRKA 4JB8B 2HNDB 3GIKA 4I68A 1CULB 1FXRA 1RT6A 2E1RA 3E01B 3S6FA 3SEOA 4DSKA 4EWTA 2OKQA 2KVQE 3SCKE 2A6MA 1UJ4A 2KRBA 4NYZA 1VQSA 3UR0A 4URGA 3IAM9 1S0OA 1F60B 3WC5A 2HS0A 4MHNA 1YJ9S 1UA1A 1FE4A 4JI7F 1B7YB 1J4JA 4BDPA 3KG0A 1G7CB 3M8PB 4IFYB 3NWRA 4JI0J 3MECB 3JXOA 2XNQA 5E3CA 1XRYA 1JKHB 3DDNA 2HKEA 5KOXA 2ZWOA 1YVOA 1UTAA 3WX4A 3QAUA 3AOAA 3TOAA 2VG5A 3JS9A 1RGVA 1ELOA 2RQ4A 2XO7A 4MK7A 3NS7B 4AUKA 2W7PA 4K4WA 4PRFA 2B3VA 3IGRA 3L7PA 4DL6A 3MFHA 1BQMB 1BWVA 1K73T 4FWUA 4JP8A 3LP1A 1VQ4S 3ZNJ1 3QAYA 2DGUA 2YNGA 2JC0A 3RW6A 4FBUA 1WC5A 2FIWA 2ZC3A 4YR2A 3CDUA 5GAGU 1I12A 4USUA 4URQU 1JKHA 4ECUA 1ACMB 2Q1LA 3DMJA 4Y2AA 4NLQA 4JOUA 4ZJLA 2KI2A 2H4YB 3MAHA 3O8WA 3UDVA 3HX9A 3BZQA 1RTDB 3RR7A 2KO1A 2H5MA 2HGMA 3L2NA 3DNSA 1HD0A 4DMZA 3SFGA 2EI5A 3J7AN 1O8BA 1RBOB 1DRZA 5D4OA 1Y7PA 2QLFB 1A7GE 2VDHA 2XI2A 2XM3A 4F4WA 5A0YB 5E7OB 3C8YA 2VD3A 3R5BA 2GC8A 1FEEA 1U09A 1RTJB 3IGNA 2I2YA 3SCLE 1FWKA 3CCZA 4TY9A 3RBDA 2I1RA 3K2YA 2HVEA 3T1HF 3E51A 3THTA 2W25A 4JI5J 3JSMA 1XIQA 1JWQA 4FS1A 1ZAXA 4L75A 3TOQA 2Z3NA 1HNIA 4ZS6A 4B6ZA 3N79A 3J7YU 1VCTA 2QVPA 4JI0F 4G1IA 1TR0A 3DOKA 3V81B 1PYOB 4I7FB 1S5KA 4ECRA 5L1IA 4MKVA 2V0NA 4MBUA 3VARA 1A2ZA 1YVKA 3GWCA 1WDDA 2R2TA 1H7XA 3BGOP 3R7NB 4NMLA 2I38A 3H2UB 2COLA 2C3MA 3H5XA 2DIUA 2FY1A 2Q79A 2JVOA 4NEZA 3T1HJ 3EZ5A 2MQMA 2OGUA 4DDFA 4EK2A 3NNHA 2NS1B 2V63A 3GZ7A 1AFJA 5HMNA 3R1KA 2LP4A 1QY7A 4TKTA 4M63A 3KI9A 2DNKA 4RNMA 1WOPA 3VAKA 3B6BA 1Q7YT 3UN5A 2MLYA 4BD9A 5D0HA 3DRPB 2C2EA 5G22A 2CQ1A 3AJ1A 2DNHA 3CUNA 4M5LA 2JHEA 4P6QA 4IFVA 3EE3A 3HHLA 1RWKB 4HPSA 5CH7B 1YLOA 3MEKA 2EK6A 1IBKF 4LVNP 1RQ0A 3IRXA 4NI2A 2DO4A 5C25A 3TVZA 4DV6F 1R8CA 4WPAA 2ZH2A 2XCPA 3J80U 1IR0A 1HQUA 4F4XA 5D29A 3EZOA 2YKQA 4RNNA 2MY7A 1IJEB 1GNKA 4M1KA 3WC6A 4M5KA 2CNSA 3H7HB 4FUUA 3HVTB 5KFXA 2ZH1A 3VV2B 2Y1IA 3H8GA 1C1CB 3KR5A 3Q8RB 3HVWA 4ZIVA 1R8PA 1VQ8S 5DQGA 1BXNA 3CC2S 8CPAA 3DHXA 4OAEA 5L46A 3BQ0A 3NMRA 1U6FA 2DNRA 3N9UC 1YK3A 2G13A 2QGFB 4USWA 7AT1B 3CC4S 2IVFB 2DXQA 1XEBA 2GW8A 2LVWA 4NZ0A 4O44B 3PNIA 2HSEB 1T9YA 4PXDA 2HQ3A 1P9YA 5K14B 4LQ9A 3FBBA 3B35A 5KFZA 4KHMA 1QQ9A 2B4UA 2W9AA 2B56A 3Q8SB 2BE2B 1TELA 1YLEA 2AJ2A 4CTAB 1LWEA 1NSQA 4CO4A 2P9CA 3R97A 5D15A 3K17A 4UOGA 3JRUA 4ITSA 1T3NA 1IBMF 5KFKA 5HBMB 1HI1A 4M5GA 2HW3A 4V1Ak 1YWXA 4MFZA 1NDPA 3MM5B 1DBDA 2SXLA 3CNQP 2PVVA 4QW8A 1DQ9A 3BN7A 2ZD1A 3CDXA 3J81U 2MLZA 2LXUA 1UPPA 3CJSA 2B3UA 1HBMA 4ZBGA 1XERA 3W2WB 2J0WA 4KVME 3W9IA 2NQPA 3MM7B 3OFFA 3EX7B 2DR6A 2U2FA 3M30B 1SJ4P 1XWLA 2PFDA 2FDNA 4BMHA 3FXTA 5DG7A 2ZBQA 1S7KA 2LDIA 2CPZA 2BOPA 1P8GA 4WKYA 1YGHA 2O1PA 3KMQA 4KY3A 1I94F 1NU4A 3QSIA 5A76A 5IX3A 2RJZA 2Z3LA 2V5HG 5FLXY 1QSLA 3QLHB 1JJ2R 5KG0A 2IJFA 2QG9B 1NHUA 1NM2A 4NXYA 3ISZA 2NLWA 1FKOA 3FVYA 3ISNC 1Y5IB 3F56A 4TXSA 3RNZA 4Z2XA 1RTHB 2EWBA 1EIYB 2WSAA 3HFZB 1VJQA 1HWJA 4PQUA 3QNVA 1WWZA 4D3HA 3EM1A 1ULRA 1AYEA 1HPZB 3MF5A 2PEHA 4WCEQ 4YRHA 3GP9A 4G6VB 4H89A 3ZTOA 4C3MA 1SQEA 3MCNA 4PK3A 2RQMA 4WIQA 4OX9F 2CWXA 2CQDA 3H40A 4FYYB 2HMIB 4M5DB 2LYVA 1SIZA 4W98A 1F3VA 2QLJB 5I3QA 5GMDA 1Q7LB 4R87A 1FT7A 2ARHA 3HMJG 5GAHI 4LF7J 4A2ZA 1MW7A 1JLCB 5DRKA 1NEEA 3HZEA 2PC6A 4O3SA 2C2OB 1VGYA 1ON0A 1DFDA 4X4RA 3GFYA 3TJAA 3PHTA 4BBHA 3CJKB 3T9ZA 5DO2A 1M1KT 2ZKUA 3TZWA 4LSZB 4RX6A 2R7XA 2Z56B 5A6WA 1PKUA 4BBYA 1AZSB 4MJ8A 3PGPA 3JTKA 4I2PA 2RF2B 4C9DA 1UVNA 1ZLIA 3F0AA 3AY0A 4WP3A 3DLGB 2MZRA 4DN0A 2AE6A 4ED3A 4LF6F 1Y9KA 1DLOA 1HIYA 3QT5A 5ISVA 4JI2J 1LWCB 1F1BB 2XSJB 2ZH5A 1W7WA 1I5OB 3BR9A 1T05A 5GVQA 3PKMA 1OQ3A 5AE1A 2ZBRA 1TFWA 3OJUA 3AQOA 1JXVA 4B08A 4QR2A 3VAIA 1KLMB 4I7FA 5J2PB 2J8RA 1R27B 4R0JA 5IM0A 4Q7AA 3EDRB 3Q22A 3G8TA 5EHHA 3P6YC 5J8CA 2GANA 1SC1B 2VJVA 3LWMA 4RU2A 1H72C 4I67A 3Q8VA 2MYFA 1S1VB 2HHVA 4Y3CA 2B9WA 4ZP9A 4DR7F 5I4MA 1L3TA 3G6VA 3EXCX 4P45A 2OMLA 2QIRA 2R7OA 1RK8A 3HLUA 4C8YA 1Y5NB 3H5YA 4RO0A 4JUZA 1ZG9A 2Z2MA 2CPFA 4NCAA 4FKXA 1HNWJ 4Y49B 1TAQA 1VQ6S 3UNYA 2AEJA 4CLFA 2ZEFA 1FXDA 2GAGC 1N4LA 1WG4A 3HVAA 1FKOB 4NLTA 3U1NA 4ALZA 2FHJD 2VONA 4A8KA 3Q86A 3GIJA 4RUBA 2AZ3A 3KKWA 2EC2A 5AGEA 3PW5A 1N88A 2NYQA 2X3GA 4MCSA 3VGVA 1KWMA 3MM6B 3H42A 2KJWA 2AFXA 2V8DA 4FYWB 4CQ1A 3PJXA 1T9XA 5I42B 2R7WA 1SC6A 4KFBA 2MJNA 1X9WA 2XS5A 3H8FA 3UCUP 2ROEA 4HVZA 1WOOA 1UVJA 2WSFC 3CEDA 4B3MJ 5B0EA 2IA6A 3C14A 1YRXA 2OFHX 1KTQA 2XLJA 1NH7A 3K8VA 3QT8A 4U7UD 2R8JA 2ZWPA 1LFPA 4ERDA 4NLOA 1KHVA 4OZ3A 3F5BA 3LANA 2AJ4A 4NE9C 2QECA 1PYSB 1YZ6A 1EETA 2J9CA 1P6TA 3W61A 1OIAA 4B9MA 1BPMA 2ZVSA 1IB1E 3LWLA 5EDWA 1DAXA 3IN5A 4DR2J 1Z2LA 2FYXA 3G6ES 2CG8A 4RUHA 4LF5J 3L4BC 4G65A 2H51B 1SXLA 2ZEGA 5DWMA 2BX6A 1IKYB 3OTBA 2ILZA 5KFGA 5C24A 4UCMA 2B8PA 4G1QB 4AFFA 3S8SA 2V4RA 4FS2A 3JTNA 1A9NB 2M7SA 5D77A 5L9XA 2A2DA 2UU9F 4FPIA 3VAGA 4OJ3A 4LR9A 2IM1A 3ILJA 3FMWA 2B6AA 2DNYA 4ZLLA 5KFFA 3W6XA 1TVRB 2QMXA 1VMBA 2PMHA 2KG1A 2C2KB 3GYAA 1OY9A 3J7YI 1QSTA 3GG1A 2IM0A 2D9PA 2CWKA 4UEFA 3PBEA 4CYQA 1UWBA 2QRRA 2YKPA 4R8UA 3NBPA 3LGNA 5B0FA 2IFXA 2RHQB 2MXYA 3NA6A 2OAUA 3ZZTA 2DR7A 5JJBA 2W9BA 4L72B 4C11A 4DUYJ 4DUYF 3DRRA 1QAJA 4PSXA 1IBLF 1VK3A 2MQQA 4FP9A 4OYXA 1M5KC 3MCMA 3MDFA 1IQTA 5J1QA 3MMCB 1IWAA 3BPDA 1QJHA 1RSCA 2YX7A 3OUYA 3D7SB 4F8ZA 2HVZA 1HNWF 5SZTA 2B4OA 3I0SA 4BHQA 4U95A 3SV4A 1RBLA 3NOCA 3PX0A 1SH3A 3KNGA 2DPIA 3LGMA 1WSRA 2E5LF 1KQGB 4CAVA 3DGPB 1IKWA 3KK2B 5H84A 4W9YA 2VG6B 1WKKA 1U6MA 1HBUB 1G3OA 3PXGa 1KZFA 1IKYA 4K4UA 1HNXJ 5C82A 4Q5VA 3GR1A 4X66F 2F8HA 1HWIA 5BYRA 4LFAJ 2HQCA 4J5OA 4F36A 2OJ3A 4UOCA 2Q4VA 1SJQA 3TARA 1U0SA 1R89A 2HS4A 2B4BA 3HUVA 3T1YF 4UZBA 2DNOA 2XLIA 4B5PA 1FJGJ 1CM0A 5ELYA 3HJVA 2KT5A 2G1HA 4AXVA 1TZ0A 3IR5B 2YWEA 4MK8A 2BJ9A 3IWNC 1WUUA 1C2PA 4ZYQA 1S4FA 2B4VA 2K7KA 3CCVS 1M90T 5CCMA 2DT9A 1N36F 4OJ1A 2OH2A 1C1BB 3HM9A 3MM6A 2Y8WA 2ZPAA 2CNLB 5IT4A 1CP6A 1JX4A 4ZI6A 4C7QA 1LAPA 4NLYA 3Q8PB 4ZCIA 2BUEA 4A8QA 5LMUJ 2YH0A 4DR1F 1S1XB 1XTZA 3QGPA 3MR3A 2J9EA 2XY6A 1UCNA 5HAOA 3FGVA 4DFKA 2CQ0A 2HFVA 3CIMA 4LX9A 3QZ7A 4HYKA 2LQJA 5H9EJ 1RTQA 4ZX8A 1K1QA 2IAJB 2MKYA 5LOQA 3R7SB 1ZYQA 1NPKA 1MROA 5KFBA 1HYSA 3TEGA 3GQCA 3PX6A 4NSQA 3NWGA 3FEZA 1UJ5A 3V4MA 1ZA1B 4ZP6A 3FF3A 3DM2A 3UQSA 3UD5A 1EX8A 4X66J 4M94A 3H98A 2CTBA 3BPSP 3KKFA 2MQLA 4DSLA 1LEOA 1RA7A 4JI6F 1CJTB 4HT7A 2UXBJ 2V34A 3OL8A 2DIVA 3BXMA 4DHVA 2M2BA 4ZX9A 4Q45A 1PG5B 3OJSA 1U0HA 5LYDA 1OS5A 2WB4A 5F3ZA 3MD1A 4NLUA 3D7HA 5D4NA 2EFNA 5J1NA 1XQIA 4CAFA 4DBQA 3C26A 2GGPA 4KKOB 2R3VA 1RLDA 2VDIA 3K57A 2AU0A 1C0TB 1W2IA 4PEOA 3JYTB 3DNCA 1MROB 2DNMA 1IBLJ 1Y3KA 2ZEMA 4FXVA 3UWTA 1QAIA 2AJ6A 1S59A 4WXWA 1C4AA 4MYTA 1RADB 2XTJP 3SJXA 3CF5Q 4WFYA 5DZ7A 2Z58B 2RUGA 5LM7E 4OFZA 1I94J 3DRYA 2KDOA 1Z5RA 4ONUA 4FN5A 2HNZA 1X0PA 3DN9A 3R95A 3W62A 5D8HB 3DLGA 2E29A 4NPOA 3QGHA 2VHGA 4NLPA 4RW4A 2QT7A 4C8LA 3TO7A 3A8EA 2BRLA 4KJIA 2O67A 4HACB 2X1BA 1UL3A 3GJSB 4UWIA 3H2VE 4JXRA 2LLZA 1XNQF 2HAIA 1VIXA 4DS5A 3D0HE 3FUYA 1LXJA 1LOKA 3M6UA 2CPJA 4NGTA 1RWOB 3M05A 1LK7A 3NP5A 5H9EK 1S97A 2Y3YA 4D3GA 3QSYB 5I0CA 2XB2D 2PRQA 3C2PA 2F9DA 3D6MB 2W8KA 1JLQA 3IM9A 2YKAA 3BB5A 1NMTA 3D2PA 2OFGX 2CTCA 2JBJA 4M5DA 1FFWB 1C1BA 2JNJA 3BJ7A 3MEDB 3GIIA 1KUYA 1H2VZ 4H4MB 3PZPA 3GYNA 4K7QA 4UY8T 3IGVA 1UFLA 4QIEA 2D41A 4M6GA 1U1MA 5J2MA 1RT3B 3A8KA 2ZOMA 4P7TA 5KFMA 3PW2A 4YFUA 4WE1B 2UVUA 1IKXB 1Z4EA 4DPXA 3BJYA 3G86A 1HBMB 1XMOJ 2OEMA 1FCAA 2XMKA 3TAPA 5D3GA 2YWKA 4AG9A 3K5PA 3BBCA 3NGRA 3IFEA 3MRUA 5T41A 2QA2A 2YNFA 1FE0A 3S6EA 4A47A 1MN7A 2KZZA 1EE3P 3R6GB 3CW2C 2X3DA 1QSSA 2M8HA 2G2YA 2WBRA 1QUPA 4MJKA 4F2RA 4A8OA 2KTQA 1M4DA 2E9ZA 3MGDA 3MM8A 1BD6A 2OEKA 4Q8EA 4OJHA 3SSRA 4KGVB 1IIDA 2X1FA 5CA5A 1CP7A 4KZTA 1IOIA 5GAEI 3C6TB 3CB4A 1UWBB 3AQPA 3ZZPA 2GLFA 3N7ZA 5KT6A 3TO9A 3G71S 3JSRA 2DB1A 3TUPA 1SJ1A 4AG7A 1CC7A 2OPRA 5KFHA 2W9BB 1FK9B 3W64A 3NE7A 4WK1A 4ATNA 3CJTA 5J1EB 2NZCA 4O4RA 3F44A 2F4FA 5BR8F 2YKOA 2HWTA 3SXLA 1RYSA 2D3OR 1S6QB 4NLVA 4CTAA 1QD1A 2MGZA 3DLKB 2C2DA 4DV4J 2GQ2A 4UWJA 5IXUA 4FF3A 4M5NA 1S1TB 4DL3A 1FESA 1WF2A 4X4QA 4DPOA 3NG8A 3OTOF 2DR5A 3EXNA 4YEAA 2P0WA 5J1PA 5A6PA 2BW7A 2EG1A 4NL5A 2GVDB 2IJNA 2UVWA 1MNEA 2Q7SA 4NLXA 2FVCA 4B11A 4R25A 1VHFA 3DCAA 4P7VA 4KLVA 5B0BA 1WEXA 3M8ZA 1UVIA 4QBJA 2EWHA 4ZLJA 5J2NB 4EO8A 2V8GA 3PM9A 5B7WA 4HDHA 4X4TA 2CA9A 4L8AA 2QLWA 2DEIA 2BE9B 4TU8A 3ITHB 1IYLA 1MSWD 4PYDA 2ERRA 1RT7B 4G1QA 5A2QY 1VQOS 2A6OA 4YB6A 3BGLA 3SJGA 3UVJA 4LF9J 1KEKA 1GXUA 4X2TA 1Z9UA 2CQHA 4PG8A 2JBKA 4XPEA 1G1XA 1MMNA 1GQEA 4R8FA 2FC8A 2BSWA 2CQ4A 2YTCA 4F3OA 2VFRA 2CJBA 2JEJA 3UO0A 4E2AA 2M88A 4USKA 5F8JA 3DOKB 2K2PA 5C24B 1P1LA 1EKSA 3KWMA 2HC9A 3RB0A 1RWVB 4C3LA 3SI0A 2B9XA 1CS4B 3FRYA 3PRDA 4NWBA 2QFIA 3UN3A 1TKJA 1CJVA 3THVA 5F48A 2PIYA 2QMUB 4LFCF 3UFCX 1HQEB 3JSYA 3VWSA 4ZVQB 2P6GA 5C7PA 4F3MA 4JI1F 4ZVEA 3HVRA 2GHVC 1Z8WA 1NUEA 2R2SA 1HEEA 2YX4A 2NXJA 4PKDB 1EZZB 1PU9A 3TAQA 4ZK7M 2VFTA 4M5HA 4CGNA 4ZVFA 3OQ2A 3BDEA 4IH5A 5ETKA 3VWDA 2E7XA 2Q4YA 4OYIA 2C3PA 1TL7A 5FD1A 1RTDA 2RS2A 3OFHA 3EFAA 2AIRB 3M2UB 3DRSA 3S9LA 1KSPA 5ETNA 1CJKB 3DR8A 4L74A 4QU6A 2ZUGA 2HUZA 5KT7A 4OC1A 2F1FA 3DOMA 2O28A 4K4VA 3DLEB 3BLNA 2PE8A 3CPWR 1KOOA 4HACA 3BGUA 4WYLA 1T7PA 3IWEA 2UVVA 5T14A 2MPUA 2NXUA 3R96A 3OV7A 2YNIB 1YW6A 4MFBA 2QZ8A 3TA0A 1YVFA 3LA0A 4CLSA 1LV5A 2B0GA 2V8HA 2DEAA 1Q2DA 2LEPA 1ZPVA 4JV5F 2DK2A 3MAAB 5JUMA 1KQSR 3A1YG 3RAQA 1G4CA 5IWAF 4NA3A 4X62J 1ELMP 4HEA9 1LQ9A 1S9FA 1CJWA 1T11A 1BGXT 2JEIA 2FL4A 4LRDA 5FLXU 3G2XA 3BV8A 4C7IA 3D6TB 4EUVA 1VRUA 3L7OA 3AJ2A 3TAMB 3G3SA 3U7JA 3PR4A 1SJRA 5ITHA 4W4MA 1XJWB 4C2MA 3E01A 5F9LA 4QCLA 5ETPA 2KT2A 1VQ9S 4WU2A 2VJUA 3CJ0A 1S7LA 3MEEA 1FWPA 1B64A 2PJ4A 3T9NA 1IWGA 4JV1A 4XNHB 2YX1A 4DL7A 2AD9A 3DU5A 4C97A 1FO1A 1JNRB 1GTHA 2B5GB 3OTOJ 2XEIA 3D3SA 1FD2A 3OTCA 2FJAB 3DRXA 1UVMA 3TRGA 5AJ3J 1HPZA 5LRGA 2UVRA 4K0KJ 2DGWA 1VBXA 2CAJA 1Q7LA 2IHR1 4NEYA 1SBRA 7FD1A 1AUSL 3M2VB 2BBEA 3V6HA 1BE4A 3SXNA 4JI8F 1VQYA 2A0FB 2UUCJ 3TW0A 2MQOA 2BACA 4KV8B 5KG5A 3QIDA 2OZGA 3TZYA 1NKEA 4NYOA 2ZJQQ 4KGZB 1IOFA 2PRBA 4A37A 3TCVA 4NRUA 2MZQA 2G0JA 3L95X 1RT2A 1Y0YA 5T7LB 3MPUB 1ELLP 4B3SF 4OI3A 2I9SA 4I1TA 1X4HA 4I4BA 1RWUA 2GMJA 3BBBA 1UVLA 1ZM3A 2Z57B 5DG9A 4PUOA 4A8SA 3FMCA 3RZAA 1OMSA 3DLJA 4TY8B 5M2RA 2ATLA 3KLEB 1PILA 3Q2TC 3CCJS 4P4EA 5BWAB 5JPHA 4LF7F 1LW0A 3JUWA 1S1UB 4UIAA 2E9RX 2DGSA 3TA2A 2H48B 4F04B 1BLLE 3M2RB 4OC5A 5CAAA 1NNDA 1S9GB 2KH9A 2JL9A 1VRQC 1X5OA 4RW6B 1NLKL 3VF0B 2ZW5A 1UW9A 3DGPA 1HDUA 4B10A 4LFBF 4GKJJ 2YKNA 4WIIA 3LH2S 1ZZFA 2WAQD 4DV4F 3UI3A 4WFBQ 2H5IB 3R8YA 4CLUA 5J2QB 2DHXA 2VBXA 3SHPA 2I3CA 3OL9A 3KNAA 3FECA 1M0SA 3DRPA 2DITA 2G0BA 2B6AB 4MCPA 1IBCB 3DSBA 3LP2A 4F4AA 1X4AA 3GU0A 4KB7A 3W5XA 4HR2A 2I0XA 4KOTA 3QAEA 3WDOA 3BREA 3AAWB 2FVQA 3EPIA 4OYBA 1KBRA 4C3KA 2RRAA 1U02A 3Q24A 2ZXVA 4HNWB 4FD5A 4PCQA 2CJ9A 1F9EB 1Y10A 2KKHA 4RZRA 4O44A 2XS2A 2XMJA 4ZHRA 2PE3A 2VXKA 3DC2A 3QGGA 4K8RA 4M6HA 2NMTA 1BMQB 2ZDOA 5GAGI 3LAKA 2KHCA 3EYZA 5IWAJ 4KSAA 2KJVA 2FQQB 1HQ2A 1HA1A 4CT8A 1H0HB 3MUTP 1PJ5A 5ETRA 2OTJS 3X1LB 2RE1A 3AXMA 4DX6A 2ZH9A 1TKTB 4K3NA 2WVCA 2UU9J 4B17A 1VQPS 2P8IA 2GJIA 4ECQA 4F02A 5L1KA 3V4IB 2UZAA 1RYRA 1KLNA 3T5HA 3ICLA 4NA2A 2Q3PA 4KSEB 1UA0A 1GMWA 2CJQA 5C42A 4G3IA 3SCJE 1B0PA 4QU7A 5HMXA 2Q66A 1T9WA 2YNHA 2DNGA 2ZZTA 1PBAA 2CADA 4AD6A 3W3SA 5EWEA 3HHLB 1BLUA 2DKOB 2YWFA 4USJC 2V2QA 3JQMA 1FFGB 1A0OB 3OL7A 1J5EJ 1CVJA 1NB2A 1NH8A 5E41A 4URSA 1R0CB 4OL8A 5KG6A 4ZN1A 2YQ3A 2BV3A 1Y7RA 4C2YA 2FVPA 3C15A 2CNOB 3HT3A 2VQEF 4U6PA 1NJXA 1VRTA 2PD1A 2AZ1A 2A18A 1P4NA 2AFWA 2BEIA 5MLCV 1ZTTA 4YQWA 2HFSA 1SUQA 3M1VA 1OQ6A 2FVSA 1J5OA 2ZEPA 2ANPA 4ED4A 1WI8A 2QX0A 3MPVA 4BWJA 2V6AA 3FKBA 3Q89A 2QL7B 2BO9A 4OC0A 3PRVA 4EGLA 3M2VA 2L08A 2BM0A 4C7HA 3MAQA 4M5MA 2N3LA 1KD1T 4XDCA 1YBUA 2BQRA 3J7ZT 3FFIB 4XPLA 3NNCA 3OWCA 3D1OA 3H8YA 1XR7A 4TWEA 2FGOA 2R9LA 1U25A 1OWXA 2EUIA 1S0NA 4RW7A 2JEFA 4MKAA 1DZ5A 3FSXA 4J3GA 1CPSA 4MAKA 3G8QA 4I49A 1N6QA 1D8YA 1OJ4A 1F3FA 3RBZA 4RNFA 1MU2A 3B82A 1DARA 1M5SA 4UFXA 3TZXA 1LCPA 4OIDA 1UZDA 1CJUB 2NXCA 2DNPA 5IC6B 3ISND 3DKDA 1WTBA 4YFJA 2PN6A 1R7IA 2AEFA 5EUHA 4B13A 2XMMA 1M4GA 1U1RA 4L76A 3D7FA 3JSMB 2DD8S 5KG7A 4ICLB 3PACA 3H0PA 1N5YA 2KL8A 1KNZA 1L0CA 2KFZA 2QA1A 4QYRA 5JGFA 3HFKA 4B3RF 4Q36A 4TU7A 4IG3B 2C2NA 2M5YA 4MCRA 4ILLA 1UWAA 1DLOB 3ZC4A 2FVRA 4QIVA 1JLFB 3D6HB 1CJKA 3UW1A 3EDQB 2DHSA 2HPUA 2B5JB 1N34J 3PG9A 3KLGB 3HPOA 2PI5A 1N52B 2PT0A 1K0VA 3M1VB 5H86A 4DV5J 2WB1D 3DMJB 2KHDA 4KH1B 4DR6J 2IM2A 5EC4A 2IMOA 1V3ZA 2ZBIA 1MK4A 4DPYA 5AE2A 1PBUA 2PQ8A 2CPDA 3G96A 1Y4ZB 1RT4A 1M1HA 3FJ2A 4K50A 4H6UA 3CJQA 4WZMA 3SJFA 2UUWA 1CJVB 4MRIA 2Z2YB 4DQPA 1XF8A 1BY9A 1VDHA 5MAOA 1M4LA 3CULA 1BHNA 5KTCA 1IGBA 2NPIA 3K5LA 4P44A 1DTDA 1WC1A 2JEWA 4CYUA 2WONB 4ECWA 1KTVA 4R3LA 1YZ7A 2LQ9A 2VG7A 4I2QA 2HHUA 3F73A 1XMBA 3A8JA 3W2WA 4Z7CA 3QLHA 3TANA 5IS2A 5KFVA 3VH9A 2YNHB 4LUAA 2XMVA 2KFNA 2ROPA 4N7TA 2N7CA 4JI1J 2B43A 3NH4A 4MFLA 3UVJB 4RKUC 3FQKA 1UWYA 1RE1B 1FF2A 3FK4A 3G87A 1GH8A 1HLWA 2R7UA 4NGSA 4YDXA 2QSFA 2IIHA 2H1YA 4ZVGA 2PA8D 4G1PA 5F0WA 3KK2A 2Y1RI 1P0HA 3N6MA 1WELA 2KT3A 1FTCA 2BJ8A 3ISXA 1HBUA 2OPPA 2D9OA 4R8UB 1HHSA 2BQ3A 2Z3KA 2DISA 2VC1A 2MGZB 4KPCA 4USHA 1S6QA 4DR2F 4BC9A 2ZENA 4WXOA 2WSCC 3SFUA 5J2QA 4P73A 4CLWA 2BJ7A 3B4DA 2V68A 1N5TA 2C22A 4KORA 2DY1A 1LOUA 4CLYA 5DM7Q 1U24A 4K4SA 2RDIA 1V9OA 1OYEA 4OYMA 3CC7S 1SH2A 3H5SA 5ETOA 4Q0BA 4N56A 4C48A 3B7IA 1IXKA 4F0HA 4KHRA 1IY7A 4ECTA 2VA3A 4ZMMA 3CMAS 3W91A 2OPQA 1L3VA 4A48A 4X8IA 4CO1A 1QVFR 4ECVA 2E5GA 1MWYA 2CG4A 3VALA 3W65A 4TLRA 3SI2A 4OMEA 3S9NA 2FHKA 1NZAA 4A39A 5FDLA 2GVZA 4YB5A 3Q0AA 4RUAA 2XYGB 4B3OB 1LWFA 2XEFA 2R7QA 3SSSA 4E8OA 4DUKA 2WOMB 5F8MA 4CRZB 4Q43A 1VISA 2GFFA 1IR1A 4J9UE 2H54B 2IM3A 3PHEA 2LQBA 1K9MT 1K4JA 2VQYA 3J81j 3HFVA 4IQMA 4Y2KA 2F9JA 1HHQA 5ETSA 5D3GB 3EGZA 1N32J 3T5LA 2EXUA 4DU8A 4LRCA 3KLEA 2DXEA 1IKXA 2G3TA 4ANDA 3TA1A 1RXOB 2YNFB 2KXFA 3NY0A 2HQFA 4RW9A 1HNVB 3IXQA 3LUYA 2IC3A 2L48A 4B9TA 1KVJA 2G3AA 4NXMF 4ETXA 3BGFA 3CCQS 4OHWA 4DV6J 2WONA 3LPEA 1NKCA 4B3MF 1Q53A 3BS9A 1IBKJ 2I8EA 2RRNA 3PYDA 3R1HA 5F9NA 3I32A 1JLFA 3GV7B 4LF6J 4NLRA 4JWPA 4MY0A 3U1MA 3U1LA 2CQIA 3HSDA 1UPMB 3BF4A 2AJ0A 4B14A 4P71A 2ZEOA 2WVDA 2FHJA 2F65A 1N36J 1U1KA 2FZKB 1HBNB 3BKTA 4RNHA 4WBFA 4IG0A 4WWSA 1R0AB 3AXKA 1RHKB 3MOJB 4HDGA 3O44A 1FDDA 1PIEA 2VG7B 5CHCB 1HI8A 3T41A 3KMSA 3NCQA 1KLMA 2RVJA 5E0OA 1REVA 5AG7A 2MZ1A 3F0NA 1HARA 2VQFF 2E1PA 1TXRA 2FC9A 2V2ZA 1HR0J 1FRMA 2M8DB 2AFOA 4A30A 4CLTA 1N6QB 5L1JA 2DH7A 2YNIA 1KR4A 2I79A 3GIRA 1PSDA 2OP5A 4EI2A 3OSPA 3BEGB 4X3RA 2UXCF 1UMJA 2JLGA 1H3DA 1V6HA 5AG5A 2GU2A 4UUXA 3MTKA 2OD6A 2W4PA 5CYMB 3GB0A 2HWIA 4OIWA 1RLCL 1H73A 3KHGA 2HIQA 2XHWA 2RU3A 3BSNA 9RUBA 3ZO7A 4GVLA 1TMMA 8ATCB 1U6ZA 5KT3A 3KHRA 5G20A 4Z65A 3EPGA 2CPIA 4QPTA 2OPSA 4QOTA 5HROA 3JYTA 1JLCA 4LF5F 2HG4A 1SUQB 3VATA 1TKZB 1YX2A 2OUGA 3OTEA 5HJYA 5A8KB 4PXEA 3KHLA 1Q8KA 1FI4A 3KUEA 1VS3A 4C68A 2Y8YA 2F5IA 3CJKA 4L3NA 1IN0A 5KAKA 2XMWA 4MT1A 1NXIA 4R3KA 1FRHA 1H8LA 2HNYB 1D9AA 1TKZA 5HN0A 4WYWA 2OU2A 1FJCA 5HXDA 1B4SA 5GMKa 1YQHA 3K5OA 1M44A 1NK7A 4DZ6A 1FRLA 3H8EA 4KOWA 4C2ZA 5EN1A 4ED7A 4QWAA 4U67Q 2RF2A 5F09A 1N5QA 3FDSA 1HKAA 3FJUA 4PQAA 1RTIA 2IL4A 1UEVA 3F8KA 1YSJA 2ALYB 4FYVB 3OR1B 3EJMA 2F63A 3PYGA 3IU2A 2R8IA 3HSJA 1RT5A 2KYXA 1N32F 2BCOA 1Q86T 2CNTA 1I6JA 3VVTA 1NSKL 2OTLS 4YB1P 5D6GA 1RO5A 4ZOSA 3C15B 4RNOA 2HK3A 1OPZA 3KK3B 3TI0A 1FD8A 3N28A 3TVYA 1ARMA 1VIOA 4NXMJ 4HLBA 2XG8A 1O5JA 1KQFB 3TO8A 2UP1A 2LXFA 1NHKL 4DUZJ 2FLLA 3D2MA 4A4JA 4YGOA 2W2MP 2DGQA 4LF1A 2CNKB 2N7YA 1T9UA 2D3ZA 1U1OA 3FBFA 2FGCA 1I21A 1RAIB 5E3PA 2LMIA 2FIUA 4LRFA 2QEXS 3FEDA 1EP4B 2LQ8A 4NF1A 2CJAA 1GX6A 4L3KA 2DR9A 4M3SA 4AE5A 1NE9A 2H5EA 3MM7A 3IWLA 5H9FJ 1BC6A 3FFIA 1NDKA 1IKVB 2W9CB 2HFUA 2CIMA 1OO0B 4LIWA 4OYWA 3TZZA 3RBUA 3FQLA 4FYDA 1TK0A 2V4QA 2VPWB 4Z37A 2IVYA 1B0VA 5D0GA 4F0KA 3D1HA 4F2SA 1SI9A 5F46A 4QIGA 6CPAA 2M0GB 2NSBA 4GC7A 4AXJA 1B7FA 2AF6A 3PB4X 3FZBA 4LT6A 2LXIA 4F0XA 2ZHAA 9ATCB 2DH9A 2W2QP 4NASA 1XNQJ 1YJRA 2OELA 2VPYB 1X7VA 1L3UA 2VF3A 3PY8A 3GUXA 2IDEA 1U7LA 4I0WA 3FMBA 2E9TA 3KLIB 3UNGC 5FDLB 2J5AA 1S0MA 3OUYB 3OHBA 1QDUB 1S99A 1KQKA 4NX9A 1XNRJ 3HZGA 1XK8A 2VPZB 2RT3A 4EFAC 1UAWA 1H2TZ 2VKRA 1RT1A 4ZCMA 1TK5A 1IKWB 5CYJA 1M4IA 3I5CA 5HQ8A 4KSFA 3MD3A 1PAEX 3PRBA 4CAEA 2E1MC 3QJPA 4MHPA 1BUXA 3LODA 1RACB 2R42A 1KONA 1L5UA 3NEKA 1NKBA 3KLVA 5LXYA 3LQVA 2RAQA 3CVKA 2AV5A 4YUDA 4RW6A 3PW0A 3PEJA 1RT1B 1E6YB 2DHGA 3ZXWA 3CMES 3RJMB 1S10A 4E98A 2DNZA 2OPPB 3CE8A 4PG5A 3SQOP 1OSCA 3MOZA 2ZM6J 3C6TA 2KG0A 2UUBF 1CBKA 2D74B 3QYYA 3C6UA 4UEEA 3UDCA 3W7BA 3W9JA 3PB9X 5C25B 5KFAA 2E5JA 4OX7A 2P6EA 3PO5A 1WHWA 2G2ZA 3JB9k 4C8MA 1TL1A 3MFIA 4P4FA 4MI4A 2YXLA 3PVXA 4RW8A 2IYGA 1RCOB 2DGVA 1O6XA 3N6NA 5CD4H 4B3SJ 3DXBA 1AXQA 1RB0A 3AA8A 3TX0A 1SC4B 4DR5F 4FXWA 2C3UA 4AVBA 2CZVC 4M8LA 1VBYA 4KGXB 2W24A 4DR3F 2VC0A 1U2RA 4MFKA 2Z2LA 2IA0A 2ZE2A 2BKOA 2K3KA 1Q81T 1WEYA 4P2MA 5DZ6A 1RTIB 2Z3MA 5HVHA 2FJDB 2BJDA 4LBPA 4TYAA 3PRTA 5DDQC 3MM8B 3BO4A 5G1ZA 1NAQA 4LF8F 4RBTA 1LW0B 1RHRB 3FEEA 3BHXA 2QMLA 4ZY0A 1SQFA 1B70B 1RAOA 4IO9Q 2W9CA 1URRA 4C8KA 1Y3JA 3SZ2A 2PJ8A 4GO7X 2VPXB 2J7KA 1TL3A 2JLFA 4NOHA 4EBEA 2RHSB 3AOCA 1ZAVA 2QYVA 3MUVP 4DV7F 4O0NA 2Z8QA 2OZUA 2HGNA 1EQMA 2X51A 5IZHA 1YBAA 2XEXA 4K59A 3B4MA 1MWQA 3SXOA 4GKJF 4A8YA 5A0YA 4FD6A 1PYTA 3LP0A 1ZO0A 2FJVA 2GO8A 2BDPA 4J37A 4ZIWA 1GMUA 1C4CA 4H2KA 2D1CA 3FC9A 1S77D 1Z8XA 5HROB 3KR4A 2VFSA 1PO6A 3SV3A 3S6KA 1TUWA 5HLFA 4DQIA 3S6HA 1ZS6A 3W5ZA 3AB2B 4QJVA 1XR6A 5I42A 2HQDA 4WKRA 2V2KA 4DNCA 5H1SV 2DVIA 1RWWB 3QIPA 2ZEEA 2WW8A 2MKJA 1U0HB 4ANEA 2AJ1A 4LUBA 2AFUA 2V4JB 2EK8A 4X64F 2M4MA 3A3PB 2VFUA 1QVGR 1VRUB 2CNMA 3DXSX 4DR4J 5ADZA 2HURA 5BYSA 1TAUA 2W01A 2PI4A 3KL9A 5KFYA 2HZCA 3TX8A 2EG2A 2Z30B 3B78A 3GJRB 4MH8A 3VVUA 2WVBA 3NMAA 2KVIA 4DL4A 1XNRF 4F67A 4XDDA 3TAMA 2XZDB 2ASDA 2RNEA 1NJIT 3IO1A 1RDRA 3CJ3A 5G4DA 4CIOA 4HH0A 4QWBA 1SKSA 1KUXA 2GMHA 1Q1KA 3K2KA 4OC3A 2G9DA 3W2VA 1GMWD 3KJVB 4HT5A 4UQTA 3P3DA 3GLJA 4QYZK 4FNHA 3HKWA 2DNQA 4ZPBA 3KLHA 1WTFA 3BI0A 4J9OA 5DLFA 1WORA 2Q4ZA 1YG0A 2F5GA 2Q51A 4PWWA 1HMVB 3DM2B 4WP9A 3KJVA 5F8NA 3B8HA 1SV5A 2RDDA 4IQXA 5HL7Q 3PB8X 4KAIA 2ZH4A 2GQQA 2BR0A 2BJ3A 3G82A 2BVZA 4DV0F 4CYOA 1WEZA 5JM6A 1S4EA 5E5NA 5IV4A 1CEZA 2DCLA 3GV5B 2DNLA 4OZLA 2IVMA 4MKYA 2XI3A 1RTHA 1VBKA 3TWZA 1S7FA 2FLPA 4ZJQA 2Z4PA 4DQRA 1GT8A 2ZH3A 2NR0A 2ATCB 1CULA 2A4NA 1N54B 4MY3A 3HHLC 2UXCJ 4JI2F 4GVBA 4DSEA 1Q79A 2G4BA 5AXLA 2AGOA 2DPTA 1S6OA 4WK3A 5B0GA 2ACMA 5F49A 4K4ZA 2JDDA 2KFYA 4FD7A 4EMDA 4AVAA 4AL6A 1SKUB 1HQEA 1QTMA 4FKYA 5THWA 2BMBA 4YWYA 3QRPA 2MHNA 1Q8LA 5DWNA 3A4TA 4LF9F 3N0VA 3R5GA 4ED0A 4MK9A 3AD9C 1AA1B 3W1YC 2V4JA 1UP1A 1S12A 2DXFA 2PCUA 1E6VA 2QO3A 3ENVA 5GMEA 4DR6F 5HVFA 2OMOA 2DTJA 2Q7BA 5IFMA 2IRXA 4DXLA 2AMCB 4DL5A 3D0IE 5AG6A 2N82B 2EK9A 4DYOA 3QAHA 1YGYA 5LMNF 1XOVA 2RB7A 3HDSA 5E96A 5HMYA 2GLJA 4NLWA 2V9KA 3DDIA 4CZCA 4WF9Q 3NXZA 1XE4A 3PP9A 4OJGA 2C2ZB 4ID5A 2ACYA 4YS2A 1OPIA 3V2UC 2EKYA 1J5EF 4CI0B 1HNVA 2UUAF 3L9ZA 4JI8J 2WVFA 5HANA 5JMNA 2UXBF 2VBZA 3MI7X 4FDFA 2JOQA 2AJQA 1TFYA 3FB3A 3R5JB 4DV1F 4WZQA 2GVDA 5CYQB 1LWEB 2QA4G 5HQLA 1FNMA 1FA0A 5DDRC 2WHOA 4CP5A 4H4OB 3NS5A 1NDLA 2R8HA 1NPRA 1UW4A 3NNAA 4H4KC 4Q0BB 5A8WA 4NMXA 5DS0A 3M7VA 5D78A 1EARA 2XNRA 3RBEA 2W2NP 5U47A 1BPNA 5HP1B 1R57A 4ZA1A 2VOPA 1LFWA 1QM9A 5BYQA 1N56A 2J0SD 4KOVA 4ECSA 2E44A 2W4DA 2CFXA 3MMAB 8AT1B 5L1LA 3R5AA 1JNZB 2YGWA 4ZPDA 4OI6A 5CYQA 2ZH6A 4ED8A 1Q82T 3KLIA 3NL0A 1DE4C 3P96A 5HBMA 3CPAA 2ZW4A 3CJRA 2VI7A 2J9DE 3P49B 3DOLA 2FJWA 4Y00A 2W2OP 3TQEA 4CYPA 3QO9B 3RRGA 2DYAA 3TE4A 3GILA 4ZLNA 1FK9A 1IM6A 3WABA 4ZCLA 5M2UA 2R8VA 4J91A 4HTIA 4UCPA 2FXFA 4X65F 1XMTA 3BYRA 1OYDA 2RDJA 3WC0A 4U5YA 1WHVA 2HHHJ 5AJ3F 1UZHA 1I1GA 3I9ZA 4NCGA 4MKBA 2Z3OA 3QFHA 1H7WA 2W1BA 1WK4A 1GX5A 1QSNA 4PYAA 3GFZA 4IRDA 3AJDA 3BM7A 6AT1B 4DWIA 4C6AA 3BQ2A 3A9LA 4LMZA 2AYBA 2D69A 3DU6A 4CYUB 4B3RJ 4BLGA 1D9DA 3CDBA 3TR5A 3KHXA 3HHDA 4XK8C 4WFXA 1FRJA 1RISA 2ZBCA 4EZ6A 3TYTA 2EFVA 1VFJA 4F3QA 2DF5A 1Y0HA 3CDEA 3I9SA 3S6GA 4JI7J 1F9FA 1N5VA 4WE1A 4LSLB 2XCAA 3H4QA 1GFWB 4HNXB 1ZG8A 5DETA 3T6BA 4DX8H 3KLGA 2ADCA 3KDOA 2VUGA 1HDQA 3DYAA 4DEZA 2RILA 4MFQA 3V81A 2HVIA 3CZXA 2O53A 4U96A 2V77A 5GADI 1F57A 2KN4A 2KXHA 2AHOB 3MEGB 3LTOA 1F5BA 4DU7A 4J9VA 2AP6A 2G0CA 3HKZD 3N5BA 4NGQA 4KGMA 1S1WA 2I00A 1Y7EA 4YP3A 1JLAA 3I0RA 2K7JA 5KFWA 1XBUA 1U1PA 2NCKL 1JWWA 2HLTA 4TYBA 4KV8A 2HNZB 1H6KX 4IO1A 2NUUG 3A8IA 4X4OA 1QSYA 1QE1A 5LMUF 4OLPA 4ZCKA 4C0HA 4UEZA 2UV8G 1V3SA 7CPAA 1VQ7S 1H98A 1KFSA 3M6XA 2B4PA 3AD7C 4CO2A 4KHPJ 3I6PA 2MKKA 3VHQA 3Q8UA 1HD1A 2REEA 2IYIA 4UF4A 4KPYA 3KUHA 3RYOA 3PW4A 3IBWA 1SL0A 3A3OB 3MEDA 5DG8A 3MM9B 1RT4B 2B9YA 5E3QA 2XO6A 3BQ1A 4P4DA 1M5HA 5E3RA 4QWCA 2RQCA 2EVNA 1U49A 3BGRA 2OSRA 2XEGA 2LECA 2L9DA 3BR8A 1FX2A 3LACA 3FCWA 1FJEB 5KT4A 1RAHB 4PAAA 1K1SA 5LRJA 2ZEJA 4RBVA 3PDNA 2Q43A 2QJ3A 3D7DA 3CCMS 2GHPA 4IG3A 3H5ZA 4UOHA 4YHHJ 4QR1A 1RZMA 1APSA 1J5OB 1ITPA 3RRKA 2QV6A 3AHPA 2E7WA 3FX6A 4R57A 1AZSA 4DV2F 3ZFVA 4ECZA 4FBTA 4R6TA 4HHUA 3RRHA 3D8PA 4I69A 2J8NA 3DFEA 4F4ZA 2HMIA 4J9MA 1B6BA 2G0IA 1VHOA 1REVB 3GKRA 1JQGA 2AGPA 1RA6A 3RG6A 3BH7B 4USTA 2J6TA 5KFQA 1X9MA 4I56A 2B7CB 3R1LA 2Y0MA 2VKZG 3D67A 3IAS9 4GXHA 4MFPA 4EFDA 4IYQA 2POKA 2J7UA 2H9ZA 3HK2A 1FHTA 3E8OA 1ZPWX 2L41A 4ZDNA 4LR7A 2RU9A 2CDQA 4K5RA 4AT1B 5K5MA 2HZAA 4FXDA 3R27A 4CH0S 3NGKA 1X5SA 3AFGA 4A95A 2QA4S 2V69A 3UR3C 5HMWA 4TNUA 3CGIA 4JI4F 1VKCA 5KTAA 2OEJA 3MPYA 3KQXA 4M95A 4ORFA 4J7CA 1D3WA 4HKFA 1XN9A 1RAJA 2XWXA 3PIPQ 3FBCA 1J2VA 4NGMA 1JLGA 4A32A 5KFSA 5HVGA 4NRTA 2DGOA 1NRKA 2F8EX 3H20A 2ZZNA 2EEYA 4K4TA 1ZM9A 3NH5A 2EBJA 3IBCB 2B58A 3IIBA 3I0RB 1LXNA 2WRMA 2CDRB 2GIQA 3SQGB 4XPKA 1FRIA 4ZVTB 3J81Y 1X4CA 1X8DA 4RLEA 2B9EA 4MTPA 2O66A 1NK8A 2ATRA 4P4BA 3SJEA 3Q2SC 4TLQA 3GJQB 3I0SB 4M6IA 4DPWA 4EU0A 4NYPA 1BQNB 2ODFA 3DYAB 2AYMA 4CS0B 4EO6A 5F8HA 4F0MA 2FZGB 1T8EA 2AJFE 5F47A 2MKHA 3MEGA 3FIXA 5D0RA 4CM0A 2KRRA 3E2EA 4DR7J 3G9CA 1GXTA 5IQQA 3DDKA 4O3PA 2P2CB 1SKWA 1O51A 4RW9B 2OB0A 2YKNB 4FF4A 2JFKA 4IR1A 3DLKA 1P9QC 1S72S 1YX0A 2V50A 4ELTA 5IT9Y 4OZ2A 1KDNA 3F41A 1JIHA 2Q04A 4A38A 3K9UA 3L3CA 1S3ZA 2QSWA 2X7BA 3TJ8A 2EVZA 1WD6A 2W7OA 5DJBA 5ETLA 3ILOA 4O3NA 4OI1A 1HHTP 2HHTA 4AXIA 2MTLA 2C6PA 1TL1B 3NS6A 4ELUA 2RIJA 1NK9A 2NSMA 4K2XA 2IMWP 5DQIA 1RWPB 3DRRB 4EEYA 4JI4J 1RAFB