3CT9A

Crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
353
structure length
346
Chain Sequence
YDIPTMTAEAVSLLKSLISIPSISREETQAADFLQNYIEAEGMQTGRKGNNVWCLSPMFDLKKPTILLNSHIDTVKPVFTPREENGKLYGLGSNDAGASVVSLLQVFLQLCRTSQNYNLIYLASCEEEVSGKEGIESVLPGLPPVSFAIVGEPTEMQPAIAEKGLMVLDVTATGKAGHAARDEGDNAIYKVLNDIAWFRDYRFEKESPLLGPVKMSVTVINAGTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNSSRIDEKHPFVQKAVKMGRIPFGSPTLSDQALMSFASVKIGPGRSSRSHTAEEYIMLKEIEEAIGIYLDLLDGLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acetylornithine deacetylase
publication title Crystal structure of a Putative Zinc Peptidase (NP_812461.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.31 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 101
structure length 346
sequence length 353
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ct9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ct9A01
4FBEA 3WT4A 2AFSA 3B7IA 1HDUA 4A38A 3IFEA 3QNVA 3GLJA 3ISXA 1F57A 1LCPA 2AFMA 3B35A 4NGPA 2O53A 2PJ1A 4OC1A 4FWUA 2V8GA 1JQGA 4AXVA 2V8VA 4RUHA 3SI2A 2AFWA 4WJBA 1XFOA 4KSIA 4A94A 4GM5A 1YSJA 2XEJA 1LOKA 1F2OA 2PVWA 4UIBA 4PXBA 3FEDA 4OC4A 3PEIA 3CPXA 3BI0A 2I3CA 3FECA 1PCAA 5CPAA 4DYOA 2WZNA 3PB9X 4UIAA 2PJ6A 5HVGA 2DEAA 2POKA 2PJ5A 2ABZA 2EK8A 2Q51A 3B3VA 4Z65A 3BXMA 3RZAA 4BD9A 1DTDA 4OC5A 2C6PA 3B3WA 1RTQA 3IO1A 3FH4A 1IY7A 3JRUA 3D7DA 1XBUA 3L2NA 2PJ9A 4OMEA 4R76A 2ZOFA 2IMOA 1R43A 3FJUA 3IIBA 2BOAA 3DLJA 3SJXA 2PJ3A 2PJCA 5JGFA 5DS0A 4P4EA 3PFOA 2C1CA 2AFOA 5ELYA 1Q7LA 3V38A 3WC5A 2PJ4A 1BAVA 1ZG7A 1XJOA 2AFUA 2CTCA 3ISZA 3D67A 5IB9A 1XRYA 2F7VA 4IHMA 2ANPA 2ZEPA 1VHOA 3WABA 1LAMA 4MCRA 2V77A 3LMSA 1NSAA 3NA6A 2GLFA 4ONWA 2F8HA 2QJ8A 1H8LA 3BHXA 4JZ0A 4PXDA 3BI1A 2PJ7A 2JBKA 4MCPA 2PJ0A 3D7FA 3SJEA 2HB6A 3CDXA 4FUUA 3KR5A 1Z8LA 7CPAA 1DE4C 2NYQA 3KZWA 4OC2A 2BCOA 1Y0YA 4EFDA 2CF4A 4ZY0A 2PCUA 3KASA 3D7HA 2ZEHA 3KQXA 4MCQA 2GREA 4PXEA 2GLJA 3IC1A 3FX6A 3D68A 1TKJA 3KHZA 3HLPA 1TXRA 4R7MA 4OIWA 2RFHA 5K8PA 2CTBA 4EMEA 2WYRA 1EE3P 4OC0A 4P45A 1F2PA 1ARLA 1OBRA 2ZEGA 2ZELA 4P4FA 1TKFA 2PJAA 5HVHA 1BLLE 5I4MA 3MN8A 4WWVA 1ELMP 2CIJA 3KR4A 1M4LA 3VH9A 2QVPA 3VATA 3N5FA 5J1QA 4DUKA 1CPSA 4YU9A 2ZENA 1ZG9A 3SJFA 5D29A 5THWA 1VGYA 8CPAA 1XMBA 5K8NA 1VIXA 2C6CA 4PQAA 2J9AA 1YW4A 4OKOA 5D8NA 1PYTB 5HXDA 3PRTA 1QQ9A 2Q43A 2BO9A 3V7ZA 2EK9A 2PRQA 1BPNA 3GB0A 4P10A 3NH5A 4A39A 4ZX8A 3TC8A 1ZG8A 1ELLP 4A37A 4X2TA 4UEEA 1FT7A 4ZY2A 2ZEOA 2RB7A 3H8GA 3K2KA 5HVFA 2XEIA 4NJQA 1GYTA 1BPMA 4DJLA 3PB4X 2PJBA 5LYFA 2ZOGA 4NGQA 4R8FA 4YWYA 3FEEA 5LRKA 1CP7A 4NGTA 5F09A 1UWYA 3H8EA 5K8MA 3B3TA 3D66A 1AYEA 1YLOA 5LYIA 4MHZA 4FAIA 3TX8A 1LFWA 2V8DA 2ZEEA 3IJ3A 5LYDA 1TKHA 2EWBA 3VARA 4F9VA 4NGMA 4X3RA 1QMUA 1FNOA 1R3NA 2AFXA 4EWTA 2OR4A 3FF3A 4P4JA 3RAMA 3FMCA 2V8HA 1CX8A 2GU2A 1AMPA 4LQGA 3NH4A 5JM6A 4H2KA 1CP6A 3D7GA 4MRIA 3S9MA 1VHEA 3PBEA 4IAVA 3S9LA 4P44A 1ARMA 4P4IA 2PJ8A 2C6GA 3DGVA 3S9NA 4OP4A 4ZI6A 2Q4ZA 4P4BA 4F9UA 2ZEMA 2NSMA 1YW6A 5LRGA 3HUVA 3GUXA 3PB8X 5LRJA 2PJ2A 3PB7X 3SJGA 4CPAA 4ZY1A 1HDQA 3B3SA 3K9TA 5CBMA 4P6YA 5JH9A 3CPAA 4P4DA 4W9YA 3WC7A 1KWMA 4OC3A 3D4UA 4NJRA 1CG2A 1Y7EA 1ZLIA 3I1UA 4K3NA 4ZYQA 4MHYA 3IEHA 1Z5RA 2O4HA 3SI1A 4UF4A 2JEWA 2JBJA 2PIZA 3MRUA 4OIDA 4UEZA 3KGQA 6CPAA 2ZEDA 3PB6X 4NFRA 3KI9A 3PBBA 1TF9A 4PPZA 4R6TA 4MXUA 4TNUA 4MHPA 1TF8A 1CPXA 3B3CA 4NGRA 3LWUA 1HEEA 4O23A 3WC6A 2IQ6A 4NGNA 4PXCA 1YMEA 3RBUA 3SI0A 2VL1A 4MMOA 3FVLA 4JYWA 2IJZA 4Q7AA 2QYVA 2PE3A 4G1PA 1Z2LA 2OOTA 3H8FA 2ZEFA 3KHXA 4X8IA 5K8OA 5LYLA 2PIYA 3B2YA 1LANA 4NGSA 2XEGA 4B6ZA 4UEFA 3KQZA 1ZLHA 3T8WA 1LAPA 4F8ZA 4IK2A 4TWEA 2AFZA 2HC9A 4MHNA 2G9DA 2PVVA 2FVGA 4MCSA 3CT9A 1Y0RA 1IGBA 1CBXA 3PFEA 3KL9A 3NH8A 2XEFA 3IWWA 3NFZA 4ZX9A
chains in the Genus database with same CATH superfamily
5F9NA 1HI8A 1UW9A 4EUVA 5HQLA 5A0YA 3R5DA 2HLUA 2R3VA 3IS9B 5A8RA 4AG9A 1QAJA 2B7BB 1K73T 1APSA 2Z10A 5H1SV 2XEJA 2QFIA 5IT9Y 4NSQA 4UIBA 4PXBA 1BUXA 3V6HA 3GZ7A 4ZVGA 4GKJF 5DM6Q 3O3LA 3MM8A 2YBVA 1TUWA 5GAGI 3WZ0A 4B3OB 3TVYA 1S48A 1HKAA 2WB4A 1XMOJ 1U2RA 3RZAA 1QLNA 4IQXA 3GJQB 3JXOA 3NNCA 5L1KA 3K8WA 1JX4A 1RTQA 2LEPA 3Q83A 3KHHA 3S7RA 5JPHA 3ET6B 5D6GA 1U09A 4EK2A 1YREA 1MJBA 1H3DA 3QJLA 4CGMA 3BBBA 3NNHA 2CPIA 3LP0A 3QWUA 1F2HA 4ECUA 2AJQA 3KG4A 4TLRA 1URRA 3DKDA 5LXRA 3W5YA 4X66F 2G1DA 2FXFA 4Z2XA 2C1CA 3CDBA 3Q23A 4JI1F 3RB6A 2FIAA 1OY9A 5CQGA 2Q6BA 3J81U 2MYFA 2F7VA 4IHMA 3KHLA 2REEA 2EC2A 4CQ1A 2ZZMA 4N56A 1HI1A 4OI0A 1F60B 2JC0A 3ZJ0A 3EC4A 2VBYA 4CLLA 4K4VA 2VQFF 1TKZB 2HQYA 1LW2B 2PJ0A 2RU9A 3FEYB 3IWEA 5J2NA 5U47A 1JLEB 5JMNA 2R4FA 3QBCA 4GVLA 4AE5A 2ZKTA 2VPZB 2ZBRA 2YX7A 2R8HA 2PO4A 3QRPA 2ASJA 1F0XA 1LWXA 3MM9B 4E0DA 2GHWA 2Y8WA 3WC0A 1FY7A 4JI2J 2Q1LA 2FYXA 5BYQA 3EWGA 4USMA 2WVCA 3NGUA 2DNRA 4ZCMA 1KEKA 2HNDB 1N36F 2ZEGA 1KD1T 4X4SA 5E3RA 1C1BB 3PX4A 2DF5A 2YNFB 1HNVB 4Q0BA 3DRXA 3SXLA 2WSAA 3K5LA 4WWVA 1M4LA 1PGZA 1QE1B 3M2UA 1WDTA 4DV7F 1CLFA 1N71A 2YQ1A 4OYPA 4OAEA 2QMUB 3SXOA 3P96A 1T9UA 1BXNA 3DXSX 4MFQA 5D8NA 4ER8A 4BWMA 2ZH7A 3TCVA 1URNA 2OPRB 4F7VA 1JWQA 1S4EA 1FKOA 4OJGA 2DTJA 2E5GA 4H4MA 3QGGA 4C2XA 2ZEOA 1SUQA 2H1YA 3OV7A 4KC5A 4GMKA 4D3HA 4DPWA 4DJLA 3T1HJ 4H4KA 2GW8A 3Q8RB 2DIUA 4CH0S 2AZ1A 2RUSA 4M5DA 1FF2A 3CC4S 2ACMA 2GE3A 1E6YA 3BN7A 4KOSA 5LYDA 3CJ3A 2EWBA 2KH9A 1N34J 3GYGA 2DGUA 2NZ4A 2RNEA 2F9DA 1RT6B 3RAMA 1IKWA 2ZW6A 3LWLA 3HSGA 4KGVB 4UOGA 4HDHA 1LWCB 1VHEA 3DLEB 2ATLA 1ARMA 4DLGA 1NKCA 4RO0A 3KLIB 4A48A 5KFJA 2YGWA 2JEIA 2H9ZA 4HYKA 4PQUB 2V34A 4DU7A 3MGDA 3CDEA 3BDPA 4NL5A 1XMQF 1RHMB 5B0AA 3WC7A 1K1QA 3JSRA 2HGNA 3N4WA 4OC3A 2VPYB 2KI2A 4K3NA 2ZH8A 4EGLA 4KZTA 3EUNA 3V81B 1NK0A 4R0EA 2FZCB 3SDEA 1UPPA 3KLVA 3C2PA 3ZTSA 1EIYB 1XN9A 3OR2A 5C5JA 3G8TA 4XK8C 4C2YA 4LF2A 4ZPAA 2EFNA 3RW7A 1S79A 2ZM6F 2AYMA 1PJ7A 2FHMA 4FKXA 4WXWA 1YKWA 3R27A 3IAS9 3OBIA 4AXIA 4IOBA 1I21A 5HI7A 1NJWA 1JJCB 2OZHA 1N0UA 3ZZIA 1TL3A 3FQLA 1RAAB 4RPFA 3OTOJ 1K47A 5F46A 3M8PB 1T94A 3CJ0A 3KHGA 1RU2A 3UI3A 3WC2A 1XBWA 2OTLS 3EICA 5KFPA 2VKZG 1XE4A 1U8SA 3DRPA 3JTPA 4MCSA 4KOWA 2KM8C 1RJJA 3WX4A 1QAYA 4UY85 3NFZA 1L3KA 2HQGA 4CAVA 1NUEA 3WT4A 4HHHA 1I1DA 7FD1A 2BM0A 4NLOA 1VHSA 2M9KA 4G1QB 4K59A 1VQKS 1IBCB 3FRMA 2QRRA 4IFVB 2Z30B 3EJMA 4YGOA 4Q36A 3CCUS 4KUBA 3MHYA 3MM7B 3BYPA 3H5ZA 2E5JA 1UWAA 4V1Ak 2XS7A 3KK2A 3TO7A 2KT2A 4JXQA 1AUSL 5B0GA 2OSQA 1N56A 1FK9A 1OYEA 4DLEA 4NXNF 2DEAA 2POKA 4A8SA 2C2NA 1RT5B 4IR9A 1I5OB 3K0JA 1NBEB 4YDXA 3NXZA 4IF5A 1S1VB 2IHR1 5G21A 3QT8A 2FCKA 2GHVC 2VOOA 1FDNA 1JXEA 3LP1A 1U1MA 4IH5A 3POTA 5G4DA 3DOLA 4DJBA 4IG0A 3M7VA 1DFDA 3AOAA 1XR5A 2FVPA 2MEWA 2PR8A 1P27B 1S1UB 4FS1A 1GFWB 4P6QA 4LVNP 2UXCJ 1A6LA 1VRQC 4ED4A 5EUHA 3DXBA 3ILOA 3M32A 1TELA 4I64A 3BO3A 3BI1A 5CH7B 4FUUA 1RT7B 1TL7B 3QNWB 3GFZA 2R98A 4QWBA 4HH1A 5H9FJ 3KQXA 2DGSA 4CT8A 4FDFA 2NXNA 3HZEA 2X1GA 2ZHBA 2KYXA 4AL7A 1P1LA 4O3PA 3CO0P 2H5EA 4HNWB 3HLPA 5GVQA 3CO9A 2LA6A 4GVBA 3SFGA 2YXLA 1SV5A 2HNZA 2HQIA 2XEXA 2K1RB 2CIMA 3TVKA 4OX9F 3HVWA 2ZUAA 1Q95G 1N5QA 2RMLA 4TYBA 4C11A 1S9EA 4LREA 3N9UC 2BUEA 4CO4A 2K8GA 3MECB 2DPJA 2FVSA 2CIJA 1F9HA 2I6WA 4MJKA 4DCPB 4B12A 4LF8J 2DXEA 4IDKA 3S6FA 1QD1A 1VQ7S 3BQ0A 2DRDA 2O01C 1XIQA 4PQAA 2BJ9A 2XHCA 2JHEA 3G8WA 4NLQA 1N4LA 1BQNB 1VISA 2KVQE 4FBTA 2GMHA 1RBLA 1V3RA 1ZG8A 2GGPB 1VQNS 3T9ZA 1CJTA 3SMZA 4LX9A 2GVDB 2HFNA 4DR2F 2Z2MA 1U0SA 4LFCJ 4B5PA 4JOUA 3MCMA 1NK9A 3H4QA 1S6QB 1B70B 2XG8A 5HATA 3MMBB 3EPIA 1U26A 4ELVA 2ZVIA 4ZLJA 3VQSA 2XHWA 5AGEA 1AYEA 3KLGA 5D15A 1T3NA 4K0KF 4RW9B 4JYAF 5BJRA 4NGMA 3RB4A 2HUZA 2QIRA 4XNHB 2CYYA 3OUYA 4EWTA 1NB7A 1KUYA 2ZPAA 5FDLA 2Z57B 1FRKA 2AQ4A 3EXNA 2KRRA 2QMLA 4WE1A 1BQMA 2MMYA 2IAJA 3O5TB 2XWYA 3A3OB 4P4IA 2C6GA 4ZI6A 4RN7A 2P9EA 2Q4ZA 2GIVA 3ITHA 2EI5A 1S99A 3UO0A 2QE5A 5BXIA 3PB7X 3SJGA 2E1PA 1MN9A 2R7WA 3V4MA 3B3SA 5JH9A 1YDLA 4NEYA 2V0NA 2EEYA 2YQ3A 1X9WA 1ZLIA 4KORA 3GIKA 1RT3B 1WEYA 2BRKA 3SCIE 4R9MA 2Y1IA 3SQGA 1RQ0A 1GK8A 1RT1A 2F4VJ 3AT1B 1RT4A 3E0KA 3ZTPA 5F8NA 2ZITA 2WUUA 2OD6A 4O4RA 1GXLA 2OZUA 3KLHB 2IQ6A 5KFVA 1S1TA 1J27A 4QR1A 2ZNYA 5LSOA 1RWXB 2IJNA 4Q7AA 3D0HE 4WTYA 4KHPF 3H8FA 5KFAA 2OZGA 1T05B 5GAEI 2KXHA 3P6YC 3LOUA 3B2YA 3R9GA 1TKTB 2PA3A 4IFYA 3CJKB 3D4JA 5C25A 4DFJA 1ZZFA 4MYUA 3QT5A 4HEA9 4JV0A 3CT9A 4CLPA 1IGBA 2YKQA 3MURP 4ED0A 1Z8WA 4DN0A 5J8CA 4A46A 3J7A1 1T9TA 4CWBA 2AFSA 4OV1A 4URQU 1GAOA 1D9DA 4Q45A 3T1YF 4EZ6A 3SYZA 3L7UA 1G7CB 1PBAA 2G0BA 2UUAF 1AUDA 2C2RA 4QBJA 3TW0A 4O44B 2W4DA 1LW0B 3M05A 3FRYA 1FXLA 1VQOS 4YP3A 2NPIA 3LD2A 1VK3A 2UP1A 5L46A 3O6QA 4K4YA 3H40A 3CPXA 4FKYA 1U1OA 2MPUA 5LT5A 2H5MA 2A1BA 1R8BA 1C0TB 4UIAA 4GS4A 3M2VA 3T6BA 5ETNA 2B5JB 4GKKF 1UETA 1MU2A 1OPIA 4A8XA 1U1QA 3DCAA 3BV8A 4K50A 5J1NA 3GU0A 3KLFA 4K4XA 9ATCB 4PG6A 2YNIA 1KLMA 3I3GA 2YH1A 1TUVA 1S6PA 3M6VA 1FVSA 1RHKB 1HARA 4FBUA 2FJWA 1MN7A 1DY3A 1R6YA 2WBRA 1D8ZA 2U1AA 1HBNB 3CMQA 5IB9A 1VBKA 4WFZA 2EVZA 3PW0A 3PKMA 3AB2B 1N5VA 4AVAA 1HMVB 4LBIA 3HULA 2MXYA 1FO1A 1XNQJ 2PSZA 1GMVA 3HHLC 3JQKA 1KTQA 2F8HA 3I4HX 2PN6A 1IOIA 4RJVA 3SJEA 4KVXA 1RCOB 2XI2A 4J37A 2D1CA 3BO2A 1YG0A 2KFZA 1R57A 4MIAA 3W61A 4M5MA 5GAHU 3M8SA 5KFGA 3QFHA 1R31A 3CPWR 1RTIA 3SCJE 3U27A 1U0HB 5ETSA 4LFBJ 3LP2B 3JTNA 4Q2MA 2E29A 5D0EA 4NOHA 3Q2TC 3EX7B 3ZZTA 1HNWJ 2LCWA 1NPKA 4RKUC 1X5OA 2DB1A 4FXWA 3TUPA 4YB7A 3IBWA 2CQ2A 4DCOB 4EZ9A 2HBYB 2VG5B 1W25A 3MEEA 3W2VA 4FS2A 1UWBA 4MFZA 3MTKA 3ENQA 5J2PB 3C6TB 2EW9A 1VR6A 2HWIA 5DDPC 2HHWA 2HVHA 2I5JA 1AXQA 5IV0A 2IVYA 3SJFA 1NJIT 1VGYA 3CEDA 2IDLA 3TJAA 1OIAA 1DRZA 2Z3NA 3P8BB 4M5KA 1SC1B 2ZJQQ 5EDWA 1UFWA 3DRYA 2BM1A 3DI6A 4K2JA 2C2MB 5KT3A 4DI6A 1RXOB 2HGLA 4KQZA 4PWUA 3A8JA 2KHCA 2I0XA 4HHJA 3PB4X 5LYFA 1SL2A 2EKNA 5IM0B 2Y0MA 3PHTA 1HBUB 1TL1A 1Q81T 1IBMF 5HQ8A 1XR7A 1XQIA 1EAYC 2WVDA 2YTCA 2V8DA 1Q79A 3KLEB 3BR9A 1A2ZA 1TKHA 3C16A 3TRGA 2H51B 5A2QY 1NB2A 4KSEB 2KZZA 1XJWB 2WONA 2IA6A 4DV3J 2GA7A 5I0CA 5EWGA 3US5A 3FDSA 3MPYA 3Q8YA 1SKUB 3C15A 2QJ3A 1Y3JA 3JB9k 4NI2B 1UP1A 2CNNB 4BDPA 4H6UA 4FF2A 4MH8A 4NMLA 4J7CA 2FJVA 4CDIA 2B0GA 4DV2J 2HVIA 3KXDA 2BOPA 4ATNA 5E41A 4J9KA 4DV0F 2YWFA 4MHYA 3IEHA 2HMIB 4NCGA 2XB2D 2D3OR 4UF4A 3THPA 3HI9A 4KOTA 2MTLA 4DR1F 4OYBA 5BYRA 1WD6A 4KH1B 4XPDB 1KQKA 1G2EA 2OMLA 1HPZA 2LLZA 5AJ3J 3MM5A 4K4UA 2Q44A 1IR0A 2BMBA 1JB0C 1JLAA 5AG6A 3M6XA 4HHUA 4IH6A 1N48A 5IQ6A 3BREA 2PI4A 3AD9C 1NK8A 2Z3OA 3VR1A 5C24B 2MZTA 5F0WA 1KHVA 3T8WA 3Q8VA 3GSIA 4X4UA 4KR0B 5B0DA 3HM9A 4IK2A 1S5ZA 4ZN1A 4LF9F 4KLVA 5J1EB 2AGQA 1ZAXA 4KPCA 1Q8BA 3JYTB 2R1IA 4ZX9A 4A8QA 2D9PA 3NKYA 4M85A 2AGOA 2OH2A 1OJ4A 3OPKA 2KM8B 1BGXT 3BKUA 4TN2A 1EZZB 3CCQS 5D0GA 2PC6A 4B08A 2DO0A 4BHQA 3G2XA 5J2QB 1PSDA 2F5GA 4FPRA 2CJBA 1YK3A 2JRSA 5HJYA 4AXVA 4B3TJ 3HVTA 3BH6B 3SSRA 1VJQA 2GFQA 4YEAA 3PVXA 4NLSA 2MJNA 1TMMA 5KFBA 2IYGA 2Q79A 2BVZA 1HI0P 2YNCA 6FDRA 2EG2A 2D3UA 2K7JA 2CQ0A 2J8AA 2PQ8A 2E1RA 5I42B 1Z4UA 3TZZA 2L08A 4K4WA 4DR7F 2JLMA 3AAWB 4OFZA 3IWXA 2V4QA 5CNPA 5KTCA 1TUGB 2YNDA 2M70A 1MNEA 4X64F 4QWCA 4ZMMA 1NRKA 3EDQB 2R7HA 4ZLLA 3BGUA 4HNYB 4DMZA 3JRUA 2B4UA 4USWA 3P2FA 3VAHA 3BGRA 1XBUA 4WP8A 3NS5A 5HROB 1Q2CA 2DNZA 5LJ3Y 4R76A 3B4DA 1Z8XA 5B09A 4HACA 2OKQA 4CTAA 3S6GA 4DSLA 2ZDOA 3GYNA 2B4DB 4KOXA 4WPAA 2RRBA 4X4NA 1R6VA 5ELYA 4NWBA 2HIYA 4ZN3A 1FJCA 2QIFA 3S6EA 1R8CA 2AX0A 2UU9J 4MKAA 2FJBB 1NSAA 4CH7A 3NWRA 1DQ9A 3FCWA 1HBMB 1IOFA 2J0SD 4Y00A 4NZ0A 2XQCA 4DV4J 1WKJA 4MJ8A 4QJVA 1I94F 3QMQA 4P73A 1VFJA 3CD6S 2AEJA 2RH3A 2Y0SD 2DISA 3DM2B 4YHHF 1KOOA 3QPIA 4CM0A 2AYGA 1N6QA 3H90A 2W01A 1VHFA 2I38A 3IR7B 4RNHA 1LKZA 1HQEB 1X5SA 3V4IB 4HDGA 3QT7A 1FKPB 5L1IA 3FC9A 1FRMA 3RB3A 4KGKA 3CXSA 2C2ZB 4QWDA 3DOKB 1RWMB 1WWZA 1JKHA 4LF4F 5HQMA 2CG4A 1RBAA 1W2IA 3A8EA 4I2PB 4M3SA 1JLGB 2DCUB 1WWHA 2J8NA 2Q7SA 2GIFA 4PG5A 2EFOA 4DQIA 3BF4A 3CDAA 2IM0A 4O3NA 2CPXA 4U8YA 3DLLQ 2X1FA 4DXLA 2JEVA 4CYOA 4F0KA 1XTZA 5JXSA 1ZM9A 4UZBA 4CO1A 3LQVA 3DLKB 1S0MA 4UFWA 1AA1B 1K0VA 2E66A 2E5HA 1Q86T 3GIJA 3E01B 2ZC3A 4UOHA 5E7OB 2VA2A 3Q8UA 4K5RA 2CPFA 1VKCA 1U4BA 4X84A 3B8GA 5IB0A 2BJ3A 3MEDA 1SQHA 4F02A 4UEEA 3MFIA 3M8WA 2XMVA 1UKUA 1QM9A 4NJQA 5M2PA 2AF6A 2O28A 2MY7A 1UL3A 4X66J 1FNMA 3PP9A 2PT0A 1QUPA 3QAYA 2JNJA 2VC0A 2YY3A 3LH2S 1S60A 3DLBA 1X31C 3T9YA 5EGYA 4TU7A 3QIPA 3GJSB 1CM0A 2R7OA 5CZVA 1R3NA 1RTDA 5A76A 4OIXA 2AFXA 2RRNA 1FNXH 1WHYA 2X51A 3NH4A 3W6XA 4J90A 4EO6A 3R2DJ 2HVZA 4ILRA 1JMTA 3DDNA 4TLQA 4NA3A 1FRXA 1XF8A 2FIUA 3AQPA 3OJSA 4BBYA 1F1BB 2W2MP 5M2UA 1QY7A 1CC7A 4EO8A 3DGPA 4PSXA 3MPUB 5F8MA 4M5GA 1Y5IB 5IC4B 1JLQB 1HQUB 1KWMA 4ZK7M 3D4UA 2CDQA 3I1UA 3WX8A 2NREA 1W7WA 3OJUA 3QB8A 2PDAA 1Q16B 1N36J 2JBJA 2RHSB 4X4RA 3RRGA 1R0BG 2MQMA 2WVBA 2Z3LA 5KFEA 4FYDA 3F56A 5D3GA 4B9NA 2LQBA 5HN0A 2QC3A 3G6VA 5AG7A 1J5EF 2BANB 1CSJA 1ZPVA 1R0AA 2G0IA 3MZIA 4PWDA 3D6HB 4DV7J 3IU1A 3BGFA 3UD4P 1WC5A 1IQTA 5A8KB 4IR1A 3UCZP 1L3VA 3NOCA 4V19J 1T0TV 7AT1B 4F4AA 1A9NB 5HLFA 1K4JA 1IJEB 3NOGA 2JWNA 3ZZZA 2G0CA 5J1PA 2FVGA 1U48A 3LW5C 2C42A 2Z3PA 2JDJA 1TFWA 1Y7PA 5ETRA 5MAOA 1RB0A 4UCNA 3M8QB 5AXMA 4I7FB 5EMIA 1VIOA 3T5HA 2KT5A 3UN2A 3FGVA 1LCPA 4ED7A 4QOTA 5LSRA 4JI8F 3MUMP 1VRTB 4DFPA 1RWPB 1JQGA 4K7QA 1B4SA 2AFWA 3N0VA 4A8WA 2ALYB 4CCHA 3AQOA 1DTQA 1R27B 3OR2B 1FT8A 2DY1A 4CT9A 4DV1F 1FKAF 3HHLD 3CCRS 2DH8A 4B11A 2AJ1A 1VOMA 3PR5B 2AP6A 4MFKA 3V6JA 2J9CA 2Z4PA 3H20A 4PG7A 1N5SA 2ZD1A 2Q3PA 1FJGJ 3IO1A 3D7DA 2QGFB 2HKEA 1XMQJ 2DNLA 2PJ9A 4M6IA 4C8LA 4Y49B 4F0XA 1XOVA 2B4OA 2QYGA 2D4PA 2PJCA 4PK2A 3PCOB 2CQ4A 1BD6A 4EI2A 4P2SA 1UW4A 2D3ZA 3N79A 1IKXB 4E0AA 2G3AA 1C0UA 4JD6A 2CNOB 1HR0F 1ZPWX 4USJC 3FBUA 2ZM6J 3RU0A 1EB0A 1C1CA 4QYZK 4QU7A 3FNCA 2W24A 5KG4A 1Y7RA 3K17A 2PSWA 1YRTA 2ZXVA 2GVZA 1HYSA 3AA9A 3CDUA 3NGSA 1B3TA 3CDXA 3T19A 3R9EA 1CJKB 3TO6A 4X62F 2VBWA 3HHLB 4DF4A 3AFGA 2PC1A 2CF4A 4LF6F 2L9NA 3TAQA 2F8EX 4M5NA 4XO0A 4OQJA 3IC1A 4KFBB 3D2MA 1VQ6S 5HP1A 3IA0A 2HPUA 2M0GB 2DRAA 1LFPA 4AXJA 1TAQA 2X7BA 2WYRA 1R8HA 3MR7A 1UJ5A 3DYAB 4ZVFA 4TU8A 1S7FA 2EKYA 4PUOB 1ARLA 2YKNA 5GAHI 2VZYA 2DR7A 2BR0A 4U5YA 3POTB 3MM6B 3J7Z5 4NA2A 4CIOA 1HWLA 3R7BB 2Q4YA 1SB6A 3L09A 3D6MB 2UUCF 3N5FA 3PX0A 2A6MA 3R97A 3BPDA 3S8SA 5DDRC 1XK8A 4YN3B 2O66A 2NSBA 2MQQA 1ZYQA 3M32B 5EWEA 4OYOA 2XZTB 1TK5A 2AT1B 4Z7CA 4QU6A 4A39A 3OTCA 3QZ7A 3U7JA 2NCKL 4X2TA 3MEGA 4C0BA 3H8GA 1NPRA 3TUZC 2CQGA 1NXIA 2ZH3A 5DETA 4O4GA 2W2PP 1HD1A 4RU2A 3M30B 1UJ4A 1FFSB 4M5LA 4MK8A 3TQ1A 3H8EA 4JP8A 2VPWB 1KONA 2N3OA 3R8YA 1GXUA 1JLCA 2W1BA 4L89A 2MKHA 4MHZA 5AE3A 2VFSA 5CYQA 1Z8TA 2FQQB 4F04B 3CNQP 1S9EB 3OVBA 3OT9A 2G1HA 2AJ4A 1XEZA 3OXLA 3I9SA 3RBZA 1RP5A 1UMJA 5F8GA 3D3BJ 2YNHA 4UA3A 3FBEA 3LPEA 2RQCA 3P49B 1IIDA 4K2XA 5F41A 2Q0YA 3Q24A 1DJ0A 1N33F 5AG4A 4FZVA 2VHGA 1SJ1A 3DHWC 4WFAQ 2BE2B 5AG5A 5HSPA 4WP3A 1D0EA 3HMJG 1F9FA 4R57A 3T5KA 4DUYF 1YJWS 1YBAA 1VK8A 2V94A 3SI1A 5C7PA 3UDVA 2DHHA 1GH8A 3FSYA 3K58A 4OX9J 2DKOB 3PJXA 3DLGA 3CJ4A 4R6TA 4F0MA 3FVYA 2OLWA 5HBMB 2MKKA 1CPXA 1MWYA 2G4BA 4H4OB 1HHQA 4MY0A 3RBUA 4MI4A 3C46A 1JJ4A 3FVLA 2PE3A 5CA5A 1SC6A 2H3EB 3EVMA 1U47A 4B3SF 2VC1A 4ZVQB 4C2ZA 3UD5A 5IWAF 4DR3F 1CQMA 2HWHA 2F63A 2VG6B 1SPBP 1TV6A 4DX7A 2IAJB 3CJ5A 4PCQA 2G9DA 2HS4A 3WR7A 4LFAF 1Y0RA 2RD5C 3SV4A 3TUIC 3FK4A 2FJDB 3IWWA 4DR2J 4WU2A 3BSOA 1JWWA 4ANDA 3D2WA 2ZH2A 1FXRA 1NSKL 3QNVA 1S9GA 4CLTA 4FD5A 1N5TA 2J7WA 2QA4G 4C8NA 3R5JB 1DZ5A 2D41A 3A3PB 3W2WA 2RE1A 4L72B 2KO1A 2R7XA 2ILZA 2GQ2A 4C3MA 4ETZA 4CLSA 4K0KJ 4FWUA 1E6VB 4JYAJ 2FHJD 3JQJA 1D1UA 4FVCA 3GIIA 3QQCD 1RT1B 2OI2A 3Q89A 2LKZA 4K5SA 4JI7F 1TQLA 1O8BA 1Y9WA 3NMAA 1RT4B 4GO5X 2DHXA 1SL0A 2BE7D 3QRRA 2XSJA 1X5TA 2DGTA 4GXHA 2B4VA 1NHKL 2ZJRQ 2PJ5A 1Y00A 2LQJA 1NM2A 2F3JA 4RW6B 1DTDA 4AYBD 3J81j 3WIUA 1VC0A 2IRYA 2QLFB 3AA8A 3NBPB 3KK1A 2LYVA 5JVGQ 3IWLA 3EVWA 4NRTA 4USUA 2ZOFA 3HKZD 1S12A 2CPJA 2XCAA 2XNQA 5I3UB 3DLJA 4ZVEA 3MOJB 4L73A 3F41A 2E44A 1V9OA 3QIDA 1BAVA 4I0WA 2VFRA 2FLNA 2ATRA 1ACMB 4J3GA 2PFFB 1FDDA 5IT4A 1B0VA 4ZBGA 4C3LA 1S1XB 1LAMA 2DPSA 1KS2A 1YLEA 3V8IA 5M2RA 3TFYA 4N47A 1LQ9A 4KHPJ 2O5DA 2NS1B 2V4JA 4PXDA 1PJ5A 3CCZA 2MHEA 3CJQA 4O0NA 4U67Q 2ZNZA 4ECYA 2NYQA 1N5YA 4U9RA 4G6VB 1PJ6A 1IICA 4U6PA 4DV6F 3LODA 2R7QA 2E1AA 4I2QB 4MFBA 2EBEA 5IFMA 1S59A 2VKRA 3V5RA 4QUSA 4LSLA 1V5IB 4R7MA 3H5XA 2ZW4A 4C8YA 1WI6A 3T1YJ 2CTBA 3Q86A 1EE3P 5CYMB 4KH0B 4ID5A 4IO9Q 2UUAJ 4RW7B 4P45A 2UVRA 4USTA 3KLFB 4MFJA 4EBEA 1REVB 2YNIB 1RWKB 3QO9B 4UWIA 5DWMA 2AHOB 1T11A 2Z56B 2GO9A 3D6TB 3ILLA 2KXFA 4F4KA 2WSEC 4F4XA 3IMQJ 5A8WB 4QVTA 3OLAA 1XEBA 3NMRA 1G1XA 3MAAA 3CCJS 2B5GA 2EK1A 5CAAA 2J6SA 3JSYA 2CQ1A 3DMJB 4OLOA 2W9CA 1RWWB 1YW4A 5F8HA 4GKKJ 3GV5B 2Z58B 1M4GA 4Y2AA 5HXDA 3BN4A 3G82A 3L9ZA 4ICLB 1QQ9A 2BO9A 3DLHA 4HI1A 2DEJA 4CRJA 4JI0F 4LSZB 3GFXA 1BPNA 2G2YA 5DDOC 3CXCR 5KG2A 1DURA 3QSIA 3K2KA 1UAWA 2A4NA 1HNZF 5B08A 2C3YA 1TFYA 1WSVA 3UDLA 1TZ0A 4M63A 2BW7A 2KDOA 3B3TA 4DSKA 1X5PA 2E9TA 3TX8A 3JAMU 1C4AA 3LPYA 2XMUA 4P75A 4F9VA 3PRBA 4XDCA 2K5TA 3D54A 2VA3A 3MR3A 2RVJA 1Y9KA 2OFGX 4P4JA 2L9DA 4CM2A 4CLWA 3NNAA 1CX8A 3UN5A 2QA4S 3MWBA 2LQ5A 2R42A 4FYXB 1H2UX 1YJ7A 2GIQA 3FEZA 3K59A 3W2VB 2CQCA 2VFVA 1UWBB 3DGVA 4OP4A 1KBRA 4P4BA 3SI8A 2Q4VA 1F5BA 1P8GA 5F8IA 6FD1A 2R7SA 5DLFA 4LSNA 4C8ZA 2QECA 4YMEA 2CAJA 4OV6A 5KFRA 1JXLA 4DS5A 3OW2R 1VBXA 1OO0B 3R3TA 3ONQA 1RAHB 2LXUA 3ZC4A 3DI6B 3OR1A 2DJWA 2JEWA 1GX5A 3R95A 4DPYA 2ARHA 3KUHA 3KGQA 4ECRA 1WNEA 4XDDA 5J2MA 3CZXA 1RI7A 4CO3A 4Q5VA 1MG7A 1U1KA 2GZOA 2QA2A 1U2FA 1S76D 2C2EA 1X4EA 3THTA 4J9MA 4KAIA 2RT3A 1SQFA 1T9YA 3EZOA 1NLKL 2AV5A 2BKNA 3SI0A 2NLWA 5EX3A 4MY3A 2VL1A 4WK3A 2XI3A 5CHCB 2KHDA 2UVVA 5A6PA 2XY6A 4NLRA 5AT1B 3A12A 4OHWA 1QTMA 3I0SB 5B7WA 4UT4A 2YNGA 4OYXA 1HIYA 5FVJA 2AEFA 2IC3A 5HMYA 2AZ3A 5C42A 1AUGA 8RUCA 2DYAA 3R9LA 5GADU 4R5PB 1HNIB 2QFJA 3M2RA 2MKCA 3AXKA 1GEHA 1RISA 3RRHA 3VCDA 2XEFA 4HR2A 1FEEA 4HVZA 5BR8F 3BQ2A 3V2UC 4A38A 1YZ7A 4FXVA 4JV1A 2R2UA 3GLJA 2IVFB 2J0XA 2BXJA 2ERRA 1IBMJ 2O53A 2PJ1A 3BB5A 1RWOB 5KT2A 2NUUG 1FRHA 3VGUA 4GM5A 1ZA2B 2B51A 2WRMA 2V2ZA 3NS7B 3P5TL 5KG7A 4PKDB 3MM5B 3IN5A 3JTOA 3HJFA 5LXYA 4TKTA 4ZKAA 1PCAA 1IR1A 3IS9A 3PEHA 4AD6A 2DNPA 4PZVA 2XBPA 2YPZA 5T7LB 1Y4ZB 3NAHA 2LVWA 4IKAA 4OC5A 1FVQA 2VH7A 3H4BA 4MK7A 1D9AA 4U7UD 3HT0A 4DCJB 2W8LA 2ZFHA 4B9VA 3UCUP 2IRUA 1HWKA 4P74A 3CB4A 3OD2A 1JNZB 3CCMS 4DV0J 4MBUA 4B9SA 1WF2A 4DR1J 4RNMA 3HK2A 3T3FA 1R89A 1WC1A 2AJ6A 4NXMF 3TOQA 2J9DE 2WPXA 5F8LA 2I2YA 3HKWA 2AFUA 2J8MA 2MQ8A 1PBUA 4OZLA 3EO4A 4CI0B 3AXMA 4B02A 2AYEA 1FEHA 4JZ0A 2M8DB 1Q82T 4LMZA 4RBTA 2Q66A 1GHEA 1Q5VA 4P71A 3UVJB 3T41A 2P2CB 1NKBA 2HAFA 3MD3A 1DE4C 5KFMA 3BJ8A 2G13A 3FMWA 3ZXWA 1Y0YA 4QIGA 2CKWA 2H54B 4CAFA 2N4DA 5KFQA 1FDAA 2XYPB 1YVFA 4LF9J 4ES3A 2DCLA 3OTBA 5E3AA 1QSMA 3TAMB 2LEAA 5DS7A 5F47A 1LW2A 4RX6A 1KHWA 1YVOA 4CYNA 3LTOA 1DLOA 2DR5A 1AFJA 1JLEA 3DRSB 2RFHA 5ETOA 4V19X 1AFIA 4J9PA 1RWNB 4ZJQA 3MM9A 4M6GA 1FJEB 2MKYA 3FKBA 3HZGA 4NLTA 1N32F 1YLXA 2BJ7A 4CTAB 2UVUA 3WHIA 3CW2C 2ZWPA 4I4BA 4OHXA 3MN8A 2W7OA 4BLGA 5D0HA 3M8YA 3C6UB 1VC6A 5HL7Q 3KOAA 3VF0B 2OUGA 4NPOA 1Q53A 4H54A 4DEZA 2XY7A 2HNDA 3OSPA 2VBQA 4DR7J 2BJ8A 2VG7B 2AE6A 5GAEU 1C1BA 2YNFA 1HNVA 4X64J 3KKWA 2C6CA 1TR0A 4CLZA 2OPQB 3GTYX 4OX7A 5KG3A 3HD2A 4RW8A 4KV8B 4UZCA 1QE1A 4NEXA 4X4VA 3NH5A 4TNOA 1Z4EA 2YVSA 2APOA 2RQ4A 4ZY2A 2W2OP 2FB0A 2OP5A 2XCPA 1SQGA 4LUBA 3GIRA 1GYTA 2HBRB 4IUSA 2ZOGA 3RG6A 2OPRA 1WKLA 4WIIA 1MROB 4RUAA 3HSJA 2Y8YA 1X9MA 5LYIA 1KUXA 2PIIA 3FSXA 3KG0A 1ULRA 3Q0AA 4DFKA 4PABA 3BR8A 4OYWA 4B9LA 2AIRB 2WOMB 5BYSA 3H98A 3GYAA 2U2FA 2BEFA 5F0UA 2UXDF 3IWNC 1V3ZA 4LJMA 4OI1A 4ZOSA 2DNKA 4ILMA 3CJSA 4DN9A 3L3CA 1H73A 1I94J 2ZZNA 3VWDA 3FBFA 1B64A 3HP6A 4IAVA 4X65F 2IJFA 3TX0A 4YHHJ 5FIIA 3BGOP 5KFLA 3HHKA 3HDSA 4O3RA 2NSMA 3CGIA 1P9YA 3ZTQA 2DO4A 1RT6A 1H74A 2PI5A 2B6AB 1LWCA 4DL7A 1Q2DA 4E8UA 4ZGYB 2JX2A 2WCXA 4DZ6A 3QRQA 3FYNA 2MGZB 3KLIA 5D4LA 3VAGA 4LF4J 3BSCA 2EXUA 4CO0A 2B3VA 2QSFA 1TF9A 1IKVB 1BWVA 2GNKA 3TE4A 2RHQB 2BABA 2VIHA 4JI3J 3N5BA 2XLJA 4IOCQ 4ECVA 3K5PA 2F5IA 4PXCA 3W6SA 1SC4B 1FI4A 1AZSB 4F2RA 2HLTA 1J5OB 3K5OA 4R25A 1L3SA 3VAJA 3QIPB 4FF1A 1TIQA 3CCVS 4NEZA 3BH7B 2XEGA 1LV5A 4LBPA 4C3KA 2LDIA 2P9GA 3KQZA 1M5VC 4ID8A 4Q43A 1UPMB 2ACYA 1KTVA 1FWLA 4ECTA 4NYOA 1FWKA 3V6KA 3FEXB 3W1YC 3KK3B 3ZZPA 1O5JA 4DPXA 2I8EA 4WK1A 1KFDA 3EE3A 3M8PA 4Y6IA 1SBRA 3IFEA 1SH3A 1PO6A 2I9SA 4USHA 5F3TA 4DQRA 1VBYA 4YB6A 1RKJA 3PJWA 2CWKA 2VZ9A 2M7SA 2V8GA 4A94A 1NZAA 1HW9A 4CO2A 1UEKA 2VFTA 4NLYA 2QV6A 4XIUA 1T7PA 2VASA 4OYZA 4OJ1A 4G1QA 4YOEA 5IXUA 5EWFA 3U02A 1M4IA 2FGOA 3DDDA 3A1YG 2I3CA 5E2QA 4ZDNA 1JLBB 1F5CA 1BOBA 1MK4A 1KVKA 2NPFA 3MTJA 1WC0A 4DQQA 3MM7A 2GX8A 1N8RT 1M5HA 2XGPA 4L6V3 2FLPA 2NR0A 4P72A 2DH7A 1DQ8A 3TA1A 1I12A 4KHMA 2BV3A 3OTEA 2VV5A 7FDRA 1KVJA 4ES1A 1S1VA 1IYKA 1DQAA 2FJAB 2VPXB 1HA1A 1J5EJ 4RNFA 2CTCA 4NLUA 3VQTA 5KTDA 3GYXB 3I0RB 2GLFA 3UDEA 2GJ2A 2DVIA 2RILA 3BHXA 4KHRA 3JSMB 1ELOA 1LRZA 1DTQB 4WZMA 1S1UA 4NX9A 4OYAA 7CPAA 2N7CA 1SJFA 3IG1B 4RWWA 2RQMA 1SJ3P 1OS5A 2PCUA 2XYHB 3MUTP 2CZVC 4GRSA 3LO3A 3G9CA 3MDFA 4A95A 1DTTB 2BQ3A 3V6DB 5H9EK 5E3PA 3UR3C 4B5OA 2JSXA 1RHUB 3R1HA 4ZPBA 4O3OA 1RT7A 4JI8J 1OSCA 4LF1A 2B9YA 4M8LA 1U6MA 1FTRA 4L75A 5C88A 3AD7C 2AD9A 3TQEA 2LQ8A 2N4CA 1Q1KA 2RU3A 4XPDC 1BQXA 1RYRA 4DV1J 3EDRB 4DUKA 4ITSA 2MZRA 2CQ3A 3MECA 2RKIB 2HURA 2UXBF 4ZP6A 1VRUB 3OFFA 4XPLA 2HFSA 4P9SA 4JI6F 2YKMB 1LWEB 4HT5A 1CQNA 3C19A 1FCAA 2ADBA 4DG1B 3D1HA 4CYUB 4ZX8A 3HX9A 3HD1A 2W9AA 3RBDA 2HZAA 3H4DA 2KL8A 4URSA 1NAQA 3WDOA 2HFZA 5KAKA 2COLA 4F25A 1BQNA 3FEEA 4BMHA 2J6UA 1QJHA 2E9ZA 1CP7A 4L3KA 1U24A 2GGPA 1H38A 1HR0J 3NLCA 2GVDA 3GV8B 3IJ3A 3ISNC 4LRAA 3RO0A 2N7YA 1FNOA 4ECQA 1S6QA 2OR4A 4C98A 2V8HA 2GU2A 1EP4B 3H2VE 1YJUA 1KQSR 3W91A 4H2KA 3MGJA 2PFDA 1IQZA 1T3OA 2V69A 3PKYA 2VBZA 3IM8A 4KGXB 4I49A 4P44A 2BACA 4TU9A 2KN4A 4X62J 4RW9A 4F9UA 2BE9B 2J8SA 4WKRA 5IZHA 4LF6J 4A47A 2F4VF 1EJ7L 3B54A 3E2EA 3JVNA 4RZRA 2OEJA 1N52B 3UPFA 2DGQA 4P4DA 1XR6A 1B0TA 4YR0A 3PG9A 1G4CA 2RAQA 5DQHA 1Z5RA 3NGDA 1TKXA 2DXDA 3NGKA 2HHVA 3J7YU 3PY8A 3UW1A 2IDEA 3KI9A 2YWWA 3T5LA 4KLWA 2K3IA 4FNIA 3TWZA 4YDDB 1ZAWA 1RT3A 2QL7B 1RCXB 1M90T 3G8QA 1UFLA 2UUCJ 3J81Y 2W4PA 1S7LA 4G1PA 5CYQB 4PK3A 2ZVSA 2V63A 3NE7A 1U02A 4B6ZA 3GFHA 1WC4A 3D6FB 4LQ3A 3KLHA 2KJWA 4XPCA 4AL6A 1XERA 2GMLA 3HPOA 2AJ0A 3I32A 1CBXA 3OSNA 4M5HA 4BC7A 1T05A 2E7VA 2IY5B 3IGVA 5ADZA 1L3TA 2XZWA 4ZLPA 1X4CA 3H8YA 2M4MA 5HAOA 1BHNA 1SJ4P 3B7IA 1HDUA 3SXNA 4IUFA 3PGPA 1TKTA 3AOBA 2X1BA 1F57A 3CJKA 4E2AA 5GADI 2M5YA 4YUDA 1T03B 3FBBA 1PU9A 3CD5A 3KMQA 2DXFA 2E7XA 2Z2LA 3B78A 1VQSA 3CXPA 1C4CA 1ZM3A 3M6WA 3CMES 4J9OA 4L76A 2R8VA 2OELA 2MSSA 4ZIWA 3IRXB 1X4FA 2CNKB 2NUHA 2V9KA 2KTQA 3H5SA 1WOOA 2BEIA 2W25A 2PJ6A 3W65A 4O44A 2Q51A 2W8KA 4DFMA 2CVIA 4OHYA 1Y5LB 3B3WA 1N33J 4X5KA 4ANEA 3LUYA 4AVBA 2X3DA 2HHPA 3RR8A 3F5BA 4UOCA 2XO6A 4OMEA 4DUYJ 3UD3P 1QAIA 2Z11A 1SXLA 3CIMA 1YIJS 2ZW7A 4MK9A 1C0TA 1RAOA 3CWJA 4OZ1A 4ZPDA 3BM7A 3CTRA 2B5JA 3I87A 5DS0A 2VQYA 3H0PA 2OMOA 1Q7LA 3BZQA 3WC5A 3NCPA 1H7WA 4DL4A 1T9WA 1MMLA 1N54B 2XYGB 3WABA 2V77A 4I6AA 2DNMA 4CAWA 5DGAA 4B3SJ 3BGLA 2HRYA 3HHDA 4OX8A 2K7KA 1HBOA 4CAXA 3W63A 2RUGA 2P0WA 4OHVA 2Y9HA 1HBNA 1RA6A 5IWAJ 1Z8LA 4IH7A 4KGZB 4DR3J 1DAXA 1VDHA 2XSJB 1K44A 5KT5A 4ZY0A 3D28A 1P0HA 2GREA 4OYIA 1UCNA 2DR8A 3Q8PB 4WFBQ 2XM3A 1Q4RA 1JNRB 2GQCA 5K8PA 2KVIA 1SKRA 3CD0A 2RC4A 3GKRA 3HF5A 3E8OA 2DBBA 3D9BA 1WORA 2HHUA 1S4FA 4YY3F 1ZH5A 5IT9U 3DDKA 2Q7BA 4RNOA 2PJAA 1BLLE 2DNNA 3D1QA 3RBXA 1U6ZA 3CULA 3H25A 1U0HA 1CJVB 4U7CA 4KKOA 4JI7J 4KSAA 1WHWA 3LP2A 3MMCB 5L39A 2O3DA 3MR5A 4H4KC 5J1QA 5L9XA 3S6KA 1ZTWA 2FLLA 4IG3B 1BWEA 2HFVA 4WWSA 2P6TA 1D9FA 3KUGA 4X4TA 4QIEA 1VIXA 2J9AA 1S7IA 3EZ5A 4ZLNA 3M6UA 2Z0GA 2OPSB 2P6FA 5J2PA 3C6TA 1IWAA 3GB0A 1RTJA 1TL4A 2FPHX 4WFYA 4J5OA 4ALZA 5CCMA 1T9XA 1N5YB 4HT7A 4PAAA 4PYAA 5HVFA 4RW4B 1F2GA 3SBMA 2HFOA 1ON0A 2HS3A 1VJWA 3MI7X 4YWYA 5LRKA 5B0EA 4NGTA 3DOMB 4N8NA 4LSLB 4JV2A 4DX5A 3GCWP 4RS2A 3CC2S 4F50A 4IRKA 1B87A 4ID5B 1QMUA 3KJVB 2CUYA 5I3QA 1MSWD 3M8ZA 4MFLA 2NXUA 1ZM4A 4KOUA 2XZDB 4HPSA 3PACA 2BJ1A 5IM0A 5JM6A 1HBUA 4X4QA 3D0IE 1PC5A 2HNYB 4DPOA 5DWNA 3IWGA 3JQMA 4W98A 3MAAB 3KLEA 4OL8A 4DV6J 1H7XA 1RZMA 1S7HA 3K7RA 1SL1A 4AUKA 3CPAA 1NO8A 4ENOA 2DGWA 4NJRA 4DPUA 4NI2A 2HQDA 3CMAS 4OX6A 2NXEA 4A8FA 3C14B 2A10A 2DHAA 3OL7A 4Y49C 2MLZA 4UEZA 2XLIA 1YWXA 1F9EB 2CQPA 5RUBA 5KFOA 5DLGA 4CS0B 3L4BC 5DG9A 4N7TA 3NS6A 5HK4A 4O23A 2EFGA 3PW2A 2HMIA 2CG8A 3QLHB 3R5CA 4R8UB 1ZM2A 4OI3A 1HNXF 1SI9A 2FHKA 5K8OA 4K4ZA 2PIYA 3G96A 2ZC4A 2HZVA 3R6LB 2P8IA 4WCEQ 1RT2B 3GG1A 3R5AA 3P5BP 3HJVA 4JI0J 1L3UA 3CSKA 2HC9A 3FB3A 1H2VZ 3PRVA 3LGMA 5C24A 4M6HA 1RWUA 2LEBA 3KL9A 1FD8A 1V3SA 1HNZJ 2X3GA 4QQBA 3GPAA 2CNMA 3A9LA 1FESA 2MJUA 3UN3A 4NLGA 1RWVB 3KMSA 3B35A 3QGHA 3HFVA 4KPYA 1ZO0A 3VGVA 5ETLA 5J1EA 2BJEA 2ZOMA 2VI7A 4ED6A 1GTEA 3JYTA 1TTHB 5HANA 3SI2A 2VUGA 1YBTA 2FZKB 1F2OA 4QR2A 1MJAA 5K9FA 5E3CA 3ZZYA 2G9OA 5DGBA 3PEIA 1HD0A 4MT1A 2B8PA 2G2OA 2MKSA 1YJTA 3FECA 3GJTB 4Y28C 3AOCA 5J2QA 4C0HA 4C6AA 4UQTA 3PB9X 3FZBA 1M1DA 1TK8A 3B3VA 4WZQA 3KHRA 3N7ZA 1Y3KA 1IBLF 4P2FA 1JXVA 5FJ4A 3ZZUA 4C4WA 2IC3B 4DL6A 1CULB 2XS5A 2Y1JA 2NXJA 1QSYA 2OPPB 2NSCA 3TEHB 1WC6A 2D69A 4UOFA 2A0FB 4ZVRB 1H6KX 3ENAA 1WF0A 4ED5A 1IKYB 3R9FA 2B8QA 4PEOA 3WIVA 4P4EA 2R8JA 1FTCA 5HROA 4ZHRB 4I68A 4RNNA 2MDAA 1XRYA 3TTHA 2ZHAA 3BDEA 3PIPQ 3UWTA 4A8MP 1U45A 4F3OA 3Q22A 1Q0NA 3NA6A 1X4DA 2B4DA 2CPZA 1Z4RA 2W9BB 1REGX 2UUWA 1PIEA 2HB6A 3H5YA 1M4DA 2X1AA 1VMBA 2ZHOA 2M52A 4HKFA 2VJVA 5FLXY 3KZWA 4NYPA 1I1GA 2A6OA 1O6XA 3D5MA 3MFHA 1HBMA 4CYQA 4DF8A 2HS0A 4ERDA 3FBCA 3QYYA 1EETA 4KTQA 2XMTA 3PNIA 1KC8T 5BR8J 4U8VA 4C9DA 3HHNB 2R8KA 3DM2A 1SVDA 4YB5A 1T02A 1HW8A 4HH0A 1F2PA 2MHNA 3ZZ0A 3J80Y 1NK5A 1Q8KA 1HQEA 3V4IA 4Q8EA 1FKPA 1RACB 4OZ3A 3UFCX 4MIBA 2HHHF 2G0JA 3ISND 2GC8A 3DOKA 2MQPA 4G1IA 4LR9A 1KZFA 3BKFA 2M3DA 4I2PA 1JLGA 3CJTA 4DR6F 2ZE2B 4X4PA 4B17A 4QWAA 2ZENA 1ZG9A 3FQKA 5D29A 1LK7A 1NEEA 3EGNA 1R8PA 1FJ7A 4TY8A 3EVOA 1JLFA 4N76A 3DLKA 4ZVTB 3TC8A 2RQKA 1ELLP 2IBOA 4CNYA 3E01A 3M1VB 1YVKA 2XMWA 3FCVA 5IV4A 4L8AA 2ZJPQ 1BPMA 1UFHA 4DR4F 3IR6B 4UFXA 3W3SA 2IBKA 2UV8G 3H2LA 4NXMJ 3TAPA 4OZ0A 3GWCA 1DLOB 3I56S 1LWFA 1WG5A 5HJXA 4JBCA 3VARA 1X12A 2DNHA 4UUWA 2P6GA 1UVMA 5K14A 1TK0A 2F65A 4DUZF 2BQUA 1B7FA 4B3MJ 2BX6A 1RLDA 4HTJA 4K4TA 2Z8QA 2PEBA 1GMUA 4NE9C 1FWPA 1UFKA 1NJZA 2HHXA 5D4NA 3S9NA 1NU4A 1EKSA 1YJ9S 1YX0A 4PG8A 1HQ2A 1HFEL 3H7HB 3PJ9A 4IQMA 2NYHA 3OWCA 5D4OA 4DV5F 1RAJA 2VDIA 3D1OA 2DY9A 1FRIA 2XO7A 2RS8A 1CG2A 1MW7A 2OGUA 2QL9B 3CC7S 4RW8B 2R7VA 2L48A 3DHXA 2MY8A 2RF2A 1RDRA 2FC9A 1RAFB 2ZEDA 4RBUA 5KFZA 4G3IA 3DRRB 1N32J 4ZP9A 2LQ9A 2MSTA 1JLQA 2E5LF 1HQUA 2CPHA 3L7PA 3QZ8A 2PMWA 2QO3A 3LWUA 1YZ6A 3WC6A 5D0RA 1D3WA 3GJRB 2WBMA 2DK2A 4UY8T 4OI2A 2QYVA 1RSCA 2M88A 3FFIB 3J7YI 3C66A 4QZVB 4B9TA 4ZCKA 3TJ8A 2DR9A 4LQ9A 1VLYA 4E8OA 2BANA 2E7WA 1U2CA 1ZLHA 5A0YB 1RGVA 4JV5F 1QDUB 2CQHA 3WBZA 3LGHA 4C8OA 2EVNA 4MHNA 4QIFA 3BBFA 5A8RB 3K89A 1FDBA 1GTHA 2QL5B 1X9SA 1IYLA 4AT1B 2GCFA 1OYDA 3HFZB 3RNZA 4J9QA 5A8KA 2JZ5A 1KVIA 4FBEA 3MMJA 2LXFA 1NCLA 4EVYA 1QVGR 3ISXA 3S1TA 4LQ6A 1S6OA 2PRBA 2Q04A 4G65A 3MM8B 1QSRA 3R5GA 4HKQA 4WU3A 4YR2A 4CYPA 4O3QA 4DR5J 4KSIA 4HNXB 2QYCA 1GMWA 3M8QA 4X4OA 2XLKA 3RW6A 4I7FA 1FJGF 3CJ8A 2UXDJ 3FEDA 4DZDA 1UVIA 4YQWA 2YH0A 4CAEA 4QPTA 1YQHA 1VRTA 4X65J 1FE4A 1YX2A 2UVWA 2KKHA 2XGQA 2VJUA 3LP0B 1KP6A 2ABZA 1X0FA 2RJZA 1D8YA 2YNEA 2HQFA 2V50A 4OHZA 1KUVA 1LXNA 1TAUA 2XMKA 1IJFB 4QYZJ 2HW3A 3TZWA 4GKJJ 1M44A 3DU5A 3F44A 2F40A 3KKFA 4JWPA 1NSLA 3EXCX 1TP7A 2B3TB 1KQGB 1C2PA 2FD2A 4A4JA 4LRDA 4J9SA 1GX6A 3IP0A 3CCES 1U6FA 3FJUA 4ONUA 4ED1A 1IN0A 3I82A 3D3CJ 2DEIA 5DJBA 4P7VA 5LMUF 2DITA 3TR5A 3PFOA 4QBUA 3V38A 5J2NB 1UZDA 1ZG7A 2XULA 2E1MC 3D2PA 2BJDA 3DR8A 3PXGa 5FD1A 1S72S 1XNRF 1IXKA 3CCTA 4DSIA 4DUTA 5KG6A 4WXOA 3P3DA 3EGZA 3IAM9 1PYTA 2N3LA 4FF4A 1I3OB 5EX0A 4H6ZA 2YQ0A 2HHQA 4TY9A 1IKXA 3DNCA 2CZ4A 4DQPA 4JI1J 3OFGA 1RHJB 3MUVP 3E51A 2FLOA 4P2MA 1KSPA 2J7KA 3NP5A 4C7HA 4WFNQ 3MPWA 3AD8C 2VQFJ 4FP9A 4Q0BB 2KFYA 1A0OB 3EXYA 2HRTA 4UBRA 1CJKA 1SKSA 2ZH4A 1YJVA 1M5OC 3W8GA 3HHLA 4EMEA 3M2UB 2DHGA 5AXNA 3QAHA 1OBRA 3A8KA 2QLWA 4PSWA 3OTDA 2RRAA 4KS9A 2HBQB 5IV3A 1GMWD 2YWHA 3EGWB 3ETMA 4KFBA 4OMFG 5I4MA 3R1LA 1JIHA 5KFFA 1R0CB 1ELMP 2EK6A 1S9FA 4M5JA 4ELUA 3BBCA 4DNCA 4LF7F 1FKOB 1YRXA 3DYAA 3TT2A 4H4MB 1KQFB 1BC6A 2VZZA 4PUOA 4N5SA 2B58A 2VQEF 1SUQB 1WK4A 3MM6A 3MPDA 4FNHA 1XMBA 1O0PA 1FE0A 4C97A 4C8KA 3FMBA 4OLLA 2JC1A 2Q43A 2NXCA 1RKIA 1WKKA 1VQMS 3PEJA 4M5DB 1S10A 3AJDA 2B43A 4A2ZA 3GSDA 1E6YB 1P6TA 2FS5A 1UA1A 3K5NA 2BA9A 3BS9A 1U1NA 1Y0HA 2Z2ZA 2PJBA 3NG8A 1IKWB 2JL9A 3FRZA 3NL0A 2WW4A 4NLPA 1IBKF 2KYZA 3W5ZA 1SQEA 4KO0A 4C7IA 2DD8S 2DGVA 3MCOA 2A2DA 4FAIA 3CCLS 3R96A 2C2KB 4C7QA 1LFWA 3QGPA 4GC6A 1BLUA 4AL5A 2B9WA 3PO5A 2DPTA 4U9ZA 3M30A 2MZ1A 4P2XA 4NCBA 4DX6A 1OY6A 1IM6A 1AROP 2FHOB 2ZH9A 2CNTA 3S9MA 3MR6A 2AMCB 3DNSA 3UQSA 2OEMA 5DDQC 5K5MA 2PE8A 4NXYA 1X60A 3NWGA 3PRDA 2IA0A 1M1HA 4NZ6A 5ETTA 3OVSA 3SDEB 1VCTA 5E0OA 3GUXA 4C0OC 2PJ2A 5T41A 1T9VA 3OFHA 2BSWA 3UCGA 3IR5B 2AW0A 4P6YA 2LECA 5CYJA 1VHIA 1X8DA 4F26A 3KTQA 4LBHA 3SZ2A 2DGOA 1TU0B 2J9EA 2CRLA 5KOXA 2O4HA 3O2IA 4CGLA 4DL3A 1AB8A 2PIZA 1OY8A 4C48A 1VQ5S 2AJFE 2DXQA 3PB6X 1RHQB 2OJ3A 4PPZA 2BE2A 2KJVA 1TL3B 4MXUA 2FTRA 4UW2A 3AODA 2LXIA 1UVLA 4MHPA 4NGNA 3MMAA 4MMOA 4ZPCA 3DRPB 4JYWA 2IJZA 1FRJA 2Y3YA 1EQMA 3PIOQ 3KHXA 3I9ZA 1Q78A 2MQLA 5LYLA 2H4WB 4WBFA 3RRKA 2UXBJ 1RHRB 2C3UA 1P4NA 3QFWA 5HBMA 3W60A 3I55S 3EPGA 4JI6J 2B9EA 4H4OA 1U49A 1PILA 3QGIA 4TWEA 4CLUA 1FX4A 2YNCC 2QZ8A 1RTHA 3R7SB 1SCJB 2D3O1 3TOAA 1S1WA 3Q8SB 3NH8A 2QMWA 3MR2A 3TARA 3GY9A 4P7TA 2KZMA 1NSPA 2W7AA 5FLXU 3KK2B 2VG6A 5L1JA 4F3QA 3S6HA 2EO8A 2EFPA 4LIWA 5A2QU 4X2BA 1FK9B 1RUSA 1TKXB 4F3MA 5EN1A 2A3JA 1MMNA 2V8VA 2GS8A 4WJBA 1JJHA 5LL6d 2F4FA 5KFIA 3PYFA 1VQ4S 4QW9A 4OC4A 3TZXA 1WF1A 2FVCA 5G1ZA 3J80U 1E6VA 3LP1B 2WZNA 2MKJA 2ROGA 1ITPA 2AWZA 2XWXA 3PDNA 2OB0A 2EK8A 1NMTA 1TMJA 2ZZTA 3DOLB 4FXDA 5J8FA 4IG0B 4AQYF 4M94A 2RDJA 1OPZA 2EG1A 1M5PC 3FH4A 1IY7A 2CJXB 4EYHB 2ZBCA 3L2NA 4U7UK 4ZPVR 2BKOA 4F2SA 1HWJA 1EX8A 5ETKA 1R43A 4ES2A 2FDNA 4OI6A 4NXNJ 3KDNA 2PJ3A 5F3ZA 3D3SA 4RW6A 3TZYA 2CFXA 2IRXA 3NBPA 3BO4A 4DQSA 3ADAC 2KG0A 4KE5A 3OHBA 3GQCA 1SH2A 4KBIA 1RLCL 2WW8A 3ISZA 5HMNA 2ZEPA 3CJ2A 3SSQA 1XMTA 5I3UA 4MCRA 3LMSA 1J2VA 2ATCB 3O8WA 1RK8A 3U1MA 2QJ8A 5KG5A 2ZBPA 3BKTA 1RAGB 3D7FA 5AXKA 4WYWA 1YK9A 3MEKA 1KDNA 4GVBB 3NGTA 2JVOA 2FT0A 2VEZA 4OC2A 2BCOA 1SV5B 5GMDA 2HNZB 4EFDA 2YWEA 1S1XA 1S3ZA 2HAIA 4CLFA 3KASA 4NLXA 2ZEHA 2FHJA 4C11B 4PXEA 1YTYA 2H5IB 3I96A 2HV2A 1Q8LA 3KWMA 4NRUA 4KOVA 1CEZA 1TKJA 4EEYA 3VVUA 3LWMA 4IDKB 3TYTA 2P6EA 4CGNA 3WQPA 1TKFA 2KT3A 4B13A 5HVHA 2OFHX 4I2QA 2C3OA 4I6YA 1VLOA 2QG9B 4B9UA 2JEFA 4F4YA 5DO2A 1K8AT 1Z1ZA 2QX0A 5H9FK 3ETOA 4RWXA 1Q7LB 3A8IA 2QVPA 5ETQA 5CYMA 4LF5F 4NCAA 2QLJB 4RW7A 2FJXA 3R6GB 1REVA 2Z3KA 1CJTB 2B4BA 3QO9A 3DFEA 2ADCA 4W90B 3KG1A 4FPIA 2FL4A 3UR0A 5CABA 3DR6A 4B5PB 2ZDPA 2LP4A 4F4ZA 2M8HA 2UZAA 1B0PA 2FC8A 5A8WA 5LOQA 3DC2A 2IYIA 3M9MB 3TOBA 3E3XA 1HBOB 1CJUA 2GV1A 1GXTA 1KOHA 2CNLB 4P10A 3KLGB 3G8SA 2BYCA 4A37A 3FZ2A 2AU0A 1DARA 2CPYA 3T6JA 4EMDA 1QUVA 1KR4A 3DMJA 1CS4A 5AE2A 1HL6A 2XMAA 1KKHA 2V2KA 3OUYB 2V2QA 3MAHA 4URGA 2C27A 4A32A 5FDLB 4JI4F 1B7YB 1KNZA 4ICLA 1S77D 2J0WA 3UNYA 3VGSA 1K0TA 5F09A 3VWSA 4WE1B 1BQMB 2K06A 2UV8A 4UFVA 3P45B 4ILLA 2YKPA 3ITHB 2HIQA 4B14A 3FF3A 2OO4A 3CE8A 4DX8H 1AMPA 4OZJA 3W66A 1RE1B 2ZWOA 1SKWA 2KCWA 1D09B 2EFQA 4DL5A 3KNGA 3TNVA 1Q8IA 1GT8A 3PBEA 4F36A 4KKOB 4J91A 1F3FA 5BWAB 4I67A 2J7UA 4OJHA 3VV2B 1U1LA 4ZPTR 2K2PA 4KYZA 1G3OA 3SQGB 4WYLA 3OQ2A 4Y2CA 1W2BR 5ETVA 1BMQB 4DPTA 4LIRA 1YGYA 3SQOP 4FYWB 4C68A 2UUBF 1WUUA 1UA0A 1IUJA 1CC8A 2PGCA 3BQ1A 1VQPS 2YX1A 3K2YA 1QSOA 3HHEA 1S1TB 1RTJB 1RBOB 2ZKUA 3HT3A 6CPAA 4YY3J 2F1FA 2WSFC 1YGHA 1NH8A 4K8RA 5KG0A 2GJIA 3R1KA 3EGVA 4UUXA 3G6XA 1NMEB 4IFYB 5C25B 4QW8A 1SC3B 2HRUA 2B3UA 2EPIA 3PW4A 1WDDA 1NKEA 1TVRA 3AB4B 5DG7A 4CRZB 1Z2LA 1YHQS 1UEVA 1LANA 2DNYA 1X4BA 4BS2A 4MKVA 1EHWA 1OZPA 3KDOA 1BE4A 1FD2A 4DSFA 1U25A 1A7GE 1RA7A 2K3KA 1FX2A 3AHPA 2NQPA 1RO5A 3G3SA 3PX6A 3I5AA 3PFEA 1GQEA 2Z2YB 3I0SA 2HG4A 2J6TA 3PW5A 4CH1A 1WHVA 4QC6A 3ZTOA 3BJ7A 4E2FB 4OYMA 1FRLA 4R5PA 1HNIA 2QLXA 2HK3A 4NGPA 4F6AA 2IM1A 4ZCLA 1S97A 3M2VB 2FUG9 1YSJA 3P4UB 1L0CA 1MU2B 2H5JB 4CZCA 2HEKA 3QWPA 2O1PA 1HWUA 2HQCA 5KT6A 3BI0A 2B9XA 2R9LA 4GC7A 1FERA 2GAGC 2CZ9A 2ROEA 4LVOP 4CLYA 1M5KC 1KLMB 5HVGA 3PO4A 3KJNB 3BXMA 3OXGA 3ZZRA 3RTVA 4XPEA 1S6PB 2VF3A 1W26A 3OL8A 2C6PA 3L95X 4NCZA 5DG8A 2XMMA 2R8GA 1X4AA 2HZCA 5LMNF 1NZ8A 4JB8B 1QSLA 5C82A 1Q5YA 5G0RA 1XIXA 5T7LA 4CNZA 1WOSA 3QAUA 6AT1B 4TXSA 1FFWB 2P9CA 2W2QP 4LRCA 4N77A 2HSEB 5KFUA 2AFOA 4B3RF 3BLNA 2J5AA 2C28A 2OTJS 4I56A 4UCPA 2NZCA 4JI5F 4ED2A 1R8AA 1HNXJ 2E1CA 2CQDA 1RTIB 2PJ7A 4FF3A 5HO4A 4MHDA 3C26A 3HSZA 3M4XA 2I00A 4DL2A 2L41A 5D77A 2YWGA 3EY5A 1WEXA 2DNGA 3H42A 1F6TA 4MCQA 4LUAA 3UE2A 3LANA 1YJNS 2LFVA 4QB9A 1NK6A 3N6LA 3UVJA 4O0IA 3KHZA 3MEEB 2DR6A 3B6BA 1TXRA 2AEMA 4ZIVA 4R3KA 4ED8A 4EU0A 3OL9A 2KB2A 3DSBA 5L9NA 4OC0A 5KOWA 4KIAA 5E96A 2I5JB 1X0PA 2FZGB 2ZELA 3TAMA 2D74B 2OU2A 3K5MA 3NAIA 2B4PA 3DRSA 3VH9A 4ZCIA 3TANA 2Z0ZA 5DQGA 2BBEA 5GCNA 2VB6A 4QWEA 3I6PA 4KB7A 1Y9OA 2ZBQA 4QPXA 3D7SB 2V6AA 2WVFA 5K8NA 3TA2A 3OVAA 3RR7A 4LT6A 1IBLJ 3GMGA 3N6MA 4JXRA 3C6UA 3MCSA 1KRPA 4USKA 4NA1A 4K30A 4ZVHA 1TL1B 3LAMA 2R2SA 2VG7A 2RB7A 5F8JA 4YRHA 1Z2ZA 1VQ8S 3C16B 2JDCA 5IQQA 3LA0A 4NF1A 5HH1A 2WONB 4OJ3A 2OPQA 1VS3A 1S0NA 3I5BA 1EETB 1K9MT 4KV8A 4QIWD 3C15B 2MQNA 2QMXA 2WZ1A 2JFKA 1YLOA 3T5JA 4WTOB 1VC5A 2CJQA 4R87A 3R2CJ 3EYZA 3GCXP 4X3RA 5KFDA 4ZS6A 4DDFA 2JLFA 3GP9A 4FVMA 2LMIA 3ZFVA 2MLXA 2CY2A 4DU8A 1HWIA 2XTJP 4LQGA 2ZH6A 2AGPA 1MROA 4USVA 3PZPA 4IYQA 4EYIB 3AJ1A 5JQ4A 4C2MA 5KFXA 4OZ2A 2PJ8A 3VAMA 4NCGB 2C3PA 1XMOF 1X10A 1TKDA 2ZEMA 4ZA1A 2WOMA 1YW6A 3HUVA 4JJXA 1HDQA 3K9TA 5D4PA 1HPZB 2D9OA 3FUYA 4ORFA 2FVRA 4TY8B 1JLAB 1Y7EA 2ILYA 4ZP8A 4JI3F 1JLFB 3NE8A 4HLBA 4MIWA 1YITS 3F0AA 3DU6A 3KFWX 1N0VC 3T1AA 4LRBA 2ALZA 1RTZA 2QSWA 3AH6A 2J0QD 2OAUA 4TNUA 1FXDA 2B6AA 3Q8QB 4OZNA 3Q2SC 3QATA 2HHHJ 1GNKA 1S0OA 4NGRA 2EFVA 4KRWA 5K20B 4DHVA 2MGZA 1OQ6A 4B3OA 4IRCA 1BY9A 3FJ2A 4DR6J 4OADA 1LWFB 1N88A 2XY5A 2NMTA 2JH3A 4X8IA 4U95A 1IKVA 3F73A 3ET6A 4TQSA 5KG1A 1FFGB 5K14B 1Y5NB 1UVJA 3GG0A 2C3MA 1J4JA 2CXEA 3RB0A 4CGPA 1AZSA 2PVVA 2CJ9A 1J5OA 1NHUA 2J9DA 4KSFA 1NHVA 1UZHA 2VICA 3HVTB 3TJ9A 1NJXA 3L7OA 4L3NA 4JI2F 1XWLA 3EM1A 4DR4J 2PMHA 2CJAA 5B0CA 5KT7A 4NLDA 3H2UB 3IGNA 2VFUA 3S01A 4OC1A 1WC3A 3OXFA 1S57A 4HI2A 4CLKA 4AG7A 2RF2B 3KK3A 1U1PA 1TKZA 1UJ6A 2KG1A 1Q7YT 4Q2LA 2PVWA 2YKAA 4ZJLA 1VQLS 4DUZJ 3P2HA 3TO8A 4USIA 5AXLA 3KYLA 3VAIA 3BGRB 1CBKA 4A8YA 4TYAA 4HACB 4YR3A 4DWIA 2DRBA 2HYIB 1TL5A 3M9NB 2IMWP 1CPZA 2JLEA 4DV5J 3PM9A 1X4HA 3FSIA 3VZIA 2GFFA 2VDHA 3H5UA 2HFUA 2XSFA 4NASA 3MXHP 5JJBA 1JLBA 3QJPA 3IIBA 2BOAA 4KVOE 1LXJA 2F8MA 2Y1RI 3G6YA 4J9NA 3T1HF 2BZ2A 5JGFA 4NYZA 3BPSP 2Y1LB 3NCRA 5H86A 2R2RA 3LACA 4RR5A 2E5LJ 2WTFA 4ZPWR 4MTPA 1I51B 5H9EJ 1N6QB 1N34F 1ZS6A 2BW2A 3RUBL 2XS2A 2F9JA 4KGMA 1NDPA 3JAMY 3VWEA 4ONWA 4R0JA 1H8LA 3A4TA 2DH9A 2ODFA 4J9UE 3KJQB 2R7UA 3TO9A 1WELA 4NLVA 5DM7Q 3GONA 1JKHB 4Y2MA 8AT1B 4JV5J 2EWHA 1IWGA 5KFYA 3J7ZT 3I0RA 3KUEA 5SUHA 2R2TA 1M0SA 2GLJA 2PA8D 4AB7A 3JSMA 4JUZA 3VGTA 1YRUA 4ZITA 5KFCA 3ILJA 2IJRA 2P6SA 2R7TA 3IG1A 4CO5A 5KFKA 4NLWA 1MMDA 5LM7E 4YB1P 1VQ9S 4WF9Q 5CD4H 2V67A 3NCQA 4P4FA 3KNAA 1WACA 4MYTA 1DTTA 3V6DA 3RJMB 3A13A 3DLEA 2GANA 3K9UA 2GIRA 4N41A 2JOQA 3QJJA 3JTKA 3NRBA 2D7SA 3VATA 3MEDB 3RBEA 5D78A 4YU9A 3K57A 1K1SA 4PQUA 1S5KA 4ECSA 2G2ZA 3SSSA 1WG4A 8CPAA 2MKIA 5C2GA 5KFHA 2AYBA 4F8RA 3ZNJ1 3OTOF 3I31A 1PYTB 4W4MA 3T9NA 5E33A 4I69A 4FD7A 3V81A 4RU9A 2VXKA 1CVJA 1Y11A 3W8PA 2XEIA 2RKIA 3AJ2A 1G6BA 1RTDB 3MCNA 5CCLA 2BQRA 5L8RC 5LMUJ 3PR4A 3CVKA 1VRUA 1PYOB 2V4RA 4R8FA 2WVEA 4C8MA 4P52A 5JVHQ 2YKMA 1LWEA 4HL9A 4O3SA 4DG1A 4LR7A 4PV6A 3H59A 4CYUA 5HMWA 1H98A 2FGCA 1XNRJ 2EUIA 1RXTA 3O44A 1NE9A 1QSNA 2HBZB 4ED3A 3DGPB 2KFNA 4J9LA 4PG4A 3LALA 3CDWA 2VBXA 4EFAC 2CDRB 3D7GA 1NNDA 2PD1A 2I79A 3LGNA 1LNQA 2QT7A 3GIUA 4KUAA 2JLGA 1S6UA 2CA9A 3ICLA 3R5BA 2RDDA 2JDDA 2BUNA 1PAEX 3JSBA 4PPDA 3PB8X 5LRJA 4CPAA 5HMZA 3GFYA 2YPYA 4Z7YA 2HHSA 1EP4A 4A31A 3ILIA 1IVZA 5D3GB 5ITHA 2DT9A 1SJQA 1VI7A 3X1LB 4II9A 3ULHA 2W4CA 2HK2A 3CIZA 4IFVA 2HWTA 1R0AB 4PWDB 2BL1A 4OIDA 1NDKA 4WP9A 3CD7A 3HO1A 2EC0A 3N28A 3PBBA 3I5CA 4QR0A 4XTTA 1JK9B 4J9RA 4CRYB 2BDPA 1NH7A 5HLFB 3BJYA 4LF7J 4ZVOB 4KO0B 1NSQA 2LU1A 3HXMA 3MPVA 2UXCF 1RT5A 5T14A 2VQEJ 2BRLA 2Z3MA 5KT4A 2QEXS 5B0FA 5KTAA 4NGSA 4S0MA 2PR1A 3GR0A 2QTWA 4BCAA 5AE1A 1XC9A 1KLNA 2JEGA 2L9WA 2OHDA 5KTQA 2HVDA 1U7LA 2A18A 3TEGA 2FJEB 3OFEA 3B8HA 1IBKJ 2AFMA 3AY0A 4UWJA 1B6BA 3ENWA 4Q44A 4M5IA 4KT0C 3UDCA 3HVRA 2QA1A 3VZHA 5GAGU 3SIPB 3G87A 3D8PA 3NY0A 2IM2A 2AX1A 4RUHA 1U8WA 1LOKA 2ZD1B 4B9MA 2Y0BB 2KRBA 2ZEJA 1S0VA 4LF8F 3RAQA 2OD4A 4MFPA 2M2BA 5I3PA 1TL7A 1T03A 3CF5Q 3FXTA 2FSRA 2FIWA 5CPAA 4F0YA 4DYOA 3MMAB 4NMXA 4Z65A 4DBQA 4BD9A 3SHPA 4WFXA 4KVME 4BINA 3JS9A 3IRXA 4OI4A 1DBDA 2K1RA 1IU8A 5IS2A 1C0UB 1S7KA 4B10A 1OMSA 1OSDA 2RS2A 1C1CB 4LFCF 2RSQA 3SJXA 4TVAB 1RTHB 1S1WB 5LSLA 2GVZB 1HYSB 2HHTA 2SXLA 1ZBTA 1M1KT 1PAUB 4A8KA 2DNQA 1X4GA 1XJOA 2MZSA 3GR1A 3FIXA 3D67A 5D8HB 3DDIA 2XMJA 5EHHA 5G22A 4DL0C 3VTIA 3VAFA 4KY3A 3OHAA 1ZA1B 5H84A 1QAXA 3PYGA 5CD4A 2IPOB 4L74A 4MCPA 4CGOA 1EKRA 5HP1B 4A30A 3KR5A 3THVA 3A3NB 1M5SA 2WAQD 5E3QA 3CUNA 5DRKA 2CVEA 3BEGB 3D7HA 5GMKa 4AFFA 2NYIA 2YKNB 2J76E 3MMBA 3QT6A 5ISVA 3G71S 3MOZA 1MJ9A 4RUCA 3U1LA 3N01A 2IIHA 4FD6A 3G4SS 2FVQA 4OIWA 2V5HG 4J9VA 3PV8A 1QSSA 1V0CA 3ENVA 3SV3A 5F49A 2CWXA 2DGXA 3FNNA 4HTIA 2HVEA 3O1LA 3PHEA 5L38A 3DN9A 3IBCB 2XNRA 4D3GA 4F67A 2VONA 3QSYB 3EZUA 3G86A 4Y2KA 3OLBA 5C2CA 4Z37A 2HGMA 2DHSA 1PYSB 1YI2S 3HLUA 2OH1A 2IM3A 4FN5A 1Y10A 3PTWA 4LRFA 1CPSA 2JJ4D 4ECXA 4H89A 3MEGB 3SEOA 5THWA 4O4GB 4OKOA 4AQYJ 1CJVA 1PC4A 2G3TA 4GO7X 5G20A 3PRTA 3MMCA 2ASYA 2P5VA 3W9JA 5JUMA 2PRQA 3B4MA 3GE9A 4FD4A 5A27A 2E5IA 1JLCB 2BKPA 1WTFA 3KJFB 5E5NA 4IG3A 1FT7A 1ZZNA 1U1RA 2CNSA 3G6ES 1CJWA 4NGQA 2R8IA 4DS4A 1S49A 2OPSA 5IOLA 4YFUA 1UWYA 3FCHA 1RYSA 4PR6A 2B56A 2GHPA 4ELTA 4NZ7A 4OLPA 1BO4A 4RW4A 4W92B 3W5XA 2YNHB 5A6WA 4LR8A 5SZTA 3HCXA 2LDYA 2VODA 1RAIB 3OL6A 5LJ5Y 3DOMA 2ZH1A 1Q2YA 4MRIA 4DOZA 3ZZOA 1I6JA 3RGIA 1HLWA 2V9WA 2HQ3A 1SIWB 3RYOA 2R7RA 2V68A 1ROFA 2GO8A 3CCSS 2W2NP 3KJVA 1F3VA 4UTGA 1VBZA 4DSEA 3C3LA 5MLCV 4ZY1A 4N8OA 2ZBIA 5CBMA 3DLGB 4AVCA 1H2TZ 2WB1D 4W9YA 2AJ2A 2HNYA 1ZETA 3VVTA 4RI1A 4ZYQA 4Q8FA 1CJUB 5KFWA 3ZTRA 1FA0A 1LW0A 4ANCA 3TUJC 4R3LA 4I1TA 1IB1E 1YBUA 4Y34A 4KJIA 4ETXA 1CS4B 1NK7A 4Q38A 4IO1A 2D4OA 1NPPA 4Y0FA 1TF8A 2A2CA 4RLEA 1HEEA 2PEHA 3CJRA 3C14A 1YMEA 1TV6B 4LF5J 2OEKA 1XNQF 3I4PA 2DPIA 3HVAA 3BSAA 1PKUA 4Y2IA 3VAKA 2ZEFA 1UVNA 4ZP7A 2MZJA 3ZNUA 2H65B 4IOAQ 4UEFA 1V5VA 2L3MA 4F8ZA 3MF5A 3W9IA 3EFAA 1S9GB 1NDCA 1MWQA 3QLHA 3PYDA 2CQBA 3W2WB 1OWXA 1WG1A 4F0HA 2LA4A 4R8UA 2RIJA 2ABYA 4MKBA 4A8OA 4KOYA 2GQQA 3TP2A 1DHMA 3PYEA 4Y65A 4CP5A 3TVZA 1LOUA 3CCWA 2UUTA 4LFBF 4JI4J 1RT2A 4I6WA 1NDLA 1IR2A 1HMVA 1HNWF 1PG5B 1ZTTA 3LF0A 1U6BA 4LFAJ 4ZJOA 2B7CB 1IM4A 2ZUGA 1VQYA 4EBCA 1XFOA 2PDOA 3R7NB 4WKYA 4WIQA 3IGRA 3QAEA 1V6HA 1T95A 2VU5A 3UNGC 3KK1B 3D0GE 1R7IA 1QSTA 1FHTA 2J8RA 3SCLE 3JUWA 1S7NA 5KFTA 4YFJA 1UTAA 1VYAA 1TVRB 2X7IA 1AW0A 1YQEA 2DIVA 3M8RA 4RBVA 2IL4A 2O67A 5B0BA 2UUBJ 1UVKA 4F4WA 2V2VA 5KFNA 1JJ2R 3SFUA 4BBHA 3GV7B 2WPWA 2IMOA 5F48A 2MLYA 5IC6B 2EBJA 1EARA 5CZXA 3I9V9 2VOPA 4FYYB 2FY1A 4ECWA 2V8PA 2VG5A 2IVMA 2MZQA 2V4JB 1MWZA 3VHQA 2CJKA 1CULA 2GMJA 2PJ4A 2OPPA 4QIVA 2ANPA 1VHOA 1RAEB 1YR0A 1IKYA 5DZ6A 4Y3CA 3ELHA 1WEZA 5KFSA 4DV3F 2C2OB 5L1LA 3VALA 4UCMA 4MFBB 5IT0A 2N82B 2JBKA 4QCLA 1UEUA 2WK4A 4TQRA 4ZHRA 4MAKA 2ROPA 4E98A 3MAQA 1KFSA 2OIHA 1M1GA 1SH0A 4DV2F 1H72C 2W9BA 2VD3A 4ZVPB 2CPEA 3GIMA 3FX6A 1WHXA 3D68A 3EMTA 2H48B 8ATCB 1ICEB 2KXNB 5HMXA 1RABB 3BSNA 1WOPA 4PWWA 3IBFB 5DQIA 1QTNB 3W9HA 3PZJA 3PW7A 2EBGA 4U9YA 2GAHC 2JVRA 5G0RB 2B5GB 1RU1A 3IU2A 3MD1A 5A28A 3F8KA 1PUAA 2W9CB 5AJ3F 2JEJA 1F5AA 1RADB 3W64A 3BYRA 3LAKA 3X3UA 3KR4A 3CXQA 3G82B 3RYLA 5CXTA 2CPDA 5F9LA 1MLAA 3UY5A 3K8VA 2QN6B 9RUBA 4XPKA 2OSRA 3IM9A 2CXAA 3V7ZA 2EK9A 5LMNJ 3TA0A 4ZVSB 2RDIA 1NK4A 2C2DA 4JLYA 4RUBA 2IFXA 2ZH5A 2ZE2A 3B82A 2MB0B 3T90A 4XAKA 5DZ7A 2ZW5A 3SCKE 1SJRA 2W7PA 3NGRA 4IRDA 2C1EB 2YWKA 4B3MF 4XNHC 2WHOA 2Q6CA 2JFDA 2FE7A 4B3RJ 3IXQA 1B99A 5K8MA 3D66A 4FYVB 3M1VA 1AT1B 2ZEEA 4B3TF 1WI8A 2CJYB 4JI5J 3M9OB 2YKOA 3FMCA 4A33A 4BC9A 4LSNB 5ETMA 1KN6A 4EBDA 2WSCC 1NJYA 4QYRA 3N6NA 1CP6A 2AKWB 1SIZA 3S9LA 5ETPA 1HHTP 1LK5A 2CADA 4DSJA 2GJFA 2PMZD 3OR1B 1T8EA 2MQOA 1LEOA 1O51A 5IX3A 3C8YA 4RL1A 5LRGA 2KU7A 3W62A 5J2MB 1H0HB 2YX4A 3TI0A 4PRFA 2I1RA 3GILA 4M95A 3J7AN 4U96A 1WJ9A 1YJRA 2ASDA 2C22A 1Z9UA 2QLBB 1WTBA 3MRUA 2FY8A 1X7VA 4NFRA 1P1TA 4BWJA 1QVFR 2REFA 2CQIA 2YNGB 3U1NA 5GMEA 2LU2A 5EC4A 3HSDA 5C42B 3HFKA 5I42A 4ZVUB 3B3CA 1ZAVA 3IRWP 2H4YB 2UU9F 2ASLA 1L5UA 4M1KA 1EQ0A 3M2RB 4MKYA 1P9QC 3F0NA 2OOTA 4OZ5A 4K4SA 3DRRA 1ZOTA 3RAXA 4DV4F 3NEKA 4YS2