3CT9A

Crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
353
structure length
346
Chain Sequence
YDIPTMTAEAVSLLKSLISIPSISREETQAADFLQNYIEAEGMQTGRKGNNVWCLSPMFDLKKPTILLNSHIDTVKPVFTPREENGKLYGLGSNDAGASVVSLLQVFLQLCRTSQNYNLIYLASCEEEVSGKEGIESVLPGLPPVSFAIVGEPTEMQPAIAEKGLMVLDVTATGKAGHAARDEGDNAIYKVLNDIAWFRDYRFEKESPLLGPVKMSVTVINAGTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNSSRIDEKHPFVQKAVKMGRIPFGSPTLSDQALMSFASVKIGPGRSSRSHTAEEYIMLKEIEEAIGIYLDLLDGLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative Zinc Peptidase (NP_812461.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.31 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
molecule keywords Acetylornithine deacetylase
total genus 101
structure length 346
sequence length 353
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ct9A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ct9A01
3SJXA 3CDXA 3B7IA 1HDUA 1BPMA 3KZWA 4FUUA 2HC9A 4LQGA 4MCQA 4YU9A 2V8DA 3S9MA 1YW4A 4A94A 2ZEGA 7CPAA 5HXDA 2BOAA 4MXUA 4UF4A 2AFUA 2PJ2A 3CPAA 2ZEHA 2CTCA 1ARMA 3KQZA 4G1PA 4FWUA 3RAMA 3L2NA 2PIZA 2PCUA 1H8LA 1CP6A 4AXVA 3IJ3A 1CPXA 4PQAA 2ZENA 4P10A 4R76A 3S9LA 1PCAA 3PB4X 2NYQA 2Q51A 4MCRA 2AFXA 2EK8A 2PVWA 3GLJA 3VH9A 4X2TA 4ZYQA 3RBUA 4A39A 3KASA 1QMUA 4MHYA 1GYTA 4NFRA 4WJBA 4R8FA 4O23A 3K2KA 1ARLA 6CPAA 3IEHA 1VGYA 4OC1A 4JZ0A 1VHOA 3KR4A 3T8WA 2CIJA 4FBEA 4A38A 4WWVA 2QJ8A 3LMSA 3D66A 2PJ5A 5F09A 3ISZA 2ZEPA 3N5FA 4W9YA 4A37A 3HLPA 2C6GA 1Z2LA 3WC5A 5HVFA 2PJ0A 2PVVA 2PIYA 4P44A 4ZY1A 3CPXA 2PRQA 5CBMA 1PYTB 2CF4A 3FF3A 1TKFA 3WABA 3MRUA 4NGQA 1ZLHA 3BHXA 5THWA 4F8ZA 3B3SA 4MMOA 1TKJA 4OC5A 1TF8A 2XEIA 5K8PA 3KR5A 3WT4A 3K9TA 2PJ4A 2EK9A 4BD9A 5D8NA 5K8NA 2V8GA 3RZAA 3PRTA 4CPAA 3GUXA 3NH5A 1ZLIA 4PXCA 1DTDA 5LRJA 4K3NA 3WC7A 3PBEA 2RB7A 4Z65A 1CPSA 2JBJA 4NGSA 5K8OA 1YMEA 4P4DA 3VATA 3NH4A 2ZEFA 3IC1A 4OKOA 1IGBA 4MRIA 2JEWA 5LRGA 2O4HA 3B2YA 1EE3P 3FMCA 3VARA 1CP7A 2BO9A 2WZNA 2HB6A 2RFHA 2FVGA 4NGPA 3PBBA 3LWUA 4NGNA 1IY7A 3B3TA 1Z8LA 4MHZA 5LYDA 4RUHA 2BCOA 2PJAA 3KHZA 2PJ3A 4UIBA 1XMBA 2QYVA 3H8GA 4OP4A 3SI0A 3KI9A 3D4UA 2OR4A 3TC8A 1Y7EA 2PJCA 2ANPA 2O53A 3HUVA 3B3WA 3KGQA 4YWYA 1ZG9A 2PJBA 2JBKA 4UEZA 2GLJA 3SJGA 2NSMA 4MCPA 3FH4A 4R7MA 3S9NA 3H8EA 5ELYA 1NSAA 4P4FA 4DJLA 3D68A 1XFOA 2PJ7A 3V7ZA 2ZEMA 2G9DA 2V8HA 1HDQA 5JH9A 2DEAA 3BI0A 3IFEA 3KL9A 3D7GA 3FX6A 2PE3A 1LOKA 4EFDA 1YW6A 1JQGA 3PB9X 1LANA 2Q4ZA 3I1UA 2ZOGA 1Z5RA 2ZEEA 3FECA 3B3CA 4R6TA 1XRYA 3WC6A 3QNVA 1R43A 4KSIA 3D7DA 1LAPA 2GLFA 3PB6X 4OC2A 2XEFA 2XEGA 4NGTA 5JGFA 3KQXA 1BAVA 4OIDA 1M4LA 3IO1A 2F7VA 1ZG8A 3D67A 1XJOA 3PB7X 3KHXA 2IQ6A 3B35A 2V77A 4IHMA 2CTBA 3PFEA 3SJEA 1LAMA 3DLJA 1CX8A 4PXEA 4OMEA 2AFZA 5HVGA 4ZY0A 5I4MA 3D7FA 4MHPA 4UEFA 3FEDA 1YSJA 4F9UA 2ZELA 5LYIA 5J1QA 3GB0A 4OC0A 1TF9A 3ISXA 4NJRA 2C6CA 3V38A 3MN8A 2VL1A 5LYLA 1DE4C 2ZEDA 4JYWA 4P45A 1Q7LA 1KWMA 2QVPA 4NGMA 8CPAA 3JRUA 3PEIA 1BPNA 1OBRA 3BXMA 4OIWA 4ZX9A 4X3RA 4PXBA 2PJ1A 3NFZA 3NH8A 1F2PA 4GM5A 2IMOA 1Y0YA 4IAVA 2AFWA 5JM6A 4ZI6A 1Y0RA 4TWEA 2ZEOA 3FEEA 4PPZA 4Q7AA 2EWBA 3IIBA 4P4BA 4DUKA 4MHNA 1LCPA 3BI1A 4P4JA 5D29A 2ABZA 3PFOA 1ELMP 2PJ8A 2GREA 2C1CA 4TNUA 4UIAA 1F57A 3SJFA 3DGVA 1R3NA 1CG2A 2PJ9A 1AMPA 4MCSA 2OOTA 2J9AA 3NA6A 1ZG7A 2GU2A 2AFOA 1VHEA 1XBUA 5IB9A 1VIXA 3TX8A 4EMEA 3SI1A 1UWYA 1CBXA 4PXDA 1BLLE 1AYEA 4P4EA 4ZY2A 4F9VA 4B6ZA 3FVLA 4EWTA 3H8FA 4NJQA 4DYOA 2C6PA 1FT7A 3PB8X 4NGRA 5CPAA 3IWWA 2POKA 1YLOA 2PJ6A 5K8MA 3SI2A 5LRKA 1HEEA 4P6YA 5HVHA 5LYFA 2F8HA 1QQ9A 3B3VA 4FAIA 4ZX8A 4H2KA 2Q43A 2WYRA 2V8VA 4ONWA 4P4IA 2AFSA 4IK2A 1RTQA 1LFWA 1F2OA 2I3CA 1ELLP 2XEJA 4OC3A 4UEEA 2IJZA 5DS0A 1TXRA 1TKHA 4OC4A 3FJUA 3CT9A 2AFMA 2ZOFA 1FNOA 4X8IA 3D7HA
chains in the Genus database with same CATH superfamily
2ZZTA 5AXKA 1Y0HA 2WOMB 1HL6A 1E6VB 2YNGB 3BJYA 1JXEA 3KZWA 2YNGA 2WAQD 4MH8A 5E3CA 4YU9A 1LWEA 1H6KX 4ZVUB 5HXDA 2R7RA 3P2HA 3GJSB 4CGLA 3KQZA 2XS2A 5CZVA 2WB1D 4JXRA 2W2OP 3A8IA 4YP3A 3QGGA 1S6OA 2DRDA 3UCUP 3PYDA 3K7RA 3LTOA 7AT1B 2UU9F 4OL8A 5K9FA 5IB0A 5A8KB 2NYQA 2HBZB 4G1IA 3K5NA 2DXDA 2FJAB 1UA0A 5CD4H 1X4CA 2F40A 2A2DA 3J80U 3M8YA 4C6AA 2MKIA 1TQLA 5C25B 1VHOA 4J5OA 2FIUA 4U7UD 4B5OA 3ISNC 5A2QU 2R1IA 3P49B 5IQ6A 3QRQA 2HMIA 3MCOA 4CO4A 2Z30B 3F44A 1GHEA 1FE0A 2XMUA 1GMWD 2KL8A 4JUZA 2OEJA 5DDRC 3S6KA 1B7YB 3MCNA 3BZQA 3ZTSA 4DPOA 4U7CA 3CPXA 1T05A 1EIYB 2R9LA 5I3QA 3BGFA 1I6JA 1UJ5A 4LF4J 4X62F 1D9FA 1K0TA 4CLKA 2Z0GA 4B13A 3TTHA 3QGPA 2DB1A 2XEIA 3MECA 3WT4A 3I82A 5D8NA 4NEYA 4CGOA 1TAUA 2CPFA 1EAYC 2B4VA 5E3QA 2RUSA 4KSEB 1WSVA 3BKUA 3HZEA 4Z65A 4KOVA 2IA0A 5KG3A 3GILA 1QTMA 1SIZA 2UV8G 5ETLA 3NE8A 5HN0A 4PWDA 4P4DA 1QAIA 3NH4A 1UVIA 3IC1A 3PACA 2CVIA 4KUAA 1TELA 1TZ0A 1JLAA 4Y3CA 5KFLA 4A2ZA 4IDKA 2YWFA 2VC0A 2WZNA 3PW7A 1AUGA 1WC3A 2ASYA 5ETVA 3KK3B 4AE5A 4FYWB 4Q2LA 4MHZA 3KKWA 2YKMA 3FGVA 4M5LA 2M88A 2B56A 2DGXA 1J5EJ 1XERA 1AZSA 3QGHA 4DL5A 3UD5A 1S77D 4OP4A 1X60A 4DV0J 2FJWA 1SV5B 1KN6A 3WIVA 1HD1A 1SC3B 1ZG9A 3CCZA 4C48A 4J9MA 4C7QA 4HH0A 2V63A 5IT9Y 3E8OA 1YJVA 1CJUA 4ZJLA 3T1AA 2VQYA 3IR6B 5KFOA 1VCTA 3ZZTA 3NE7A 2YQ0A 4BS2A 2HQFA 4ITSA 2D3O1 3J7AN 2BJ3A 1U6FA 4Y2KA 4WF9Q 4KC5A 1YW6A 2KN4A 4CH1A 4DSKA 4KO0B 4IH7A 1HARA 4OV6A 2PC1A 1RTIB 2I38A 5BWAB 1UAWA 1FRHA 5BJRA 4PAAA 2HUZA 4NI2A 1HMVA 3AFGA 3KQXA 3ELHA 1E6YA 1HBMB 2MKCA 4DS5A 3KHXA 2QLWA 4IRKA 2ALYB 4ZCLA 3FYNA 3KJNB 4DCPB 1Q78A 3SJEA 2Y0BB 2I79A 1HNWJ 2AFZA 1EP4B 3OFEA 3HFVA 3BO2A 1IR2A 4B3SF 4KVME 3TO9A 4I0WA 4F7VA 1RADB 3OJSA 2ZELA 1RTDB 1E6YB 2OZHA 2XI3A 2NSCA 6FD1A 4P45A 1Q7LA 1LEOA 2J7UA 1RAAB 1HI0P 2E7VA 1I3OB 5F8LA 5KTQA 3PEHA 3W8PA 2F9DA 4ER8A 1Y0YA 4CGNA 4A48A 3I87A 2R7UA 1CJKA 4KV8B 3R96A 1NPKA 5EX0A 1S1TA 1KUVA 5HANA 3CC2S 1WC0A 1A2ZA 4P4JA 2Z0ZA 4NMXA 1KKHA 3QPIA 1F57A 3DGVA 3HKWA 1S99A 1S7LA 3MAQA 2CZVC 3TX8A 2CJKA 4ILMA 1UWYA 4ZY2A 4DR4J 3JTKA 5L9NA 2ZWOA 1TKTB 1R31A 1FESA 5J8CA 4V19J 1H2UX 3PGPA 2CQIA 1XIXA 3MUMP 2Z2ZA 1ZOTA 1UFLA 2VG7B 1N33J 1HQUB 2YNHB 3NAIA 5HBMB 3EVMA 4AXJA 5DS0A 1CS4B 2BW2A 1CULB 5IWAJ 2W7OA 2RDIA 1YI2S 4OHWA 2OUGA 4Y49C 2R8HA 3PZPA 2V8DA 3N5BA 3NRBA 2NXUA 4DR3F 2MHNA 3RB0A 2KVQE 4LRAA 4FKXA 3H2VE 3PR5B 3HX9A 3PJ9A 2FLOA 2HAIA 1WOOA 3NY0A 1S1XB 2YNCA 2G0CA 2PIZA 3M8RA 3Q8YA 5D77A 1MK4A 3IGNA 3PX4A 1Q5VA 3TZXA 2AZ1A 2HS3A 4NEXA 4TQRA 3ENWA 1U1NA 4JI1F 2KHDA 3AOCA 1N56A 4F0HA 2DEIA 5B0BA 2BABA 2XMWA 1Q2YA 2LEAA 2XS7A 4KOWA 2FL4A 5C82A 3Q83A 1D8YA 4HNWB 1N4LA 1BOBA 5ETPA 3RAQA 3VAGA 3W2WB 1U8WA 2G2YA 2LCWA 2K7KA 2JWNA 1H72C 1HNVB 1MLAA 1YJWS 4CYUA 3CZXA 2BE2A 3DCAA 4H6ZA 3LMSA 3M7VA 4RW8A 1S7NA 1PILA 4MFLA 1BXNA 5A6WA 4QIGA 4J9LA 2MLYA 3HLPA 2CQCA 3POTA 4DEZA 4NX9A 5CYMA 3TZYA 4KSFA 1SUQA 1IXKA 1VMBA 2Q1LA 5HLFB 2PRQA 3LGNA 5A27A 3GIMA 1UW4A 4LVOP 1EJ7L 4F8ZA 2MMYA 1F0XA 4OJ1A 4C2XA 4OC5A 2B6AA 4OZ5A 4YGOA 4P52A 2IHR1 1HBOA 2PI5A 5CZXA 7FD1A 3NH5A 2G2OA 1M44A 4C0BA 3QRPA 1MJBA 3FSIA 3QLHB 4WU2A 3WC7A 4QU6A 2FC9A 3MTKA 2HHUA 3DLKA 4NGSA 2E7XA 4H4MB 4ZVQB 4LF5J 2YPZA 1SJ3P 1RT5B 2ZEFA 2DKOB 1BQMB 1N32F 2PDAA 4JI7F 4P73A 3AOAA 4RL1A 3DMJA 3POTB 4H89A 2VKZG 1Q8LA 1OSCA 5EWGA 4XO0A 3Q8UA 2ZH7A 4ZMMA 5HJYA 2PD1A 4O44B 1KC8T 3SCIE 1WHVA 3AQOA 4LSLB 3PW2A 1B64A 3VWSA 3D6TB 2MY8A 5MLCV 1WTBA 1IOIA 2GV1A 3QT5A 3Q8SB 3R97A 1S5ZA 4JBCA 1Y5NB 3OLAA 1UW9A 1AT1B 3M05A 1KOOA 1P4NA 3PM9A 5DG8A 1X0PA 2NSBA 4DV4J 1QY7A 4R7MA 3S9NA 3GFZA 4X65J 4AQYF 3AXMA 1MU2A 3LP2B 4FYYB 1SQGA 5JQ4A 3MEEA 1NHKL 2V8HA 2BEFA 2DGSA 2DEAA 2DNGA 1NNDA 2BRLA 2ZOGA 1KNZA 2HG4A 5HH1A 4OHYA 3FK4A 5J2PA 2DR7A 3FEZA 4WKYA 5E0OA 2OO4A 4DV6J 4PABA 1VQLS 1LW2A 1BAVA 4PUOB 2R98A 2D3ZA 2F7VA 4MK9A 5CYJA 3OHBA 3KG4A 2E1AA 5C5JA 3T41A 2WSAA 2IM3A 1WWZA 3OL8A 4IHMA 3OTEA 3WX4A 4K59A 5KFDA 4F04B 2DNZA 3JAMY 4C97A 2XZTB 1RT3A 1EETB 4OMEA 1V9OA 1XE4A 3G2XA 3ETMA 2VB6A 1RBAA 1EARA 1AA1B 2DGVA 3FVYA 4CZCA 5KOXA 3C15B 5T7LB 2OU2A 5KFBA 1NSQA 2ZNZA 2G2ZA 4HH1A 1QUPA 3WHIA 5IV0A 5H84A 4KHPF 1TKXA 3SEOA 4ANEA 5LYLA 4HVZA 4Y34A 2LLZA 3S6GA 2PE8A 5IV3A 1EZZB 5J2NB 1HYSB 4GKJF 3D9BA 4FXWA 1RHRB 3OBIA 2WONB 3LW5C 1RCXB 3TJAA 4FYVB 4KJIA 4PV6A 5GMEA 2C2NA 4X2BA 3SFGA 4TU8A 4HPSA 2F8MA 4M5GA 3ILLA 4DV7J 4ECUA 2Y1RI 1S0VA 3MPVA 2C2RA 4U96A 1M1HA 5IQQA 2V2VA 1P9QC 2J9AA 3V81A 4NI2B 2XY5A 2HZVA 2IYGA 1XBUA 1M5PC 1HBUB 2FQQB 2LKZA 3SI1A 2CFXA 1MJ9A 5HMXA 4P4EA 3CMQA 1H2VZ 2ZH3A 3UR0A 2WVFA 2YGWA 1QJHA 5EC4A 1HQEA 1Q53A 1PSDA 3M8PA 1VRTA 3H25A 2N7CA 4ED5A 3CULA 1S60A 3RW6A 1Q79A 4CLWA 3C15A 2J0SD 3KJFB 1SJ4P 1WKKA 4LF6F 3RJMB 4OX9J 2NUHA 5J1PA 3Q2SC 1M5HA 2FYXA 4CIOA 3QO9B 4ZVFA 3JSRA 2WSCC 3UR3C 2F1FA 1FNOA 3H8YA 2AV5A 1FK9B 4O3NA 3EC4A 2FD2A 3BH7B 5D78A 3SZ2A 3P4UB 5DGAA 4MCQA 1OQ3A 1CVJA 4ELTA 1BC6A 4WFXA 4M85A 3AAWB 5HMYA 3SQGB 2FHMA 4G1PA 3ZZ0A 4JI3F 1LOUA 1FNMA 3JSMA 1R7IA 1T9UA 1I1GA 2XQCA 3KHLA 3IG1B 3HD1A 1D8ZA 4LBHA 1MNEA 2ZENA 4QVTA 3VAFA 3PB4X 4USTA 1BO4A 3W66A 2UVUA 3KLVA 1B6BA 2PVWA 5JJBA 1RA6A 2MSSA 1U1QA 4JD6A 1QMUA 4L3KA 4WK3A 2GS8A 2MKHA 2KCWA 3CO0P 4CQ1A 2HNYB 4ECWA 3G8QA 3TO8A 3Q8QB 2W9BB 4O23A 2IL4A 3K2KA 5KFHA 4ZCKA 4JZ0A 3NEKA 4RBUA 3MF5A 2MYFA 5GAEI 3MDFA 5BYQA 3DOKA 3OD2A 4IDKB 4KHMA 1V3SA 2M9KA 4YY3J 4GC7A 3M6WA 1IYLA 2Q79A 2AYEA 2YWEA 2O1PA 4QBUA 4UBRA 1S7FA 1K4JA 3Q8PB 1NK5A 1UMJA 1RZMA 4UWIA 1TF8A 5GADI 3PRDA 5K8PA 2NXJA 5ETOA 5K8NA 1VRUA 3MR6A 5LRJA 2G3TA 4MT1A 3PBEA 1TVRB 3TNVA 4LT6A 4WXOA 3GY9A 3W6SA 3PRBA 1QSLA 2XMVA 1X31C 2EC0A 2WK4A 4FDFA 4MFPA 4B08A 2D41A 2V2QA 4J91A 3CF5Q 3FZ2A 1OIAA 3PCOB 3BGOP 1RT1B 1UFKA 2RQ4A 4W92B 2HHTA 1WEYA 3CJ0A 1F6TA 2DNNA 4RW8B 1TVRA 1WF0A 1Z8LA 1IKVA 2GANA 3KHZA 2PJ3A 3FCVA 3DKDA 2HWTA 1TL1B 4LJMA 3ZXWA 1WC1A 3W2WA 2GVDA 2ASDA 4ZVTB 2XYPB 2AJ6A 5KTCA 1NE9A 3NS5A 3B3WA 2LMIA 3WC0A 5IT9U 2BJ7A 1ZYQA 4U8YA 2DCUB 4C4WA 4ES1A 1RXTA 5ELYA 3VAKA 3CC7S 4U9RA 4F2RA 2CG4A 4ZPCA 5E96A 3Q86A 5B0GA 5KOWA 1RT6B 2X3GA 4I6YA 1XNRF 3KTQA 1AB8A 3M2VB 2MZRA 4CI0B 1N88A 4A8MP 3D3SA 2ZEEA 3OTCA 4R6TA 2HGMA 4JJXA 3C46A 3OWCA 4JOUA 3D0IE 5FVJA 1XC9A 3M2UA 5L9XA 1RHMB 3UDEA 4DDFA 4ECSA 1RHQB 2W9CB 3WX8A 1HWKA 6FDRA 1XWLA 4ECZA 2ZWPA 1URRA 3DXSX 3M8WA 4H6UA 4OJHA 3EDQB 2NLWA 4F4ZA 3NNCA 4RUAA 4Q38A 4G6VB 2J0WA 4FS1A 3THPA 2R7VA 2C2KB 5LYIA 4QWDA 3CO9A 2VD3A 4R0JA 3MMCB 4JV1A 2RSQA 1GTHA 1WTFA 3THTA 5RUBA 1VFJA 3R5CA 2LVWA 2IIHA 1VQ4S 2HQGA 4B5PA 1I94F 4USMA 2ZW5A 3SHPA 3MM8A 3GR1A 1P27B 2ZH1A 3T5JA 1JXLA 3H40A 4MFBA 2GO8A 2JDCA 4GM5A 3R6LB 5FJ4A 4W90B 4DPXA 1Y3JA 1RYSA 3TUZC 1C2PA 2AJQA 5AGEA 3FRZA 2EWBA 4Q5VA 2UUBJ 1YDLA 4N8NA 4FZVA 3BI1A 1NJYA 1YITS 2P6TA 4C8OA 2DRAA 2EWHA 3GSIA 1U1OA 4WU3A 1X7VA 4UOGA 2OOTA 2J9DA 1HYSA 2C42A 2YNIA 4B11A 4EMEA 3KJQB 1AYEA 3IWXA 3R7BB 3B82A 1TKXB 2C6PA 4L75A 4UOCA 1NKBA 3PB8X 3SXNA 2AZ3A 2KRRA 2YNFA 4OLPA 3DM2B 5KT2A 2AKWB 3TO7A 2DNLA 3S7RA 4NLOA 3T90A 2F8HA 4BLGA 1YRUA 4DQRA 2J6UA 1NJIT 4CYOA 1FA0A 4O3OA 2MKKA 2UUAF 4B3TF 4ZCIA 2W2PP 5B0AA 1LWFB 2I2YA 4J9QA 4M5KA 4MIAA 4OZ0A 2AFMA 1RSCA 2HVIA 3K59A 1KOHA 5D4OA 3P8BB 4MIBA 4XPKA 1HDUA 1BPMA 4PSWA 1HNXF 4LQGA 1LW2B 1IBCB 2HNDB 5A8RA 1QVGR 3UNGC 5CNPA 1PBUA 1FNXH 3I5AA 2UXCJ 3SSRA 4B9VA 1F3VA 1VQ7S 4NCGA 2C2EA 4OI0A 3BJ8A 4KHRA 1W25A 4YRHA 3EWGA 2V5HG 1Z4EA 4JI8J 2A0FB 2AJ2A 4NMLA 3K17A 4P10A 1YVKA 1OSDA 3HF5A 1YWXA 4ED1A 3OUYA 3T5HA 4EBEA 2Z4PA 1T7PA 4RU2A 2EK8A 3GLJA 3VH9A 3CCTA 4K4TA 4WFYA 4F6AA 4OZLA 5F8MA 4IKAA 5B0EA 2LEPA 5KT3A 1U2RA 1IR1A 3QGIA 4FD7A 3HFKA 2IM0A 3RYOA 2QLXA 2VKRA 2NQPA 3QFHA 2ACMA 1CEZA 2PIIA 4W98A 4W9YA 2Z3PA 2JSXA 2R7QA 4TU9A 4ILLA 1H7WA 4IFYA 1GFWB 4AL7A 1FKPB 1SQFA 4HNXB 3HK2A 1F1BB 2IBKA 4RJVA 1RT2A 4RO0A 4Q2MA 2DXFA 3SYZA 3LACA 3BV8A 3FF3A 2ASJA 2JEVA 2Z3KA 5THWA 4OLLA 3KDOA 5JXSA 3KLHB 3BH6B 3TVKA 1SC1B 2RUGA 1IUJA 2OD6A 1NSPA 4CPAA 3DC2A 2ZHAA 4LREA 1N8RT 2DEJA 2Y8WA 3PRVA 5G21A 4B14A 3CJ5A 2KH9A 3DHXA 4TLQA 1WK4A 5E3AA 1MMNA 1HNIB 1UZDA 3FDSA 4TY8A 5J2MA 1OY6A 1VJWA 1IBLJ 2JEWA 3OJUA 3D0HE 2QA1A 3M2VA 4DSJA 2AJ0A 5GAHI 1V3RA 3J7YI 3GZ7A 1ZPVA 3KLGA 3SCJE 1RXOB 1G1XA 3HULA 2UUBF 5J8FA 4UQGA 4ZVRB 1WHYA 4M5MA 5EGYA 1MN9A 1N5VA 1V5VA 2NUUG 2VBXA 2K1RA 4F3OA 1IBLF 3QT6A 3D4UA 1P9YA 1TL1A 2D74B 4KS9A 1Y7EA 2OPSA 1YBAA 3HLUA 2J0QD 3V6DB 2OZUA 2FXFA 1Y5LB 1X0FA 3HKZD 3KXDA 4DR3J 1K9MT 4EGLA 3MMJA 4DL4A 1Z2ZA 3PHTA 1LK7A 1T9YA 4NLRA 4JI7J 1NJZA 4DR2F 4DN0A 1PKUA 4A33A 4LUAA 2VDIA 3H98A 5KFUA 4PQUB 2YKQA 2XBPA 4EFDA 3CCQS 1S1XA 4ANDA 3ZTRA 4KGKA 3SXLA 4NYZA 4M6GA 1VQNS 1XRYA 2DHXA 3V6DA 4DV3F 1UEUA 5EUHA 3BDEA 1L0CA 2B0GA 4LF2A 5AG6A 3PB6X 4H4OA 3H5XA 3WIUA 2XEGA 1RBLA 1RWNB 3TOAA 2CIMA 3HSJA 1ZTWA 1M4LA 3UE2A 2O66A 4AFFA 2QFJA 4DR7J 3D67A 1XJOA 1TAQA 4X62J 2VONA 4PK3A 2MZSA 4OYAA 4UW2A 3R1KA 1RP5A 3SQOP 2D9OA 4F26A 1IM4A 2G0JA 1VBZA 5ETNA 1Y7RA 2HPUA 2BSWA 3H7HB 4DCOB 1V3ZA 3FEDA 2C3UA 3EGNA 4I49A 1REVA 2D9PA 3CMAS 2W24A 2CQBA 2C6CA 1WD6A 3MN8A 5L1LA 5D0GA 3AQPA 2KXHA 3DXBA 3ZFVA 4DSFA 2LXIA 1NMTA 3GYAA 1U8SA 3IAM9 3D8PA 2GVDB 4OYOA 5KG0A 3KLFA 3NFZA 1UJ6A 4R25A 4FF4A 1S3ZA 2V9KA 3J81Y 2FJVA 2R7WA 2GHPA 1Y10A 2ZH8A 2WW4A 2FJEB 2PFFB 2P8IA 2ABZA 4JWPA 4MYUA 3MURP 1U2CA 2Q7BA 4USUA 4OYPA 3P45B 4ICLA 2GJIA 3EDRB 1M90T 2UVWA 5E2QA 3VALA 2EVZA 2H5MA 1TFWA 1UVJA 3GIIA 5KG7A 1O5JA 1FF2A 1W2BR 4QIVA 3JUWA 2BXJA 3D1HA 4DV2F 5EHHA 4IFVB 3LO3A 1T03B 5EMIA 3CCVS 4IH5A 2V0NA 3N6MA 2CQ2A 2IJZA 3GTYX 1T02A 2DR8A 3CT9A 2Z3OA 2IRYA 3M8ZA 4PG8A 4FF1A 5F3ZA 2Y3YA 5AJ3F 1Q8BA 4U6PA 3OPKA 5HP1B 4FN5A 2DNQA 2GMHA 2R8JA 2FZGB 1J4JA 2KT2A 4I1TA 2ZZMA 2XMMA 4A95A 5I42A 3ZJ0A 1FXRA 2ACYA 4DV1J 3V6HA 3WZ0A 1ARMA 3SDEA 4KH1B 2W2MP 4ZPDA 4DL6A 2C2MB 1WOSA 4YB7A 1VJQA 2KO1A 1P1LA 3R5GA 3DDNA 4AXVA 2PMWA 3W2VA 2EBEA 2W9AA 2DNOA 1S0NA 1QSYA 3SXOA 5DQGA 1PJ6A 2OPPB 1LQ9A 2X1FA 1JXVA 2YBVA 3LH2S 5CCLA 4TNOA 1GMVA 4CRJA 1HBMA 2D69A 2O67A 2IVFB 2BQ3A 1IQZA 3OSNA 4WJBA 1UTAA 5HJXA 5KFIA 2PFDA 3UW1A 4HL9A 2W4PA 4K4WA 1LKZA 1HIYA 2CPHA 4YDXA 4ID5B 2VZZA 4XK8C 2DNHA 2CWKA 5C24B 3H4QA 3TJ8A 1QSTA 1XN9A 1IWGA 3LPEA 5CXTA 3WC5A 3DRRA 3UVJA 1X9WA 2XNRA 4QIEA 4F67A 4ES2A 3L09A 2QSWA 5IXUA 3D5MA 3KHRA 4ZY1A 1YGHA 1NZ8A 1TKJA 4QYRA 4G1QB 4DR7F 5CABA 3FRMA 2HFSA 4BD9A 4CO0A 4PWUA 5F46A 5CA5A 2HQIA 5G22A 1VC0A 4LFCJ 3UN2A 3I31A 1KS2A 1AUDA 4K2XA 2OSRA 4O3SA 3UY5A 4LRDA 2ZUGA 2K3IA 5K8OA 4YOEA 2DH9A 4ZKAA 2DF5A 2BO9A 5ISVA 2ROPA 3BQ2A 1V0CA 1S0OA 3BJ7A 3GJQB 4NGPA 1IY7A 4EYHB 2DH8A 4M8LA 5C42A 3HZGA 2LYVA 4RUHA 1WKLA 3HI9A 1N36J 2KFYA 1AZSB 1OQ6A 2B7BB 2QECA 2BACA 3JQMA 3MECB 3WDOA 3HUVA 1OPZA 3KLFB 4X5KA 3BO4A 4LSLA 5HATA 1S7IA 2OLWA 1H2TZ 4ZS6A 1W2IA 2JEFA 2MKJA 1S1UB 2IJNA 2JLFA 2VV5A 3J7Z5 3R6GB 2YQ3A 5HO4A 4C2MA 2B5JB 3TI0A 1ZETA 2IDEA 1N33F 4OFZA 2XTJP 2Z2YB 1D9AA 1WF2A 5JVGQ 3QJLA 3IS9A 1IWAA 3AHPA 4DR5F 4OIDA 5IZHA 2Y1IA 3WC2A 4ED2A 4QR2A 4CO3A 3PJWA 3QIDA 4B5PB 1GAOA 2ZH6A 2V77A 2W2QP 4JLYA 4JI0F 3GE9A 4ZVEA 2XZDB 5L1IA 1VLYA 5HLFA 1F9EB 1SPBP 2DR5A 1QE1A 2IRUA 2QMWA 3DU6A 4G3IA 3N6NA 4J9VA 4AYBD 2EKNA 3SI8A 3Q8VA 3NLCA 4K7QA 4AL6A 5KT5A 2ZM6F 1QSOA 2A2CA 1X12A 2J8NA 4LQ9A 1SQHA 3FFIB 3FCHA 2VL1A 5HL7Q 3JB9k 5KG6A 2RH3A 4K5RA 1RT7B 4CAEA 4NGMA 2BV3A 4IFVA 2HHPA 4X3RA 2JVRA 4OAEA 4KY3A 5F8JA 2Q6CA 2ZFHA 3GIUA 3G96A 1R6YA 5KG1A 4ZCMA 1WDDA 3DOMA 3F0AA 1CJVB 2FVPA 4MJ8A 1H7XA 4CAFA 2H4WB 1CJTA 4WFAQ 2QG9B 3Q0AA 4ICLB 3CJRA 1Z4RA 2ZEJA 4WYWA 4DQQA 1U1RA 3RBDA 4ZGYB 1XOVA 4C2YA 3KHGA 2QA4G 1VIXA 1U02A 4RWXA 3J7ZT 1Q81T 3K89A 2QT7A 5C2CA 3FVLA 5CPAA 1YLOA 3R5BA 3SSQA 1M0SA 1S9EB 5DLGA 3U7JA 1XNQJ 3QYYA 1VQMS 4FF3A 4W4MA 4ZX8A 1RT7A 3MOZA 1FTCA 1RKJA 2Q43A 1IKVB 3MD3A 5KG2A 1B70B 3JSBA 5A8WB 2AFSA 4IK2A 4RW4B 1FVSA 2HNZB 1LFWA 2ZJQQ 2NXCA 2FHOB 4MHDA 3FJUA 1T3NA 2ADBA 3BM7A 2BOPA 2CJXB 3ILOA 2WZ1A 1NDCA 2F63A 2HC9A 4DFMA 4CLYA 3FBBA 1VOMA 1A9NB 3MUTP 3AJ1A 5F3TA 5IX3A 4UF4A 1TUVA 1U6MA 2K5TA 1G7CB 1DTTA 1KVIA 1FRIA 1RUSA 3MM7B 4TY9A 2MZTA 3NCQA 3KMSA 1JK9B 1N0UA 4PSXA 2QJ3A 4DBQA 2RVJA 1LK5A 4JP8A 2CNNB 2PEHA 1O0PA 3ICLA 2A6MA 1CPXA 2FZCB 5M2UA 3R2DJ 1NDKA 2OAUA 4USWA 2BQUA 3DLBA 4TVAB 1QSRA 3BB5A 3ILIA 4CT8A 2AFXA 2R2TA 3VAIA 3F5BA 1PC5A 3BPSP 2E5HA 2HFVA 3VGSA 4F36A 3LOUA 1RACB 1HR0J 3PZJA 3FQLA 3T1YJ 1LNQA 3H4BA 3TAMA 4OV1A 5SZTA 4YS2A 2MQPA 4ZHRB 3LP1A 3W3SA 3ISZA 3PYGA 4IOCQ 3NOGA 4RPFA 3S6EA 3EO4A 4Z7CA 3LPYA 2YVSA 1NKEA 5KFSA 4M5HA 1EQ0A 3GP9A 4ZJQA 3H90A 3SCLE 1HW8A 1DURA 2ZOMA 4P72A 4J9SA 2M5YA 4NLWA 3CGIA 5C2GA 3RRGA 5ETSA 2CPEA 2ALZA 2W2NP 2ZH4A 2KT5A 2HHHJ 3PXGa 4IFYB 1XNQF 1HKAA 1HQEB 4ZVHA 1ZLIA 3NP5A 4DZ6A 4C7HA 3OSPA 4K3NA 1UFHA 1FFGB 2VODA 1S48A 4ECVA 4X66F 4J9PA 2JFKA 3M9NB 1AXQA 4LUBA 4E2AA 1RAEB 5B0DA 5LSLA 4LR7A 3CJKA 2R7OA 5K14B 2R2SA 4G1QA 1XMOJ 1S6PB 2WVCA 2J7WA 2XLIA 2F4VF 4PG6A 3T1HJ 2FJXA 2R8IA 2DT9A 1NK4A 4NGNA 4DN9A 2UU9J 4HTIA 1RGVA 2Q4VA 4NLYA 3NGUA 2C27A 1M1KT 1TV6B 5AJ3J 2VFRA 1PG5B 1WG5A 4DR5J 5K14A 2GVZA 4FP9A 2PJCA 2V50A 2DK2A 2NS1B 3KGQA 5IWAF 1VYAA 2GLJA 3SJGA 4F3MA 2VG5B 5M2RA 2Q3PA 4PR6A 5F8HA 2X1AA 1DJ0A 4DJLA 4P71A 5DQIA 3DU5A 3I32A 2FDNA 3NXZA 5KFYA 1Q5YA 4KAIA 3W65A 4HHJA 4LF8J 3FX6A 2ODFA 4KGMA 2CAJA 1EB0A 2G3AA 3A9LA 3HHLD 2ZJPQ 3QNVA 5ETKA 4UZCA 2ZPAA 3H0PA 2ZE2B 1S6PA 4B02A 1OZPA 3ZO7A 1FJ7A 3SV3A 1DHMA 4I64A 2YNCC 2EEYA 5DLFA 1GTEA 5F9NA 3PB7X 2X7BA 1QLNA 1Z8XA 2R4FA 2COLA 2FUG9 4DUYJ 3DHWC 3NWGA 1C0TA 1YJUA 2HGLA 3KK3A 4LFBJ 1NHVA 3T1HF 4ZBGA 3G87A 2RQKA 2XMKA 3HFZB 4F9UA 4JI8F 4GVBA 3OTOF 2QL5B 3LALA 4J9KA 4QUSA 3V38A 3HVAA 3OL6A 3EVWA 2RE1A 2GHWA 4YN3B 1J27A 2QE5A 1BPNA 4X84A 5A8WA 4OJ3A 2D7SA 5C25A 5E33A 1N36F 2RQMA 2HWHA 1TL7A 2DIUA 4QW8A 4LF4F 3N6LA 3IIBA 3F8KA 1JLFA 1H38A 2R3VA 1M4GA 2IC3B 4YB6A 1SJFA 1BGXT 3PFOA 4OIXA 3TW0A 4DR2J 1S7KA 1G3OA 2Z57B 4JYAF 1SBRA 4QR0A 2CWXA 5I3UB 3FC9A 1VBYA 2QA4S 1FHTA 1BLLE 3V5RA 4B6ZA 3H8FA 2UXCF 2HV2A 2PJ6A 2ROGA 4DUZJ 3D2MA 5G4DA 2UUCJ 1UVNA 5HVHA 5LYFA 3D0GE 3EZ5A 1B99A 4C11B 2HK2A 1VDHA 4CLSA 4WZMA 5GAGU 4RNNA 1X4DA 3SIPB 5F8IA 5LMUJ 2BANB 2I0XA 3I9V9 1UA1A 2V34A 4X8IA 1VS3A 4FUUA 2IJFA 3AB2B 1K44A 4H4MA 4D3GA 1QSSA 3ET6A 4KH0B 4EO6A 2YQ1A 4R87A 4L73A 3W7BA 3Q89A 1VQ6S 3OXGA 3O5TB 4F4WA 4K2JA 4MBUA 3BN7A 1CP6A 2WOMA 4NLUA 2Q7SA 2C2DA 2YWHA 3NWRA 4RW6B 5F48A 4PQUA 4MCRA 1RT1A 1NK9A 3UD3P 1N6QB 4B9LA 1ZM9A 4DS4A 4A39A 2HHXA 4HHUA 5J2MB 2HBRB 1SKRA 2NXEA 4LSNB 2ATLA 4R8FA 1HNIA 3BF4A 3QATA 2OEKA 4CAXA 2ZJRQ 4ATNA 1U1PA 2CIJA 1RE1B 2HHVA 1PJ7A 4TYBA 3CNQP 4HLBA 3T9YA 1RA7A 1NO8A 1NJWA 4F0YA 2MKYA 4OYMA 4G65A 2IY5B 2PJ0A 1HLWA 4BINA 2E5LF 5A6PA 4P44A 1SCJB 3PV8A 1C1BB 1JB0C 1HQUA 2J5AA 2YNHA 3BYPA 5CBMA 1S1TB 1FD8A 2HBQB 3PG9A 4NGQA 1WG1A 5DG7A 1LXNA 1CLFA 4YQWA 3QAHA 1UCNA 3IG1A 4Q36A 3L7PA 3A8KA 3MXHP 4X64J 4GMKA 2JLEA 3CDEA 1RWUA 4LQ3A 4M5IA 3IU2A 1YRTA 4U9ZA 3MAAB 4LR8A 2JBJA 3T5KA 2PN6A 2YTCA 2YWGA 4L6V3 3GFHA 4IO1A 2HHSA 2AYGA 3FBFA 3CCLS 4OKOA 4ECXA 3MPYA 3MM5B 3BGRB 2FLNA 1FO1A 4ED3A 1L3SA 2HB6A 3I0SB 1MG7A 3EMTA 1RWPB 4X66J 2BM0A 1IJEB 2LA4A 8RUCA 3VAJA 2VBQA 4DX5A 4AG9A 1LW0A 1HHQA 1P8GA 2EI5A 2OTJS 3NGTA 2PMHA 3LWMA 1DQ8A 4B9SA 3MCMA 1XMOF 2DRBA 1RHKB 4P2FA 4B9NA 2F5IA 5KT4A 4WP3A 1M5VC 4J3GA 1VRTB 4P2SA 2WVEA 3BBBA 2XY6A 1GT8A 4BMHA 2OTLS 1Y3KA 3PX0A 4OI1A 2HNDA 3D68A 3QWUA 4NZ6A 1M1DA 3JTPA 4NE9C 3LWLA 5ADZA 2B4DA 4CH7A 2G9DA 1FRLA 1HDQA 4NOHA 2Z2LA 4XTTA 2I6WA 4RS2A 4RWWA 2EFQA 3CDUA 3BSCA 1W26A 1Z9UA 3IM8A 2VG6B 2EFOA 3TR5A 4L3NA 1KVKA 4HYKA 1M5OC 2WCXA 1VR6A 2HW3A 3OFGA 3MUVP 4KIAA 3PVXA 2C2ZB 3PTWA 1A7GE 2OFGX 3IO1A 4QWAA 3RRHA 1BE4A 4NCGB 4UFXA 4WP9A 3RB4A 2MZ1A 3DLJA 2W4DA 4I2QB 2VICA 3TQ1A 4A8OA 1JLCB 4PXEA 4Y2MA 2B3TB 4NA1A 3AD8C 2NYIA 2AX1A 1U0SA 1FI4A 5B08A 2BX6A 3B8HA 4U67Q 4OC0A 1MU2B 3LP2A 1YHQS 3KK1A 4NJRA 2HRUA 1RT4B 1DE4C 1APSA 4ED7A 2QN6B 4F4AA 1RTZA 3LD2A 4WIQA 4C8NA 4OIWA 1XQIA 3IA0A 5H1SV 1HMVB 2JOQA 2PGCA 1XR6A 4DSLA 4IAVA 3G6XA 3OHAA 3MHYA 3J81U 3T6BA 2ZEOA 4F4YA 2ZITA 2HFOA 5HK4A 3SDEB 2JLGA 4Q7AA 2YX4A 3VWDA 3TQEA 3CXPA 4F4XA 1AFJA 1C1CB 5DZ6A 4EO8A 3KNAA 2C1EB 3V81B 1R0CB 4QW9A 1PU9A 2B4UA 5LJ3Y 2NCKL 4ZVOB 1Y9KA 3DLLQ 4OYBA 2FLPA 2AFOA 1T8EA 4DU8A 3G6ES 2RF2B 4F9VA 4ZIWA 3Q8RB 1IBKF 2B43A 2ZH5A 5J1NA 3I4PA 4NLQA 4JV5J 1KEKA 1OY8A 1S97A 4PUOA 2WYRA 1ZM4A 1F2HA 3MMAB 1WELA 2G9OA 4P7TA 2OSQA 3J80Y 2ERRA 3JAMU 1ELLP 4UEEA 3W9HA 3U1LA 3TP2A 5L46A 5FLXU 3V6JA 1KZFA 3V4IA 3VQTA 1S9GB 2XNQA 2GHVC 3R5JB 4Q44A 1SJ1A 1LV5A 3D7HA 4KSAA 3EXNA 1PIEA 3HHLB 2JC0A 1SUQB 3PNIA 4QIWD 3DSBA 2HZCA 2J9DE 2PJ2A 5DO2A 4R5PB 1QD1A 2CTCA 5DDOC 3B4MA 2CJBA 3A13A 4ZLPA 2VF3A 3VTIA 2HKEA 1SL0A 3BGLA 4NCZA 3GIJA 2PCUA 2KRBA 3RO0A 4CGPA 2BUNA 4ZK7M 3S9LA 3TVZA 4N56A 3GG0A 2L9WA 2VI7A 1LWCB 4L72B 1MJAA 3EE3A 4P7VA 2OELA 2ABYA 1TTHB 3TE4A 2IYIA 1S6QA 4O3QA 2DO0A 2MQMA 3DYAB 2XO7A 3TYTA 3KR4A 1Z8WA 2UVRA 3BDPA 2PSWA 1NDLA 2BE2B 2G1HA 3HXMA 2L08A 4EUVA 5F09A 1NSKL 3N5FA 3T1YF 2OPSB 3CMES 2YWKA 4LF8F 2C6GA 2AEFA 4MTPA 2WVDA 4L89A 3A3OB 2AWZA 4A8FA 1UFWA 4DL2A 3FFIA 1RKIA 2LECA 4Y28C 1NLKL 1Q4RA 4ILRA 3VZIA 3R1HA 1URNA 2XG8A 3G8WA 3RAXA 4KR0B 3AODA 2GAHC 5KFWA 1Q7YT 4MY0A 1YJNS 2XMTA 4XIUA 2YKPA 2DBBA 2ZKUA 1TUWA 4CO2A 3OR2B 4DPWA 4DQPA 1LWEB 4NCAA 3TA2A 1WF1A 1U1MA 2ATRA 5FIIA 2FJDB 2MEWA 2O4HA 3D6MB 3NNHA 3CCWA 1TU0B 4N77A 2W25A 2GJ2A 1WHWA 4B12A 1MN7A 3TFYA 4AG7A 4RNHA 1ZTTA 1Z1ZA 4QIFA 3MD1A 1SL1A 1D1UA 5HBMA 4V19X 4KQZA 5KFXA 5LYDA 2CXAA 1BD6A 1ZO0A 3QFWA 5CYQB 3ILJA 1EKSA 4UIBA 4M63A 1UZHA 1S1UA 3CXQA 2I5JB 1WC4A 2AE6A 1PYSB 2KT3A 5IM0B 2W1BA 2CDRB 4FKYA 2A3JA 4ES3A 2CNOB 4LRFA 1JWWA 2UP1A 1ELOA 1U48A 1TL7B 3F41A 4P4FA 1EQMA 1REGX 1M4IA 2QV6A 1NCLA 4CLPA 1RBOB 2XSFA 2ZEMA 2BKOA 3P5TL 1RAHB 3CCUS 4KVOE 3W6XA 5L1KA 1R0BG 3N0VA 1QAYA 3V4MA 4KLWA 2FCKA 1LANA 5IOLA 4QQBA 2Q4ZA 3E01B 2M8DB 1YTYA 3KYLA 1O51A 4NZ7A 2F8EX 4X4UA 2DPSA 4I6AA 3LAKA 2QYGA 4A4JA 3KLEA 2Z3LA 1VK3A 1NMEB 3N9UC 3CIZA 1H0HB 4E98A 4JI5J 3B35A 1VC5A 1RISA 1C0TB 1TKTA 1N5YB 2P9EA 2CTBA 4DG1A 3NCPA 4EK2A 1AUSL 5ITHA 1U0HB 3BKFA 4NLPA 2LU2A 4BBYA 5HVGA 4KOSA 4IYQA 4DCJB 4UEFA 3DLGA 2AP6A 3VR1A 4X4OA 4KOUA 1EHWA 4ZDNA 2P5VA 3N7ZA 1RO5A 3QO9A 1RWWB 1TF9A 5KFGA 4HDGA 4DQSA 2FY1A 2RDJA 3OR1B 1KWMA 4RU9A 2QVPA 2ZBCA 1IOFA 3MMBB 2QFIA 4WK1A 2DTJA 2Q04A 4ZI6A 5D0RA 3D54A 1NSLA 4DHVA 1V6HA 1HD0A 2FE7A 1H74A 4FYXB 2MDAA 4NXNJ 4PPDA 2ZVIA 1N34J 2EK1A 3CJ2A 1ELMP 1RB0A 2PJ8A 2GREA 4EEYA 1RWMB 5F41A 1FRXA 1OYEA 1RDRA 2HQ3A 3PDNA 4LQ6A 4X4RA 3I9ZA 4M94A 4E0DA 1P1TA 3MZIA 1GXTA 3OUYB 1ULRA 5F9LA 4R8UA 1GK8A 3AJ2A 1JLFB 4TU7A 3SBMA 1DFDA 3WQPA 2VUGA 3FEYB 2HVZA 2HSEB 4NWBA 3FUYA 4H2KA 2CJAA 2V8VA 4ALZA 1MWZA 1SJRA 2QLBB 3G6YA 1UJ4A 2OI2A 4DWIA 1U45A 4XAKA 2ZOFA 4KLVA 2KTQA 1T05B 3GMGA 2F4FA 4QPXA 4CAVA 3M30B 1YK3A 2ILYA 2MKSA 4J9NA 2OP5A 2H1YA 3M4XA 3TCVA 5BYRA 1Z8TA 2ZVSA 3O6QA 1UEKA 4TQSA 4NL5A 3ZZYA 4A8YA 1MROB 5SUHA 3UNYA 3HHEA 2LXFA 5H9EJ 2XWYA 2ZM6J 4DSEA 1WDTA 2YX1A 5KFCA 3PKMA 4IR9A 1U24A 2P6SA 4CLTA 4K50A 5LMNJ 2XZWA 1SI9A 3EXYA 3GCXP 3H42A 1ZH5A 4UOHA 3C16B 2UZAA 3AOBA 4RI1A 3IRXA 3MMCA 4PYAA 3LGHA 3IU1A 3QAUA 4MAKA 3DOLA 1RTHA 2Y1LB 3RB6A 1ZZNA 5KFAA 5ETTA 5CYQA 4U7UK 3GONA 3HHDA 4PWDB 1KVJA 2OMLA 4MK7A 4A38A 2QLFB 3RBEA 2HNZA 1RTJB 2ZEPA 4I4BA 4FVMA 2G4BA 3JQKA 1YJRA 4E8UA 4K8RA 4F50A 1E6VA 2J8RA 1R0AA 2FJBB 1KHWA 2PIYA 3CJTA 4PYDA 3HPOA 4TYAA 1JLEB 3OT9A 2RHQB 4EYIB 2ZC3A 3CD7A 1F60B 4ZP8A 3B3SA 3MCSA 5EBVA 1KTVA 3OVAA 5EN1A 2PJ4A 3EPGA 4P75A 4AD6A 2MTLA 4J7CA 5GADU 1Q86T 4IUSA 4OHVA 2QLJB 4PG4A 3PW5A 4GC6A 3DLKB 3EZUA 1YJ7A 5D6GA 1F9FA 1S7HA 3BSOA 1FKAF 3H2LA 2GA7A 1YMEA 2Z10A 2BJ9A 1T9TA 2RRNA 3K57A 4C3LA 2KXFA 3AB4B 1EE3P 2DH7A 2MJUA 4HACA 3FB3A 5E3PA 3G82A 2RQCA 2DIVA 1D09B 2AEJA 4RN7A 2DNRA 4ENOA 1BWEA 2B4BA 5LT5A 2LXUA 4R9MA 1LWXA 4LF7J 4DUTA 5DRKA 1G2EA 2GW8A 4UCNA 3D7SB 3G6VA 1S4FA 1UVLA 1FX2A 2CRLA 2FSRA 3RR8A 3DOKB 3R9FA 1U26A 4EBCA 1H98A 3F56A 3OLBA 2XHCA 3KK2A 2NMTA 3QIPA 2K1RB 5GAHU 1VRUB 4CLLA 1QM9A 3KLEB 1B4SA 2HGNA 2Z58B 3D7GA 2UUCF 1NPRA 4DF4A 3I1UA 3KLGB 3WC6A 2DGQA 1HHSA 1FDDA 5D0EA 5G0RB 3NCRA 4OC2A 4AXIA 4JYAJ 4CNYA 3QQCD 4TY8B 2UXDF 5HAOA 2K8GA 4ED6A 2DY1A 2HAFA 2NXNA 3ZC4A 4XPDB 1L3UA 4ORFA 3GU0A 4PKDB 4DPTA 1DARA 2VPYB 5D15A 4X4TA 1FDAA 3ZZIA 2W9BA 2XB2D 3EFAA 3Q24A 1U25A 2ATCB 3I56S 1CBKA 2FT0A 1IR0A 2EO8A 1YSJA 1YLXA 4AQYJ 2RAQA 4URGA 3HCXA 3TARA 1CS4A 3H4DA 1HNWF 2HQYA 2WRMA 1Z4UA 4IH6A 1XTZA 4EU0A 4RBTA 2OD4A 3E0KA 3R7SB 4EMDA 1NRKA 1DQ9A 3K5OA 3PEIA 1YLEA 2OMOA 2DY9A 1F5BA 2GMJA 3CCJS 4MY3A 3K5PA 9ATCB 4OLOA 2OZGA 1Y0RA 3JSMB 2ZZNA 3B8GA 1OJ4A 2RS8A 1VHSA 4FPIA 1A0OB 2CQ1A 3W1YC 1YJ9S 2GJFA 3SQGA 3N4WA 1DZ5A 4YFUA 3CD0A 3E3XA 2RU9A 3UWTA 3BN4A 2VXKA 4DUKA 3IR5B 1UL3A 3O3LA 4AVAA 4Y2IA 1PAUB 3SJFA 4K4UA 2WPXA 4N41A 4OJGA 5A76A 2MQ8A 1AMPA 3MM6B 2GIVA 4I7FB 1KUYA 1NU4A 3TT2A 5BYSA 2V68A 4EWTA 1FT7A 2PRBA 5A2QY 1RAGB 1KRPA 3DRXA 3W60A 3LF0A 3GPAA 2OPQB 2PMZD 1YX2A 3NOCA 4M5NA 4U5YA 4P4IA 3EM1A 2JVOA 4EBDA 2ARHA 4QC6A 4A8XA 2XEJA 2JNJA 5D0HA 3G71S 4ZP7A 4DV4F 4L76A 1GH8A 2JC1A 3VGVA 3TO6A 2EPIA 3CDAA 3MM9A 2AW0A 5DQHA 4OHXA 3KUEA 1FRMA 3CDXA 1T3OA 2DNPA 4UUWA 2Y9HA 2QIFA 1HNZF 2RRAA 3NBPB 4A94A 3TAQA 5AXLA 2E1CA 1BUXA 1LWCA 4PG7A 2AMCB 5DDQC 2WONA 2E7WA 1KLMA 4J9UE 1C0UB 3K0JA 5GAEU 2HVHA 1SQEA 3L2NA 4ELVA 1FE4A 2XCPA 2YNFB 4A8SA 4CM2A 5J2NA 5T41A 4DFKA 3Q23A 3KDNA 5E3RA 4KO0A 2K2PA 4URSA 4NLVA 2C3PA 1HBUA 3G9CA 3G8TA 2I00A 5KTAA 2HWIA 4NLSA 1ROFA 3MEDB 4R3LA 3VGTA 2LQJA 3QJPA 1YBTA 2E66A 1PC4A 1GX5A 3A1YG 1D0EA 3EYZA 3T8WA 4QZVB 4E0AA 2QRRA 4FXDA 4O4GB 2CZ4A 1M1GA 1R57A 2ZC4A 2ZHBA 2JL9A 3R95A 4H54A 4HT7A 2IM1A 4F4KA 4DMZA 3IGVA 4DV6F 1XIQA 4CS0B 3N01A 1TP7A 2EK6A 4B9MA 3UPFA 1X10A 2FLLA 4K4YA 1MSWD 1BWVA 1KLNA 2CY2A 2MSTA 5F47A 4M95A 3MRUA 2ZW4A 1BQNB 4MMOA 1IVZA 1S0MA 4WIIA 5HP1A 4WE1B 3LANA 2XMAA 4WTOB 1QVFR 3TA0A 2HMIB 2P6FA 4IG0B 4GRSA 3AJDA 4PXCA 1EETA 2HLUA 3PW0A 1NBEB 1RT5A 2HYIB 1O8BA 4LIRA 4U8VA 4JI1J 3MEGB 2DD8S 1R89A 4QWCA 4F25A 1WUUA 3FMBA 4DR6F 3DDIA 2B9EA 2CPDA 5GVQA 3A3NB 2DHGA 3MPWA 3PBBA 4RW9B 3B3TA 2Q44A 2BCOA 4R8UB 1JJCB 4ONUA 4GKJJ 4CO5A 1REVB 3IMQJ 3SI0A 3Q2TC 1RU2A 3SFUA 4DSIA 2MQQA 3VCDA 1JLCA 1CJWA 2JHEA 4XPEA 4KHPJ 2PC6A 4F0XA 1AW0A 3M32B 2PDOA 4LFAF 3R9LA 1UVKA 3GV8B 5J1EA 1HBOB 1QUVA 2N4CA 2V94A 2WHOA 1XR5A 3GIRA 3CPWR 1GEHA 2RKIB 2W4CA 3FXTA 1V5IB 2EC2A 3CWJA 1JLGB 3BS9A 1TL3B 4RLEA 2Y0MA 1S57A 3ITHB 1ZA1B 1GXUA 1N5QA 3O1LA 3ENQA 2IQ6A 3VV2B 3HSDA 3U1MA 4O0IA 3GIKA 4B10A 1GMWA 3WBZA 2D3UA 1HNVA 1XJWB 1WHXA 4ECTA 2VASA 1N5YA 4DF8A 4MHPA 3FBUA 1X4HA 5KFJA 2DNYA 3M1VB 2MJNA 2VJUA 3GB0A 2KFNA 4DX6A 4II9A 4YUDA 2FB0A 3LP0B 1WI6A 3QT7A 3IR7B 1YBUA 1C1BA 3NG8A 4KT0C 1FJGF 7FDRA 5HROB 1XMQF 2N3LA 1PGZA 2GAGC 4M1KA 4PXBA 1C4AA 2FVCA 2MQLA 1WG4A 4DR1F 2YWWA 2P2CB 3EICA 1GX6A 5H9EK 2R8VA 3GJTB 1NPPA 1CPZA 4KFBB 3C6TB 3M2RB 2NPIA 4DZDA 4P4BA 3PX6A 2UUAJ 4HKQA 5AG7A 3OTBA 2DJWA 1EKRA 4K4ZA 3C6TA 3M2RA 1TFYA 1FDNA 4USKA 1VQOS 2B9WA 1TIQA 1YVOA 4U9YA 1N32J 3FKBA 1S10A 3R3TA 3FIXA 5AT1B 4MCSA 2GU2A 1SXLA 5B7WA 1VHEA 5IB9A 3CD5A 3CCMS 4ECYA 2D4PA 1CBXA 3TEHB 3C26A 4DYOA 5DM7Q 3MAHA 2UVVA 3UDLA 4E8OA 3BPDA 3IWGA 6AT1B 4IRDA 2ZH2A 2M4MA 5HQMA 5LJ5Y 3B3VA 1S4EA 2BJDA 4UA3A 4KUBA 4Q43A 1RWXB 4Q0BB 4LSZB 3R27A 2M70A 4EZ9A 4P6QA 2IA6A 1Q7LB 2H5JB 5DZ7A 3NGDA 1H3DA 4O0NA 2MHEA 2PI4A 4UFVA 4XPLA 5U47A 3RUBL 4B9TA 3BKTA 2J6TA 3MR5A 2RU3A 2WBRA 3H2UB 4C68A 2KU7A 4ZLNA 2B7CB 2CQGA 5C7PA 2VOOA 4JI2J 2SXLA 5HQ8A 1FCAA 5DETA 1C4CA 5LL6d 3NKYA 1KP6A 2AFUA 2Q6BA 1NJXA 1VKCA 2AGPA 3ZZOA 2ZEHA 3BSNA 3AXKA 4XPCA 4RNMA 3RAMA 3LUYA 1CQMA 4IUFA 2KZZA 4UWJA 1TK5A 3DDKA 3QIPB 3IJ3A 5D8HB 2GNKA 3T9NA 4L74A 2GQCA 2UUTA 1RQ0A 2B51A 2L48A 1Q82T 1RTDA 2JH3A 2KJWA 3QMQA 4MHYA 5GMDA 1S1VA 1S6QB 4B3MF 1FERA 1B0TA 1PYOB 1IKYB 2KI2A 3IEHA 1FJGJ 2C3YA 3X1LB 2H48B 3AY0A 3VGUA 2HQDA 2RC4A 1KBRA 2C3MA 4P2MA 3D3BJ 1DLOB 3MR3A 2VPZB 2AIRB 4ED4A 5DG9A 4UCPA 5HVFA 4DL0C 4N7TA 3V8IA 2DITA 2R2UA 2MLXA 4X65F 3DN9A 1OYDA 4DQIA 2NZ4A 1S6UA 2I9SA 1FEHA 3X3UA 3HJFA 1MROA 4KPYA 5B09A 3K9TA 3D1OA 1Q0NA 2YH0A 3PRTA 4RUBA 3GFXA 1Q8IA 2V4JA 4ID8A 2GIQA 3UN5A 1WEXA 1PUAA 4QR1A 4EVYA 1CPSA 4WCEQ 2X51A 1HFEL 2JZ5A 3UI3A 5KFQA 2BA9A 2BUEA 1SL2A 3K8WA 8AT1B 3RBZA 4OQJA 1U2FA 5K5MA 1Y9OA 4YMEA 1IGBA 5KTDA 3TUJC 3B2YA 3R8YA 3EGZA 3R5DA 3FMWA 3DM2A 4X4QA 4A32A 3PW4A 1KSPA 2I8EA 3N28A 2ZE2A 3MM8B 1FKOB 4B3TJ 2RD5C 4QB9A 2ILZA 4DOZA 3KLIB 1K0VA 2N7YA 4CAWA 1QTNB 2KZMA 2FC8A 2CDQA 3DGPB 1YK9A 4DR6J 3F0NA 3EY5A 2E1RA 3DOLB 4NCBA 3VVUA 3HD2A 3DNCA 5ETMA 3H5ZA 4ZVPB 5D3GB 4JI4J 1CJUB 3US5A 4LX9A 3PR4A 1WJ9A 1YKWA 2VQFJ 2JBKA 3D2WA 2HURA 5A28A 1Q16B 1SV5A 2XM3A 5KFEA 1N5SA 5DWNA 1ZM2A 1VRQC 1R8BA 2XY7A 1IKXA 2ZBRA 2CJQA 2YXLA 2B8QA 1XFOA 2J8AA 1HPZB 2PJ7A 2AGOA 5JPHA 2HRTA 5L39A 4C7IA 3K8VA 3CD6S 1DTTB 4R0EA 3T6JA 3FECA 2DNKA 1NK0A 3ENVA 1K1SA 2WSEC 1TK0A 5A0YA 2HZAA 3JSYA 1D9DA 2FVRA 4X64F 1VBKA 4Q8FA 5JGFA 3AA9A 1BQMA 1F5AA 1NH7A 4N5SA 2JDDA 3QZ7A 1NKCA 3HDSA 1X8DA 2EVNA 3C6UB 3DRSA 3W5YA 2Z11A 2G13A 1XMQJ 2ZKTA 3BYRA 4A30A 1RJJA 4I69A 4ANCA 2AGQA 4OYIA 3QLHA 4RW7A 1Y9WA 4M5DA 3U1NA 4I2QA 5F0UA 4IQXA 3K2YA 4M6HA 3IWEA 1DLOA 1TV6A 1FVQA 1TR0A 1LRZA 2KYZA 3E01A 8CPAA 4GKKJ 3CJ4A 2XULA 3G86A 4DR1J 2E5GA 3I0RB 4QCLA 3JYTB 4LFCF 3HT0A 4Q45A 2BJEA 4ZVGA 2V69A 1S9FA 2ZXVA 3LP1B 3MGDA 1T94A 3L9ZA 3GKRA 4C3KA 4I67A 4F8RA 4MHNA 1U6ZA 1S49A 2HFUA 4LF1A 2LFVA 1KQSR 2C1CA 1NB2A 5LSOA 4YB1P 1R3NA 2CJYB 1I1DA 3W9JA 2DVIA 1IN0A 1WSRA 2J0XA 5A8KA 2OIHA 2YKOA 2DGTA 3S01A 2WPWA 4JI2F 1Y7PA 2RJZA 4P6YA 1T9XA 3MPUB 2X3DA 1TKZA 4DLGA 3CEDA 2VC1A 1NHUA 3V6KA 4WBFA 2I3CA 2FHKA 4BC7A 3CSKA 3ONQA 1YG0A 2MGZB 3FZBA 1XEBA 4OADA 3TJ9A 2AYBA 3THVA 4A8QA 3A3PB 3SJXA 4O3RA 2JFDA 4MJKA 4ZIVA 1LFPA 4NRTA 5DDPC 5L38A 3S9MA 1IJFB 1N34F 3HO1A 3BGUA 5AXNA 3QSYB 2UUWA 3C14B 3LP0A 2YKNB 4C2ZA 2PO4A 2XYGB 4Y2AA 2ADCA 2BMBA 3BSAA 8ATCB 2AEMA 3CIMA 3RG6A 4F0KA 3DRPA 1FT8A 4WFBQ 3R1LA 3DLEB 2XEXA 4C8MA 3ZZUA 3K5LA 4DFPA 2Z3MA 2EFGA 1M5SA 4PQAA 4UY8T 4OZ3A 3M2UB 4CRZB 4LR9A 2LU1A 3TVYA 2W7AA 2KB2A 4NSQA 4ZPTR 1XK8A 2HNYA 4B3OA 4YY3F 3FRYA 4B3SJ 2LQ5A 2QYCA 1HI8A 1TKZB 2XSJA 4DPUA 1VQ9S 3JYTA 3VWEA 4DXLA 2BEIA 3IAS9 3I96A 2QJ8A 2MXYA 4QBJA 4CNZA 3JVNA 1Z2LA 3VQSA 4X4NA 2ZD1B 4JI6J 4DLEA 2FIWA 1S9EA 2OB0A 4YB5A 4MK8A 3BQ1A 2MQOA 2BJ8A 2IAJB 1IB1E 2CQ4A 3LAMA 2GZOA 3TAPA 1TL4A 4YR2A 2PA8D 1FY7A 1BY9A 4DL7A 4DV0F 1TMJA 3TRGA 4IG0A 3C6UA 3DRSB 1S79A 5GAGI 2OGUA 1IBMJ 2XS5A 3U27A 4XDDA 4DV5J 1SKWA 1YR0A 3EUNA 3W5ZA 2VFTA 4PK2A 1UWBA 3KKFA 2M0GB 2P9CA 5BR8J 2FGOA 4B3MJ 2JJ4D 4C8LA 3HVTA 4FBUA 3FMCA 2QIRA 1XF8A 2R8GA 3RNZA 1HWLA 4BBHA 1WI8A 4I2PA 4MIWA 1CSJA 2OKQA 3LWUA 2QL9B 4KBIA 4MKVA 5AG4A 3T5LA 3HVRA 1X5PA 3B54A 4OX6A 3ITHA 3GYXB 4ED0A 1KFDA 1SC6A 1ZAWA 4CGMA 4FVCA 5T7LA 3K58A 3H8GA 1HNXJ 1F5CA 1Q2DA 2Z2MA 1SC4B 3TEGA 3HM9A 3KG1A 2YNDA 2DR6A 3JS9A 5CHCB 2LQ8A 2R7XA 3Q22A 1JJHA 1RAOA 5CD4A 1OY9A 2A1BA 3I55S 1XMTA 1DTQB 1IBMF 1RLCL 1NUEA 3V7ZA 1D3WA 5HI7A 3I5CA 4CT9A 4HDHA 4WFZA 3M32A 1VQKS 3IFEA 1NK7A 4B9UA 4R57A 5FLXY 1ZA2B 1JMTA 1YVFA 2PE3A 2ASLA 3LODA 4NLXA 3RW7A 1Y4ZB 3H59A 3B3CA 5BXIA 2QMUB 4ZN1A 1CC7A 5JUMA 1IKWB 4NF1A 1UETA 4FS2A 4K30A 1OO0B 3GQCA 4IR1A 2IMWP 4FYDA 3HMJG 2CPJA 1S76D 2LDIA 4F0MA 2N82B 4KGZB 1KQKA 3RRKA 2V8PA 2HHWA 2XMJA 3IRXB 4WFNQ 3PFEA 2CQ3A 3RTVA 1TL5A 2RS2A 2EFPA 5KFNA 1N0VC 5E5NA 5HMZA 4GO5X 5LMNF 3CVKA 4LVNP 3QT8A 5IS2A 1KR4A 2G0BA 1TKDA 3D3CJ 4WXWA 3PKYA 3VAHA 3GJRB 5J1QA 4KVXA 3ZTPA 1FK9A 1QSMA 5C42B 3IXQA 4BDPA 2N3OA 4RUCA 2R7HA 4K4XA 5D4LA 5KFRA 4ELUA 2RILA 2ZEDA 3H5SA 4R3KA 2VQEJ 1BHNA 4F2SA 2RT3A 2ZBQA 1J5OB 1Y00A 4KKOB 4CDIA 1S72S 1NZAA 1XEZA 1BQNA 4YHHF 1L5UA 4TWEA 4A31A 1N5TA 3KNGA 4XPDC 1L3KA 2GMLA 2K7JA 2V4QA 2H51B 3BEGB 3MFIA 4IO9Q 3EJMA 1NAQA 1S1WA 5B0CA 2DPTA 2ZD1A 2XO6A 4DNCA 3LQVA 2J8SA 3W63A 2PJ9A 4BWJA 2LP4A 1KTQA 4ZITA 1LW0B 1UWBB 5CH7B 4DUYF 4NJQA 2VG6A 3IM9A 4C98A 2OH2A 3M9MB 3OR1A 3GFYA 4E2FB 3MEDA 2M7SA 1M5KC 5FD1A 5ETQA 2UXBF 3MEKA 2KG0A 2XGQA 2DGUA 3A8EA 2DGWA 4TXSA 5C24A 1R8CA 3C8YA 2QC3A 4ZPWR 1RTQA 3PEJA 2H54B 1F2OA 2GGPA 3F73A 4OC4A 2KHCA 4DG1B 5H86A 2KDOA 2MQNA 2OPRA 2KM8B 3EPIA 2FGCA 3JQJA 3KHHA 2UXBJ 2H4YB 4H4OB 4ETZA 2VBYA 3PO4A 2N4DA 3CB4A 2DHSA 4LF5F 2BOAA 4MKYA 2APOA 3H5YA 3WR7A 3CPAA 2B4PA 1GXLA 1PJ5A 2DPJA 4FWUA 3KFWX 2Y1JA 2EFNA 4NYPA 5GCNA 4YFJA 1FFSB 1FRKA 3CCES 2VFSA 1H8LA 4QOTA 4CYNA 2FVQA 4R76A 1PCAA 1ZPWX 4H4KA 5J2PB 2CUYA 1I12A 4FD4A 4K0KJ 3PJXA 2MZQA 5J2QB 4KFBA 3A12A 5AXMA 2Q0YA 3U02A 2AJ1A 2B4OA 2O01C 4B3RF 1YX0A 2DPIA 2M52A 5IFMA 2VA3A 1RWOB 4FBEA 3I0SA 1SJQA 3MFHA 4RW6A 3D66A 4DI6A 2XI2A 4OZNA 4B3OB 1YRXA 2X7IA 2QO3A 1TMMA 2H3EB 4RNFA 2D3OR 1RK8A 1JKHA 2NREA 2IM2A 3GR0A 2IFXA 4UQTA 2BM1A 3KJVB 3CJSA 2VIHA 4A8KA 3KJVA 3M6XA 2A6OA 2B9XA 3BHXA 2QMXA 3FCWA 4ZJOA 5KFZA 2ZHOA 2V8GA 2OJ3A 3BLNA 2REEA 5G0RA 1DTDA 2OFHX 2K06A 3IWLA 4GKKF 5D4PA 3UDCA 4A46A 4L8AA 1HBNA 3PYEA 4UCMA 4LF9F 3W9IA 2XWXA 4U95A 1CJKB 1ZZFA 4KV8A 4Y00A 3VATA 2VG7A 4RW4A 5LRGA 2B5GA 3NGKA 1VQYA 2GQ2A 4F02A 2C22A 5H9FK 2GCFA 3SCKE 3SMZA 4OHZA 3R5AA 3PHEA 1CC8A 4WZQA 3D6FB 4PZVA 2KYXA 2D4OA 3T3FA 3BQ0A 4LSNA 1JNRB 1RWKB 4OI2A 4PRFA 5CYMB 1R8AA 2O5DA 2IBOA 2X1GA 3P3DA 3SSSA 3VZHA 4NLGA 1X5TA 2HRYA 1I94J 5DGBA 1CM0A 4QU7A 3H20A 3FH4A 2AF6A 1NSAA 3W61A 4QYZJ 2HLTA 2U2FA 3OVBA 4ECQA 4RKUC 3KK2B 1GMUA 1NK8A 5KFTA 2GFQA 2C3OA 4P9SA 4OI3A 1L3TA 3QZ8A 3A4TA 4KSIA 1SIWB 2IVMA 3ENAA 5I3UA 2G0IA 2GLFA 3GV7B 3GCWP 2J9CA 3RB3A 1UEVA 3FNCA 4OZJA 2C2OB 1BMQB 2BANA 1S9GA 1KFSA 1T95A 2VU5A 4FD6A 1IKWA 4WTYA 2QGFB 1X9MA 5KG4A 1VQ8S 1JIHA 4ZY0A 2G1DA 3D7FA 1NDPA 4WP8A 3R9EA 1HPZA 3RU0A 1WOPA 3JXOA 3MMAA 2JEIA 3OQ2A 2OPRB 1RTJA 1I21A 1F9HA 2H5IB 4RW7B 3TA1A 3ISXA 3B78A 2KG1A 1CULA 1YQEA 3DNSA 1HWUA 3PO5A 5KG5A 5EX3A 4NPOA 5HSPA 3L7OA 4ZLLA 2AYMA 1WC6A 3IBCB 2AFWA 4RBVA 1NB7A 4CWBA 1JNZB 3HHKA 4YEAA 3OXFA 5K20B 2VG5A 1LCPA 1Q1KA 3JTOA 2RIJA 1SB6A 1IKXB 3BBFA 2DO4A 4MFBB 2H65B 2YPYA 4N8OA 2UXDJ 4JB8B 4MFJA 3VVTA 4H4KC 2GQQA 2YKMB 3OVSA 1HWJA 5IT0A 4KYZA 3S6FA 4AB7A 3G8SA 1IICA 4FXVA 2RF2A 1RYRA 5T14A 4MFKA 2NPFA 1RTHB 1UVMA 4ERDA 1HEEA 1JLAB 3NAHA 4KRWA 5LOQA 4CLUA 2R7SA 1GNKA 4C9DA 3CJKB 4LFAJ 4FPRA 5IT4A 1KDNA 1ON0A 1X5OA 1TXRA 1NM2A 3QWPA 1YQHA 3KG0A 4Y49B 2V6AA 3DR8A 1ZAXA 2HS0A 4DX8H 4Y0FA 4JV0A 2R2RA 3B7IA 2QX0A 2D1CA 3I4HX 3MMBA 1HWIA 4IG3B 2ZEGA 4FD5A 4MXUA 1LXJA 2EBGA 1LWFA 2WUUA 4Z7YA 2UV8A 4J9OA 1RT4A 4DU7A 4I68A 3CJ3A 3M30A 1JX4A 3EX7B 2HK3A 2P6GA 3K9UA 3N79A 2F4VJ 2FHJA 4USHA 2EXUA 4LF7F 3GYNA 3O8WA 3NGSA 4ZHRA 4KOXA 1RTIA 2M8HA 1KQFB 1X9SA 4O4RA 4LF6J 4I2PB 2JLMA 4X2TA 3L3CA 4URQU 4YHHJ 1VQPS 4CCHA 3RBUA 4EFAC 2CPXA 4CRYB 4JV2A 4IOBA 4NFRA 2BJ1A 5D4NA 5AE2A 2W01A 2BYCA 2ZBIA 3DRYA 1VGYA 4OC1A 2GIFA 2CQPA 4DV3J 2H9ZA 1U09A 2JEJA 2YKNA 4UUXA 2OPPA 2PJ5A 1X5SA 2P0WA 2GC8A 2ZDOA 1R6VA 4TKTA 3MOJB 3IGRA 3BGRA 1HI1A 3PYFA 2R7TA 2EBJA 2JX2A 2PVVA 1RI7A 3MM9B 2HHQA 1N48A 5F0WA 1PYTB 3WABA 3ZNJ1 3FBCA 1JLQB 4Q0BA 2MGZA 2CVEA 1T9WA 2C28A 1K1QA 1WEZA 3QNWB 2JEGA 4NRUA 1WWHA 5I42B 1KONA 2J7KA 2I5JA 2Q66A 5G20A 2VBWA 2M2BA 3IP0A 4ZN3A 1RHUB 3CDWA 3HSZA 5CCMA 2IDLA 2RB7A 4DR4F 1Q2CA 3B4DA 2KKHA 4AUKA 2X1BA 3DI6A 3DLGB 3J7YU 4NASA 4DL3A 2EFVA 3VARA 3MR7A 2DXEA 3QB8A 3R9GA 3OFFA 1PYTA 4I56A 2PR8A 4JI4F 1MMLA 3D28A 2A4NA 4CM0A 2KM8C 3CC4S 1XMBA 2O28A 1TL3A 3UN3A 2CNSA 2BZ2A 2CPYA 2O3DA 1JLBA 2EG2A 3NS7B 2VPXB 2OR4A 1VISA 2ANPA 1QAJA 2O53A 3I0RA 3CXSA 2PJBA 2B58A 1ZM3A 1R27B 2NSMA 4EI2A 5E41A 4AT1B 1RAJA 3DOMB 2BKNA 1YZ6A 2FY8A 2CQ0A 3AH6A 3P96A 3HHLC 3GV5B 1MWQA 5J1EB 3M6VA 3BI0A 1JWQA 2BW7A 3KL9A 4CYPA 1DY3A 4LFBF 3MM7A 4DFJA 4NXNF 1R43A 3OL9A 4LRBA 3DFEA 5HMWA 4UT4A 2CJ9A 1LAPA 2V4RA 2L3MA 2EUIA 4MKBA 5G1ZA 2LDYA 1AFIA 4ETXA 1KHVA 3DI6B 2V9WA 2HEKA 4CTAB 2EW9A 2MLZA 1N6QA 2HBYB 4RW9A 3AD9C 1CJTB 1OMSA 2QL7B 5FDLB 3TUPA 5A0YB 2WSFC 3PIPQ 3G82B 1JLEA 4USJC 4C11A 2ZNYA 1X4EA 4DX7A 5M2PA 9RUBA 3MEGA 1ITPA 2HFZA 2GGPB 3KOAA 3W8GA 3AD7C 3MGJA 2XHWA 4R5PA 3CDBA 4M5DB 2FVSA 2K3KA 1WORA 3JRUA 1NH8A 3BXMA 2DGOA 4ZX9A 1ICEB 3M8QA 1WACA 4KKOA 2PJ1A 1JLGA 2KXNB 2HS4A 2CPIA 4DJBA 1IIDA 1F2PA 4IF5A 4MFZA 5JM6A 4Q8EA 4WE1A 3TOQA 2VQEF 1U1LA 2B9YA 2W7PA 4PPZA 2VH7A 2VDHA 2CYYA 3H5UA 2IC3A 4M3SA 1UPMB 4FF2A 4KORA 5D29A 3CW2C 1IU8A 1X4AA 3NS6A 2FZKB 1MMDA 3VAMA 1W7WA 1CG2A 3IRWP 3P5BP 5MAOA 3NA6A 1ZG7A 3GG1A 4HT5A 4UFWA 4IOAQ 2CADA 2FHJD 5DWMA 1IBKJ 3UCGA 3BR8A 2VFUA 3IBWA 4XNHB 4NLDA 1U7LA 5KT6A 4NYOA 2B5JA 4B17A 2NR0A 2POKA 3PIOQ 2CG8A 3BREA 5K8MA 3SI2A 3UDVA 2KJVA 1RAFB 2Z56B 3FNNA 1J5OA 4QPTA 2A10A 4A47A 4BC9A 3DDDA 1NXIA 1B3TA 3MPDA 5KFPA 5KFMA 3DGPA 1YGYA 2E9RX 4C8KA 2W8KA 2HIQA 2R8KA 3UQSA 3HHNB 4PWWA 1DRZA 4IG3A 4LBPA 4CP5A 2WB4A 4ZOSA 3QSIA 2DNMA 3EVOA 1DTQA 1YW4A 7CPAA 1FJEB 1FD2A 2V2ZA 1SKUB 1OPIA 4O4GA 4MFQA 1FJCA 3CCSS 2DISA 2VQFF 3EZOA 3KLHA 2Y0SD 3W62A 4HNYB 4B3RJ 3MEEB 3V4IB 3DRRB 1IYKA 2CPZA 4OX8A 3G4SS 3CTRA 4NLTA 1FKPA 2CNMA 2OH1A 5LM7E 1C1CA 3RGIA 1BQXA 2DHHA 5JVHQ 4LRCA 2J9EA 4NZ0A 3C16A 4K4SA 3ADAC 3T19A 2MZJA 4C8ZA 4N47A 1OWXA 3CJ8A 4ZYQA 3D2PA 1U1KA 3FSXA 2RDDA 4AVCA 2OPQA 2HIYA 4O44A 3KK1B 4WYLA 4XNHC 1FEEA 4DV5F 5F8GA 2E44A 1PO6A 2E1PA 1FXLA 1HNZJ 4A37A 1Y11A 2RHSB 1H73A 2V4JB 3DMJB 1MW7A 1S1VB 5KFKA 2PEBA 4KTQA 3OV7A 2P9GA 3E51A 3KLIA 1UPPA 2J8MA 4QWEA 1FKOA 2IAJA 5LSRA 1O6XA 1TKFA 3IWNC 1ZAVA 3MAAA 1ZLHA 3R7NB 1VBXA 2B8PA 3OXLA 4NXYA 4JI6F 2IJRA 3KR5A 1F3FA 1FX4A 4RNOA 3TZWA 5GMKa 5DM6Q 2PA3A 3RZAA 2GVZB 1KLMB 3GUXA 2PSZA 2CQHA 3S1TA 3OW2R 4CYQA 4ED8A 1YIJS 2BDPA 3FBEA 1FRJA 1HBNB 3RYLA 1AROP 2E29A 3LGMA 2ZDPA 4P74A 2E5IA 3FEXB 3W2VB 3ZZPA 3RBXA 4C3MA 1IQTA 4MRIA 4NXMF 5IC4B 1CP7A 1RHJB 4HI2A 1RWVB 2CNTA 2VZYA 4CYUB 3NNAA 1TK8A 2XLJA 4BHQA 3OTDA 1T11A 2CNLB 3QJJA 1QSNA 1RCOB 2AJ4A 3TAMB 2QYVA 2B5GB 3HSGA 3DLHA 5IM0A 4JV5F 1PBAA 2BL1A 2VBZA 2AJFE 1L3VA 4JI3J 4KOTA 5HMNA 1KD1T 4LF9J 4RR5A 4OZ2A 5HROA 1R8PA 3ZZZA 4MCPA 2XLKA 3D4JA 1IKYA 3L7UA 1T03A 2VHGA 5E7OB 2E5LJ 1OS5A 2R42A 3AT1B 2B4DB 3DR6A 4OI6A 4Y6IA 1G4CA 4HR2A 1Y5IB 2V2KA 2FTRA 4UOFA 5IV4A 3D6HB 2HVDA 1LOKA 3R2CJ 4F3QA 3PB9X 1JQGA 2DR9A 3TANA 1Z5RA 5LMUF 2Y8YA 3J81j 3EGWB 2CQDA 3D7DA 4HI1A 3ET6B 2OHDA 1RU1A 2XEFA 4XDCA 3DLEA 1RAIB 2Z3NA 3A8JA 1YREA 1JJ4A 2HHHF 1U47A 4P2XA 2BVZA 4IRCA 2YX7A 4GS4A 1N52B 4X4VA 4UTGA 3HVWA 3GWCA 4KE5A 1VQSA 2GX8A 3CXCR 4C0HA 3I9SA 3O44A 1CX8A 3MM5A 2CZ9A 1Q8KA 1U49A 1HR0F 5I4MA 2W9CA 4AL5A 1VLOA 2ROEA 1M4DA 1FWPA 2QZ8A 3P2FA 5BR8F 2B6AB 3HJVA 2GO9A 1B7FA 3B6BA 2HQCA 5DJBA 1TUGB 2CA9A 2DXQA 2Q4YA 4YR0A 4D3HA 2XCAA 1QAXA 1K73T 5KFFA 4M6IA 3NH8A 2B3VA 3ETOA 1X4FA 4HEA9 2EKYA 4KPCA 1U4BA 5KAKA 5AE3A 2F9JA 4OZ1A 3EGVA 2IRXA 4YDDB 4N76A 2EG1A 5C88A 2AHOB 1DQAA 4OX9F 2RKIA 1HW9A 3AA8A 4Y65A 1A6LA 3S6HA 4HACB 1CJVA 5HQLA 4JI5F 4UIAA 1YJTA 3NL0A 1ACMB 2ZUAA 5J2QA 2HVEA 3IBFB 4J9RA 4X4PA 1HA1A 4BCAA 2YKAA 3TX0A 2LQBA 4LBIA 2WBMA 4PXDA 3ZNUA 1S1WB 3FSYA 4MKAA 4ZPBA 3ZZRA 4GXHA 4WKRA 4NGRA 2FPHX 3IWWA 5EWEA 4QWBA 4UZBA 3ZTQA 1P6TA 3OL7A 5LRKA 1JJ2R 4GO7X 4FAIA 2XYHB 3GYGA 3V2UC 1FWLA 2BR0A 3CJQA 4OC3A 1FTRA 1K8AT 1FXDA 4HTJA 2VFVA 1TKHA 1R0AB 5EDWA 2RRBA 3I5BA 3W64A 3M1VA 4Y2CA 4OI4A 4HHHA 3MTJA 1YZ7A 1XNRJ 3IN5A 1F2GA 2JRSA 4ZP6A 4PEOA 2CXEA 4USVA 3ZTOA 2F3JA 2PT0A 1EX8A 4OYXA 2QSFA 2V67A 3M8SA 3MR2A 1QDUB 4M5JA 5D3GA 3W91A 2W8LA 5KFVA 1Q95G 5H9FJ 2H5EA 4KGXB 1HQ2A 1XR7A 3UCZP 1VQ5S 3HHLA 3SV4A 2PQ8A 4RX6A 3NMAA 1QE1B 2IVYA 3KWMA 4KZTA 5L1JA 4K4VA 1VIOA 4FNIA 2Q51A 2L9DA 4ECRA 4MYTA 4JI0J 1IM6A 2FS5A 1N54B 3C2PA 3QAYA 1S59A 3RR7A 1FWKA 4NA2A 3KASA 3BR9A 1SKSA 1GYTA 1N71A 1DAXA 1NEEA 2E9ZA 3TOBA 2VZ9A 4ZPVR 2A18A 3C66A 3BO3A 3P6YC 2P6EA 1ARLA 6CPAA 3IS9B 4CO1A 2FIAA 4WPAA 2E5JA 3CCRS 4FBTA 2MY7A 5F8NA 2E1MC 5KT7A 1RT2B 2OEMA 4WWVA 4V1Ak 3K5MA 1ZBTA 3OTOJ 5B0FA 3NMRA 2L9NA 2KFZA 2BE9B 3BBCA 3CUNA 4LIWA 2REFA 2YNEA 4LMZA 5CAAA 2XC9A 1MWYA 1WNEA 2YH1A 1PAEX 4C0OC 2CF4A 4CLFA 1WC5A 5I0CA 4TN2A 3S8SA 4RZRA 2YY3A 2LA6A 3HT3A 5A8RB 2EK9A 1T0TV 3C3LA 4KOYA 4QYZK 3HVTB 1FDBA 1SH3A 1EP4A 4MI4A 4HKFA 4PG5A 1SH2A 2DHAA 4PCQA 4CLZA 5JMNA 1NK6A 4OMFG 4GVBB 4CH0S 1UWAA 1RLDA 3MM6A 2QA2A 4KB7A 2JDJA 3UVJB 2BBEA 5LXYA 1VHIA 3EXCX 4ZVSB 1S5KA 2RFHA 2FVGA 1U0HA 4OYWA 2Z8QA 3M8PB 4A8WA 4DPYA 5F49A 2CKWA 2L41A 4OYZA 2QMLA 3D1QA 4ID5A 4NEZA 2PJAA 2M3DA 4BWMA 2VJVA 3OFHA 4C8YA 3I6PA 1VI7A 2IPOB 4J37A 4ZA1A 2DYAA 2E9TA 1UP1A 2ZW6A 3KI9A 2WW8A 2NYHA 1J5EF 2ZBPA 3O2IA 3ISND 3TC8A 3C19A 2AD9A 4JXQA 3W5XA 1B0VA 4YWYA 2VEZA 4GVLA 3M6UA 4UEZA 1I51B 5L8RC 1DBDA 2AQ4A 2WTFA 5ETRA 3H8EA 1S12A 3NBPA 1UKUA 3QBCA 2DCLA 4I6WA 5I3PA 3QAEA 1T9VA 4ZPAA 5JH9A 3FQKA 4YR3A 3G3SA 5CQGA 4EZ6A 2XGPA 1FFWB 1WKJA 4J90A 1BLUA 2GE3A 3QRRA 3KUHA 2YNIB 4X4SA 3KMQA 4S0MA 3I3GA 4NGTA 1ZG8A 3TWZA 1KQGB 1C0UA 2AX0A 1B0PA 3UFCX 3PP9A 4DUZF 2CNKB 3DRPB 4IQMA 1GQEA 2J6SA 2VPWB 4ZLJA 5FDLA 2VA2A 1K47A 3M9OB 1SVDA 4Z2XA 1LAMA 1RT3B 4CTAA 4NA3A 1XBWA 2B3UA 2XSJB 4I7FA 1J2VA 1JLBB 3KUGA 1KUXA 3VHQA 4DV7F 2HFNA 5IC6B 3UD4P 2PR1A 4O3PA 4K0KF 1HHTP 4UY85 2AT1B 3FJ2A 4FNHA 1SH0A 3NGRA 3TUIC 1CQNA 2LEBA 4JYWA 1JKHB 2AU0A 4DV1F 1P0HA 5AE1A 3JTNA 1R8HA 1OBRA 1I5OB 1VHFA 3MWBA 1G6BA 2IMOA 2GFFA 3ULHA 2F65A 1RT6A 2F5GA 1U6BA 3FEEA 3LA0A 4KGVB 3MI7X 2MPUA 4TLRA 2WVBA 1RABB 3T9ZA 2QTWA 3CE8A 3UO0A 2MB0B 4TNUA 4NXMJ 2J76E 2BKPA 2I1RA 4OX7A 1B87A 5EWFA 3E2EA 2RNEA 3PY8A 2BRKA 3VF0B 1JLQA 3OR2A 4USIA 1VC6A 2ZH9A 4AVBA 5LXRA 1ZS6A 3DYAA 2LQ9A 4QJVA 3L95X 3L4BC 2KVIA 4DV2J 2BE7D 2QEXS 3J7A1 2ZW7A 1X4GA 1QQ9A 1X4BA 4ONWA 3HP6A 2GIRA <