2BEIA

X-ray structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
156
Chain Sequence
SVRIREAKEGDCGDILRLIRELAEFEKLKISEEALRADGFGDNPFYHCLVAEILGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 2
publication title Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 156
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2beiA00
1IICA 4J3GA 1TIQA 4KOSA 2Q44A 4JXQA 1KUVA 1MJBA 4PK2A 2Z10A 3LD2A 1WWZA 2QIRA 3GKRA 4B5PB 5FVJA 4XNHB 3P2HA 4HKFA 1OZPA 4R87A 2B3UA 2FL4A 4BMHA 2DXQA 4CAXA 2P6EA 5F46A 4Y49B 2B58A 3R96A 2VQYA 3B8GA 1J4JA 4U9ZA 3FRMA 4JXRA 2PR1A 2B5GA 4KVXA 2B4DB 3W6SA 2CY2A 3JUWA 2GIVA 2D4PA 2F5IA 2QMLA 1UFHA 3FIXA 3T9YA 4KUAA 3IGRA 4R3LA 2PRBA 4OAEA 3UY5A 3C26A 1MK4A 4MI4A 4QUSA 3VWDA 4KOUA 3R9EA 4RS2A 2H5MA 2PDOA 1QSMA 4KOTA 1U6MA 2I00A 3V8IA 1BOBA 2ZW6A 4HNWB 4MY0A 2QECA 1M4GA 1Y7RA 3TOAA 1S7KA 1M4DA 2Q4VA 3FYNA 4KORA 4QB9A 4U5YA 4ZBGA 1RO5A 4KLVA 1BO4A 3QAHA 5KTDA 5F49A 4HNXB 4FD7A 5JQ4A 1M4IA 3SHPA 2CNTA 4CS0B 4H6ZA 4AG7A 3H4QA 2I79A 3DR8A 1I1DA 4H89A 5J8FA 4MHDA 4IUSA 2K5TA 2FS5A 2P0WA 2PQ8A 2OB0A 2D4OA 2G3TA 3TO7A 5C88A 1K4JA 3W91A 1YVOA 2VZZA 4AVBA 1Y9WA 4F0YA 2Q4YA 2JLMA 4CRYB 2IL4A 1S7FA 4ORFA 1B6BA 2G0BA 1L0CA 1WK4A 3TO9A 2VBQA 4MBUA 1KUYA 3MGDA 1S7LA 2REEA 2AJ6A 2WPXA 4XPLA 4XPKA 1S5KA 3CXPA 3TE4A 4PK3A 5HMNA 3F5BA 3S6GA 4QBJA 4CAWA 4R3KA 1N71A 1YX0A 1LRZA 2R7HA 4KOXA 5E96A 2OU2A 3EXNA 4KOWA 2VZYA 5C82A 2X7BA 4QVTA 1FY7A 4U9YA 4DNCA 4EVYA 1Q2CA 3BLNA 3BJ7A 1YVKA 3R95A 3FNCA 5H84A 2FT0A 4X5KA 3QB8A 1IYKA 1Z9UA 4FD5A 4E8OA 2R98A 3W6XA 4NSQA 2FXFA 1QSOA 2ATRA 1NE9A 4PSWA 4XPDC 1P4NA 5DWNA 5DWMA 1YK3A 1CM0A 2J8RA 1PU9A 4B5PA 1IB1E 5CNPA 2VEZA 1R57A 3I3GA 2EVNA 1M44A 2C27A 3DSBA 4JD6A 4KOYA 2FIWA 3R9FA 5H86A 3BJ8A 5KTCA 2FE7A 4MJ8A 4KLWA 4LUAA 4L89A 5I0CA 1Z4RA 3E0KA 4R9MA 3TCVA 3F0AA 3D2MA 2GE3A 3S6FA 2B4DA 3EO4A 2OZGA 3SXNA 4OLLA 1I21A 4LX9A 4JLYA 3DNSA 3P2FA 1XEBA 2KCWA 4MY3A 1S7NA 2OH1A 4KOVA 2R8VA 3KKWA 2ZW5A 4KZTA 3TTHA 2RC4A 5F48A 3CXSA 2ZW7A 4CAVA 4XNHC 2O28A 3GYAA 4KUBA 4E2AA 1XF8A 2JDDA 3G8WA 2BSWA 4HNYB 3PP9A 1IYLA 2J8NA 1XMTA 4Y49C 4CRZB 2VI7A 2VXKA 4I49A 4GS4A 3DR6A 2Z11A 4ONUA 3JVNA 4AVCA 2GANA 2P6FA 2FCKA 3CXQA 4PSXA 3PGPA 1YR0A 4NEXA 1RXTA 2BEIA 4YFJA 1Y9KA 3D8PA 4KVOE 2PR8A 2Q04A 4UBRA 3WR7A 4UWIA 5F47A 1NMTA 4IF5A 2AE6A 3ZZIA 4RI1A 2HV2A 1S3ZA 3RYOA 4E0AA 2B5GB 4UWJA 4AVAA 3S6KA 1KZFA 3FB3A 4KVME 3TT2A 1I12A 2BUEA 1YREA 4FD6A 2P6GA 2J8MA 5HH1A 3NE7A 3S6HA 1MJAA 1QSNA 1S60A 2A4NA 4UA3A 2B4BA 1V0CA 1MJ9A 3TOBA 1QSRA 2CNSA 2OZUA 5J8CA 3D2PA 4L8AA 5KTAA 2ZPAA 4M3SA 4JJXA 1Q2DA 1YLEA 4YGOA 2Q0YA 4R57A 4OADA 1XIXA 3I9SA 2Y0MA 3TO6A 2REFA 3OWCA 3SXOA 3T90A 3PZJA 2G3AA 2Q7BA 1NSLA 5IV0A 1CJWA 3K9UA 5IX3A 1XE4A 4QC6A 3LODA 3DDDA 2JEVA 3EC4A 2HQYA 5EC4A 3R1KA 2FSRA 5GCNA 1ON0A 4K30A 2CNMA 3D3SA 4NXYA 3GY9A 1IIDA 3ZJ0A 1SQHA 4YRHA 3TFYA 2ZW4A 5ISVA 5IB0A 1GHEA 4H6UA 1VHSA 4JWPA 4NCZA 5JPHA 3VWEA 4FD4A 4B5OA 2ARHA 1YGHA 2JDCA 4AB7A 2OZHA 2R1IA 3EY5A 1P0HA 1Q2YA 1QSTA 4F6AA 2Z0ZA 3FBUA 4XPDB 1VKCA 2EUIA 1PUAA 1B87A 2BL1A 4II9A 3F8KA 3G3SA 2NMTA 4M85A 2ZXVA 3FXTA 2PC1A 3N7ZA 1Z4EA 2FIAA 3EFAA 4AG9A 5EBVA 3R9GA 4PV6A 3IWGA 2B3VA 2HUZA 2PSWA 4NF1A 1KUXA 2WPWA 1M1DA
chains in the Genus database with same CATH superfamily
1IICA 4J3GA 1TIQA 4KOSA 4CGPA 2IQ6A 3FEDA 4Z65A 2FVGA 3PB9X 2EWBA 2PJCA 2ZEMA 3B3SA 3B3WA 2Q44A 1ZO0A 3PFOA 5G20A 4JXQA 1QQ9A 4RN7A 1KUVA 1MJBA 1YLOA 4IAVA 4ZY1A 4PK2A 5AG7A 2YNEA 2Z10A 4JYWA 4UEEA 4P45A 3LD2A 4OP4A 4YWYA 5LYDA 5JH9A 1WWZA 2GLJA 2PRQA 4OIDA 2G9DA 2QIRA 3PRTA 3GKRA 4B5PB 5FVJA 4ZX9A 4XNHB 2OR4A 4A38A 4B13A 3P2HA 4HKFA 1OZPA 4R87A 3KI9A 5K8MA 2B3UA 2FL4A 5G1ZA 4BMHA 4PXCA 2DXQA 4NGRA 4F9UA 4CAXA 2Z3PA 3SJEA 3K2KA 2P6EA 5F46A 4OC2A 3WABA 5I4MA 6CPAA 4Y49B 2B58A 3R96A 2QYVA 4C68A 2VQYA 3B8GA 3PB7X 4WWVA 1J4JA 1NSAA 2GLFA 8CPAA 2PJ5A 4U9ZA 3FRMA 3BI0A 4JXRA 1F2PA 2PR1A 4R7MA 3CPAA 1TKHA 2PJ9A 2B5GA 2YNCA 4KVXA 4GM5A 2PJ4A 2B4DB 3RZAA 3W6SA 2CY2A 4DYOA 1JQGA 3JUWA 2ODFA 3NH5A 2EO8A 2GIVA 4R8FA 1PYTB 2D4PA 2F5IA 5F09A 5LYFA 2QMLA 1UFHA 4TWEA 2BCOA 2ZOFA 3FIXA 3IWWA 3T9YA 3BHXA 4KUAA 3IGRA 4R3LA 2PRBA 3IEHA 2BOAA 4M6HA 1GYTA 1VHEA 4OAEA 2DF5A 4KSFA 3LACA 3UY5A 3C26A 1MK4A 4YU9A 4MI4A 4QUSA 2YGWA 3VWDA 4MMOA 2GFQA 2XEGA 4PPZA 4KOUA 3R9EA 4RS2A 2H5MA 1CX8A 2PDOA 1QSMA 2O53A 1U6MA 4KOTA 3D66A 2I00A 3V8IA 1BOBA 4IK2A 3CZXA 1IOFA 2ZW6A 2Q51A 4HNWB 3SI2A 4B11A 1ZG9A 2NSMA 4MY0A 2QECA 3HUVA 1M4GA 3WT4A 1Y7RA 3N5FA 2AFMA 1CP6A 3PFEA 3IFEA 2WYRA 4O23A 1S7KA 1M4DA 1Z8TA 2Q4VA 3TOAA 3FYNA 4KORA 4P4EA 2CTBA 4P4IA 3FVLA 3SI1A 5KTDA 2PJ8A 4QB9A 2HB6A 4U5YA 3B3VA 1RO5A 3KHXA 4X2TA 4ZBGA 3PB4X 3FX6A 4KLVA 1BO4A 3QAHA 4B10A 2V8HA 3JRUA 4R6TA 4Q36A 4HNXB 5F49A 4B12A 3GLJA 4FD7A 4PXEA 4FUUA 4EFDA 5JQ4A 1M4IA 2QVPA 3SHPA 4ZY0A 2CNTA 1R3NA 5K8OA 4CS0B 4H6ZA 4MFKA 1OBRA 1IY7A 2RB7A 3D4UA 1IOIA 2ZEDA 3H4QA 4MFLA 4AG7A 2I79A 2CTCA 3DR8A 3FH4A 1I1DA 4TNUA 4H89A 5J8FA 4MHDA 2POKA 4IUSA 3WC5A 2K5TA 1KWMA 3B3CA 2FS5A 2P0WA 4CYNA 2PQ8A 2OB0A 3KQXA 2D4OA 1BLLE 2G3TA 2PJ1A 3FECA 4MFPA 5ELYA 2F8HA 4ZX8A 3TO7A 2Z3NA 1F57A 5C88A 1X10A 1K4JA 3H5ZA 1YVOA 2VZZA 3PBEA 4MRIA 3W91A 4AVBA 4BD9A 3CT9A 1ZG8A 1Y9WA 2JBKA 4F0YA 1TF8A 2Q4YA 1ARMA 2EK8A 2JLMA 4CRYB 2IL4A 3FJUA 2C6GA 2CXAA 1Y0RA 1TKJA 2PJ2A 2XEJA 1S7FA 3LWUA 3B3TA 4KSAA 4ORFA 3SI0A 1B6BA 2G0BA 1L0CA 1BAVA 4NFRA 1WK4A 4OC1A 3TO9A 4P4DA 2VBQA 4F9VA 2F7VA 4MBUA 1KUYA 3MGDA 4MCSA 1S7LA 3KR4A 2REEA 2AJ6A 3PBBA 4LQGA 2WPXA 3D7GA 4XPLA 4XPKA 2EBJA 2C6PA 1S5KA 2RFHA 4NGTA 1XRYA 3CXPA 3TE4A 4PK3A 3PB8X 4UEFA 5HMNA 3F5BA 3S6GA 2Z3OA 4QBJA 4CAWA 2PJAA 1F2OA 2Q43A 4R3KA 1N71A 2ZEPA 4DUKA 1YX0A 4AXVA 4CGLA 2Q7SA 1AMPA 1A2ZA 4MCQA 1LRZA 3CPXA 2R7HA 4KOXA 1LOKA 5E96A 2OU2A 3EXNA 4KOWA 2AFXA 2VZYA 1X12A 2ZEFA 5IB9A 5C82A 3H8EA 2Z3MA 4A94A 2AFOA 2X7BA 2EK9A 3IU2A 4EMEA 4PXDA 1LFWA 5J1QA 4KS9A 1ELLP 1FY7A 4QVTA 4G1PA 4U9YA 4DNCA 4EVYA 4MFQA 1Q2CA 2ZENA 3BJ7A 3BLNA 1YVKA 4P4JA 4NGQA 5CPAA 3R95A 4PQAA 3QAYA 4A31A 3FNCA 2ZEOA 5H84A 2FT0A 4X5KA 4OMEA 1HDQA 1IU8A 4MFZA 3QB8A 3RAMA 1IYKA 5CBMA 1Z9UA 4FD5A 4E8OA 5EMIA 2R98A 3W6XA 3BI1A 2ZEHA 2FXFA 2PJ7A 1QSOA 2PVWA 4NSQA 5HVHA 5JM6A 2AFSA 4R76A 2ATRA 1Z2LA 1NE9A 4PSWA 4XPDC 4C7IA 1P4NA 3NFZA 5DWNA 5DWMA 1YK3A 3VATA 1CM0A 2J8RA 2GREA 4MCRA 1PU9A 3V7ZA 4B5PA 4CGMA 1IB1E 5CNPA 2VEZA 4A2ZA 2CIJA 1R57A 3I3GA 2EVNA 1M44A 4C2ZA 1LAMA 2WSAA 2C27A 4NGMA 1AUGA 3DSBA 5DS0A 3MRUA 3S9MA 2ZELA 4JD6A 4KOYA 3KGQA 2FIWA 1M4LA 3R9FA 3IIBA 3KL9A 5H86A 3BJ8A 5KTCA 3DGVA 3FEEA 3FMCA 2FE7A 3NA6A 4MJ8A 4KLWA 4LUAA 1DE4C 4L89A 3CDXA 3D67A 5I0CA 1ARLA 1Z4RA 3E0KA 3IJ3A 4R9MA 3TCVA 3F0AA 3D2MA 4A30A 2O4HA 2OOTA 4MHNA 1YW4A 2GE3A 3B35A 4MHZA 3S6FA 2B4DA 3EO4A 2OZGA 3TC8A 3SXNA 4CGNA 4OLLA 5G22A 1TKFA 1I21A 4UCPA 4LX9A 3H8FA 4JLYA 5LRGA 3DNSA 3P2FA 1XEBA 2AFUA 1JWQA 2KCWA 3H8GA 4MY3A 4UFVA 1LCPA 1S7NA 3IC1A 2OH1A 1CPSA 2VL1A 4KOVA 2R8VA 5AG4A 3KKWA 4X8IA 4ZY2A 2ZW5A 5AG6A 4MXUA 4KZTA 4BBHA 2V8GA 1UWYA 3TTHA 4FAIA 1H8LA 2RC4A 4OC5A 5F48A 3CXSA 1DTDA 3ISXA 4FBEA 2ZW7A 4CAVA 3KASA 4XNHC 5G21A 4EWTA 2O28A 1PCAA 3GYAA 4KUBA 2XEFA 3D7FA 4UFXA 4E2AA 2BO9A 1XF8A 2JDDA 3G8WA 2BSWA 3KZWA 2Z3KA 4HNYB 1XOVA 4Q38A 3PP9A 1IYLA 2J8NA 1XMTA 2PJ0A 1ELMP 4Y49C 4WJBA 2VI7A 4CRZB 1BPMA 2VXKA 4A95A 4I49A 4UCNA 4GS4A 1FNOA 3DR6A 4H2KA 2Z11A 4ZYQA 4ONUA 3S9LA 3VH9A 3JVNA 1ZLIA 2WUUA 4AVCA 2GANA 2P6FA 2FCKA 3BXMA 3CXQA 1YW6A 4PSXA 3PGPA 2HC9A 1YR0A 4NEXA 1RTQA 4CGOA 5AG5A 1RXTA 2IMOA 4HPSA 1CPXA 4OC0A 4GXHA 3PB6X 2BEIA 4YFJA 1Y9KA 4A39A 3D8PA 3IWEA 2J9AA 2PR8A 2Q04A 2PVVA 4KVOE 4UBRA 4OKOA 4UWIA 4UCMA 3WC6A 3RNZA 5F47A 4DJLA 2Q4ZA 1NMTA 2ZEGA 3KQZA 4IF5A 3S9NA 2AE6A 3MN8A 4OIWA 3ZZIA 5JGFA 2DEAA 1IGBA 2HV2A 1S3ZA 4RI1A 3RYOA 1HDUA 4E0AA 2B5GB 4UWJA 5LRJA 4AVAA 5A28A 2GU2A 4LQ6A 3S6KA 1KZFA 4UIAA 4P4FA 3FB3A 4KVME 4ZGYB 3TT2A 4B14A 1I12A 2BUEA 1YREA 4FD6A 4M6GA 3RO0A 2P6GA 2J8MA 2PIYA 4CAFA 3KR5A 3IO1A 5A27A 5HH1A 3NE7A 3S6HA 1BPNA 2C1CA 3B7IA 3SJGA 4C2YA 4BINA 1MJAA 1QSNA 2C6CA 1S60A 3L2NA 4K3NA 2QJ8A 2A4NA 4UA3A 3HLPA 3QNVA 2B4BA 1XBUA 3RBUA 4MFJA 1CBXA 5THWA 4UEZA 1V0CA 2V8VA 1MJ9A 4ONWA 3TOBA 1QSRA 4CYOA 2CNSA 4C2XA 2OZUA 5AGEA 5J8CA 3D2PA 3V38A 4L8AA 4P4BA 5D29A 3LMSA 5KTAA 5BWAB 2CF4A 2ZPAA 4M3SA 4RUHA 3SJXA 4JJXA 1Q2DA 3ISZA 1YLEA 4YGOA 2Q0YA 4KSIA 1Y0YA 4IHMA 4NGSA 1LANA 4OADA 1XIXA 4R57A 4PXBA 3I9SA 1AYEA 1EE3P 1Z8XA 3D7HA 2Y0MA 3TO6A 2REFA 3OWCA 3SXOA 3T90A 2I3CA 4MHPA 2ABZA 3VARA 3D68A 1ZLHA 3PZJA 2G3AA 1XMBA 2WZNA 3PEIA 1FT7A 1NSLA 2Q7BA 1CJWA 1Y7EA 3K9UA 5IV0A 4NGNA 4A33A 1YSJA 4B6ZA 2NYQA 5IX3A 1XE4A 4A32A 4QC6A 3LODA 2DPTA 3DDDA 1CP7A 4NJQA 1LAPA 5HVFA 4UIBA 4A37A 4NGPA 2PJBA 2JEVA 2DPSA 5LYLA 2YNDA 3EC4A 2HQYA 1VIXA 2JEWA 3NE8A 5EC4A 3WR7A 3R1KA 3GIUA 1Z8WA 2FSRA 5GCNA 2ZOGA 1R43A 4MHYA 5K8PA 1ON0A 4K30A 5LYIA 3WC7A 3TX8A 1XJOA 4UFWA 3NH4A 2CNMA 3D3SA 2PCUA 2V8DA 1Z8LA 3A9LA 4NXYA 2AFWA 3B2YA 4Q7AA 3FF3A 1YMEA 3GY9A 1IIDA 3ZJ0A 1SQHA 2IJZA 4YRHA 3GB0A 2ZW4A 4P44A 4F0XA 5IB0A 3TFYA 5ISVA 1GHEA 4H6UA 3D7DA 1Z5RA 1VHSA 4JWPA 4NCZA 5JPHA 3VWEA 4FD4A 4CYPA 3KHZA 1Q7LA 5HVGA 4B5OA 1YQEA 3SJFA 2ARHA 1YGHA 2JDCA 2ZEEA 5HXDA 2YNCC 1CG2A 3GUXA 4ZI6A 4C7HA 4AB7A 2AFZA 1HEEA 2PJ6A 2OZHA 2R1IA 3EY5A 3K9TA 1P0HA 1Q2YA 1QSTA 2ANPA 2V77A 1TF9A 1ZG7A 2Z0ZA 4CPAA 4F6AA 3FBUA 3IU1A 4XPDB 1VKCA 2EUIA 1PUAA 1B87A 2BL1A 4II9A 1QMUA 3F8KA 3I1UA 3G3SA 5D8NA 2NMTA 4M85A 4P6YA 3JTKA 2ZXVA 3FXTA 4OC4A 2JBJA 4CAEA 4F8ZA 2PC1A 5LRKA 4P10A 4CYQA 3T8WA 3N7ZA 2PE3A 4JZ0A 1Z4EA 2FIAA 3DLJA 4UF4A 3EFAA 4AG9A 5EBVA 2XEIA 4W9YA 1VHOA 3NH8A 3R9GA 7CPAA 4PV6A 3IWGA 2PIZA 1VGYA 2B3VA 4X3RA 2HUZA 2PSWA 4M6IA 4OC3A 4NF1A 1XFOA 4MCPA 1KUXA 2Z3LA 1TXRA 2WPWA 2PJ3A 4NJRA 4FWUA 5K8NA 1M1DA
chains in the Genus database with same CATH topology
1IICA 4J3GA 1TIQA 4KOSA 4CGPA 2Q44A 1ZO0A 5G20A 4JXQA 1KUVA 1MJBA 4PK2A 5AG7A 2YNEA 2Z10A 3LD2A 1WWZA 2QIRA 3GKRA 4B5PB 5FVJA 4XNHB 4B13A 3P2HA 4HKFA 1OZPA 4R87A 2B3UA 2FL4A 5G1ZA 4BMHA 2DXQA 4CAXA 2Z3PA 2P6EA 5F46A 4Y49B 2B58A 3R96A 4C68A 2VQYA 3B8GA 1J4JA 4U9ZA 3FRMA 4JXRA 2PR1A 2B5GA 2YNCA 4KVXA 2B4DB 3W6SA 2CY2A 3JUWA 2GIVA 2D4PA 2F5IA 2QMLA 1UFHA 3FIXA 3T9YA 4KUAA 3IGRA 4R3LA 2PRBA 4OAEA 4KSFA 3UY5A 3C26A 1MK4A 4MI4A 4QUSA 2YGWA 3VWDA 4KOUA 3R9EA 4RS2A 2H5MA 2PDOA 1QSMA 1U6MA 4KOTA 2I00A 3V8IA 1BOBA 2ZW6A 4HNWB 4B11A 4MY0A 2QECA 1M4GA 1Y7RA 3TOAA 1S7KA 1M4DA 2Q4VA 3FYNA 4KORA 4QB9A 4U5YA 4ZBGA 1RO5A 4KLVA 1BO4A 3QAHA 4B10A 5KTDA 4Q36A 4HNXB 5F49A 4B12A 4FD7A 5JQ4A 1M4IA 3SHPA 2CNTA 4CS0B 4H6ZA 4MFKA 4AG7A 3H4QA 4MFLA 2I79A 3DR8A 1I1DA 4H89A 5J8FA 4MHDA 4IUSA 2K5TA 2FS5A 2P0WA 4CYNA 2PQ8A 2OB0A 2D4OA 2G3TA 3TO7A 4MFPA 2Z3NA 5C88A 3H5ZA 1K4JA 3W91A 1YVOA 2VZZA 4AVBA 1Y9WA 4F0YA 2Q4YA 2JLMA 4CRYB 2IL4A 2CXAA 4KSAA 1S7FA 4ORFA 1B6BA 2G0BA 1L0CA 1WK4A 3TO9A 2VBQA 4MBUA 1KUYA 3MGDA 1S7LA 2REEA 2AJ6A 2WPXA 4XPLA 4XPKA 1S5KA 3CXPA 3TE4A 4PK3A 5HMNA 3F5BA 3S6GA 2Z3OA 4QBJA 4CAWA 4R3KA 1N71A 1YX0A 4CGLA 1LRZA 2R7HA 4KOXA 5E96A 2OU2A 3EXNA 4KOWA 2VZYA 5C82A 2Z3MA 2X7BA 3IU2A 4KS9A 4QVTA 1FY7A 4U9YA 4DNCA 4EVYA 4MFQA 1Q2CA 3BLNA 3BJ7A 1YVKA 3R95A 4A31A 3FNCA 5H84A 2FT0A 4X5KA 4MFZA 3QB8A 1IYKA 1Z9UA 4FD5A 4E8OA 2R98A 3W6XA 4NSQA 2FXFA 1QSOA 4C7IA 2ATRA 1NE9A 4PSWA 4XPDC 1P4NA 5DWNA 5DWMA 1YK3A 1CM0A 2J8RA 1PU9A 4B5PA 4CGMA 1IB1E 5CNPA 2VEZA 4A2ZA 1R57A 3I3GA 2EVNA 1M44A 4C2ZA 2WSAA 2C27A 3DSBA 4JD6A 4KOYA 2FIWA 3R9FA 5H86A 3BJ8A 5KTCA 2FE7A 4MJ8A 4KLWA 4LUAA 4L89A 5I0CA 1Z4RA 3E0KA 4R9MA 3TCVA 3F0AA 3D2MA 4A30A 2GE3A 3S6FA 2B4DA 3EO4A 2OZGA 4CGNA 3SXNA 4OLLA 5G22A 1I21A 4UCPA 4LX9A 4JLYA 3DNSA 3P2FA 1XEBA 2KCWA 4MY3A 4UFVA 1S7NA 2OH1A 4KOVA 2R8VA 5AG4A 3KKWA 2ZW5A 5AG6A 4KZTA 4BBHA 3TTHA 2RC4A 5F48A 3CXSA 2ZW7A 4CAVA 4XNHC 5G21A 2O28A 3GYAA 4KUBA 4UFXA 4E2AA 1XF8A 2JDDA 3G8WA 2BSWA 2Z3KA 4HNYB 4Q38A 3PP9A 1IYLA 2J8NA 1XMTA 4Y49C 4CRZB 2VI7A 2VXKA 4A95A 4I49A 4UCNA 4GS4A 3DR6A 2Z11A 4ONUA 3JVNA 2WUUA 4AVCA 2GANA 2P6FA 2FCKA 3CXQA 4PSXA 3PGPA 1YR0A 4NEXA 4CGOA 5AG5A 1RXTA 2BEIA 4YFJA 1Y9KA 3D8PA 3IWEA 4KVOE 2PR8A 2Q04A 4UBRA 3WR7A 4UWIA 4UCMA 5F47A 1NMTA 4IF5A 2AE6A 3ZZIA 4RI1A 2HV2A 1S3ZA 3RYOA 4E0AA 2B5GB 4UWJA 4AVAA 5A28A 3S6KA 1KZFA 3FB3A 4KVME 4ZGYB 3TT2A 4B14A 1I12A 2BUEA 1YREA 4FD6A 2P6GA 2J8MA 4CAFA 5A27A 5HH1A 3NE7A 3S6HA 4C2YA 1MJAA 1QSNA 1S60A 2A4NA 4UA3A 2B4BA 4MFJA 1V0CA 1MJ9A 3TOBA 4CYOA 1QSRA 2CNSA 4C2XA 2OZUA 5AGEA 5J8CA 3D2PA 4L8AA 5KTAA 5BWAB 2ZPAA 4M3SA 4JJXA 1Q2DA 1YLEA 4YGOA 2Q0YA 4R57A 4OADA 1XIXA 3I9SA 2Y0MA 3TO6A 2REFA 3OWCA 3SXOA 3T90A 3PZJA 2G3AA 2Q7BA 1NSLA 5IV0A 1CJWA 3K9UA 4A33A 5IX3A 1XE4A 4A32A 4QC6A 3LODA 2DPTA 3DDDA 2JEVA 2DPSA 2YNDA 3EC4A 2HQYA 5EC4A 3R1KA 2FSRA 5GCNA 1ON0A 4K30A 4UFWA 2CNMA 3D3SA 3A9LA 4NXYA 3GY9A 1IIDA 3ZJ0A 1SQHA 4YRHA 3TFYA 2ZW4A 4F0XA 5IB0A 5ISVA 1GHEA 4H6UA 1VHSA 4JWPA 4NCZA 5JPHA 3VWEA 4FD4A 4CYPA 4B5OA 2ARHA 1YGHA 2JDCA 2YNCC 4C7HA 4AB7A 2OZHA 2R1IA 3EY5A 1P0HA 1Q2YA 1QSTA 4F6AA 2Z0ZA 3FBUA 3IU1A 4XPDB 1VKCA 2EUIA 1PUAA 1B87A 2BL1A 4II9A 3F8KA 3G3SA 2NMTA 4M85A 3JTKA 2ZXVA 3FXTA 4CAEA 2PC1A 4CYQA 3N7ZA 1Z4EA 2FIAA 3EFAA 4AG9A 5EBVA 3R9GA 4PV6A 3IWGA 2B3VA 2HUZA 2PSWA 4NF1A 1KUXA 2Z3LA 2WPWA 1M1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIC A;  4J3G A;  1TIQ A;  4KOS A;  2Q44 A;  4JXQ A;  1KUV A;  1MJB A;  4PK2 A;  2Z10 A;  3LD2 A;  1WWZ A;  2QIR A;  3GKR A;  4B5P B;  5FVJ A;  4XNH B;  3P2H A;  4HKF A;  1OZP A;  4R87 A;  2B3U A;  2FL4 A;  4BMH A;  2DXQ A;  4CAX A;  2P6E A;  5F46 A;  4Y49 B;  2B58 A;  3R96 A;  2VQY A;  3B8G A;  1J4J A;  4U9Z A;  3FRM A;  4JXR A;  2PR1 A;  2B5G A;  4KVX A;  2B4D B;  3W6S A;  2CY2 A;  3JUW A;  2GIV A;  2D4P A;  2F5I A;  2QML A;  1UFH A;  3FIX A;  3T9Y A;  4KUA A;  3IGR A;  4R3L A;  2PRB A;  4OAE A;  3UY5 A;  3C26 A;  1MK4 A;  4MI4 A;  4QUS A;  3VWD A;  4KOU A;  3R9E A;  4RS2 A;  2H5M A;  2PDO A;  1QSM A;  4KOT A;  1U6M A;  2I00 A;  3V8I A;  1BOB A;  2ZW6 A;  4HNW B;  4MY0 A;  2QEC A;  1M4G A;  1Y7R A;  3TOA A;  1S7K A;  1M4D A;  2Q4V A;  3FYN A;  4KOR A;  4QB9 A;  4U5Y A;  4ZBG A;  1RO5 A;  4KLV A;  1BO4 A;  3QAH A;  5KTD A;  5F49 A;  4HNX B;  4FD7 A;  5JQ4 A;  1M4I A;  3SHP A;  2CNT A;  4CS0 B;  4H6Z A;  4AG7 A;  3H4Q A;  2I79 A;  3DR8 A;  1I1D A;  4H89 A;  5J8F A;  4MHD A;  4IUS A;  2K5T A;  2FS5 A;  2P0W A;  2PQ8 A;  2OB0 A;  2D4O A;  2G3T A;  3TO7 A;  5C88 A;  1K4J A;  3W91 A;  1YVO A;  2VZZ A;  4AVB A;  1Y9W A;  4F0Y A;  2Q4Y A;  2JLM A;  4CRY B;  2IL4 A;  1S7F A;  4ORF A;  1B6B A;  2G0B A;  1L0C A;  1WK4 A;  3TO9 A;  2VBQ A;  4MBU A;  1KUY A;  3MGD A;  1S7L A;  2REE A;  2AJ6 A;  2WPX A;  4XPL A;  4XPK A;  1S5K A;  3CXP A;  3TE4 A;  4PK3 A;  5HMN A;  3F5B A;  3S6G A;  4QBJ A;  4CAW A;  4R3K A;  1N71 A;  1YX0 A;  1LRZ A;  2R7H A;  4KOX A;  5E96 A;  2OU2 A;  3EXN A;  4KOW A;  2VZY A;  5C82 A;  2X7B A;  4QVT A;  1FY7 A;  4U9Y A;  4DNC A;  4EVY A;  1Q2C A;  3BLN A;  3BJ7 A;  1YVK A;  3R95 A;  3FNC A;  5H84 A;  2FT0 A;  4X5K A;  3QB8 A;  1IYK A;  1Z9U A;  4FD5 A;  4E8O A;  2R98 A;  3W6X A;  4NSQ A;  2FXF A;  1QSO A;  2ATR A;  1NE9 A;  4PSW A;  4XPD C;  1P4N A;  5DWN A;  5DWM A;  1YK3 A;  1CM0 A;  2J8R A;  1PU9 A;  4B5P A;  1IB1 E;  5CNP A;  2VEZ A;  1R57 A;  3I3G A;  2EVN A;  1M44 A;  2C27 A;  3DSB A;  4JD6 A;  4KOY A;  2FIW A;  3R9F A;  5H86 A;  3BJ8 A;  5KTC A;  2FE7 A;  4MJ8 A;  4KLW A;  4LUA A;  4L89 A;  5I0C A;  1Z4R A;  3E0K A;  4R9M A;  3TCV A;  3F0A A;  3D2M A;  2GE3 A;  3S6F A;  2B4D A;  3EO4 A;  2OZG A;  3SXN A;  4OLL A;  1I21 A;  4LX9 A;  4JLY A;  3DNS A;  3P2F A;  1XEB A;  2KCW A;  4MY3 A;  1S7N A;  2OH1 A;  4KOV A;  2R8V A;  3KKW A;  2ZW5 A;  4KZT A;  3TTH A;  2RC4 A;  5F48 A;  3CXS A;  2ZW7 A;  4CAV A;  4XNH C;  2O28 A;  3GYA A;  4KUB A;  4E2A A;  1XF8 A;  2JDD A;  3G8W A;  2BSW A;  4HNY B;  3PP9 A;  1IYL A;  2J8N A;  1XMT A;  4Y49 C;  4CRZ B;  2VI7 A;  2VXK A;  4I49 A;  4GS4 A;  3DR6 A;  2Z11 A;  4ONU A;  3JVN A;  4AVC A;  2GAN A;  2P6F A;  2FCK A;  3CXQ A;  4PSX A;  3PGP A;  1YR0 A;  4NEX A;  1RXT A;  2BEI A;  4YFJ A;  1Y9K A;  3D8P A;  4KVO E;  2PR8 A;  2Q04 A;  4UBR A;  3WR7 A;  4UWI A;  5F47 A;  1NMT A;  4IF5 A;  2AE6 A;  3ZZI A;  4RI1 A;  2HV2 A;  1S3Z A;  3RYO A;  4E0A A;  2B5G B;  4UWJ A;  4AVA A;  3S6K A;  1KZF A;  3FB3 A;  4KVM E;  3TT2 A;  1I12 A;  2BUE A;  1YRE A;  4FD6 A;  2P6G A;  2J8M A;  5HH1 A;  3NE7 A;  3S6H A;  1MJA A;  1QSN A;  1S60 A;  2A4N A;  4UA3 A;  2B4B A;  1V0C A;  1MJ9 A;  3TOB A;  1QSR A;  2CNS A;  2OZU A;  5J8C A;  3D2P A;  4L8A A;  5KTA A;  2ZPA A;  4M3S A;  4JJX A;  1Q2D A;  1YLE A;  4YGO A;  2Q0Y A;  4R57 A;  4OAD A;  1XIX A;  3I9S A;  2Y0M A;  3TO6 A;  2REF A;  3OWC A;  3SXO A;  3T90 A;  3PZJ A;  2G3A A;  2Q7B A;  1NSL A;  5IV0 A;  1CJW A;  3K9U A;  5IX3 A;  1XE4 A;  4QC6 A;  3LOD A;  3DDD A;  2JEV A;  3EC4 A;  2HQY A;  5EC4 A;  3R1K A;  2FSR A;  5GCN A;  1ON0 A;  4K30 A;  2CNM A;  3D3S A;  4NXY A;  3GY9 A;  1IID A;  3ZJ0 A;  1SQH A;  4YRH A;  3TFY A;  2ZW4 A;  5ISV A;  5IB0 A;  1GHE A;  4H6U A;  1VHS A;  4JWP A;  4NCZ A;  5JPH A;  3VWE A;  4FD4 A;  4B5O A;  2ARH A;  1YGH A;  2JDC A;  4AB7 A;  2OZH A;  2R1I A;  3EY5 A;  1P0H A;  1Q2Y A;  1QST A;  4F6A A;  2Z0Z A;  3FBU A;  4XPD B;  1VKC A;  2EUI A;  1PUA A;  1B87 A;  2BL1 A;  4II9 A;  3F8K A;  3G3S A;  2NMT A;  4M85 A;  2ZXV A;  3FXT A;  2PC1 A;  3N7Z A;  1Z4E A;  2FIA A;  3EFA A;  4AG9 A;  5EBV A;  3R9G A;  4PV6 A;  3IWG A;  2B3V A;  2HUZ A;  2PSW A;  4NF1 A;  1KUX A;  2WPW A;  1M1D A; 
#chains in the Genus database with same CATH topology
 1IIC A;  4J3G A;  1TIQ A;  4KOS A;  4CGP A;  2IQ6 A;  3FED A;  4Z65 A;  2FVG A;  3PB9 X;  2EWB A;  2PJC A;  2ZEM A;  3B3S A;  3B3W A;  2Q44 A;  1ZO0 A;  3PFO A;  5G20 A;  4JXQ A;  1QQ9 A;  4RN7 A;  1KUV A;  1MJB A;  1YLO A;  4IAV A;  4ZY1 A;  4PK2 A;  5AG7 A;  2YNE A;  2Z10 A;  4JYW A;  4UEE A;  4P45 A;  3LD2 A;  4OP4 A;  4YWY A;  5LYD A;  5JH9 A;  1WWZ A;  2GLJ A;  2PRQ A;  4OID A;  2G9D A;  2QIR A;  3PRT A;  3GKR A;  4B5P B;  5FVJ A;  4ZX9 A;  4XNH B;  2OR4 A;  4A38 A;  4B13 A;  3P2H A;  4HKF A;  1OZP A;  4R87 A;  3KI9 A;  5K8M A;  2B3U A;  2FL4 A;  5G1Z A;  4BMH A;  4PXC A;  2DXQ A;  4NGR A;  4F9U A;  4CAX A;  2Z3P A;  3SJE A;  3K2K A;  2P6E A;  5F46 A;  4OC2 A;  3WAB A;  5I4M A;  6CPA A;  4Y49 B;  2B58 A;  3R96 A;  2QYV A;  4C68 A;  2VQY A;  3B8G A;  3PB7 X;  4WWV A;  1J4J A;  1NSA A;  2GLF A;  8CPA A;  2PJ5 A;  4U9Z A;  3FRM A;  3BI0 A;  4JXR A;  1F2P A;  2PR1 A;  4R7M A;  3CPA A;  1TKH A;  2PJ9 A;  2B5G A;  2YNC A;  4KVX A;  4GM5 A;  2PJ4 A;  2B4D B;  3RZA A;  3W6S A;  2CY2 A;  4DYO A;  1JQG A;  3JUW A;  2ODF A;  3NH5 A;  2EO8 A;  2GIV A;  4R8F A;  1PYT B;  2D4P A;  2F5I A;  5F09 A;  5LYF A;  2QML A;  1UFH A;  4TWE A;  2BCO A;  2ZOF A;  3FIX A;  3IWW A;  3T9Y A;  3BHX A;  4KUA A;  3IGR A;  4R3L A;  2PRB A;  3IEH A;  2BOA A;  4M6H A;  1GYT A;  1VHE A;  4OAE A;  2DF5 A;  4KSF A;  3LAC A;  3UY5 A;  3C26 A;  1MK4 A;  4YU9 A;  4MI4 A;  4QUS A;  2YGW A;  3VWD A;  4MMO A;  2GFQ A;  2XEG A;  4PPZ A;  4KOU A;  3R9E A;  4RS2 A;  2H5M A;  1CX8 A;  2PDO A;  1QSM A;  2O53 A;  1U6M A;  4KOT A;  3D66 A;  2I00 A;  3V8I A;  1BOB A;  4IK2 A;  3CZX A;  1IOF A;  2ZW6 A;  2Q51 A;  4HNW B;  3SI2 A;  4B11 A;  1ZG9 A;  2NSM A;  4MY0 A;  2QEC A;  3HUV A;  1M4G A;  3WT4 A;  1Y7R A;  3N5F A;  2AFM A;  1CP6 A;  3PFE A;  3IFE A;  2WYR A;  4O23 A;  1S7K A;  1M4D A;  1Z8T A;  2Q4V A;  3TOA A;  3FYN A;  4KOR A;  4P4E A;  2CTB A;  4P4I A;  3FVL A;  3SI1 A;  5KTD A;  2PJ8 A;  4QB9 A;  2HB6 A;  4U5Y A;  3B3V A;  1RO5 A;  3KHX A;  4X2T A;  4ZBG A;  3PB4 X;  3FX6 A;  4KLV A;  1BO4 A;  3QAH A;  4B10 A;  2V8H A;  3JRU A;  4R6T A;  4Q36 A;  4HNX B;  5F49 A;  4B12 A;  3GLJ A;  4FD7 A;  4PXE A;  4FUU A;  4EFD A;  5JQ4 A;  1M4I A;  2QVP A;  3SHP A;  4ZY0 A;  2CNT A;  1R3N A;  5K8O A;  4CS0 B;  4H6Z A;  4MFK A;  1OBR A;  1IY7 A;  2RB7 A;  3D4U A;  1IOI A;  2ZED A;  3H4Q A;  4MFL A;  4AG7 A;  2I79 A;  2CTC A;  3DR8 A;  3FH4 A;  1I1D A;  4TNU A;  4H89 A;  5J8F A;  4MHD A;  2POK A;  4IUS A;  3WC5 A;  2K5T A;  1KWM A;  3B3C A;  2FS5 A;  2P0W A;  4CYN A;  2PQ8 A;  2OB0 A;  3KQX A;  2D4O A;  1BLL E;  2G3T A;  2PJ1 A;  3FEC A;  4MFP A;  5ELY A;  2F8H A;  4ZX8 A;  3TO7 A;  2Z3N A;  1F57 A;  5C88 A;  1X10 A;  1K4J A;  3H5Z A;  1YVO A;  2VZZ A;  3PBE A;  4MRI A;  3W91 A;  4AVB A;  4BD9 A;  3CT9 A;  1ZG8 A;  1Y9W A;  2JBK A;  4F0Y A;  1TF8 A;  2Q4Y A;  1ARM A;  2EK8 A;  2JLM A;  4CRY B;  2IL4 A;  3FJU A;  2C6G A;  2CXA A;  1Y0R A;  1TKJ A;  2PJ2 A;  2XEJ A;  1S7F A;  3LWU A;  3B3T A;  4KSA A;  4ORF A;  3SI0 A;  1B6B A;  2G0B A;  1L0C A;  1BAV A;  4NFR A;  1WK4 A;  4OC1 A;  3TO9 A;  4P4D A;  2VBQ A;  4F9V A;  2F7V A;  4MBU A;  1KUY A;  3MGD A;  4MCS A;  1S7L A;  3KR4 A;  2REE A;  2AJ6 A;  3PBB A;  4LQG A;  2WPX A;  3D7G A;  4XPL A;  4XPK A;  2EBJ A;  2C6P A;  1S5K A;  2RFH A;  4NGT A;  1XRY A;  3CXP A;  3TE4 A;  4PK3 A;  3PB8 X;  4UEF A;  5HMN A;  3F5B A;  3S6G A;  2Z3O A;  4QBJ A;  4CAW A;  2PJA A;  1F2O A;  2Q43 A;  4R3K A;  1N71 A;  2ZEP A;  4DUK A;  1YX0 A;  4AXV A;  4CGL A;  2Q7S A;  1AMP A;  1A2Z A;  4MCQ A;  1LRZ A;  3CPX A;  2R7H A;  4KOX A;  1LOK A;  5E96 A;  2OU2 A;  3EXN A;  4KOW A;  2AFX A;  2VZY A;  1X12 A;  2ZEF A;  5IB9 A;  5C82 A;  3H8E A;  2Z3M A;  4A94 A;  2AFO A;  2X7B A;  2EK9 A;  3IU2 A;  4EME A;  4PXD A;  1LFW A;  5J1Q A;  4KS9 A;  1ELL P;  1FY7 A;  4QVT A;  4G1P A;  4U9Y A;  4DNC A;  4EVY A;  4MFQ A;  1Q2C A;  2ZEN A;  3BJ7 A;  3BLN A;  1YVK A;  4P4J A;  4NGQ A;  5CPA A;  3R95 A;  4PQA A;  3QAY A;  4A31 A;  3FNC A;  2ZEO A;  5H84 A;  2FT0 A;  4X5K A;  4OME A;  1HDQ A;  1IU8 A;  4MFZ A;  3QB8 A;  3RAM A;  1IYK A;  5CBM A;  1Z9U A;  4FD5 A;  4E8O A;  5EMI A;  2R98 A;  3W6X A;  3BI1 A;  2ZEH A;  2FXF A;  2PJ7 A;  1QSO A;  2PVW A;  4NSQ A;  5HVH A;  5JM6 A;  2AFS A;  4R76 A;  2ATR A;  1Z2L A;  1NE9 A;  4PSW A;  4XPD C;  4C7I A;  1P4N A;  3NFZ A;  5DWN A;  5DWM A;  1YK3 A;  3VAT A;  1CM0 A;  2J8R A;  2GRE A;  4MCR A;  1PU9 A;  3V7Z A;  4B5P A;  4CGM A;  1IB1 E;  5CNP A;  2VEZ A;  4A2Z A;  2CIJ A;  1R57 A;  3I3G A;  2EVN A;  1M44 A;  4C2Z A;  1LAM A;  2WSA A;  2C27 A;  4NGM A;  1AUG A;  3DSB A;  5DS0 A;  3MRU A;  3S9M A;  2ZEL A;  4JD6 A;  4KOY A;  3KGQ A;  2FIW A;  1M4L A;  3R9F A;  3IIB A;  3KL9 A;  5H86 A;  3BJ8 A;  5KTC A;  3DGV A;  3FEE A;  3FMC A;  2FE7 A;  3NA6 A;  4MJ8 A;  4KLW A;  4LUA A;  1DE4 C;  4L89 A;  3CDX A;  3D67 A;  5I0C A;  1ARL A;  1Z4R A;  3E0K A;  3IJ3 A;  4R9M A;  3TCV A;  3F0A A;  3D2M A;  4A30 A;  2O4H A;  2OOT A;  4MHN A;  1YW4 A;  2GE3 A;  3B35 A;  4MHZ A;  3S6F A;  2B4D A;  3EO4 A;  2OZG A;  3TC8 A;  3SXN A;  4CGN A;  4OLL A;  5G22 A;  1TKF A;  1I21 A;  4UCP A;  4LX9 A;  3H8F A;  4JLY A;  5LRG A;  3DNS A;  3P2F A;  1XEB A;  2AFU A;  1JWQ A;  2KCW A;  3H8G A;  4MY3 A;  4UFV A;  1LCP A;  1S7N A;  3IC1 A;  2OH1 A;  1CPS A;  2VL1 A;  4KOV A;  2R8V A;  5AG4 A;  3KKW A;  4X8I A;  4ZY2 A;  2ZW5 A;  5AG6 A;  4MXU A;  4KZT A;  4BBH A;  2V8G A;  1UWY A;  3TTH A;  4FAI A;  1H8L A;  2RC4 A;  4OC5 A;  5F48 A;  3CXS A;  1DTD A;  3ISX A;  4FBE A;  2ZW7 A;  4CAV A;  3KAS A;  4XNH C;  5G21 A;  4EWT A;  2O28 A;  1PCA A;  3GYA A;  4KUB A;  2XEF A;  3D7F A;  4UFX A;  4E2A A;  2BO9 A;  1XF8 A;  2JDD A;  3G8W A;  2BSW A;  3KZW A;  2Z3K A;  4HNY B;  1XOV A;  4Q38 A;  3PP9 A;  1IYL A;  2J8N A;  1XMT A;  2PJ0 A;  1ELM P;  4Y49 C;  4WJB A;  2VI7 A;  4CRZ B;  1BPM A;  2VXK A;  4A95 A;  4I49 A;  4UCN A;  4GS4 A;  1FNO A;  3DR6 A;  4H2K A;  2Z11 A;  4ZYQ A;  4ONU A;  3S9L A;  3VH9 A;  3JVN A;  1ZLI A;  2WUU A;  4AVC A;  2GAN A;  2P6F A;  2FCK A;  3BXM A;  3CXQ A;  1YW6 A;  4PSX A;  3PGP A;  2HC9 A;  1YR0 A;  4NEX A;  1RTQ A;  4CGO A;  5AG5 A;  1RXT A;  2IMO A;  4HPS A;  1CPX A;  4OC0 A;  4GXH A;  3PB6 X;  2BEI A;  4YFJ A;  1Y9K A;  4A39 A;  3D8P A;  3IWE A;  2J9A A;  2PR8 A;  2Q04 A;  2PVV A;  4KVO E;  4UBR A;  4OKO A;  4UWI A;  4UCM A;  3WC6 A;  3RNZ A;  5F47 A;  4DJL A;  2Q4Z A;  1NMT A;  2ZEG A;  3KQZ A;  4IF5 A;  3S9N A;  2AE6 A;  3MN8 A;  4OIW A;  3ZZI A;  5JGF A;  2DEA A;  1IGB A;  2HV2 A;  1S3Z A;  4RI1 A;  3RYO A;  1HDU A;  4E0A A;  2B5G B;  4UWJ A;  5LRJ A;  4AVA A;  5A28 A;  2GU2 A;  4LQ6 A;  3S6K A;  1KZF A;  4UIA A;  4P4F A;  3FB3 A;  4KVM E;  4ZGY B;  3TT2 A;  4B14 A;  1I12 A;  2BUE A;  1YRE A;  4FD6 A;  4M6G A;  3RO0 A;  2P6G A;  2J8M A;  2PIY A;  4CAF A;  3KR5 A;  3IO1 A;  5A27 A;  5HH1 A;  3NE7 A;  3S6H A;  1BPN A;  2C1C A;  3B7I A;  3SJG A;  4C2Y A;  4BIN A;  1MJA A;  1QSN A;  2C6C A;  1S60 A;  3L2N A;  4K3N A;  2QJ8 A;  2A4N A;  4UA3 A;  3HLP A;  3QNV A;  2B4B A;  1XBU A;  3RBU A;  4MFJ A;  1CBX A;  5THW A;  4UEZ A;  1V0C A;  2V8V A;  1MJ9 A;  4ONW A;  3TOB A;  1QSR A;  4CYO A;  2CNS A;  4C2X A;  2OZU A;  5AGE A;  5J8C A;  3D2P A;  3V38 A;  4L8A A;  4P4B A;  5D29 A;  3LMS A;  5KTA A;  5BWA B;  2CF4 A;  2ZPA A;  4M3S A;  4RUH A;  3SJX A;  4JJX A;  1Q2D A;  3ISZ A;  1YLE A;  4YGO A;  2Q0Y A;  4KSI A;  1Y0Y A;  4IHM A;  4NGS A;  1LAN A;  4OAD A;  1XIX A;  4R57 A;  4PXB A;  3I9S A;  1AYE A;  1EE3 P;  1Z8X A;  3D7H A;  2Y0M A;  3TO6 A;  2REF A;  3OWC A;  3SXO A;  3T90 A;  2I3C A;  4MHP A;  2ABZ A;  3VAR A;  3D68 A;  1ZLH A;  3PZJ A;  2G3A A;  1XMB A;  2WZN A;  3PEI A;  1FT7 A;  1NSL A;  2Q7B A;  1CJW A;  1Y7E A;  3K9U A;  5IV0 A;  4NGN A;  4A33 A;  1YSJ A;  4B6Z A;  2NYQ A;  5IX3 A;  1XE4 A;  4A32 A;  4QC6 A;  3LOD A;  2DPT A;  3DDD A;  1CP7 A;  4NJQ A;  1LAP A;  5HVF A;  4UIB A;  4A37 A;  4NGP A;  2PJB A;  2JEV A;  2DPS A;  5LYL A;  2YND A;  3EC4 A;  2HQY A;  1VIX A;  2JEW A;  3NE8 A;  5EC4 A;  3WR7 A;  3R1K A;  3GIU A;  1Z8W A;  2FSR A;  5GCN A;  2ZOG A;  1R43 A;  4MHY A;  5K8P A;  1ON0 A;  4K30 A;  5LYI A;  3WC7 A;  3TX8 A;  1XJO A;  4UFW A;  3NH4 A;  2CNM A;  3D3S A;  2PCU A;  2V8D A;  1Z8L A;  3A9L A;  4NXY A;  2AFW A;  3B2Y A;  4Q7A A;  3FF3 A;  1YME A;  3GY9 A;  1IID A;  3ZJ0 A;  1SQH A;  2IJZ A;  4YRH A;  3GB0 A;  2ZW4 A;  4P44 A;  4F0X A;  5IB0 A;  3TFY A;  5ISV A;  1GHE A;  4H6U A;  3D7D A;  1Z5R A;  1VHS A;  4JWP A;  4NCZ A;  5JPH A;  3VWE A;  4FD4 A;  4CYP A;  3KHZ A;  1Q7L A;  5HVG A;  4B5O A;  1YQE A;  3SJF A;  2ARH A;  1YGH A;  2JDC A;  2ZEE A;  5HXD A;  2YNC C;  1CG2 A;  3GUX A;  4ZI6 A;  4C7H A;  4AB7 A;  2AFZ A;  1HEE A;  2PJ6 A;  2OZH A;  2R1I A;  3EY5 A;  3K9T A;  1P0H A;  1Q2Y A;  1QST A;  2ANP A;  2V77 A;  1TF9 A;  1ZG7 A;  2Z0Z A;  4CPA A;  4F6A A;  3FBU A;  3IU1 A;  4XPD B;  1VKC A;  2EUI A;  1PUA A;  1B87 A;  2BL1 A;  4II9 A;  1QMU A;  3F8K A;  3I1U A;  3G3S A;  5D8N A;  2NMT A;  4M85 A;  4P6Y A;  3JTK A;  2ZXV A;  3FXT A;  4OC4 A;  2JBJ A;  4CAE A;  4F8Z A;  2PC1 A;  5LRK A;  4P10 A;  4CYQ A;  3T8W A;  3N7Z A;  2PE3 A;  4JZ0 A;  1Z4E A;  2FIA A;  3DLJ A;  4UF4 A;  3EFA A;  4AG9 A;  5EBV A;  2XEI A;  4W9Y A;  1VHO A;  3NH8 A;  3R9G A;  7CPA A;  4PV6 A;  3IWG A;  2PIZ A;  1VGY A;  2B3V A;  4X3R A;  2HUZ A;  2PSW A;  4M6I A;  4OC3 A;  4NF1 A;  1XFO A;  4MCP A;  1KUX A;  2Z3L A;  1TXR A;  2WPW A;  2PJ3 A;  4NJR A;  4FWU A;  5K8N A;  1M1D A; 
#chains in the Genus database with same CATH homology
 1IIC A;  4J3G A;  1TIQ A;  4KOS A;  4CGP A;  2Q44 A;  1ZO0 A;  5G20 A;  4JXQ A;  1KUV A;  1MJB A;  4PK2 A;  5AG7 A;  2YNE A;  2Z10 A;  3LD2 A;  1WWZ A;  2QIR A;  3GKR A;  4B5P B;  5FVJ A;  4XNH B;  4B13 A;  3P2H A;  4HKF A;  1OZP A;  4R87 A;  2B3U A;  2FL4 A;  5G1Z A;  4BMH A;  2DXQ A;  4CAX A;  2Z3P A;  2P6E A;  5F46 A;  4Y49 B;  2B58 A;  3R96 A;  4C68 A;  2VQY A;  3B8G A;  1J4J A;  4U9Z A;  3FRM A;  4JXR A;  2PR1 A;  2B5G A;  2YNC A;  4KVX A;  2B4D B;  3W6S A;  2CY2 A;  3JUW A;  2GIV A;  2D4P A;  2F5I A;  2QML A;  1UFH A;  3FIX A;  3T9Y A;  4KUA A;  3IGR A;  4R3L A;  2PRB A;  4OAE A;  4KSF A;  3UY5 A;  3C26 A;  1MK4 A;  4MI4 A;  4QUS A;  2YGW A;  3VWD A;  4KOU A;  3R9E A;  4RS2 A;  2H5M A;  2PDO A;  1QSM A;  1U6M A;  4KOT A;  2I00 A;  3V8I A;  1BOB A;  2ZW6 A;  4HNW B;  4B11 A;  4MY0 A;  2QEC A;  1M4G A;  1Y7R A;  3TOA A;  1S7K A;  1M4D A;  2Q4V A;  3FYN A;  4KOR A;  4QB9 A;  4U5Y A;  4ZBG A;  1RO5 A;  4KLV A;  1BO4 A;  3QAH A;  4B10 A;  5KTD A;  4Q36 A;  4HNX B;  5F49 A;  4B12 A;  4FD7 A;  5JQ4 A;  1M4I A;  3SHP A;  2CNT A;  4CS0 B;  4H6Z A;  4MFK A;  4AG7 A;  3H4Q A;  4MFL A;  2I79 A;  3DR8 A;  1I1D A;  4H89 A;  5J8F A;  4MHD A;  4IUS A;  2K5T A;  2FS5 A;  2P0W A;  4CYN A;  2PQ8 A;  2OB0 A;  2D4O A;  2G3T A;  3TO7 A;  4MFP A;  2Z3N A;  5C88 A;  3H5Z A;  1K4J A;  3W91 A;  1YVO A;  2VZZ A;  4AVB A;  1Y9W A;  4F0Y A;  2Q4Y A;  2JLM A;  4CRY B;  2IL4 A;  2CXA A;  4KSA A;  1S7F A;  4ORF A;  1B6B A;  2G0B A;  1L0C A;  1WK4 A;  3TO9 A;  2VBQ A;  4MBU A;  1KUY A;  3MGD A;  1S7L A;  2REE A;  2AJ6 A;  2WPX A;  4XPL A;  4XPK A;  1S5K A;  3CXP A;  3TE4 A;  4PK3 A;  5HMN A;  3F5B A;  3S6G A;  2Z3O A;  4QBJ A;  4CAW A;  4R3K A;  1N71 A;  1YX0 A;  4CGL A;  1LRZ A;  2R7H A;  4KOX A;  5E96 A;  2OU2 A;  3EXN A;  4KOW A;  2VZY A;  5C82 A;  2Z3M A;  2X7B A;  3IU2 A;  4KS9 A;  4QVT A;  1FY7 A;  4U9Y A;  4DNC A;  4EVY A;  4MFQ A;  1Q2C A;  3BLN A;  3BJ7 A;  1YVK A;  3R95 A;  4A31 A;  3FNC A;  5H84 A;  2FT0 A;  4X5K A;  4MFZ A;  3QB8 A;  1IYK A;  1Z9U A;  4FD5 A;  4E8O A;  2R98 A;  3W6X A;  4NSQ A;  2FXF A;  1QSO A;  4C7I A;  2ATR A;  1NE9 A;  4PSW A;  4XPD C;  1P4N A;  5DWN A;  5DWM A;  1YK3 A;  1CM0 A;  2J8R A;  1PU9 A;  4B5P A;  4CGM A;  1IB1 E;  5CNP A;  2VEZ A;  4A2Z A;  1R57 A;  3I3G A;  2EVN A;  1M44 A;  4C2Z A;  2WSA A;  2C27 A;  3DSB A;  4JD6 A;  4KOY A;  2FIW A;  3R9F A;  5H86 A;  3BJ8 A;  5KTC A;  2FE7 A;  4MJ8 A;  4KLW A;  4LUA A;  4L89 A;  5I0C A;  1Z4R A;  3E0K A;  4R9M A;  3TCV A;  3F0A A;  3D2M A;  4A30 A;  2GE3 A;  3S6F A;  2B4D A;  3EO4 A;  2OZG A;  4CGN A;  3SXN A;  4OLL A;  5G22 A;  1I21 A;  4UCP A;  4LX9 A;  4JLY A;  3DNS A;  3P2F A;  1XEB A;  2KCW A;  4MY3 A;  4UFV A;  1S7N A;  2OH1 A;  4KOV A;  2R8V A;  5AG4 A;  3KKW A;  2ZW5 A;  5AG6 A;  4KZT A;  4BBH A;  3TTH A;  2RC4 A;  5F48 A;  3CXS A;  2ZW7 A;  4CAV A;  4XNH C;  5G21 A;  2O28 A;  3GYA A;  4KUB A;  4UFX A;  4E2A A;  1XF8 A;  2JDD A;  3G8W A;  2BSW A;  2Z3K A;  4HNY B;  4Q38 A;  3PP9 A;  1IYL A;  2J8N A;  1XMT A;  4Y49 C;  4CRZ B;  2VI7 A;  2VXK A;  4A95 A;  4I49 A;  4UCN A;  4GS4 A;  3DR6 A;  2Z11 A;  4ONU A;  3JVN A;  2WUU A;  4AVC A;  2GAN A;  2P6F A;  2FCK A;  3CXQ A;  4PSX A;  3PGP A;  1YR0 A;  4NEX A;  4CGO A;  5AG5 A;  1RXT A;  2BEI A;  4YFJ A;  1Y9K A;  3D8P A;  3IWE A;  4KVO E;  2PR8 A;  2Q04 A;  4UBR A;  3WR7 A;  4UWI A;  4UCM A;  5F47 A;  1NMT A;  4IF5 A;  2AE6 A;  3ZZI A;  4RI1 A;  2HV2 A;  1S3Z A;  3RYO A;  4E0A A;  2B5G B;  4UWJ A;  4AVA A;  5A28 A;  3S6K A;  1KZF A;  3FB3 A;  4KVM E;  4ZGY B;  3TT2 A;  4B14 A;  1I12 A;  2BUE A;  1YRE A;  4FD6 A;  2P6G A;  2J8M A;  4CAF A;  5A27 A;  5HH1 A;  3NE7 A;  3S6H A;  4C2Y A;  1MJA A;  1QSN A;  1S60 A;  2A4N A;  4UA3 A;  2B4B A;  4MFJ A;  1V0C A;  1MJ9 A;  3TOB A;  4CYO A;  1QSR A;  2CNS A;  4C2X A;  2OZU A;  5AGE A;  5J8C A;  3D2P A;  4L8A A;  5KTA A;  5BWA B;  2ZPA A;  4M3S A;  4JJX A;  1Q2D A;  1YLE A;  4YGO A;  2Q0Y A;  4R57 A;  4OAD A;  1XIX A;  3I9S A;  2Y0M A;  3TO6 A;  2REF A;  3OWC A;  3SXO A;  3T90 A;  3PZJ A;  2G3A A;  2Q7B A;  1NSL A;  5IV0 A;  1CJW A;  3K9U A;  4A33 A;  5IX3 A;  1XE4 A;  4A32 A;  4QC6 A;  3LOD A;  2DPT A;  3DDD A;  2JEV A;  2DPS A;  2YND A;  3EC4 A;  2HQY A;  5EC4 A;  3R1K A;  2FSR A;  5GCN A;  1ON0 A;  4K30 A;  4UFW A;  2CNM A;  3D3S A;  3A9L A;  4NXY A;  3GY9 A;  1IID A;  3ZJ0 A;  1SQH A;  4YRH A;  3TFY A;  2ZW4 A;  4F0X A;  5IB0 A;  5ISV A;  1GHE A;  4H6U A;  1VHS A;  4JWP A;  4NCZ A;  5JPH A;  3VWE A;  4FD4 A;  4CYP A;  4B5O A;  2ARH A;  1YGH A;  2JDC A;  2YNC C;  4C7H A;  4AB7 A;  2OZH A;  2R1I A;  3EY5 A;  1P0H A;  1Q2Y A;  1QST A;  4F6A A;  2Z0Z A;  3FBU A;  3IU1 A;  4XPD B;  1VKC A;  2EUI A;  1PUA A;  1B87 A;  2BL1 A;  4II9 A;  3F8K A;  3G3S A;  2NMT A;  4M85 A;  3JTK A;  2ZXV A;  3FXT A;  4CAE A;  2PC1 A;  4CYQ A;  3N7Z A;  1Z4E A;  2FIA A;  3EFA A;  4AG9 A;  5EBV A;  3R9G A;  4PV6 A;  3IWG A;  2B3V A;  2HUZ A;  2PSW A;  4NF1 A;  1KUX A;  2Z3L A;  2WPW A;  1M1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...