2BEIA

X-ray structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
156
Chain Sequence
SVRIREAKEGDCGDILRLIRELAEFEKLKISEEALRADGFGDNPFYHCLVAEILGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 2
publication title Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 156
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2beiA00
1S7FA 4H6ZA 4XPDB 5DWNA 3BLNA 3JUWA 1NMTA 1GHEA 1YVOA 2X7BA 2AJ6A 4MBUA 4B5PB 1Y7RA 3BJ8A 2PC1A 1I21A 2FIAA 4MHDA 5HMNA 1QSNA 4II9A 4CS0B 1S60A 2EUIA 2AE6A 3P2HA 2HV2A 3TE4A 4Y49B 2CY2A 2FXFA 3BJ7A 3W91A 4ZBGA 2J8MA 4KOXA 3B8GA 1UFHA 2ATRA 4FD4A 4FD7A 1Y9KA 4E2AA 4UBRA 3ZZIA 3LODA 4RS2A 4MY0A 4H6UA 4XPDC 4HNWB 3F8KA 1S7KA 3H4QA 4KVXA 3S6FA 4CRYB 2VXKA 2FSRA 5ISVA 3I3GA 4F0YA 3R96A 3V8IA 5H86A 1V0CA 3TO9A 4MJ8A 3JVNA 2B4DB 4I49A 4QC6A 4K30A 4AB7A 2JEVA 2G3AA 3T90A 3FBUA 4Y49C 2P6FA 4PSWA 4H89A 4OAEA 3DR6A 1B6BA 4KOWA 3S6HA 5C88A 4KOTA 1WK4A 4JLYA 3GYAA 4DNCA 2QECA 3TCVA 2WPWA 4JXRA 1TIQA 1LRZA 3EFAA 1YX0A 2I79A 3CXPA 5KTDA 2VZZA 4LUAA 3SXNA 2FCKA 1MJAA 2CNSA 3W6XA 1N71A 3RYOA 2I00A 2B3VA 5GCNA 2ZW7A 3K9UA 1CJWA 3EC4A 5F46A 2VBQA 1IB1E 3FB3A 3R9GA 3EY5A 3FIXA 4YRHA 1XEBA 5FVJA 4RI1A 2R8VA 1RXTA 3I9SA 2Y0MA 4HNYB 4HKFA 3TO6A 3QB8A 2B58A 1KZFA 3D3SA 3D2PA 1J4JA 1Q2CA 4OLLA 2Q4VA 3MGDA 3TT2A 3FNCA 2Q4YA 2PRBA 2OB0A 4XNHB 3GY9A 4U5YA 2F5IA 2J8NA 5IV0A 1Z4EA 1XE4A 4JWPA 3C26A 4NXYA 1L0CA 5J8FA 4LX9A 4AVCA 2H5MA 4AVBA 1Q2YA 1YVKA 4CRZB 1B87A 3EO4A 4NEXA 1YLEA 5EBVA 3WR7A 3TOBA 2B4BA 5H84A 5JPHA 3TFYA 4KVME 4JD6A 2FE7A 3EXNA 4UWJA 2R7HA 2Z10A 5CNPA 1QSTA 2ZXVA 4R9MA 2C27A 3CXSA 2Q0YA 4R3KA 3TOAA 1BOBA 2P6GA 3VWEA 2O28A 2REEA 4XNHC 2PR1A 2CNMA 3PZJA 3IGRA 2HUZA 1PUAA 5F48A 1K4JA 4U9YA 3ZJ0A 4B5OA 1I12A 4JJXA 4QB9A 4X5KA 4AVAA 1Q2DA 3R9EA 4IUSA 4KVOE 1BO4A 2GANA 2B5GA 2R1IA 2PR8A 1XF8A 2QIRA 1PU9A 4J3GA 3R1KA 1IIDA 2G3TA 3R9FA 1VHSA 1MJ9A 3DSBA 2RC4A 4QUSA 1S5KA 1S3ZA 4KZTA 2J8RA 1P4NA 4L89A 2FT0A 2D4OA 1M4GA 3S6GA 4AG7A 4KOUA 4UWIA 5KTAA 2EVNA 3R95A 1QSMA 2VI7A 1NE9A 2ZW4A 2VZYA 2JLMA 2ZPAA 2ZW6A 1QSOA 4AG9A 2PDOA 5EC4A 2BL1A 3F5BA 1WWZA 4QVTA 2BUEA 1M1DA 1NSLA 3VWDA 2VEZA 3D8PA 4E0AA 4OADA 2GE3A 4M85A 4KUAA 2FS5A 4NCZA 4GS4A 1M44A 3OWCA 4L8AA 1P0HA 5IB0A 2FIWA 2IL4A 1IYLA 1VKCA 1I1DA 1YK3A 2BEIA 2OZUA 2WPXA 3DDDA 1SQHA 4QBJA 2Z0ZA 3W6SA 4KLVA 3N7ZA 1KUVA 3FXTA 1XIXA 4PK2A 1Z4RA 4BMHA 4MY3A 2CNTA 4UA3A 1KUXA 2Q04A 4YFJA 4NSQA 5IX3A 1YREA 3DR8A 4B5PA 4FD6A 4KUBA 2OZGA 2P0WA 5JQ4A 1OZPA 3LD2A 4NF1A 2B5GB 2A4NA 3SXOA 3PGPA 3G8WA 4R57A 3G3SA 2QMLA 1ON0A 4KOYA 4JXQA 2OH1A 1IICA 4ORFA 5E96A 3TO7A 1MK4A 1KUYA 3IWGA 3DNSA 1CM0A 1S7LA 4MI4A 5I0CA 4ONUA 2PQ8A 1RO5A 1QSRA 2K5TA 2R98A 2VQYA 3FYNA 2REFA 5DWMA 1XMTA 1Z9UA 2HQYA 4YGOA 4R87A 1M4DA 4U9ZA 5F47A 4E8OA 2P6EA 2FL4A 4M3SA 3CXQA 3GKRA 2B4DA 3SHPA 2PSWA 3TTHA 2GIVA 1S7NA 4IF5A 2Q44A 5C82A 4CAXA 2ARHA 5HH1A 3UY5A 2JDDA 2G0BA 4CAVA 4PV6A 4F6AA 2KCWA 1U6MA 3QAHA 1Y9WA 4XPLA 3D2MA 3PP9A 2ZW5A 3KKWA 4CAWA 2Z11A 2Q7BA 3E0KA 2BSWA 2D4PA 1YR0A 2JDCA 4PK3A 1FY7A 5J8CA 3FRMA 1R57A 4FD5A 3P2FA 5KTCA 2B3UA 2DXQA 4EVYA 3NE7A 3S6KA 1IYKA 4KOVA 4XPKA 4KORA 2NMTA 5F49A 2OU2A 4HNXB 2OZHA 1M4IA 4PSXA 4KLWA 4R3LA 1YGHA 4KOSA 1MJBA 3F0AA 3T9YA
chains in the Genus database with same CATH superfamily
1S7FA 4H6ZA 3D66A 4XPDB 5DWNA 1GYTA 3FECA 4A95A 5G21A 3BLNA 1XJOA 3JUWA 1NMTA 2Z3KA 1GHEA 2CTBA 3KHZA 2NYQA 1YVOA 2X7BA 2AJ6A 4MBUA 4UEEA 2Z3LA 4B5PB 2RB7A 1Y7RA 1LAMA 3BJ8A 2PC1A 4BBHA 1I21A 2CIJA 2FIAA 4YU9A 4C68A 4WJBA 5A28A 2V8GA 4MHDA 5HMNA 1QSNA 4II9A 2C6GA 4CS0B 4OKOA 3VH9A 1CX8A 4JZ0A 4CYPA 1S60A 2EUIA 2ODFA 3D4UA 2AE6A 4CGLA 1IOFA 3P2HA 7CPAA 2HV2A 4MFLA 5JGFA 3TE4A 3WC5A 4Y49B 1Z8WA 1A2ZA 2CY2A 1PCAA 2FXFA 2POKA 3BJ7A 4WWVA 3W91A 4ZBGA 2J8MA 2HB6A 4B12A 4KOXA 3B8GA 1UFHA 2ATRA 2EBJA 3NA6A 3FX6A 2PCUA 4FD4A 4G1PA 4FD7A 1ELMP 1Y9KA 1IY7A 3WABA 4E2AA 4UBRA 2EK8A 3KQZA 4OC4A 3ZZIA 4A94A 4YWYA 1Z8XA 1LCPA 3LODA 4RS2A 2C6PA 5K8PA 4MY0A 4H6UA 4XPDC 4HNWB 1VGYA 2CTCA 1ZG8A 1HEEA 2NSMA 3F8KA 4P4EA 1S7KA 2Q43A 3RZAA 3H4QA 4KVXA 2PIZA 1TF9A 4KSIA 3S6FA 4CRYB 3D7DA 5AG7A 2VXKA 2FSRA 5ISVA 3S9MA 3I3GA 5K8MA 2EK9A 3NH5A 3D7FA 5AG6A 4F0YA 3R96A 3V8IA 5H86A 1V0CA 3TO9A 1IU8A 3CPXA 4NJQA 4UIBA 4MJ8A 2WZNA 3JVNA 2B4DB 1TXRA 4I49A 4QC6A 4Q38A 4K30A 4ZY0A 2XEFA 4AB7A 3KGQA 2JEVA 2G3AA 4MCPA 3FBUA 3T90A 4A32A 2PJ5A 5G22A 4DYOA 2PJAA 1YW6A 4Y49C 2P6FA 4PSWA 4H89A 4OIDA 4OAEA 3DR6A 3JTKA 1B6BA 4KOWA 4CYOA 2WUUA 3TX8A 3HUVA 3S6HA 2WYRA 5C88A 4KOTA 1F57A 4MMOA 4BINA 5CBMA 1WK4A 3N5FA 2YNEA 4JLYA 4ZY1A 2PVWA 1Y7EA 3GYAA 2QECA 3TCVA 4DNCA 2WPWA 3D7HA 2IQ6A 4JXRA 4Q7AA 4CGPA 1TIQA 4ZGYB 1LOKA 1LRZA 2DPTA 3EFAA 1YX0A 4P4JA 4MFZA 4P4DA 2I79A 4Q36A 3DGVA 3CXPA 4MRIA 5AG5A 3VARA 1BAVA 4B11A 4FWUA 2VZZA 4LUAA 4ZY2A 3RAMA 4MXUA 2FCKA 3SXNA 2V8DA 1MJAA 2CNSA 4UFWA 4UCPA 3W6XA 4A37A 4NGPA 1N71A 3D68A 2I00A 3RYOA 2B3VA 5GCNA 3CPAA 2PJ2A 2ZW7A 2BCOA 3V7ZA 4ZX9A 4IK2A 3K9UA 1CJWA 4F9VA 4NFRA 3NH8A 3H8EA 3KL9A 3EC4A 4NGNA 4CGOA 4NGRA 1CP7A 4MFKA 5F46A 2AFSA 2Q4ZA 2VBQA 1IB1E 3B3VA 2PJBA 4KSAA 5G20A 3FB3A 3R9GA 3B7IA 1IGBA 2CF4A 3EY5A 3FIXA 4YRHA 3SJGA 3KASA 3BHXA 3BI1A 2ZEFA 4MCSA 5I4MA 1H8LA 1XEBA 1LFWA 5FVJA 3L2NA 4RI1A 5JM6A 2R8VA 4A33A 5LYDA 1RXTA 3I9SA 2Z3NA 5CPAA 2Y0MA 3SJXA 4HNYB 4HKFA 1CPSA 3TO6A 3PFEA 3HLPA 3GUXA 1R43A 3QB8A 2B58A 2ZEPA 4Z65A 1KZFA 4B6ZA 3D3SA 3D2PA 1J4JA 1Q2CA 1CBXA 1X12A 3CT9A 4OLLA 1UWYA 2Q4VA 3MGDA 3TT2A 4H2KA 1ZLIA 3FNCA 5THWA 4AXVA 2Q4YA 2BOAA 2PRBA 2AFWA 2OB0A 4MHYA 2OOTA 2ZENA 4CPAA 2AFMA 2ZEOA 4XNHB 3GY9A 4UCMA 4U5YA 4ZYQA 5A27A 2F5IA 2HC9A 1ZG7A 2J8NA 4A39A 5IV0A 1Z4EA 1XE4A 2ZOGA 4JWPA 3MN8A 3SI2A 4M6IA 3C26A 3LACA 4NXYA 1L0CA 2GU2A 1M4LA 2QYVA 5J8FA 4LX9A 1LAPA 2EWBA 5ELYA 2H5MA 4PPZA 4OP4A 4AVCA 1Q2YA 1YVKA 4OC1A 4A30A 2QVPA 4IAVA 4AVBA 4CRZB 2PRQA 1B87A 3SJEA 3EO4A 2YGWA 3B3WA 4NEXA 2ZEDA 3S9NA 1YLEA 4K3NA 5EBVA 1KWMA 3IFEA 3WR7A 3TOBA 2B4BA 4KSFA 5H84A 5JPHA 2Z3MA 3TFYA 4PXDA 2PJ3A 4KVME 4JD6A 3JRUA 4MFQA 4OMEA 2YNCA 5G1ZA 2FE7A 4MCRA 3EXNA 4P45A 4UWJA 2R7HA 2Z10A 4RUHA 5BWAB 1FNOA 3BXMA 2Z3OA 1QSTA 5CNPA 2ZXVA 4R9MA 5F09A 3T8WA 2C27A 3CXSA 2Q0YA 4P10A 4R3KA 3TOAA 1BOBA 5IB9A 4P4IA 2P6GA 3VWEA 2O28A 3VATA 2REEA 2YNDA 4M6GA 2PR1A 4NGSA 4IHMA 4XNHC 4TNUA 2CNMA 2PJ8A 3PZJA 2PIYA 1LANA 2HUZA 1PUAA 3IGRA 4UIAA 2RFHA 5F48A 1K4JA 4U9YA 2PJ4A 3ZJ0A 1I12A 4B5OA 5DS0A 4JJXA 4QB9A 4X5KA 2G9DA 3KI9A 1VHOA 3IWWA 2AFZA 2FVGA 5LRGA 4AVAA 1Q2DA 3R9EA 3V38A 4IUSA 1BPNA 2BO9A 2AFUA 4ONWA 4NGMA 1ARMA 4KVOE 1TKHA 4UFVA 2YNCC 3ISXA 4C2YA 2AFXA 3DLJA 1BO4A 2GANA 2B5GA 4A31A 4B14A 2R1IA 2PR8A 1XF8A 3B3CA 1JWQA 2PJ6A 4EFDA 2QIRA 1PU9A 4J3GA 2GLFA 3PEIA 3BI0A 3R1KA 5KTDA 3IJ3A 1IIDA 2V8HA 1Q7LA 2G3TA 3R9FA 1VHSA 1MJ9A 2DPSA 3IU2A 4UF4A 4W9YA 4FAIA 3DSBA 2RC4A 2GLJA 4QUSA 5AGEA 3IC1A 4PXBA 2ZEMA 1S5KA 1S3ZA 1TKJA 4KZTA 2J8RA 1P4NA 3IEHA 4L89A 2FT0A 4MCQA 1ARLA 2D4OA 1M4GA 3FVLA 3S6GA 4AG7A 3H8GA 4KOUA 4UWIA 8CPAA 5KTAA 2EVNA 4TWEA 3R95A 3KZWA 1QSMA 2VI7A 3FJUA 3PFOA 4C2ZA 1OBRA 1NE9A 1ZO0A 2ZW4A 4C7IA 1F2OA 2PJ9A 2VZYA 2CXAA 2JLMA 2ZPAA 3A9LA 3I1UA 2ZW6A 3SI1A 3QNVA 4UEZA 2GREA 1QSOA 4AG9A 2PDOA 3QAYA 4F9UA 5EC4A 2V8VA 2BL1A 3F5BA 1WWZA 2C1CA 1QQ9A 3PB6X 4MHZA 2DF5A 5J1QA 1YLOA 3K9TA 2PVVA 4X2TA 4QVTA 3FEEA 2BUEA 4GM5A 4CAEA 2IJZA 2XEJA 4HPSA 1M1DA 1NSLA 2O4HA 3VWDA 2VEZA 3B2YA 2PJ7A 3D8PA 4E0AA 2J9AA 1BPMA 6CPAA 3TC8A 4OADA 1DE4C 5JH9A 4CGNA 2JBKA 3RO0A 4RN7A 3RNZA 2GE3A 4UEFA 4M85A 4KUAA 2F7VA 2F8HA 4DUKA 2FS5A 3CDXA 3NFZA 1RTQA 4UFXA 2JBJA 3FF3A 4NCZA 4GS4A 2EO8A 1M44A 4UCNA 3OWCA 4L8AA 1BLLE 1Y0RA 1P0HA 1JQGA 1QMUA 4NGQA 5IB0A 2FIWA 1XBUA 2IL4A 4NGTA 1IYLA 2ZELA 3SI0A 3GB0A 1VKCA 1PYTB 3PB4X 3B3SA 1I1DA 1YW4A 1YK3A 2BEIA 4F0XA 3NE8A 3LMSA 4A38A 2IMOA 2ZEGA 2O53A 2OZUA 2WPXA 3DDDA 1SQHA 4P4FA 4QBJA 4KS9A 2Z0ZA 1AMPA 3FEDA 4KLVA 3N7ZA 4LQGA 3W6SA 1KUVA 3IU1A 1ZG9A 3FXTA 5LRKA 1XIXA 4X3RA 4PK2A 1Z4RA 4BMHA 2ZOFA 4MY3A 5HVFA 2CNTA 2VL1A 4JYWA 4MFJA 2QJ8A 1XFOA 4UA3A 5EMIA 1KUXA 2Q04A 4YFJA 4PQAA 4NSQA 2XEIA 5IX3A 4CYQA 1YREA 3DR8A 3FH4A 4B5PA 1Z8TA 3B35A 4OC0A 5LYFA 4B13A 4FD6A 4KUBA 2OZGA 3D67A 2P0WA 4OC3A 2DEAA 4M6HA 1XMBA 3MRUA 1CP6A 5K8OA 2XEGA 5JQ4A 1OZPA 3LD2A 1NSAA 2B5GB 2Q7SA 4NF1A 2A4NA 2ABZA 4MFPA 3PGPA 4FUUA 3SXOA 1X10A 3G8WA 5D8NA 2JEWA 4R57A 3G3SA 3CZXA 3IO1A 4B10A 2ZEEA 2QMLA 1XOVA 1Z2LA 4C2XA 1ON0A 1TKFA 4X8IA 5HVGA 1CG2A 4KOYA 4JXQA 4P44A 4OIWA 2OH1A 1IICA 1VHEA 4ORFA 5E96A 3TO7A 1MK4A 1KUYA 3IWGA 3DNSA 1CM0A 4R6TA 3WT4A 5HXDA 3H8FA 4R76A 1S7LA 3H5ZA 2ANPA 3KQXA 4MI4A 5I0CA 4ONUA 4P6YA 2PQ8A 1RO5A 1QSRA 4DJLA 3PBBA 3PB9X 2K5TA 2R98A 2VQYA 3PB8X 3FYNA 1ELLP 2REFA 5LRJA 4F8ZA 4O23A 5DWMA 4CAFA 1XMTA 1Z9UA 2HQYA 2PJ1A 4YGOA 4R87A 1M4DA 4MHPA 4U9ZA 1HDUA 2PJ0A 3KR5A 5F47A 4E8OA 5LYLA 4FBEA 2P6EA 2FL4A 3IIBA 4CGMA 1FT7A 1VIXA 1YQEA 2PE3A 3IWEA 3PB7X 4M3SA 3CXQA 3GKRA 2B4DA 3SJFA 1F2PA 3SHPA 1EE3P 1YSJA 2PSWA 3TTHA 2Z3PA 4C7HA 2GIVA 3PRTA 4OC5A 4EMEA 2GFQA 2WSAA 1S7NA 4IF5A 2Q44A 5C82A 4CAXA 2ARHA 1AUGA 1Z5RA 2V77A 5HH1A 3UY5A 2JDDA 3GIUA 4PXCA 2G0BA 4CAVA 3B3TA 4PV6A 2PJCA 1CPXA 3KHXA 2AFOA 5HVHA 1YMEA 2KCWA 4F6AA 1U6MA 3QAHA 1Y9WA 4R8FA 4XPLA 4NJRA 3K2KA 2OR4A 3D2MA 1IOIA 1R3NA 2I3CA 4P4BA 1DTDA 3PP9A 2ZEHA 2ZW5A 3ISZA 3D7GA 3KKWA 1XRYA 4CAWA 3NH4A 4GXHA 3WC6A 2Q51A 1Z8LA 2Z11A 2Q7BA 3E0KA 3KR4A 2BSWA 2D4PA 4OC2A 1Y0YA 3RBUA 4A2ZA 3GLJA 1YR0A 4R7MA 2JDCA 4PK3A 5K8NA 1FY7A 5AG4A 3FRMA 5J8CA 1R57A 1TF8A 4FD5A 3P2FA 4ZX8A 5LYIA 4CYNA 2B3UA 2DXQA 1HDQA 5KTCA 4EVYA 3S9LA 1AYEA 3NE7A 3S6KA 1IYKA 4KOVA 5D29A 4EWTA 4XPKA 4KORA 3PBEA 2NMTA 5F49A 2OU2A 2C6CA 1ZLHA 2OZHA 1M4IA 4HNXB 4MHNA 4PSXA 4KLWA 4BD9A 4PXEA 4R3LA 1YGHA 1MJBA 4KOSA 4LQ6A 3WC7A 3LWUA 3FMCA 3F0AA 3T9YA 4ZI6A
chains in the Genus database with same CATH topology
1S7FA 4H6ZA 4XPDB 5DWNA 4A95A 5G21A 3BLNA 3JUWA 1NMTA 2Z3KA 1GHEA 1YVOA 2X7BA 2AJ6A 4MBUA 2Z3LA 4B5PB 1Y7RA 3BJ8A 2PC1A 4BBHA 1I21A 2FIAA 4C68A 5A28A 4MHDA 5HMNA 1QSNA 4II9A 4CS0B 4CYPA 1S60A 2EUIA 2AE6A 4CGLA 3P2HA 2HV2A 4MFLA 3TE4A 4Y49B 2CY2A 2FXFA 3BJ7A 3W91A 4ZBGA 2J8MA 4B12A 4KOXA 3B8GA 1UFHA 2ATRA 4FD4A 4FD7A 1Y9KA 4E2AA 4UBRA 3ZZIA 3LODA 4RS2A 4MY0A 4H6UA 4XPDC 4HNWB 3F8KA 1S7KA 3H4QA 4KVXA 3S6FA 4CRYB 5AG7A 2VXKA 2FSRA 5ISVA 3I3GA 5AG6A 4F0YA 3R96A 3V8IA 5H86A 1V0CA 3TO9A 4MJ8A 3JVNA 2B4DB 4I49A 4QC6A 4Q38A 4K30A 4AB7A 2JEVA 2G3AA 3T90A 3FBUA 4A32A 5G22A 4Y49C 2P6FA 4PSWA 4H89A 4OAEA 3DR6A 3JTKA 1B6BA 4KOWA 4CYOA 2WUUA 3S6HA 5C88A 4KOTA 1WK4A 2YNEA 4JLYA 3GYAA 4DNCA 2QECA 3TCVA 2WPWA 4JXRA 4CGPA 1TIQA 4ZGYB 1LRZA 2DPTA 3EFAA 1YX0A 4MFZA 2I79A 4Q36A 3CXPA 5AG5A 4B11A 5KTDA 2VZZA 4LUAA 3SXNA 2FCKA 1MJAA 2CNSA 4UFWA 4UCPA 3W6XA 1N71A 3RYOA 2I00A 2B3VA 5GCNA 2ZW7A 3K9UA 1CJWA 3EC4A 4CGOA 4MFKA 5F46A 2VBQA 1IB1E 4KSAA 5G20A 3FB3A 3R9GA 3EY5A 3FIXA 4YRHA 1XEBA 5FVJA 4RI1A 2R8VA 4A33A 1RXTA 3I9SA 2Z3NA 2Y0MA 4HNYB 4HKFA 3TO6A 3QB8A 2B58A 1KZFA 3D3SA 3D2PA 1J4JA 1Q2CA 4OLLA 2Q4VA 3MGDA 3TT2A 3FNCA 2Q4YA 2PRBA 2OB0A 4XNHB 3GY9A 4UCMA 4U5YA 5A27A 2F5IA 2J8NA 5IV0A 1Z4EA 1XE4A 4JWPA 3C26A 4NXYA 1L0CA 5J8FA 4LX9A 4AVCA 2H5MA 4AVBA 1Q2YA 1YVKA 4A30A 4CRZB 1B87A 3EO4A 2YGWA 4NEXA 1YLEA 5EBVA 3WR7A 3TOBA 2B4BA 4KSFA 5H84A 5JPHA 2Z3MA 3TFYA 4KVME 4JD6A 4MFQA 2YNCA 5G1ZA 2FE7A 3EXNA 4UWJA 2R7HA 2Z10A 5BWAB 5CNPA 2Z3OA 1QSTA 2ZXVA 4R9MA 2C27A 3CXSA 2Q0YA 4R3KA 3TOAA 1BOBA 2P6GA 3VWEA 2O28A 2REEA 2YNDA 4XNHC 2PR1A 2CNMA 3PZJA 3IGRA 2HUZA 1PUAA 5F48A 1K4JA 4U9YA 3ZJ0A 4B5OA 1I12A 4JJXA 4QB9A 4X5KA 4AVAA 1Q2DA 3R9EA 4IUSA 4KVOE 4UFVA 2YNCC 4C2YA 1BO4A 2GANA 2B5GA 4A31A 4B14A 2R1IA 2PR8A 1XF8A 2QIRA 1PU9A 4J3GA 3R1KA 1IIDA 2G3TA 3R9FA 1VHSA 1MJ9A 2DPSA 3IU2A 3DSBA 2RC4A 4QUSA 5AGEA 1S5KA 1S3ZA 4KZTA 2J8RA 1P4NA 4L89A 2FT0A 2D4OA 1M4GA 3S6GA 4AG7A 4KOUA 4UWIA 5KTAA 2EVNA 3R95A 1QSMA 2VI7A 4C2ZA 1NE9A 1ZO0A 2ZW4A 4C7IA 2VZYA 2CXAA 2JLMA 2ZPAA 3A9LA 2ZW6A 1QSOA 4AG9A 2PDOA 5EC4A 2BL1A 3F5BA 1WWZA 4QVTA 2BUEA 4CAEA 1M1DA 1NSLA 3VWDA 2VEZA 3D8PA 4E0AA 4OADA 4CGNA 2GE3A 4M85A 4KUAA 2FS5A 4UFXA 4NCZA 4GS4A 1M44A 4UCNA 3OWCA 4L8AA 1P0HA 5IB0A 2FIWA 2IL4A 1IYLA 1VKCA 1I1DA 1YK3A 2BEIA 4F0XA 2OZUA 2WPXA 3DDDA 1SQHA 4QBJA 4KS9A 2Z0ZA 3W6SA 4KLVA 3N7ZA 1KUVA 3IU1A 3FXTA 1XIXA 4PK2A 1Z4RA 4BMHA 4MY3A 2CNTA 4MFJA 4UA3A 1KUXA 2Q04A 4YFJA 4NSQA 5IX3A 4CYQA 1YREA 3DR8A 4B5PA 4B13A 4FD6A 4KUBA 2OZGA 2P0WA 5JQ4A 1OZPA 3LD2A 4NF1A 2B5GB 2A4NA 4MFPA 3SXOA 3PGPA 3G8WA 4R57A 3G3SA 4B10A 2QMLA 4C2XA 1ON0A 4KOYA 4JXQA 2OH1A 1IICA 4ORFA 5E96A 3TO7A 1MK4A 1KUYA 3IWGA 3DNSA 1CM0A 1S7LA 3H5ZA 4MI4A 5I0CA 4ONUA 2PQ8A 1RO5A 1QSRA 2K5TA 2R98A 2VQYA 3FYNA 2REFA 5DWMA 4CAFA 1XMTA 1Z9UA 2HQYA 4YGOA 4R87A 1M4DA 4U9ZA 5F47A 4E8OA 2P6EA 2FL4A 4CGMA 3IWEA 4M3SA 3CXQA 3GKRA 2B4DA 3SHPA 2PSWA 3TTHA 2Z3PA 4C7HA 2GIVA 2WSAA 1S7NA 4IF5A 2Q44A 5C82A 4CAXA 2ARHA 5HH1A 3UY5A 2JDDA 2G0BA 4CAVA 4PV6A 4F6AA 2KCWA 1U6MA 3QAHA 1Y9WA 4XPLA 3D2MA 3PP9A 2ZW5A 3KKWA 4CAWA 2Z11A 2Q7BA 3E0KA 2BSWA 2D4PA 4A2ZA 1YR0A 2JDCA 4PK3A 1FY7A 5AG4A 3FRMA 5J8CA 1R57A 4FD5A 3P2FA 4CYNA 5KTCA 2B3UA 2DXQA 4EVYA 3NE7A 3S6KA 1IYKA 4KOVA 4XPKA 4KORA 2NMTA 5F49A 2OU2A 4HNXB 2OZHA 1M4IA 4PSXA 4KLWA 4R3LA 1YGHA 1MJBA 4KOSA 3F0AA 3T9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7F A;  4H6Z A;  4XPD B;  5DWN A;  3BLN A;  3JUW A;  1NMT A;  1GHE A;  1YVO A;  2X7B A;  2AJ6 A;  4MBU A;  4B5P B;  1Y7R A;  3BJ8 A;  2PC1 A;  1I21 A;  2FIA A;  4MHD A;  5HMN A;  1QSN A;  4II9 A;  4CS0 B;  1S60 A;  2EUI A;  2AE6 A;  3P2H A;  2HV2 A;  3TE4 A;  4Y49 B;  2CY2 A;  2FXF A;  3BJ7 A;  3W91 A;  4ZBG A;  2J8M A;  4KOX A;  3B8G A;  1UFH A;  2ATR A;  4FD4 A;  4FD7 A;  1Y9K A;  4E2A A;  4UBR A;  3ZZI A;  3LOD A;  4RS2 A;  4MY0 A;  4H6U A;  4XPD C;  4HNW B;  3F8K A;  1S7K A;  3H4Q A;  4KVX A;  3S6F A;  4CRY B;  2VXK A;  2FSR A;  5ISV A;  3I3G A;  4F0Y A;  3R96 A;  3V8I A;  5H86 A;  1V0C A;  3TO9 A;  4MJ8 A;  3JVN A;  2B4D B;  4I49 A;  4QC6 A;  4K30 A;  4AB7 A;  2JEV A;  2G3A A;  3T90 A;  3FBU A;  4Y49 C;  2P6F A;  4PSW A;  4H89 A;  4OAE A;  3DR6 A;  1B6B A;  4KOW A;  3S6H A;  5C88 A;  4KOT A;  1WK4 A;  4JLY A;  3GYA A;  4DNC A;  2QEC A;  3TCV A;  2WPW A;  4JXR A;  1TIQ A;  1LRZ A;  3EFA A;  1YX0 A;  2I79 A;  3CXP A;  5KTD A;  2VZZ A;  4LUA A;  3SXN A;  2FCK A;  1MJA A;  2CNS A;  3W6X A;  1N71 A;  3RYO A;  2I00 A;  2B3V A;  5GCN A;  2ZW7 A;  3K9U A;  1CJW A;  3EC4 A;  5F46 A;  2VBQ A;  1IB1 E;  3FB3 A;  3R9G A;  3EY5 A;  3FIX A;  4YRH A;  1XEB A;  5FVJ A;  4RI1 A;  2R8V A;  1RXT A;  3I9S A;  2Y0M A;  4HNY B;  4HKF A;  3TO6 A;  3QB8 A;  2B58 A;  1KZF A;  3D3S A;  3D2P A;  1J4J A;  1Q2C A;  4OLL A;  2Q4V A;  3MGD A;  3TT2 A;  3FNC A;  2Q4Y A;  2PRB A;  2OB0 A;  4XNH B;  3GY9 A;  4U5Y A;  2F5I A;  2J8N A;  5IV0 A;  1Z4E A;  1XE4 A;  4JWP A;  3C26 A;  4NXY A;  1L0C A;  5J8F A;  4LX9 A;  4AVC A;  2H5M A;  4AVB A;  1Q2Y A;  1YVK A;  4CRZ B;  1B87 A;  3EO4 A;  4NEX A;  1YLE A;  5EBV A;  3WR7 A;  3TOB A;  2B4B A;  5H84 A;  5JPH A;  3TFY A;  4KVM E;  4JD6 A;  2FE7 A;  3EXN A;  4UWJ A;  2R7H A;  2Z10 A;  5CNP A;  1QST A;  2ZXV A;  4R9M A;  2C27 A;  3CXS A;  2Q0Y A;  4R3K A;  3TOA A;  1BOB A;  2P6G A;  3VWE A;  2O28 A;  2REE A;  4XNH C;  2PR1 A;  2CNM A;  3PZJ A;  3IGR A;  2HUZ A;  1PUA A;  5F48 A;  1K4J A;  4U9Y A;  3ZJ0 A;  4B5O A;  1I12 A;  4JJX A;  4QB9 A;  4X5K A;  4AVA A;  1Q2D A;  3R9E A;  4IUS A;  4KVO E;  1BO4 A;  2GAN A;  2B5G A;  2R1I A;  2PR8 A;  1XF8 A;  2QIR A;  1PU9 A;  4J3G A;  3R1K A;  1IID A;  2G3T A;  3R9F A;  1VHS A;  1MJ9 A;  3DSB A;  2RC4 A;  4QUS A;  1S5K A;  1S3Z A;  4KZT A;  2J8R A;  1P4N A;  4L89 A;  2FT0 A;  2D4O A;  1M4G A;  3S6G A;  4AG7 A;  4KOU A;  4UWI A;  5KTA A;  2EVN A;  3R95 A;  1QSM A;  2VI7 A;  1NE9 A;  2ZW4 A;  2VZY A;  2JLM A;  2ZPA A;  2ZW6 A;  1QSO A;  4AG9 A;  2PDO A;  5EC4 A;  2BL1 A;  3F5B A;  1WWZ A;  4QVT A;  2BUE A;  1M1D A;  1NSL A;  3VWD A;  2VEZ A;  3D8P A;  4E0A A;  4OAD A;  2GE3 A;  4M85 A;  4KUA A;  2FS5 A;  4NCZ A;  4GS4 A;  1M44 A;  3OWC A;  4L8A A;  1P0H A;  5IB0 A;  2FIW A;  2IL4 A;  1IYL A;  1VKC A;  1I1D A;  1YK3 A;  2BEI A;  2OZU A;  2WPX A;  3DDD A;  1SQH A;  4QBJ A;  2Z0Z A;  3W6S A;  4KLV A;  3N7Z A;  1KUV A;  3FXT A;  1XIX A;  4PK2 A;  1Z4R A;  4BMH A;  4MY3 A;  2CNT A;  4UA3 A;  1KUX A;  2Q04 A;  4YFJ A;  4NSQ A;  5IX3 A;  1YRE A;  3DR8 A;  4B5P A;  4FD6 A;  4KUB A;  2OZG A;  2P0W A;  5JQ4 A;  1OZP A;  3LD2 A;  4NF1 A;  2B5G B;  2A4N A;  3SXO A;  3PGP A;  3G8W A;  4R57 A;  3G3S A;  2QML A;  1ON0 A;  4KOY A;  4JXQ A;  2OH1 A;  1IIC A;  4ORF A;  5E96 A;  3TO7 A;  1MK4 A;  1KUY A;  3IWG A;  3DNS A;  1CM0 A;  1S7L A;  4MI4 A;  5I0C A;  4ONU A;  2PQ8 A;  1RO5 A;  1QSR A;  2K5T A;  2R98 A;  2VQY A;  3FYN A;  2REF A;  5DWM A;  1XMT A;  1Z9U A;  2HQY A;  4YGO A;  4R87 A;  1M4D A;  4U9Z A;  5F47 A;  4E8O A;  2P6E A;  2FL4 A;  4M3S A;  3CXQ A;  3GKR A;  2B4D A;  3SHP A;  2PSW A;  3TTH A;  2GIV A;  1S7N A;  4IF5 A;  2Q44 A;  5C82 A;  4CAX A;  2ARH A;  5HH1 A;  3UY5 A;  2JDD A;  2G0B A;  4CAV A;  4PV6 A;  4F6A A;  2KCW A;  1U6M A;  3QAH A;  1Y9W A;  4XPL A;  3D2M A;  3PP9 A;  2ZW5 A;  3KKW A;  4CAW A;  2Z11 A;  2Q7B A;  3E0K A;  2BSW A;  2D4P A;  1YR0 A;  2JDC A;  4PK3 A;  1FY7 A;  5J8C A;  3FRM A;  1R57 A;  4FD5 A;  3P2F A;  5KTC A;  2B3U A;  2DXQ A;  4EVY A;  3NE7 A;  3S6K A;  1IYK A;  4KOV A;  4XPK A;  4KOR A;  2NMT A;  5F49 A;  2OU2 A;  4HNX B;  2OZH A;  1M4I A;  4PSX A;  4KLW A;  4R3L A;  1YGH A;  4KOS A;  1MJB A;  3F0A A;  3T9Y A; 
#chains in the Genus database with same CATH topology
 1S7F A;  4H6Z A;  3D66 A;  4XPD B;  5DWN A;  1GYT A;  3FEC A;  4A95 A;  5G21 A;  3BLN A;  1XJO A;  3JUW A;  1NMT A;  2Z3K A;  1GHE A;  2CTB A;  3KHZ A;  2NYQ A;  1YVO A;  2X7B A;  2AJ6 A;  4MBU A;  4UEE A;  2Z3L A;  4B5P B;  2RB7 A;  1Y7R A;  1LAM A;  3BJ8 A;  2PC1 A;  4BBH A;  1I21 A;  2CIJ A;  2FIA A;  4YU9 A;  4C68 A;  4WJB A;  5A28 A;  2V8G A;  4MHD A;  5HMN A;  1QSN A;  4II9 A;  2C6G A;  4CS0 B;  4OKO A;  3VH9 A;  1CX8 A;  4JZ0 A;  4CYP A;  1S60 A;  2EUI A;  2ODF A;  3D4U A;  2AE6 A;  4CGL A;  1IOF A;  3P2H A;  7CPA A;  2HV2 A;  4MFL A;  5JGF A;  3TE4 A;  3WC5 A;  4Y49 B;  1Z8W A;  1A2Z A;  2CY2 A;  1PCA A;  2FXF A;  2POK A;  3BJ7 A;  4WWV A;  3W91 A;  4ZBG A;  2J8M A;  2HB6 A;  4B12 A;  4KOX A;  3B8G A;  1UFH A;  2ATR A;  2EBJ A;  3NA6 A;  3FX6 A;  2PCU A;  4FD4 A;  4G1P A;  4FD7 A;  1ELM P;  1Y9K A;  1IY7 A;  3WAB A;  4E2A A;  4UBR A;  2EK8 A;  3KQZ A;  4OC4 A;  3ZZI A;  4A94 A;  4YWY A;  1Z8X A;  1LCP A;  3LOD A;  4RS2 A;  2C6P A;  5K8P A;  4MY0 A;  4H6U A;  4XPD C;  4HNW B;  1VGY A;  2CTC A;  1ZG8 A;  1HEE A;  2NSM A;  3F8K A;  4P4E A;  1S7K A;  2Q43 A;  3RZA A;  3H4Q A;  4KVX A;  2PIZ A;  1TF9 A;  4KSI A;  3S6F A;  4CRY B;  3D7D A;  5AG7 A;  2VXK A;  2FSR A;  5ISV A;  3S9M A;  3I3G A;  5K8M A;  2EK9 A;  3NH5 A;  3D7F A;  5AG6 A;  4F0Y A;  3R96 A;  3V8I A;  5H86 A;  1V0C A;  3TO9 A;  1IU8 A;  3CPX A;  4NJQ A;  4UIB A;  4MJ8 A;  2WZN A;  3JVN A;  2B4D B;  1TXR A;  4I49 A;  4QC6 A;  4Q38 A;  4K30 A;  4ZY0 A;  2XEF A;  4AB7 A;  3KGQ A;  2JEV A;  2G3A A;  4MCP A;  3FBU A;  3T90 A;  4A32 A;  2PJ5 A;  5G22 A;  4DYO A;  2PJA A;  1YW6 A;  4Y49 C;  2P6F A;  4PSW A;  4H89 A;  4OID A;  4OAE A;  3DR6 A;  3JTK A;  1B6B A;  4KOW A;  4CYO A;  2WUU A;  3TX8 A;  3HUV A;  3S6H A;  2WYR A;  5C88 A;  4KOT A;  1F57 A;  4MMO A;  4BIN A;  5CBM A;  1WK4 A;  3N5F A;  2YNE A;  4JLY A;  4ZY1 A;  2PVW A;  1Y7E A;  3GYA A;  2QEC A;  3TCV A;  4DNC A;  2WPW A;  3D7H A;  2IQ6 A;  4JXR A;  4Q7A A;  4CGP A;  1TIQ A;  4ZGY B;  1LOK A;  1LRZ A;  2DPT A;  3EFA A;  1YX0 A;  4P4J A;  4MFZ A;  4P4D A;  2I79 A;  4Q36 A;  3DGV A;  3CXP A;  4MRI A;  5AG5 A;  3VAR A;  1BAV A;  4B11 A;  4FWU A;  2VZZ A;  4LUA A;  4ZY2 A;  3RAM A;  4MXU A;  2FCK A;  3SXN A;  2V8D A;  1MJA A;  2CNS A;  4UFW A;  4UCP A;  3W6X A;  4A37 A;  4NGP A;  1N71 A;  3D68 A;  2I00 A;  3RYO A;  2B3V A;  5GCN A;  3CPA A;  2PJ2 A;  2ZW7 A;  2BCO A;  3V7Z A;  4ZX9 A;  4IK2 A;  3K9U A;  1CJW A;  4F9V A;  4NFR A;  3NH8 A;  3H8E A;  3KL9 A;  3EC4 A;  4NGN A;  4CGO A;  4NGR A;  1CP7 A;  4MFK A;  5F46 A;  2AFS A;  2Q4Z A;  2VBQ A;  1IB1 E;  3B3V A;  2PJB A;  4KSA A;  5G20 A;  3FB3 A;  3R9G A;  3B7I A;  1IGB A;  2CF4 A;  3EY5 A;  3FIX A;  4YRH A;  3SJG A;  3KAS A;  3BHX A;  3BI1 A;  2ZEF A;  4MCS A;  5I4M A;  1H8L A;  1XEB A;  1LFW A;  5FVJ A;  3L2N A;  4RI1 A;  5JM6 A;  2R8V A;  4A33 A;  5LYD A;  1RXT A;  3I9S A;  2Z3N A;  5CPA A;  2Y0M A;  3SJX A;  4HNY B;  4HKF A;  1CPS A;  3TO6 A;  3PFE A;  3HLP A;  3GUX A;  1R43 A;  3QB8 A;  2B58 A;  2ZEP A;  4Z65 A;  1KZF A;  4B6Z A;  3D3S A;  3D2P A;  1J4J A;  1Q2C A;  1CBX A;  1X12 A;  3CT9 A;  4OLL A;  1UWY A;  2Q4V A;  3MGD A;  3TT2 A;  4H2K A;  1ZLI A;  3FNC A;  5THW A;  4AXV A;  2Q4Y A;  2BOA A;  2PRB A;  2AFW A;  2OB0 A;  4MHY A;  2OOT A;  2ZEN A;  4CPA A;  2AFM A;  2ZEO A;  4XNH B;  3GY9 A;  4UCM A;  4U5Y A;  4ZYQ A;  5A27 A;  2F5I A;  2HC9 A;  1ZG7 A;  2J8N A;  4A39 A;  5IV0 A;  1Z4E A;  1XE4 A;  2ZOG A;  4JWP A;  3MN8 A;  3SI2 A;  4M6I A;  3C26 A;  3LAC A;  4NXY A;  1L0C A;  2GU2 A;  1M4L A;  2QYV A;  5J8F A;  4LX9 A;  1LAP A;  2EWB A;  5ELY A;  2H5M A;  4PPZ A;  4OP4 A;  4AVC A;  1Q2Y A;  1YVK A;  4OC1 A;  4A30 A;  2QVP A;  4IAV A;  4AVB A;  4CRZ B;  2PRQ A;  1B87 A;  3SJE A;  3EO4 A;  2YGW A;  3B3W A;  4NEX A;  2ZED A;  3S9N A;  1YLE A;  4K3N A;  5EBV A;  1KWM A;  3IFE A;  3WR7 A;  3TOB A;  2B4B A;  4KSF A;  5H84 A;  5JPH A;  2Z3M A;  3TFY A;  4PXD A;  2PJ3 A;  4KVM E;  4JD6 A;  3JRU A;  4MFQ A;  4OME A;  2YNC A;  5G1Z A;  2FE7 A;  4MCR A;  3EXN A;  4P45 A;  4UWJ A;  2R7H A;  2Z10 A;  4RUH A;  5BWA B;  1FNO A;  3BXM A;  2Z3O A;  1QST A;  5CNP A;  2ZXV A;  4R9M A;  5F09 A;  3T8W A;  2C27 A;  3CXS A;  2Q0Y A;  4P10 A;  4R3K A;  3TOA A;  1BOB A;  5IB9 A;  4P4I A;  2P6G A;  3VWE A;  2O28 A;  3VAT A;  2REE A;  2YND A;  4M6G A;  2PR1 A;  4NGS A;  4IHM A;  4XNH C;  4TNU A;  2CNM A;  2PJ8 A;  3PZJ A;  2PIY A;  1LAN A;  2HUZ A;  1PUA A;  3IGR A;  4UIA A;  2RFH A;  5F48 A;  1K4J A;  4U9Y A;  2PJ4 A;  3ZJ0 A;  1I12 A;  4B5O A;  5DS0 A;  4JJX A;  4QB9 A;  4X5K A;  2G9D A;  3KI9 A;  1VHO A;  3IWW A;  2AFZ A;  2FVG A;  5LRG A;  4AVA A;  1Q2D A;  3R9E A;  3V38 A;  4IUS A;  1BPN A;  2BO9 A;  2AFU A;  4ONW A;  4NGM A;  1ARM A;  4KVO E;  1TKH A;  4UFV A;  2YNC C;  3ISX A;  4C2Y A;  2AFX A;  3DLJ A;  1BO4 A;  2GAN A;  2B5G A;  4A31 A;  4B14 A;  2R1I A;  2PR8 A;  1XF8 A;  3B3C A;  1JWQ A;  2PJ6 A;  4EFD A;  2QIR A;  1PU9 A;  4J3G A;  2GLF A;  3PEI A;  3BI0 A;  3R1K A;  5KTD A;  3IJ3 A;  1IID A;  2V8H A;  1Q7L A;  2G3T A;  3R9F A;  1VHS A;  1MJ9 A;  2DPS A;  3IU2 A;  4UF4 A;  4W9Y A;  4FAI A;  3DSB A;  2RC4 A;  2GLJ A;  4QUS A;  5AGE A;  3IC1 A;  4PXB A;  2ZEM A;  1S5K A;  1S3Z A;  1TKJ A;  4KZT A;  2J8R A;  1P4N A;  3IEH A;  4L89 A;  2FT0 A;  4MCQ A;  1ARL A;  2D4O A;  1M4G A;  3FVL A;  3S6G A;  4AG7 A;  3H8G A;  4KOU A;  4UWI A;  8CPA A;  5KTA A;  2EVN A;  4TWE A;  3R95 A;  3KZW A;  1QSM A;  2VI7 A;  3FJU A;  3PFO A;  4C2Z A;  1OBR A;  1NE9 A;  1ZO0 A;  2ZW4 A;  4C7I A;  1F2O A;  2PJ9 A;  2VZY A;  2CXA A;  2JLM A;  2ZPA A;  3A9L A;  3I1U A;  2ZW6 A;  3SI1 A;  3QNV A;  4UEZ A;  2GRE A;  1QSO A;  4AG9 A;  2PDO A;  3QAY A;  4F9U A;  5EC4 A;  2V8V A;  2BL1 A;  3F5B A;  1WWZ A;  2C1C A;  1QQ9 A;  3PB6 X;  4MHZ A;  2DF5 A;  5J1Q A;  1YLO A;  3K9T A;  2PVV A;  4X2T A;  4QVT A;  3FEE A;  2BUE A;  4GM5 A;  4CAE A;  2IJZ A;  2XEJ A;  4HPS A;  1M1D A;  1NSL A;  2O4H A;  3VWD A;  2VEZ A;  3B2Y A;  2PJ7 A;  3D8P A;  4E0A A;  2J9A A;  1BPM A;  6CPA A;  3TC8 A;  4OAD A;  1DE4 C;  5JH9 A;  4CGN A;  2JBK A;  3RO0 A;  4RN7 A;  3RNZ A;  2GE3 A;  4UEF A;  4M85 A;  4KUA A;  2F7V A;  2F8H A;  4DUK A;  2FS5 A;  3CDX A;  3NFZ A;  1RTQ A;  4UFX A;  2JBJ A;  3FF3 A;  4NCZ A;  4GS4 A;  2EO8 A;  1M44 A;  4UCN A;  3OWC A;  4L8A A;  1BLL E;  1Y0R A;  1P0H A;  1JQG A;  1QMU A;  4NGQ A;  5IB0 A;  2FIW A;  1XBU A;  2IL4 A;  4NGT A;  1IYL A;  2ZEL A;  3SI0 A;  3GB0 A;  1VKC A;  1PYT B;  3PB4 X;  3B3S A;  1I1D A;  1YW4 A;  1YK3 A;  2BEI A;  4F0X A;  3NE8 A;  3LMS A;  4A38 A;  2IMO A;  2ZEG A;  2O53 A;  2OZU A;  2WPX A;  3DDD A;  1SQH A;  4P4F A;  4QBJ A;  4KS9 A;  2Z0Z A;  1AMP A;  3FED A;  4KLV A;  3N7Z A;  4LQG A;  3W6S A;  1KUV A;  3IU1 A;  1ZG9 A;  3FXT A;  5LRK A;  1XIX A;  4X3R A;  4PK2 A;  1Z4R A;  4BMH A;  2ZOF A;  4MY3 A;  5HVF A;  2CNT A;  2VL1 A;  4JYW A;  4MFJ A;  2QJ8 A;  1XFO A;  4UA3 A;  5EMI A;  1KUX A;  2Q04 A;  4YFJ A;  4PQA A;  4NSQ A;  2XEI A;  5IX3 A;  4CYQ A;  1YRE A;  3DR8 A;  3FH4 A;  4B5P A;  1Z8T A;  3B35 A;  4OC0 A;  5LYF A;  4B13 A;  4FD6 A;  4KUB A;  2OZG A;  3D67 A;  2P0W A;  4OC3 A;  2DEA A;  4M6H A;  1XMB A;  3MRU A;  1CP6 A;  5K8O A;  2XEG A;  5JQ4 A;  1OZP A;  3LD2 A;  1NSA A;  2B5G B;  2Q7S A;  4NF1 A;  2A4N A;  2ABZ A;  4MFP A;  3PGP A;  4FUU A;  3SXO A;  1X10 A;  3G8W A;  5D8N A;  2JEW A;  4R57 A;  3G3S A;  3CZX A;  3IO1 A;  4B10 A;  2ZEE A;  2QML A;  1XOV A;  1Z2L A;  4C2X A;  1ON0 A;  1TKF A;  4X8I A;  5HVG A;  1CG2 A;  4KOY A;  4JXQ A;  4P44 A;  4OIW A;  2OH1 A;  1IIC A;  1VHE A;  4ORF A;  5E96 A;  3TO7 A;  1MK4 A;  1KUY A;  3IWG A;  3DNS A;  1CM0 A;  4R6T A;  3WT4 A;  5HXD A;  3H8F A;  4R76 A;  1S7L A;  3H5Z A;  2ANP A;  3KQX A;  4MI4 A;  5I0C A;  4ONU A;  4P6Y A;  2PQ8 A;  1RO5 A;  1QSR A;  4DJL A;  3PBB A;  3PB9 X;  2K5T A;  2R98 A;  2VQY A;  3PB8 X;  3FYN A;  1ELL P;  2REF A;  5LRJ A;  4F8Z A;  4O23 A;  5DWM A;  4CAF A;  1XMT A;  1Z9U A;  2HQY A;  2PJ1 A;  4YGO A;  4R87 A;  1M4D A;  4MHP A;  4U9Z A;  1HDU A;  2PJ0 A;  3KR5 A;  5F47 A;  4E8O A;  5LYL A;  4FBE A;  2P6E A;  2FL4 A;  3IIB A;  4CGM A;  1FT7 A;  1VIX A;  1YQE A;  2PE3 A;  3IWE A;  3PB7 X;  4M3S A;  3CXQ A;  3GKR A;  2B4D A;  3SJF A;  1F2P A;  3SHP A;  1EE3 P;  1YSJ A;  2PSW A;  3TTH A;  2Z3P A;  4C7H A;  2GIV A;  3PRT A;  4OC5 A;  4EME A;  2GFQ A;  2WSA A;  1S7N A;  4IF5 A;  2Q44 A;  5C82 A;  4CAX A;  2ARH A;  1AUG A;  1Z5R A;  2V77 A;  5HH1 A;  3UY5 A;  2JDD A;  3GIU A;  4PXC A;  2G0B A;  4CAV A;  3B3T A;  4PV6 A;  2PJC A;  1CPX A;  3KHX A;  2AFO A;  5HVH A;  1YME A;  2KCW A;  4F6A A;  1U6M A;  3QAH A;  1Y9W A;  4R8F A;  4XPL A;  4NJR A;  3K2K A;  2OR4 A;  3D2M A;  1IOI A;  1R3N A;  2I3C A;  4P4B A;  1DTD A;  3PP9 A;  2ZEH A;  2ZW5 A;  3ISZ A;  3D7G A;  3KKW A;  1XRY A;  4CAW A;  3NH4 A;  4GXH A;  3WC6 A;  2Q51 A;  1Z8L A;  2Z11 A;  2Q7B A;  3E0K A;  3KR4 A;  2BSW A;  2D4P A;  4OC2 A;  1Y0Y A;  3RBU A;  4A2Z A;  3GLJ A;  1YR0 A;  4R7M A;  2JDC A;  4PK3 A;  5K8N A;  1FY7 A;  5AG4 A;  3FRM A;  5J8C A;  1R57 A;  1TF8 A;  4FD5 A;  3P2F A;  4ZX8 A;  5LYI A;  4CYN A;  2B3U A;  2DXQ A;  1HDQ A;  5KTC A;  4EVY A;  3S9L A;  1AYE A;  3NE7 A;  3S6K A;  1IYK A;  4KOV A;  5D29 A;  4EWT A;  4XPK A;  4KOR A;  3PBE A;  2NMT A;  5F49 A;  2OU2 A;  2C6C A;  1ZLH A;  2OZH A;  1M4I A;  4HNX B;  4MHN A;  4PSX A;  4KLW A;  4BD9 A;  4PXE A;  4R3L A;  1YGH A;  1MJB A;  4KOS A;  4LQ6 A;  3WC7 A;  3LWU A;  3FMC A;  3F0A A;  3T9Y A;  4ZI6 A; 
#chains in the Genus database with same CATH homology
 1S7F A;  4H6Z A;  4XPD B;  5DWN A;  4A95 A;  5G21 A;  3BLN A;  3JUW A;  1NMT A;  2Z3K A;  1GHE A;  1YVO A;  2X7B A;  2AJ6 A;  4MBU A;  2Z3L A;  4B5P B;  1Y7R A;  3BJ8 A;  2PC1 A;  4BBH A;  1I21 A;  2FIA A;  4C68 A;  5A28 A;  4MHD A;  5HMN A;  1QSN A;  4II9 A;  4CS0 B;  4CYP A;  1S60 A;  2EUI A;  2AE6 A;  4CGL A;  3P2H A;  2HV2 A;  4MFL A;  3TE4 A;  4Y49 B;  2CY2 A;  2FXF A;  3BJ7 A;  3W91 A;  4ZBG A;  2J8M A;  4B12 A;  4KOX A;  3B8G A;  1UFH A;  2ATR A;  4FD4 A;  4FD7 A;  1Y9K A;  4E2A A;  4UBR A;  3ZZI A;  3LOD A;  4RS2 A;  4MY0 A;  4H6U A;  4XPD C;  4HNW B;  3F8K A;  1S7K A;  3H4Q A;  4KVX A;  3S6F A;  4CRY B;  5AG7 A;  2VXK A;  2FSR A;  5ISV A;  3I3G A;  5AG6 A;  4F0Y A;  3R96 A;  3V8I A;  5H86 A;  1V0C A;  3TO9 A;  4MJ8 A;  3JVN A;  2B4D B;  4I49 A;  4QC6 A;  4Q38 A;  4K30 A;  4AB7 A;  2JEV A;  2G3A A;  3T90 A;  3FBU A;  4A32 A;  5G22 A;  4Y49 C;  2P6F A;  4PSW A;  4H89 A;  4OAE A;  3DR6 A;  3JTK A;  1B6B A;  4KOW A;  4CYO A;  2WUU A;  3S6H A;  5C88 A;  4KOT A;  1WK4 A;  2YNE A;  4JLY A;  3GYA A;  4DNC A;  2QEC A;  3TCV A;  2WPW A;  4JXR A;  4CGP A;  1TIQ A;  4ZGY B;  1LRZ A;  2DPT A;  3EFA A;  1YX0 A;  4MFZ A;  2I79 A;  4Q36 A;  3CXP A;  5AG5 A;  4B11 A;  5KTD A;  2VZZ A;  4LUA A;  3SXN A;  2FCK A;  1MJA A;  2CNS A;  4UFW A;  4UCP A;  3W6X A;  1N71 A;  3RYO A;  2I00 A;  2B3V A;  5GCN A;  2ZW7 A;  3K9U A;  1CJW A;  3EC4 A;  4CGO A;  4MFK A;  5F46 A;  2VBQ A;  1IB1 E;  4KSA A;  5G20 A;  3FB3 A;  3R9G A;  3EY5 A;  3FIX A;  4YRH A;  1XEB A;  5FVJ A;  4RI1 A;  2R8V A;  4A33 A;  1RXT A;  3I9S A;  2Z3N A;  2Y0M A;  4HNY B;  4HKF A;  3TO6 A;  3QB8 A;  2B58 A;  1KZF A;  3D3S A;  3D2P A;  1J4J A;  1Q2C A;  4OLL A;  2Q4V A;  3MGD A;  3TT2 A;  3FNC A;  2Q4Y A;  2PRB A;  2OB0 A;  4XNH B;  3GY9 A;  4UCM A;  4U5Y A;  5A27 A;  2F5I A;  2J8N A;  5IV0 A;  1Z4E A;  1XE4 A;  4JWP A;  3C26 A;  4NXY A;  1L0C A;  5J8F A;  4LX9 A;  4AVC A;  2H5M A;  4AVB A;  1Q2Y A;  1YVK A;  4A30 A;  4CRZ B;  1B87 A;  3EO4 A;  2YGW A;  4NEX A;  1YLE A;  5EBV A;  3WR7 A;  3TOB A;  2B4B A;  4KSF A;  5H84 A;  5JPH A;  2Z3M A;  3TFY A;  4KVM E;  4JD6 A;  4MFQ A;  2YNC A;  5G1Z A;  2FE7 A;  3EXN A;  4UWJ A;  2R7H A;  2Z10 A;  5BWA B;  5CNP A;  2Z3O A;  1QST A;  2ZXV A;  4R9M A;  2C27 A;  3CXS A;  2Q0Y A;  4R3K A;  3TOA A;  1BOB A;  2P6G A;  3VWE A;  2O28 A;  2REE A;  2YND A;  4XNH C;  2PR1 A;  2CNM A;  3PZJ A;  3IGR A;  2HUZ A;  1PUA A;  5F48 A;  1K4J A;  4U9Y A;  3ZJ0 A;  4B5O A;  1I12 A;  4JJX A;  4QB9 A;  4X5K A;  4AVA A;  1Q2D A;  3R9E A;  4IUS A;  4KVO E;  4UFV A;  2YNC C;  4C2Y A;  1BO4 A;  2GAN A;  2B5G A;  4A31 A;  4B14 A;  2R1I A;  2PR8 A;  1XF8 A;  2QIR A;  1PU9 A;  4J3G A;  3R1K A;  1IID A;  2G3T A;  3R9F A;  1VHS A;  1MJ9 A;  2DPS A;  3IU2 A;  3DSB A;  2RC4 A;  4QUS A;  5AGE A;  1S5K A;  1S3Z A;  4KZT A;  2J8R A;  1P4N A;  4L89 A;  2FT0 A;  2D4O A;  1M4G A;  3S6G A;  4AG7 A;  4KOU A;  4UWI A;  5KTA A;  2EVN A;  3R95 A;  1QSM A;  2VI7 A;  4C2Z A;  1NE9 A;  1ZO0 A;  2ZW4 A;  4C7I A;  2VZY A;  2CXA A;  2JLM A;  2ZPA A;  3A9L A;  2ZW6 A;  1QSO A;  4AG9 A;  2PDO A;  5EC4 A;  2BL1 A;  3F5B A;  1WWZ A;  4QVT A;  2BUE A;  4CAE A;  1M1D A;  1NSL A;  3VWD A;  2VEZ A;  3D8P A;  4E0A A;  4OAD A;  4CGN A;  2GE3 A;  4M85 A;  4KUA A;  2FS5 A;  4UFX A;  4NCZ A;  4GS4 A;  1M44 A;  4UCN A;  3OWC A;  4L8A A;  1P0H A;  5IB0 A;  2FIW A;  2IL4 A;  1IYL A;  1VKC A;  1I1D A;  1YK3 A;  2BEI A;  4F0X A;  2OZU A;  2WPX A;  3DDD A;  1SQH A;  4QBJ A;  4KS9 A;  2Z0Z A;  3W6S A;  4KLV A;  3N7Z A;  1KUV A;  3IU1 A;  3FXT A;  1XIX A;  4PK2 A;  1Z4R A;  4BMH A;  4MY3 A;  2CNT A;  4MFJ A;  4UA3 A;  1KUX A;  2Q04 A;  4YFJ A;  4NSQ A;  5IX3 A;  4CYQ A;  1YRE A;  3DR8 A;  4B5P A;  4B13 A;  4FD6 A;  4KUB A;  2OZG A;  2P0W A;  5JQ4 A;  1OZP A;  3LD2 A;  4NF1 A;  2B5G B;  2A4N A;  4MFP A;  3SXO A;  3PGP A;  3G8W A;  4R57 A;  3G3S A;  4B10 A;  2QML A;  4C2X A;  1ON0 A;  4KOY A;  4JXQ A;  2OH1 A;  1IIC A;  4ORF A;  5E96 A;  3TO7 A;  1MK4 A;  1KUY A;  3IWG A;  3DNS A;  1CM0 A;  1S7L A;  3H5Z A;  4MI4 A;  5I0C A;  4ONU A;  2PQ8 A;  1RO5 A;  1QSR A;  2K5T A;  2R98 A;  2VQY A;  3FYN A;  2REF A;  5DWM A;  4CAF A;  1XMT A;  1Z9U A;  2HQY A;  4YGO A;  4R87 A;  1M4D A;  4U9Z A;  5F47 A;  4E8O A;  2P6E A;  2FL4 A;  4CGM A;  3IWE A;  4M3S A;  3CXQ A;  3GKR A;  2B4D A;  3SHP A;  2PSW A;  3TTH A;  2Z3P A;  4C7H A;  2GIV A;  2WSA A;  1S7N A;  4IF5 A;  2Q44 A;  5C82 A;  4CAX A;  2ARH A;  5HH1 A;  3UY5 A;  2JDD A;  2G0B A;  4CAV A;  4PV6 A;  4F6A A;  2KCW A;  1U6M A;  3QAH A;  1Y9W A;  4XPL A;  3D2M A;  3PP9 A;  2ZW5 A;  3KKW A;  4CAW A;  2Z11 A;  2Q7B A;  3E0K A;  2BSW A;  2D4P A;  4A2Z A;  1YR0 A;  2JDC A;  4PK3 A;  1FY7 A;  5AG4 A;  3FRM A;  5J8C A;  1R57 A;  4FD5 A;  3P2F A;  4CYN A;  5KTC A;  2B3U A;  2DXQ A;  4EVY A;  3NE7 A;  3S6K A;  1IYK A;  4KOV A;  4XPK A;  4KOR A;  2NMT A;  5F49 A;  2OU2 A;  4HNX B;  2OZH A;  1M4I A;  4PSX A;  4KLW A;  4R3L A;  1YGH A;  1MJB A;  4KOS A;  3F0A A;  3T9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...