2BEIA

X-ray structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
156
Chain Sequence
b'SVRIREAKEGDCGDILRLIRELAEFEKLKISEEALRADGFGDNPFYHCLVAEILGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 2
publication title Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 156
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2beiA00
1KUYA 5C82A 2HUZA 2G3AA 2Q0YA 4H6UA 2ZW5A 4J3GA 2P0WA 1Y9KA 3DNSA 3UY5A 1NE9A 2FCKA 5J8CA 2JLMA 3K9UA 3S6KA 3RYOA 4HNWB 2B4DB 2C27A 2PQ8A 5DWNA 2OZUA 4EVYA 5KTCA 4F0YA 2ARHA 4U5YA 4UBRA 3F8KA 4MJ8A 5DWMA 4KOUA 3FNCA 2B3UA 2QMLA 4XPDC 1P0HA 2B3VA 1QSMA 4KOVA 2GE3A 1NSLA 4KOWA 3G8WA 2JEVA 1XEBA 1S60A 4UWJA 4R9MA 1S3ZA 2J8MA 4R57A 1S7FA 2FT0A 3VWEA 3R9EA 2FXFA 2REFA 4FD5A 4F6AA 5EBVA 2OH1A 2PR1A 1WWZA 1FY7A 4HKFA 3R9FA 2R1IA 1MJAA 1B6BA 1CJWA 5IV0A 4LX9A 1XMTA 2B5GA 4BMHA 2G3TA 2A4NA 1RXTA 3MGDA 1M4IA 1OZPA 1YR0A 1I12A 4NF1A 1S5KA 4KVME 1YREA 4RS2A 1ON0A 2GANA 2VZYA 3SXOA 2PSWA 3DR6A 2FIWA 1IIDA 2VBQA 1BO4A 4XPKA 4OADA 1CM0A 5H86A 3GY9A 1Y9WA 2H5MA 2NMTA 2HV2A 4L8AA 3EXNA 4CS0B 2QECA 4JJXA 3E0KA 3TFYA 5CNPA 1Z4EA 5KTDA 3R9GA 4KOTA 3W6SA 4YFJA 4R3LA 3LODA 3D3SA 1Z4RA 2ZW4A 3H4QA 4QBJA 3EC4A 4OLLA 5ISVA 2FSRA 3LD2A 4JWPA 2IL4A 1TIQA 4ZBGA 4MI4A 2I00A 1PU9A 4DNCA 2R8VA 3ZZIA 1S7NA 2BEIA 3NE7A 2D4OA 3FIXA 2CNMA 4NSQA 3S6HA 4U9ZA 4KZTA 4E2AA 2EUIA 2B4DA 2FS5A 4IUSA 4Y49C 3TCVA 2R7HA 1I21A 3P2HA 2Y0MA 4X5KA 1XE4A 1RO5A 2AE6A 2OZHA 1S7LA 2JDCA 4JLYA 1NMTA 1U6MA 4MHDA 2ZW6A 2PRBA 1KUXA 4NEXA 4KUAA 3PZJA 2DXQA 4AVCA 4XPDB 3WR7A 5HMNA 3GKRA 4RI1A 4AVBA 4E8OA 3ZJ0A 4AG7A 4JXQA 2O28A 1QSRA 3TE4A 2REEA 1M1DA 3EO4A 4YGOA 3D2MA 2RC4A 1GHEA 5HH1A 4CAWA 1IYLA 3FB3A 1IICA 3FXTA 2VZZA 1M44A 3S6FA 3IWGA 2VEZA 1UFHA 3N7ZA 1WK4A 2ZPAA 3F5BA 4KUBA 2ZXVA 4HNXB 5H84A 3OWCA 1SQHA 1N71A 1IB1E 2EVNA 3C26A 2Z11A 1MJBA 3JVNA 3TO9A 4II9A 4KOXA 3CXQA 2GIVA 1MK4A 2F5IA 2FE7A 4PK3A 3R95A 5F48A 1VKCA 1Q2DA 4KOSA 5JQ4A 1YVOA 2I79A 3VWDA 3SHPA 5F47A 2ATRA 1M4GA 4KVOE 2PDOA 3TO6A 5E96A 3G3SA 3QAHA 3W91A 2PR8A 1YX0A 4B5PB 3DR8A 2OU2A 2G0BA 5J8FA 3CXSA 4FD7A 4CAXA 4XNHC 1MJ9A 4KOYA 3FYNA 4NCZA 2JDDA 4H6ZA 3TOBA 4PV6A 2Q4VA 4HNYB 3FBUA 2QIRA 4FD4A 1IYKA 1XIXA 4R3KA 3R1KA 1Y7RA 2CY2A 3F0AA 2HQYA 4CAVA 2WPWA 4B5OA 4AB7A 2Q04A 3QB8A 1Q2CA 3EFAA 4I49A 4AVAA 3SXNA 3PGPA 1J4JA 1B87A 2Z10A 1M4DA 4QUSA 2VXKA 3R96A 4KVXA 3TOAA 1YLEA 4U9YA 1Z9UA 4UWIA 5IB0A 2CNSA 2VQYA 4FD6A 4KLWA 4XPLA 3V8IA 2AJ6A 4PSWA 4QC6A 1K4JA 5GCNA 1PUAA 4MY3A 2Z0ZA 4Y49B 4M85A 4GS4A 1YGHA 4M3SA 3I9SA 5C88A 3D8PA 2FIAA 2B4BA 3FRMA 3B8GA 5IX3A 1KZFA 1R57A 3T90A 4KLVA 2FL4A 3BLNA 2Q44A 2KCWA 4LUAA 1I1DA 2B5GB 3T9YA 5EC4A 2BL1A 5F49A 4L89A 4MBUA 2Q7BA 1QSNA 3S6GA 3JUWA 1L0CA 4QVTA 4QB9A 2B58A 2P6FA 4NXYA 1KUVA 3TTHA 1YK3A 2OB0A 3BJ8A 1YVKA 4IF5A 3DDDA 4ORFA 3DSBA 3KKWA 2R98A 1P4NA 3D2PA 3P2FA 1Q2YA 4K30A 1QSTA 2J8NA 4CRZB 4KORA 2OZGA 4UA3A 3TO7A 5I0CA 3I3GA 3TT2A 1S7KA 5JPHA 1LRZA 2PC1A 4E0AA 5F46A 3IGRA 2P6GA 2CNTA 4OAEA 4R87A 2Q4YA 2ZW7A 1BOBA 1VHSA 4CRYB 3CXPA 4AG9A 2BUEA 4MY0A 4PK2A 4PSXA 3BJ7A 1V0CA 2X7BA 4B5PA 1XF8A 4YRHA 2D4PA 3EY5A 2BSWA 2J8RA 2WPXA 4ONUA 2P6EA 4JXRA 2K5TA 3W6XA 2VI7A 4JD6A 1QSOA 4H89A 3GYAA 4XNHB 5KTAA 5FVJA 3PP9A
chains in the Genus database with same CATH superfamily
1KUYA 3GLJA 5C82A 2HUZA 2G3AA 2F7VA 4B10A 2Q0YA 4DUKA 2PJ7A 4H6UA 2ZW5A 4J3GA 3SI2A 1LOKA 2P0WA 1Y9KA 5G1ZA 3DNSA 3UY5A 1NE9A 1IOIA 2FCKA 5J8CA 1TF8A 4KSFA 4ZX8A 2JBKA 1PYTB 1VHOA 2JLMA 3K9UA 3S6KA 1Q7LA 3RYOA 5LYLA 3FX6A 4HNWB 2B4DB 2C27A 2PQ8A 5DWNA 2OZUA 4EVYA 5KTCA 2WSAA 2GLJA 2ZENA 4PXCA 2Q43A 4F0YA 2WUUA 4OIWA 3B3TA 3NA6A 4PPZA 4FAIA 2PJ4A 1XOVA 2ARHA 4U5YA 1IY7A 3H5ZA 3MN8A 2ZEFA 3F8KA 4MJ8A 4UBRA 2DPSA 1H8LA 4X8IA 5DWMA 3FEEA 4KSIA 4MRIA 4KOUA 2C6GA 3FNCA 2B3UA 3TC8A 2QMLA 4P45A 5AG5A 1ZG7A 2ZEGA 3IU2A 1XBUA 4XPDC 1P0HA 4M6GA 4NGTA 2AFXA 2B3VA 1QSMA 1A2ZA 4KOVA 4OC4A 2GE3A 2AFWA 3D7HA 3RBUA 5K8OA 4OC0A 2PJCA 3H8EA 5EMIA 3IIBA 1CP7A 1NSLA 4EFDA 1YMEA 3KR4A 5A28A 1OBRA 2ZOGA 3G8WA 3MRUA 2C6CA 4KOWA 2Z3NA 4GXHA 3B3VA 1AMPA 4TWEA 2JEVA 1XEBA 2PE3A 4FUUA 1S60A 4PXDA 4LQ6A 3LMSA 4UWJA 4R9MA 8CPAA 1S3ZA 2J8MA 4M6IA 4UIAA 4YU9A 4DJLA 2EK8A 2AFMA 4R57A 3FEDA 1S7FA 4A30A 2FT0A 3VWEA 3R9EA 4C2XA 1LAMA 5J1QA 2FXFA 2PJ6A 2REFA 3KL9A 4FD5A 4IK2A 4F6AA 5EBVA 2DPTA 5HXDA 4WJBA 4MFLA 1CX8A 1ZO0A 4NGPA 5LRJA 2Q7SA 2OH1A 4R8FA 1Z8TA 4BINA 4CYQA 2PR1A 4P44A 1IOFA 1WWZA 1FY7A 4MCRA 1Y0RA 3D66A 4HKFA 3R9FA 2R1IA 5CBMA 1AYEA 4C68A 1MJAA 1Z2LA 1B6BA 4MFPA 1CJWA 4CYNA 4LX9A 5IV0A 2G9DA 4CAFA 1XMTA 2B5GA 4BMHA 4LQGA 2ZEHA 2G3TA 2AFUA 2A4NA 2XEGA 1RXTA 3VATA 3K9TA 4Z65A 5JGFA 3MGDA 4P4IA 1M4IA 2DF5A 3WC6A 4BBHA 1OZPA 4NGRA 1YR0A 1I12A 2Z3PA 4NF1A 2PRQA 3SJGA 4HPSA 1S5KA 4KVME 3FF3A 1YREA 4RS2A 2HC9A 2Z3KA 1ON0A 4R76A 2C6PA 4MHZA 4ZY2A 2GANA 2Q51A 4MHYA 3RZAA 2VZYA 3SXOA 2PSWA 2PVWA 3DR6A 2FIWA 4NJQA 1IIDA 5HVFA 3VH9A 4MCPA 1HDUA 2PJ2A 2VBQA 3IFEA 4MFKA 1BO4A 2V77A 2Q4ZA 4G1PA 1CM0A 3D7FA 4OADA 3GY9A 4ONWA 1Y9WA 3CDXA 4PXBA 5H86A 2H5MA 3TX8A 3VARA 3S9NA 5LRKA 2AFOA 2NMTA 3GUXA 2HV2A 4L8AA 3EXNA 3HLPA 4CS0B 3FH4A 2QECA 4JJXA 3E0KA 3JRUA 3KQXA 2XEJA 3TFYA 3IO1A 7CPAA 1TKJA 2PJAA 5AG7A 1Z4EA 5CNPA 5KTDA 3SJFA 3D68A 3R9GA 4M6HA 4MCSA 4KOTA 3GIUA 3IEHA 3W6SA 1XMBA 3H8GA 5HMNA 5JM6A 4YFJA 4R3LA 5LRGA 3IU1A 2ZEPA 2DEAA 2CXAA 3LODA 4MHNA 3D3SA 1Z4RA 2ZW4A 3H4QA 4QBJA 4DYOA 2AFZA 3KR5A 3EC4A 5JH9A 4OLLA 2O4HA 2V8DA 4OC3A 3IWEA 5ISVA 4A32A 2FSRA 3DGVA 4P10A 3LD2A 4JWPA 2IL4A 1TIQA 2EBJA 4JYWA 3RO0A 4ZBGA 2RFHA 4CPAA 5K8MA 4MI4A 1TF9A 2I00A 4ZI6A 3FJUA 4OC5A 4UEFA 1PU9A 3FVLA 4DNCA 2YNCA 1Y0YA 2R8VA 3ZZIA 3BI1A 1F2PA 2V8GA 1S7NA 2BEIA 2ZEMA 2QYVA 3IWWA 3KI9A 3CZXA 1QMUA 3NE7A 2D4OA 4FWUA 3FIXA 4ZGYB 3B7IA 2CNMA 4OC2A 5THWA 2HB6A 4NSQA 3S6HA 4U9ZA 4CGMA 3B35A 3FMCA 4KZTA 4P4BA 1EE3P 4E2AA 3N5FA 2WYRA 4A95A 3PFEA 2EUIA 2B4DA 2FS5A 1ARLA 2EK9A 2PJ8A 4IUSA 2J9AA 3WT4A 4Y49C 4CGLA 2EO8A 4MFQA 2R7HA 1I21A 3TCVA 1TXRA 3P2HA 1Y7EA 2Y0MA 3PFOA 4C7HA 1CPSA 1LANA 4X5KA 1XE4A 1RO5A 4P4DA 1VIXA 2AE6A 2OZHA 3RAMA 1S7LA 2JDCA 1R43A 1ZG8A 1NMTA 1U6MA 2ZOFA 4JLYA 4K3NA 4MHDA 2PJ5A 2ZW6A 4O23A 1PCAA 2PRBA 1KUXA 2IQ6A 1Z5RA 4NEXA 4KUAA 3PZJA 2DXQA 2CF4A 4AVCA 4CGPA 4ZYQA 4XPDB 3WR7A 4MMOA 1R3NA 3GKRA 4P4EA 4RI1A 4KS9A 3ISZA 4AVBA 4MFZA 3SI1A 4UCMA 3ZJ0A 4E8OA 4AG7A 2GREA 3BI0A 3NFZA 4JXQA 4NGNA 4CGOA 2O28A 4ZY1A 4ZY0A 2C1CA 1QSRA 2AFSA 3IJ3A 2IMOA 2NSMA 1CP6A 3K2KA 3TE4A 2REEA 2V8VA 1M1DA 3EO4A 4YGOA 3V38A 3D2MA 2RC4A 4UFVA 1GHEA 5HH1A 1DTDA 4CAWA 1IYLA 3FB3A 3GB0A 1IICA 4B6ZA 1BPMA 4PXEA 4CGNA 4Q36A 1YQEA 3FXTA 4UEEA 1NSAA 2VZZA 1LFWA 1M44A 2I3CA 2ZEOA 3HUVA 3S6FA 3IWGA 5IB9A 4TNUA 2Z3OA 5AG6A 2VEZA 1UFHA 3N7ZA 4UF4A 2OOTA 4RUHA 1X12A 4OMEA 1WK4A 2ZEEA 4OKOA 2ZPAA 3F5BA 4KUBA 2ZXVA 4HNXB 5H84A 2QJ8A 2EWBA 3OWCA 1AUGA 4NJRA 4CYOA 1SQHA 1N71A 1IB1E 2EVNA 3C26A 3CPXA 4H2KA 2Z11A 1MJBA 3JVNA 4UFWA 3TO9A 5LYFA 4II9A 5HVHA 4KOXA 3CXQA 2GIVA 1MK4A 2F5IA 2FE7A 4GM5A 4NGQA 4OC1A 4X2TA 4PK3A 4YWYA 4EMEA 4R7MA 4X3RA 5DS0A 3R95A 5F48A 3SJXA 1VKCA 4F9VA 5F09A 1Q2DA 4KOSA 5JQ4A 1YVOA 2I79A 2NYQA 3VWDA 3A9LA 3SHPA 5F47A 1FT7A 1ZLIA 1ZG9A 2ATRA 1M4GA 4KVOE 2PDOA 3TO6A 4B12A 3SJEA 5E96A 1ARMA 3G3SA 3QAHA 4ZX9A 3W91A 3FECA 2PR8A 1YX0A 4C7IA 2V8HA 3QNVA 4B5PB 3DR8A 3PBEA 3PEIA 2OU2A 1HEEA 2PIYA 2G0BA 4W9YA 4A33A 4OIDA 5J8FA 3CXSA 1RTQA 4UCNA 4FD7A 4CAXA 4NFRA 4XNHC 1MJ9A 4KOYA 1X10A 3JTKA 3FYNA 4NCZA 2YNCC 2JDDA 4JZ0A 3PB9X 4H6ZA 3RNZA 3TOBA 4B11A 4PV6A 2Q4VA 4HNYB 3FBUA 3KHZA 3QAYA 5LYIA 2QIRA 4FD4A 3S9MA 1IYKA 1XIXA 2OR4A 3NH8A 4R3KA 1BPNA 3R1KA 1YW6A 1Y7RA 2CY2A 3F0AA 2HQYA 3CPAA 1IU8A 4CAVA 1JWQA 2WPWA 4B5OA 2BO9A 4C2YA 4AB7A 3WC5A 1ZLHA 2Q04A 3QB8A 1Q2CA 2YNEA 5AG4A 3EFAA 4I49A 2CTCA 4Q38A 5CPAA 2YGWA 4A39A 4P4FA 1F57A 4AVAA 3PBBA 3SXNA 2ABZA 3PGPA 3B2YA 1J4JA 1B87A 2XEFA 2Z10A 2RB7A 2YNDA 2PCUA 4AXVA 4UIBA 1M4DA 3BXMA 4QUSA 2VXKA 2FVGA 1LCPA 3LACA 4KVXA 3R96A 3TOAA 1YLEA 4MHPA 4U9YA 4UFXA 4WWVA 2XEIA 3NE8A 4MCQA 2BCOA 1Z9UA 1LAPA 2PJBA 4UWIA 5IB0A 2CNSA 2Z3MA 4A31A 2VQYA 2JBJA 4FD6A 2PJ1A 4KLWA 4XPLA 3SI0A 5A27A 3V8IA 1YSJA 2AJ6A 3PB6X 4PSWA 4QC6A 6CPAA 3PRTA 1K4JA 3L2NA 5GCNA 1PUAA 3B3WA 4MY3A 5AGEA 2Z0ZA 1XJOA 1YLOA 4Y49B 1CBXA 2ZEDA 4M85A 4GS4A 1DE4C 4A38A 1YGHA 4EWTA 4M3SA 1GYTA 3I9SA 4KSAA 4Q7AA 4BD9A 3D8PA 2FIAA 5C88A 2B4BA 3FRMA 5I4MA 3B8GA 2POKA 5IX3A 2Z3LA 2F8HA 1KZFA 1R57A 4MFJA 3T90A 2PJ3A 3LWUA 4KLVA 5D8NA 2FL4A 3T8WA 3WABA 1XFOA 2ZELA 3BLNA 2Q44A 4B13A 3CT9A 3S9LA 3H8FA 2KCWA 3PB7X 1TKFA 1CG2A 1I1DA 4LUAA 3B3SA 2B5GB 2GU2A 3T9YA 5G20A 2ANPA 5EC4A 4CAEA 2BL1A 5F49A 4L89A 4MBUA 2Q7BA 4MXUA 4FBEA 1QSNA 3S6GA 3JUWA 1L0CA 4QVTA 4QB9A 1XRYA 2B58A 5K8PA 1HDQA 4NGMA 4IHMA 2ODFA 5HVGA 2P6FA 4NXYA 4XPKA 2CTBA 1KUVA 1TKHA 1BAVA 2BOAA 1FNOA 3TTHA 1YK3A 2OB0A 2QVPA 3BJ8A 3D7GA 1Z8XA 4IAVA 5D29A 4C2ZA 1YVKA 4IF5A 5G22A 1VGYA 4CYPA 3DDDA 4ORFA 2IJZA 5BWAB 4P6YA 2GFQA 3DSBA 2R98A 3KASA 1CPXA 3KKWA 3NH4A 1P4NA 3D2PA 1IGBA 3P2FA 3DLJA 1UWYA 1Q2YA 4K30A 1Z8LA 3I1UA 1QSTA 2J8NA 2WZNA 3KQZA 4CRZB 1JQGA 5ELYA 4KORA 4A37A 2OZGA 4UA3A 3TO7A 1VHEA 5G21A 4B14A 5I0CA 3I3GA 3BHXA 1S7KA 3TT2A 1YW4A 3D4UA 3V7ZA 4UEZA 4F8ZA 2PVVA 4R6TA 4F0XA 3KGQA 5JPHA 1LRZA 2PC1A 2GLFA 3NH5A 4E0AA 5F46A 1QQ9A 2P6GA 3IGRA 2CNTA 4OAEA 4R87A 2Q4YA 2ZW7A 1BOBA 1VHSA 3KHXA 4UCPA 4CRYB 3CXPA 4AG9A 5LYDA 2BUEA 1KWMA 4MY0A 4PK2A 4PSXA 3BJ7A 1V0CA 1M4LA 2PJ9A 2PJ0A 3WC7A 2X7BA 4OP4A 4RN7A 3D7DA 3PB8X 3D67A 4P4JA 4B5PA 1Z8WA 1XF8A 4YRHA 2D4PA 4PQAA 3EY5A 2BSWA 2J8RA 2WPXA 4ONUA 1F2OA 2P6EA 4A2ZA 4JXRA 2K5TA 3W6XA 2VI7A 2JEWA 2O53A 2VL1A 4JD6A 1QSOA 4H89A 3GYAA 3KZWA 4NGSA 4A94A 5K8NA 3IC1A 1ELMP 3PB4X 4F9UA 3ISXA 4XNHB 5KTAA 5FVJA 1ELLP 1BLLE 3PP9A 2PIZA 3B3CA 2CIJA
chains in the Genus database with same CATH topology
1KUYA 5C82A 2HUZA 2G3AA 4B10A 2Q0YA 4H6UA 2ZW5A 4J3GA 2P0WA 1Y9KA 5G1ZA 3DNSA 3UY5A 1NE9A 2FCKA 5J8CA 4KSFA 2JLMA 3K9UA 3S6KA 3RYOA 4HNWB 2B4DB 2C27A 2PQ8A 5DWNA 2OZUA 4EVYA 5KTCA 2WSAA 4F0YA 2WUUA 2ARHA 4U5YA 3H5ZA 4UBRA 3F8KA 4MJ8A 2DPSA 5DWMA 4KOUA 3FNCA 2B3UA 2QMLA 5AG5A 3IU2A 4XPDC 1P0HA 2B3VA 1QSMA 4KOVA 2GE3A 1NSLA 5A28A 4KOWA 3G8WA 2Z3NA 2JEVA 1XEBA 1S60A 4UWJA 4R9MA 1S3ZA 2J8MA 4R57A 1S7FA 4A30A 2FT0A 3VWEA 3R9EA 4C2XA 2FXFA 2REFA 4FD5A 4F6AA 5EBVA 2DPTA 4MFLA 1ZO0A 2OH1A 4CYQA 2PR1A 1WWZA 1FY7A 4HKFA 3R9FA 2R1IA 4C68A 1MJAA 1B6BA 4MFPA 1CJWA 4CYNA 4LX9A 5IV0A 4CAFA 1XMTA 2B5GA 4BMHA 2G3TA 2A4NA 1RXTA 3MGDA 1M4IA 4BBHA 1OZPA 1YR0A 1I12A 2Z3PA 4NF1A 1S5KA 4KVME 1YREA 4RS2A 2Z3KA 1ON0A 2GANA 2VZYA 3SXOA 2PSWA 3DR6A 2FIWA 1IIDA 2VBQA 4MFKA 1BO4A 4XPKA 4OADA 1CM0A 5H86A 3GY9A 1Y9WA 2H5MA 2NMTA 2HV2A 4L8AA 3EXNA 4CS0B 2QECA 4JJXA 3E0KA 3TFYA 5AG7A 5CNPA 1Z4EA 5KTDA 3R9GA 4KOTA 3W6SA 4YFJA 4R3LA 3IU1A 3LODA 2CXAA 3D3SA 1Z4RA 2ZW4A 3H4QA 4QBJA 3EC4A 4OLLA 3IWEA 5ISVA 4A32A 2FSRA 3LD2A 4JWPA 2IL4A 1TIQA 4ZBGA 4MI4A 2I00A 1PU9A 4DNCA 2YNCA 2R8VA 3ZZIA 1S7NA 2BEIA 3NE7A 2D4OA 4ZGYB 3FIXA 2CNMA 4NSQA 3S6HA 4CGMA 4U9ZA 4KZTA 4E2AA 4A95A 2EUIA 2B4DA 2FS5A 4IUSA 4CGLA 4Y49C 4MFQA 3TCVA 2R7HA 1I21A 3P2HA 2Y0MA 4C7HA 4X5KA 1XE4A 1RO5A 2AE6A 2OZHA 1S7LA 2JDCA 4JLYA 1NMTA 1U6MA 4MHDA 2ZW6A 2PRBA 1KUXA 4NEXA 4KUAA 3PZJA 2DXQA 4AVCA 4CGPA 4XPDB 3WR7A 5HMNA 3GKRA 4RI1A 4KS9A 4AVBA 4MFZA 4UCMA 3ZJ0A 4E8OA 4AG7A 4JXQA 4CGOA 2O28A 1QSRA 3TE4A 2REEA 1M1DA 3EO4A 4YGOA 3D2MA 2RC4A 4UFVA 1GHEA 5HH1A 4CAWA 1IYLA 3FB3A 1IICA 4CGNA 4Q36A 3FXTA 2VZZA 1M44A 3S6FA 3IWGA 2Z3OA 5AG6A 2VEZA 1UFHA 3N7ZA 1WK4A 2ZPAA 3F5BA 4KUBA 2ZXVA 4HNXB 5H84A 3OWCA 4CYOA 1SQHA 1N71A 1IB1E 2EVNA 3C26A 2Z11A 1MJBA 3JVNA 4UFWA 3TO9A 4II9A 4KOXA 3CXQA 2GIVA 1MK4A 2F5IA 2FE7A 4PK3A 3R95A 5F48A 1VKCA 1Q2DA 4KOSA 5JQ4A 1YVOA 2I79A 3VWDA 3A9LA 3SHPA 5F47A 2ATRA 1M4GA 4KVOE 2PDOA 3TO6A 4B12A 5E96A 3G3SA 3QAHA 3W91A 2PR8A 1YX0A 4C7IA 4B5PB 3DR8A 2OU2A 2G0BA 4A33A 5J8FA 3CXSA 4UCNA 4FD7A 4CAXA 4XNHC 1MJ9A 4KOYA 3JTKA 3FYNA 4NCZA 2YNCC 2JDDA 4H6ZA 3TOBA 4B11A 4PV6A 2Q4VA 4HNYB 3FBUA 2QIRA 4FD4A 1IYKA 1XIXA 4R3KA 3R1KA 1Y7RA 2CY2A 3F0AA 2HQYA 4CAVA 2WPWA 4B5OA 4C2YA 4AB7A 2Q04A 3QB8A 1Q2CA 2YNEA 5AG4A 3EFAA 4I49A 4Q38A 2YGWA 4AVAA 3SXNA 3PGPA 1J4JA 1B87A 2Z10A 2YNDA 1M4DA 4QUSA 2VXKA 3R96A 4KVXA 3TOAA 1YLEA 4U9YA 4UFXA 1Z9UA 4UWIA 5IB0A 2CNSA 2Z3MA 4A31A 2VQYA 4FD6A 4KLWA 4XPLA 5A27A 3V8IA 2AJ6A 4PSWA 4QC6A 1K4JA 5GCNA 1PUAA 4MY3A 5AGEA 2Z0ZA 4Y49B 4M85A 4GS4A 1YGHA 4M3SA 3I9SA 4KSAA 5C88A 3D8PA 2FIAA 2B4BA 3FRMA 3B8GA 5IX3A 2Z3LA 1KZFA 1R57A 4MFJA 3T90A 4KLVA 2FL4A 3BLNA 2Q44A 4B13A 2KCWA 4LUAA 1I1DA 2B5GB 3T9YA 5G20A 5EC4A 4CAEA 2BL1A 5F49A 4L89A 4MBUA 2Q7BA 1QSNA 3S6GA 3JUWA 1L0CA 4QVTA 4QB9A 2B58A 2P6FA 4NXYA 1KUVA 3TTHA 1YK3A 2OB0A 3BJ8A 4C2ZA 1YVKA 4IF5A 5G22A 4CYPA 3DDDA 4ORFA 5BWAB 3DSBA 3KKWA 2R98A 1P4NA 3D2PA 3P2FA 1Q2YA 4K30A 1QSTA 2J8NA 4CRZB 4KORA 2OZGA 4UA3A 3TO7A 5G21A 4B14A 5I0CA 3I3GA 3TT2A 1S7KA 4F0XA 5JPHA 1LRZA 2PC1A 4E0AA 5F46A 3IGRA 2P6GA 2CNTA 4OAEA 4R87A 2Q4YA 2ZW7A 1BOBA 1VHSA 4UCPA 4CRYB 3CXPA 4AG9A 2BUEA 4MY0A 4PK2A 4PSXA 3BJ7A 1V0CA 2X7BA 4B5PA 1XF8A 4YRHA 2D4PA 3EY5A 2BSWA 2J8RA 2WPXA 4ONUA 2P6EA 4A2ZA 4JXRA 2K5TA 3W6XA 2VI7A 4JD6A 1QSOA 4H89A 3GYAA 4XNHB 5KTAA 5FVJA 3PP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUY A;  5C82 A;  2HUZ A;  2G3A A;  2Q0Y A;  4H6U A;  2ZW5 A;  4J3G A;  2P0W A;  1Y9K A;  3DNS A;  3UY5 A;  1NE9 A;  2FCK A;  5J8C A;  2JLM A;  3K9U A;  3S6K A;  3RYO A;  4HNW B;  2B4D B;  2C27 A;  2PQ8 A;  5DWN A;  2OZU A;  4EVY A;  5KTC A;  4F0Y A;  2ARH A;  4U5Y A;  4UBR A;  3F8K A;  4MJ8 A;  5DWM A;  4KOU A;  3FNC A;  2B3U A;  2QML A;  4XPD C;  1P0H A;  2B3V A;  1QSM A;  4KOV A;  2GE3 A;  1NSL A;  4KOW A;  3G8W A;  2JEV A;  1XEB A;  1S60 A;  4UWJ A;  4R9M A;  1S3Z A;  2J8M A;  4R57 A;  1S7F A;  2FT0 A;  3VWE A;  3R9E A;  2FXF A;  2REF A;  4FD5 A;  4F6A A;  5EBV A;  2OH1 A;  2PR1 A;  1WWZ A;  1FY7 A;  4HKF A;  3R9F A;  2R1I A;  1MJA A;  1B6B A;  1CJW A;  5IV0 A;  4LX9 A;  1XMT A;  2B5G A;  4BMH A;  2G3T A;  2A4N A;  1RXT A;  3MGD A;  1M4I A;  1OZP A;  1YR0 A;  1I12 A;  4NF1 A;  1S5K A;  4KVM E;  1YRE A;  4RS2 A;  1ON0 A;  2GAN A;  2VZY A;  3SXO A;  2PSW A;  3DR6 A;  2FIW A;  1IID A;  2VBQ A;  1BO4 A;  4XPK A;  4OAD A;  1CM0 A;  5H86 A;  3GY9 A;  1Y9W A;  2H5M A;  2NMT A;  2HV2 A;  4L8A A;  3EXN A;  4CS0 B;  2QEC A;  4JJX A;  3E0K A;  3TFY A;  5CNP A;  1Z4E A;  5KTD A;  3R9G A;  4KOT A;  3W6S A;  4YFJ A;  4R3L A;  3LOD A;  3D3S A;  1Z4R A;  2ZW4 A;  3H4Q A;  4QBJ A;  3EC4 A;  4OLL A;  5ISV A;  2FSR A;  3LD2 A;  4JWP A;  2IL4 A;  1TIQ A;  4ZBG A;  4MI4 A;  2I00 A;  1PU9 A;  4DNC A;  2R8V A;  3ZZI A;  1S7N A;  2BEI A;  3NE7 A;  2D4O A;  3FIX A;  2CNM A;  4NSQ A;  3S6H A;  4U9Z A;  4KZT A;  4E2A A;  2EUI A;  2B4D A;  2FS5 A;  4IUS A;  4Y49 C;  3TCV A;  2R7H A;  1I21 A;  3P2H A;  2Y0M A;  4X5K A;  1XE4 A;  1RO5 A;  2AE6 A;  2OZH A;  1S7L A;  2JDC A;  4JLY A;  1NMT A;  1U6M A;  4MHD A;  2ZW6 A;  2PRB A;  1KUX A;  4NEX A;  4KUA A;  3PZJ A;  2DXQ A;  4AVC A;  4XPD B;  3WR7 A;  5HMN A;  3GKR A;  4RI1 A;  4AVB A;  4E8O A;  3ZJ0 A;  4AG7 A;  4JXQ A;  2O28 A;  1QSR A;  3TE4 A;  2REE A;  1M1D A;  3EO4 A;  4YGO A;  3D2M A;  2RC4 A;  1GHE A;  5HH1 A;  4CAW A;  1IYL A;  3FB3 A;  1IIC A;  3FXT A;  2VZZ A;  1M44 A;  3S6F A;  3IWG A;  2VEZ A;  1UFH A;  3N7Z A;  1WK4 A;  2ZPA A;  3F5B A;  4KUB A;  2ZXV A;  4HNX B;  5H84 A;  3OWC A;  1SQH A;  1N71 A;  1IB1 E;  2EVN A;  3C26 A;  2Z11 A;  1MJB A;  3JVN A;  3TO9 A;  4II9 A;  4KOX A;  3CXQ A;  2GIV A;  1MK4 A;  2F5I A;  2FE7 A;  4PK3 A;  3R95 A;  5F48 A;  1VKC A;  1Q2D A;  4KOS A;  5JQ4 A;  1YVO A;  2I79 A;  3VWD A;  3SHP A;  5F47 A;  2ATR A;  1M4G A;  4KVO E;  2PDO A;  3TO6 A;  5E96 A;  3G3S A;  3QAH A;  3W91 A;  2PR8 A;  1YX0 A;  4B5P B;  3DR8 A;  2OU2 A;  2G0B A;  5J8F A;  3CXS A;  4FD7 A;  4CAX A;  4XNH C;  1MJ9 A;  4KOY A;  3FYN A;  4NCZ A;  2JDD A;  4H6Z A;  3TOB A;  4PV6 A;  2Q4V A;  4HNY B;  3FBU A;  2QIR A;  4FD4 A;  1IYK A;  1XIX A;  4R3K A;  3R1K A;  1Y7R A;  2CY2 A;  3F0A A;  2HQY A;  4CAV A;  2WPW A;  4B5O A;  4AB7 A;  2Q04 A;  3QB8 A;  1Q2C A;  3EFA A;  4I49 A;  4AVA A;  3SXN A;  3PGP A;  1J4J A;  1B87 A;  2Z10 A;  1M4D A;  4QUS A;  2VXK A;  3R96 A;  4KVX A;  3TOA A;  1YLE A;  4U9Y A;  1Z9U A;  4UWI A;  5IB0 A;  2CNS A;  2VQY A;  4FD6 A;  4KLW A;  4XPL A;  3V8I A;  2AJ6 A;  4PSW A;  4QC6 A;  1K4J A;  5GCN A;  1PUA A;  4MY3 A;  2Z0Z A;  4Y49 B;  4M85 A;  4GS4 A;  1YGH A;  4M3S A;  3I9S A;  5C88 A;  3D8P A;  2FIA A;  2B4B A;  3FRM A;  3B8G A;  5IX3 A;  1KZF A;  1R57 A;  3T90 A;  4KLV A;  2FL4 A;  3BLN A;  2Q44 A;  2KCW A;  4LUA A;  1I1D A;  2B5G B;  3T9Y A;  5EC4 A;  2BL1 A;  5F49 A;  4L89 A;  4MBU A;  2Q7B A;  1QSN A;  3S6G A;  3JUW A;  1L0C A;  4QVT A;  4QB9 A;  2B58 A;  2P6F A;  4NXY A;  1KUV A;  3TTH A;  1YK3 A;  2OB0 A;  3BJ8 A;  1YVK A;  4IF5 A;  3DDD A;  4ORF A;  3DSB A;  3KKW A;  2R98 A;  1P4N A;  3D2P A;  3P2F A;  1Q2Y A;  4K30 A;  1QST A;  2J8N A;  4CRZ B;  4KOR A;  2OZG A;  4UA3 A;  3TO7 A;  5I0C A;  3I3G A;  3TT2 A;  1S7K A;  5JPH A;  1LRZ A;  2PC1 A;  4E0A A;  5F46 A;  3IGR A;  2P6G A;  2CNT A;  4OAE A;  4R87 A;  2Q4Y A;  2ZW7 A;  1BOB A;  1VHS A;  4CRY B;  3CXP A;  4AG9 A;  2BUE A;  4MY0 A;  4PK2 A;  4PSX A;  3BJ7 A;  1V0C A;  2X7B A;  4B5P A;  1XF8 A;  4YRH A;  2D4P A;  3EY5 A;  2BSW A;  2J8R A;  2WPX A;  4ONU A;  2P6E A;  4JXR A;  2K5T A;  3W6X A;  2VI7 A;  4JD6 A;  1QSO A;  4H89 A;  3GYA A;  4XNH B;  5KTA A;  5FVJ A;  3PP9 A; 
#chains in the Genus database with same CATH topology
 1KUY A;  3GLJ A;  5C82 A;  2HUZ A;  2G3A A;  2F7V A;  4B10 A;  2Q0Y A;  4DUK A;  2PJ7 A;  4H6U A;  2ZW5 A;  4J3G A;  3SI2 A;  1LOK A;  2P0W A;  1Y9K A;  5G1Z A;  3DNS A;  3UY5 A;  1NE9 A;  1IOI A;  2FCK A;  5J8C A;  1TF8 A;  4KSF A;  4ZX8 A;  2JBK A;  1PYT B;  1VHO A;  2JLM A;  3K9U A;  3S6K A;  1Q7L A;  3RYO A;  5LYL A;  3FX6 A;  4HNW B;  2B4D B;  2C27 A;  2PQ8 A;  5DWN A;  2OZU A;  4EVY A;  5KTC A;  2WSA A;  2GLJ A;  2ZEN A;  4PXC A;  2Q43 A;  4F0Y A;  2WUU A;  4OIW A;  3B3T A;  3NA6 A;  4PPZ A;  4FAI A;  2PJ4 A;  1XOV A;  2ARH A;  4U5Y A;  1IY7 A;  3H5Z A;  3MN8 A;  2ZEF A;  3F8K A;  4MJ8 A;  4UBR A;  2DPS A;  1H8L A;  4X8I A;  5DWM A;  3FEE A;  4KSI A;  4MRI A;  4KOU A;  2C6G A;  3FNC A;  2B3U A;  3TC8 A;  2QML A;  4P45 A;  5AG5 A;  1ZG7 A;  2ZEG A;  3IU2 A;  1XBU A;  4XPD C;  1P0H A;  4M6G A;  4NGT A;  2AFX A;  2B3V A;  1QSM A;  1A2Z A;  4KOV A;  4OC4 A;  2GE3 A;  2AFW A;  3D7H A;  3RBU A;  5K8O A;  4OC0 A;  2PJC A;  3H8E A;  5EMI A;  3IIB A;  1CP7 A;  1NSL A;  4EFD A;  1YME A;  3KR4 A;  5A28 A;  1OBR A;  2ZOG A;  3G8W A;  3MRU A;  2C6C A;  4KOW A;  2Z3N A;  4GXH A;  3B3V A;  1AMP A;  4TWE A;  2JEV A;  1XEB A;  2PE3 A;  4FUU A;  1S60 A;  4PXD A;  4LQ6 A;  3LMS A;  4UWJ A;  4R9M A;  8CPA A;  1S3Z A;  2J8M A;  4M6I A;  4UIA A;  4YU9 A;  4DJL A;  2EK8 A;  2AFM A;  4R57 A;  3FED A;  1S7F A;  4A30 A;  2FT0 A;  3VWE A;  3R9E A;  4C2X A;  1LAM A;  5J1Q A;  2FXF A;  2PJ6 A;  2REF A;  3KL9 A;  4FD5 A;  4IK2 A;  4F6A A;  5EBV A;  2DPT A;  5HXD A;  4WJB A;  4MFL A;  1CX8 A;  1ZO0 A;  4NGP A;  5LRJ A;  2Q7S A;  2OH1 A;  4R8F A;  1Z8T A;  4BIN A;  4CYQ A;  2PR1 A;  4P44 A;  1IOF A;  1WWZ A;  1FY7 A;  4MCR A;  1Y0R A;  3D66 A;  4HKF A;  3R9F A;  2R1I A;  5CBM A;  1AYE A;  4C68 A;  1MJA A;  1Z2L A;  1B6B A;  4MFP A;  1CJW A;  4CYN A;  4LX9 A;  5IV0 A;  2G9D A;  4CAF A;  1XMT A;  2B5G A;  4BMH A;  4LQG A;  2ZEH A;  2G3T A;  2AFU A;  2A4N A;  2XEG A;  1RXT A;  3VAT A;  3K9T A;  4Z65 A;  5JGF A;  3MGD A;  4P4I A;  1M4I A;  2DF5 A;  3WC6 A;  4BBH A;  1OZP A;  4NGR A;  1YR0 A;  1I12 A;  2Z3P A;  4NF1 A;  2PRQ A;  3SJG A;  4HPS A;  1S5K A;  4KVM E;  3FF3 A;  1YRE A;  4RS2 A;  2HC9 A;  2Z3K A;  1ON0 A;  4R76 A;  2C6P A;  4MHZ A;  4ZY2 A;  2GAN A;  2Q51 A;  4MHY A;  3RZA A;  2VZY A;  3SXO A;  2PSW A;  2PVW A;  3DR6 A;  2FIW A;  4NJQ A;  1IID A;  5HVF A;  3VH9 A;  4MCP A;  1HDU A;  2PJ2 A;  2VBQ A;  3IFE A;  4MFK A;  1BO4 A;  2V77 A;  2Q4Z A;  4G1P A;  1CM0 A;  3D7F A;  4OAD A;  3GY9 A;  4ONW A;  1Y9W A;  3CDX A;  4PXB A;  5H86 A;  2H5M A;  3TX8 A;  3VAR A;  3S9N A;  5LRK A;  2AFO A;  2NMT A;  3GUX A;  2HV2 A;  4L8A A;  3EXN A;  3HLP A;  4CS0 B;  3FH4 A;  2QEC A;  4JJX A;  3E0K A;  3JRU A;  3KQX A;  2XEJ A;  3TFY A;  3IO1 A;  7CPA A;  1TKJ A;  2PJA A;  5AG7 A;  1Z4E A;  5CNP A;  5KTD A;  3SJF A;  3D68 A;  3R9G A;  4M6H A;  4MCS A;  4KOT A;  3GIU A;  3IEH A;  3W6S A;  1XMB A;  3H8G A;  5HMN A;  5JM6 A;  4YFJ A;  4R3L A;  5LRG A;  3IU1 A;  2ZEP A;  2DEA A;  2CXA A;  3LOD A;  4MHN A;  3D3S A;  1Z4R A;  2ZW4 A;  3H4Q A;  4QBJ A;  4DYO A;  2AFZ A;  3KR5 A;  3EC4 A;  5JH9 A;  4OLL A;  2O4H A;  2V8D A;  4OC3 A;  3IWE A;  5ISV A;  4A32 A;  2FSR A;  3DGV A;  4P10 A;  3LD2 A;  4JWP A;  2IL4 A;  1TIQ A;  2EBJ A;  4JYW A;  3RO0 A;  4ZBG A;  2RFH A;  4CPA A;  5K8M A;  4MI4 A;  1TF9 A;  2I00 A;  4ZI6 A;  3FJU A;  4OC5 A;  4UEF A;  1PU9 A;  3FVL A;  4DNC A;  2YNC A;  1Y0Y A;  2R8V A;  3ZZI A;  3BI1 A;  1F2P A;  2V8G A;  1S7N A;  2BEI A;  2ZEM A;  2QYV A;  3IWW A;  3KI9 A;  3CZX A;  1QMU A;  3NE7 A;  2D4O A;  4FWU A;  3FIX A;  4ZGY B;  3B7I A;  2CNM A;  4OC2 A;  5THW A;  2HB6 A;  4NSQ A;  3S6H A;  4U9Z A;  4CGM A;  3B35 A;  3FMC A;  4KZT A;  4P4B A;  1EE3 P;  4E2A A;  3N5F A;  2WYR A;  4A95 A;  3PFE A;  2EUI A;  2B4D A;  2FS5 A;  1ARL A;  2EK9 A;  2PJ8 A;  4IUS A;  2J9A A;  3WT4 A;  4Y49 C;  4CGL A;  2EO8 A;  4MFQ A;  2R7H A;  1I21 A;  3TCV A;  1TXR A;  3P2H A;  1Y7E A;  2Y0M A;  3PFO A;  4C7H A;  1CPS A;  1LAN A;  4X5K A;  1XE4 A;  1RO5 A;  4P4D A;  1VIX A;  2AE6 A;  2OZH A;  3RAM A;  1S7L A;  2JDC A;  1R43 A;  1ZG8 A;  1NMT A;  1U6M A;  2ZOF A;  4JLY A;  4K3N A;  4MHD A;  2PJ5 A;  2ZW6 A;  4O23 A;  1PCA A;  2PRB A;  1KUX A;  2IQ6 A;  1Z5R A;  4NEX A;  4KUA A;  3PZJ A;  2DXQ A;  2CF4 A;  4AVC A;  4CGP A;  4ZYQ A;  4XPD B;  3WR7 A;  4MMO A;  1R3N A;  3GKR A;  4P4E A;  4RI1 A;  4KS9 A;  3ISZ A;  4AVB A;  4MFZ A;  3SI1 A;  4UCM A;  3ZJ0 A;  4E8O A;  4AG7 A;  2GRE A;  3BI0 A;  3NFZ A;  4JXQ A;  4NGN A;  4CGO A;  2O28 A;  4ZY1 A;  4ZY0 A;  2C1C A;  1QSR A;  2AFS A;  3IJ3 A;  2IMO A;  2NSM A;  1CP6 A;  3K2K A;  3TE4 A;  2REE A;  2V8V A;  1M1D A;  3EO4 A;  4YGO A;  3V38 A;  3D2M A;  2RC4 A;  4UFV A;  1GHE A;  5HH1 A;  1DTD A;  4CAW A;  1IYL A;  3FB3 A;  3GB0 A;  1IIC A;  4B6Z A;  1BPM A;  4PXE A;  4CGN A;  4Q36 A;  1YQE A;  3FXT A;  4UEE A;  1NSA A;  2VZZ A;  1LFW A;  1M44 A;  2I3C A;  2ZEO A;  3HUV A;  3S6F A;  3IWG A;  5IB9 A;  4TNU A;  2Z3O A;  5AG6 A;  2VEZ A;  1UFH A;  3N7Z A;  4UF4 A;  2OOT A;  4RUH A;  1X12 A;  4OME A;  1WK4 A;  2ZEE A;  4OKO A;  2ZPA A;  3F5B A;  4KUB A;  2ZXV A;  4HNX B;  5H84 A;  2QJ8 A;  2EWB A;  3OWC A;  1AUG A;  4NJR A;  4CYO A;  1SQH A;  1N71 A;  1IB1 E;  2EVN A;  3C26 A;  3CPX A;  4H2K A;  2Z11 A;  1MJB A;  3JVN A;  4UFW A;  3TO9 A;  5LYF A;  4II9 A;  5HVH A;  4KOX A;  3CXQ A;  2GIV A;  1MK4 A;  2F5I A;  2FE7 A;  4GM5 A;  4NGQ A;  4OC1 A;  4X2T A;  4PK3 A;  4YWY A;  4EME A;  4R7M A;  4X3R A;  5DS0 A;  3R95 A;  5F48 A;  3SJX A;  1VKC A;  4F9V A;  5F09 A;  1Q2D A;  4KOS A;  5JQ4 A;  1YVO A;  2I79 A;  2NYQ A;  3VWD A;  3A9L A;  3SHP A;  5F47 A;  1FT7 A;  1ZLI A;  1ZG9 A;  2ATR A;  1M4G A;  4KVO E;  2PDO A;  3TO6 A;  4B12 A;  3SJE A;  5E96 A;  1ARM A;  3G3S A;  3QAH A;  4ZX9 A;  3W91 A;  3FEC A;  2PR8 A;  1YX0 A;  4C7I A;  2V8H A;  3QNV A;  4B5P B;  3DR8 A;  3PBE A;  3PEI A;  2OU2 A;  1HEE A;  2PIY A;  2G0B A;  4W9Y A;  4A33 A;  4OID A;  5J8F A;  3CXS A;  1RTQ A;  4UCN A;  4FD7 A;  4CAX A;  4NFR A;  4XNH C;  1MJ9 A;  4KOY A;  1X10 A;  3JTK A;  3FYN A;  4NCZ A;  2YNC C;  2JDD A;  4JZ0 A;  3PB9 X;  4H6Z A;  3RNZ A;  3TOB A;  4B11 A;  4PV6 A;  2Q4V A;  4HNY B;  3FBU A;  3KHZ A;  3QAY A;  5LYI A;  2QIR A;  4FD4 A;  3S9M A;  1IYK A;  1XIX A;  2OR4 A;  3NH8 A;  4R3K A;  1BPN A;  3R1K A;  1YW6 A;  1Y7R A;  2CY2 A;  3F0A A;  2HQY A;  3CPA A;  1IU8 A;  4CAV A;  1JWQ A;  2WPW A;  4B5O A;  2BO9 A;  4C2Y A;  4AB7 A;  3WC5 A;  1ZLH A;  2Q04 A;  3QB8 A;  1Q2C A;  2YNE A;  5AG4 A;  3EFA A;  4I49 A;  2CTC A;  4Q38 A;  5CPA A;  2YGW A;  4A39 A;  4P4F A;  1F57 A;  4AVA A;  3PBB A;  3SXN A;  2ABZ A;  3PGP A;  3B2Y A;  1J4J A;  1B87 A;  2XEF A;  2Z10 A;  2RB7 A;  2YND A;  2PCU A;  4AXV A;  4UIB A;  1M4D A;  3BXM A;  4QUS A;  2VXK A;  2FVG A;  1LCP A;  3LAC A;  4KVX A;  3R96 A;  3TOA A;  1YLE A;  4MHP A;  4U9Y A;  4UFX A;  4WWV A;  2XEI A;  3NE8 A;  4MCQ A;  2BCO A;  1Z9U A;  1LAP A;  2PJB A;  4UWI A;  5IB0 A;  2CNS A;  2Z3M A;  4A31 A;  2VQY A;  2JBJ A;  4FD6 A;  2PJ1 A;  4KLW A;  4XPL A;  3SI0 A;  5A27 A;  3V8I A;  1YSJ A;  2AJ6 A;  3PB6 X;  4PSW A;  4QC6 A;  6CPA A;  3PRT A;  1K4J A;  3L2N A;  5GCN A;  1PUA A;  3B3W A;  4MY3 A;  5AGE A;  2Z0Z A;  1XJO A;  1YLO A;  4Y49 B;  1CBX A;  2ZED A;  4M85 A;  4GS4 A;  1DE4 C;  4A38 A;  1YGH A;  4EWT A;  4M3S A;  1GYT A;  3I9S A;  4KSA A;  4Q7A A;  4BD9 A;  3D8P A;  2FIA A;  5C88 A;  2B4B A;  3FRM A;  5I4M A;  3B8G A;  2POK A;  5IX3 A;  2Z3L A;  2F8H A;  1KZF A;  1R57 A;  4MFJ A;  3T90 A;  2PJ3 A;  3LWU A;  4KLV A;  5D8N A;  2FL4 A;  3T8W A;  3WAB A;  1XFO A;  2ZEL A;  3BLN A;  2Q44 A;  4B13 A;  3CT9 A;  3S9L A;  3H8F A;  2KCW A;  3PB7 X;  1TKF A;  1CG2 A;  1I1D A;  4LUA A;  3B3S A;  2B5G B;  2GU2 A;  3T9Y A;  5G20 A;  2ANP A;  5EC4 A;  4CAE A;  2BL1 A;  5F49 A;  4L89 A;  4MBU A;  2Q7B A;  4MXU A;  4FBE A;  1QSN A;  3S6G A;  3JUW A;  1L0C A;  4QVT A;  4QB9 A;  1XRY A;  2B58 A;  5K8P A;  1HDQ A;  4NGM A;  4IHM A;  2ODF A;  5HVG A;  2P6F A;  4NXY A;  4XPK A;  2CTB A;  1KUV A;  1TKH A;  1BAV A;  2BOA A;  1FNO A;  3TTH A;  1YK3 A;  2OB0 A;  2QVP A;  3BJ8 A;  3D7G A;  1Z8X A;  4IAV A;  5D29 A;  4C2Z A;  1YVK A;  4IF5 A;  5G22 A;  1VGY A;  4CYP A;  3DDD A;  4ORF A;  2IJZ A;  5BWA B;  4P6Y A;  2GFQ A;  3DSB A;  2R98 A;  3KAS A;  1CPX A;  3KKW A;  3NH4 A;  1P4N A;  3D2P A;  1IGB A;  3P2F A;  3DLJ A;  1UWY A;  1Q2Y A;  4K30 A;  1Z8L A;  3I1U A;  1QST A;  2J8N A;  2WZN A;  3KQZ A;  4CRZ B;  1JQG A;  5ELY A;  4KOR A;  4A37 A;  2OZG A;  4UA3 A;  3TO7 A;  1VHE A;  5G21 A;  4B14 A;  5I0C A;  3I3G A;  3BHX A;  1S7K A;  3TT2 A;  1YW4 A;  3D4U A;  3V7Z A;  4UEZ A;  4F8Z A;  2PVV A;  4R6T A;  4F0X A;  3KGQ A;  5JPH A;  1LRZ A;  2PC1 A;  2GLF A;  3NH5 A;  4E0A A;  5F46 A;  1QQ9 A;  2P6G A;  3IGR A;  2CNT A;  4OAE A;  4R87 A;  2Q4Y A;  2ZW7 A;  1BOB A;  1VHS A;  3KHX A;  4UCP A;  4CRY B;  3CXP A;  4AG9 A;  5LYD A;  2BUE A;  1KWM A;  4MY0 A;  4PK2 A;  4PSX A;  3BJ7 A;  1V0C A;  1M4L A;  2PJ9 A;  2PJ0 A;  3WC7 A;  2X7B A;  4OP4 A;  4RN7 A;  3D7D A;  3PB8 X;  3D67 A;  4P4J A;  4B5P A;  1Z8W A;  1XF8 A;  4YRH A;  2D4P A;  4PQA A;  3EY5 A;  2BSW A;  2J8R A;  2WPX A;  4ONU A;  1F2O A;  2P6E A;  4A2Z A;  4JXR A;  2K5T A;  3W6X A;  2VI7 A;  2JEW A;  2O53 A;  2VL1 A;  4JD6 A;  1QSO A;  4H89 A;  3GYA A;  3KZW A;  4NGS A;  4A94 A;  5K8N A;  3IC1 A;  1ELM P;  3PB4 X;  4F9U A;  3ISX A;  4XNH B;  5KTA A;  5FVJ A;  1ELL P;  1BLL E;  3PP9 A;  2PIZ A;  3B3C A;  2CIJ A; 
#chains in the Genus database with same CATH homology
 1KUY A;  5C82 A;  2HUZ A;  2G3A A;  4B10 A;  2Q0Y A;  4H6U A;  2ZW5 A;  4J3G A;  2P0W A;  1Y9K A;  5G1Z A;  3DNS A;  3UY5 A;  1NE9 A;  2FCK A;  5J8C A;  4KSF A;  2JLM A;  3K9U A;  3S6K A;  3RYO A;  4HNW B;  2B4D B;  2C27 A;  2PQ8 A;  5DWN A;  2OZU A;  4EVY A;  5KTC A;  2WSA A;  4F0Y A;  2WUU A;  2ARH A;  4U5Y A;  3H5Z A;  4UBR A;  3F8K A;  4MJ8 A;  2DPS A;  5DWM A;  4KOU A;  3FNC A;  2B3U A;  2QML A;  5AG5 A;  3IU2 A;  4XPD C;  1P0H A;  2B3V A;  1QSM A;  4KOV A;  2GE3 A;  1NSL A;  5A28 A;  4KOW A;  3G8W A;  2Z3N A;  2JEV A;  1XEB A;  1S60 A;  4UWJ A;  4R9M A;  1S3Z A;  2J8M A;  4R57 A;  1S7F A;  4A30 A;  2FT0 A;  3VWE A;  3R9E A;  4C2X A;  2FXF A;  2REF A;  4FD5 A;  4F6A A;  5EBV A;  2DPT A;  4MFL A;  1ZO0 A;  2OH1 A;  4CYQ A;  2PR1 A;  1WWZ A;  1FY7 A;  4HKF A;  3R9F A;  2R1I A;  4C68 A;  1MJA A;  1B6B A;  4MFP A;  1CJW A;  4CYN A;  4LX9 A;  5IV0 A;  4CAF A;  1XMT A;  2B5G A;  4BMH A;  2G3T A;  2A4N A;  1RXT A;  3MGD A;  1M4I A;  4BBH A;  1OZP A;  1YR0 A;  1I12 A;  2Z3P A;  4NF1 A;  1S5K A;  4KVM E;  1YRE A;  4RS2 A;  2Z3K A;  1ON0 A;  2GAN A;  2VZY A;  3SXO A;  2PSW A;  3DR6 A;  2FIW A;  1IID A;  2VBQ A;  4MFK A;  1BO4 A;  4XPK A;  4OAD A;  1CM0 A;  5H86 A;  3GY9 A;  1Y9W A;  2H5M A;  2NMT A;  2HV2 A;  4L8A A;  3EXN A;  4CS0 B;  2QEC A;  4JJX A;  3E0K A;  3TFY A;  5AG7 A;  5CNP A;  1Z4E A;  5KTD A;  3R9G A;  4KOT A;  3W6S A;  4YFJ A;  4R3L A;  3IU1 A;  3LOD A;  2CXA A;  3D3S A;  1Z4R A;  2ZW4 A;  3H4Q A;  4QBJ A;  3EC4 A;  4OLL A;  3IWE A;  5ISV A;  4A32 A;  2FSR A;  3LD2 A;  4JWP A;  2IL4 A;  1TIQ A;  4ZBG A;  4MI4 A;  2I00 A;  1PU9 A;  4DNC A;  2YNC A;  2R8V A;  3ZZI A;  1S7N A;  2BEI A;  3NE7 A;  2D4O A;  4ZGY B;  3FIX A;  2CNM A;  4NSQ A;  3S6H A;  4CGM A;  4U9Z A;  4KZT A;  4E2A A;  4A95 A;  2EUI A;  2B4D A;  2FS5 A;  4IUS A;  4CGL A;  4Y49 C;  4MFQ A;  3TCV A;  2R7H A;  1I21 A;  3P2H A;  2Y0M A;  4C7H A;  4X5K A;  1XE4 A;  1RO5 A;  2AE6 A;  2OZH A;  1S7L A;  2JDC A;  4JLY A;  1NMT A;  1U6M A;  4MHD A;  2ZW6 A;  2PRB A;  1KUX A;  4NEX A;  4KUA A;  3PZJ A;  2DXQ A;  4AVC A;  4CGP A;  4XPD B;  3WR7 A;  5HMN A;  3GKR A;  4RI1 A;  4KS9 A;  4AVB A;  4MFZ A;  4UCM A;  3ZJ0 A;  4E8O A;  4AG7 A;  4JXQ A;  4CGO A;  2O28 A;  1QSR A;  3TE4 A;  2REE A;  1M1D A;  3EO4 A;  4YGO A;  3D2M A;  2RC4 A;  4UFV A;  1GHE A;  5HH1 A;  4CAW A;  1IYL A;  3FB3 A;  1IIC A;  4CGN A;  4Q36 A;  3FXT A;  2VZZ A;  1M44 A;  3S6F A;  3IWG A;  2Z3O A;  5AG6 A;  2VEZ A;  1UFH A;  3N7Z A;  1WK4 A;  2ZPA A;  3F5B A;  4KUB A;  2ZXV A;  4HNX B;  5H84 A;  3OWC A;  4CYO A;  1SQH A;  1N71 A;  1IB1 E;  2EVN A;  3C26 A;  2Z11 A;  1MJB A;  3JVN A;  4UFW A;  3TO9 A;  4II9 A;  4KOX A;  3CXQ A;  2GIV A;  1MK4 A;  2F5I A;  2FE7 A;  4PK3 A;  3R95 A;  5F48 A;  1VKC A;  1Q2D A;  4KOS A;  5JQ4 A;  1YVO A;  2I79 A;  3VWD A;  3A9L A;  3SHP A;  5F47 A;  2ATR A;  1M4G A;  4KVO E;  2PDO A;  3TO6 A;  4B12 A;  5E96 A;  3G3S A;  3QAH A;  3W91 A;  2PR8 A;  1YX0 A;  4C7I A;  4B5P B;  3DR8 A;  2OU2 A;  2G0B A;  4A33 A;  5J8F A;  3CXS A;  4UCN A;  4FD7 A;  4CAX A;  4XNH C;  1MJ9 A;  4KOY A;  3JTK A;  3FYN A;  4NCZ A;  2YNC C;  2JDD A;  4H6Z A;  3TOB A;  4B11 A;  4PV6 A;  2Q4V A;  4HNY B;  3FBU A;  2QIR A;  4FD4 A;  1IYK A;  1XIX A;  4R3K A;  3R1K A;  1Y7R A;  2CY2 A;  3F0A A;  2HQY A;  4CAV A;  2WPW A;  4B5O A;  4C2Y A;  4AB7 A;  2Q04 A;  3QB8 A;  1Q2C A;  2YNE A;  5AG4 A;  3EFA A;  4I49 A;  4Q38 A;  2YGW A;  4AVA A;  3SXN A;  3PGP A;  1J4J A;  1B87 A;  2Z10 A;  2YND A;  1M4D A;  4QUS A;  2VXK A;  3R96 A;  4KVX A;  3TOA A;  1YLE A;  4U9Y A;  4UFX A;  1Z9U A;  4UWI A;  5IB0 A;  2CNS A;  2Z3M A;  4A31 A;  2VQY A;  4FD6 A;  4KLW A;  4XPL A;  5A27 A;  3V8I A;  2AJ6 A;  4PSW A;  4QC6 A;  1K4J A;  5GCN A;  1PUA A;  4MY3 A;  5AGE A;  2Z0Z A;  4Y49 B;  4M85 A;  4GS4 A;  1YGH A;  4M3S A;  3I9S A;  4KSA A;  5C88 A;  3D8P A;  2FIA A;  2B4B A;  3FRM A;  3B8G A;  5IX3 A;  2Z3L A;  1KZF A;  1R57 A;  4MFJ A;  3T90 A;  4KLV A;  2FL4 A;  3BLN A;  2Q44 A;  4B13 A;  2KCW A;  4LUA A;  1I1D A;  2B5G B;  3T9Y A;  5G20 A;  5EC4 A;  4CAE A;  2BL1 A;  5F49 A;  4L89 A;  4MBU A;  2Q7B A;  1QSN A;  3S6G A;  3JUW A;  1L0C A;  4QVT A;  4QB9 A;  2B58 A;  2P6F A;  4NXY A;  1KUV A;  3TTH A;  1YK3 A;  2OB0 A;  3BJ8 A;  4C2Z A;  1YVK A;  4IF5 A;  5G22 A;  4CYP A;  3DDD A;  4ORF A;  5BWA B;  3DSB A;  3KKW A;  2R98 A;  1P4N A;  3D2P A;  3P2F A;  1Q2Y A;  4K30 A;  1QST A;  2J8N A;  4CRZ B;  4KOR A;  2OZG A;  4UA3 A;  3TO7 A;  5G21 A;  4B14 A;  5I0C A;  3I3G A;  3TT2 A;  1S7K A;  4F0X A;  5JPH A;  1LRZ A;  2PC1 A;  4E0A A;  5F46 A;  3IGR A;  2P6G A;  2CNT A;  4OAE A;  4R87 A;  2Q4Y A;  2ZW7 A;  1BOB A;  1VHS A;  4UCP A;  4CRY B;  3CXP A;  4AG9 A;  2BUE A;  4MY0 A;  4PK2 A;  4PSX A;  3BJ7 A;  1V0C A;  2X7B A;  4B5P A;  1XF8 A;  4YRH A;  2D4P A;  3EY5 A;  2BSW A;  2J8R A;  2WPX A;  4ONU A;  2P6E A;  4A2Z A;  4JXR A;  2K5T A;  3W6X A;  2VI7 A;  4JD6 A;  1QSO A;  4H89 A;  3GYA A;  4XNH B;  5KTA A;  5FVJ A;  3PP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...