2BEIA

X-ray structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
156
Chain Sequence
SVRIREAKEGDCGDILRLIRELAEFEKLKISEEALRADGFGDNPFYHCLVAEILGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 2
publication title Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 156
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2beiA00
4H89A 1YLEA 1XMTA 4MY3A 2Z11A 3WR7A 4JD6A 4R87A 4OAEA 4EVYA 5I0CA 1KUXA 3F5BA 4NF1A 1S7LA 2Q4YA 5E96A 1J4JA 3BJ7A 1U6MA 3JVNA 2VXKA 4IUSA 2Q4VA 3GKRA 1QSOA 2PSWA 2OH1A 4KOWA 2J8RA 4AB7A 4Y49C 1TIQA 3D3SA 3PGPA 2G3TA 2X7BA 4HNWB 3LD2A 4RI1A 4AVAA 2K5TA 2ATRA 5GCNA 3T90A 3EXNA 4CAXA 2VI7A 3FIXA 1XF8A 2KCWA 4KZTA 1V0CA 4HKFA 2PR1A 3P2HA 4B5PA 4KOSA 1QSMA 2REEA 2CNTA 5HH1A 5EBVA 4AG7A 2JEVA 2R8VA 4UA3A 4YRHA 3W6SA 1S5KA 2ZW7A 2PC1A 4KVME 1QSTA 2A4NA 4JXQA 2IL4A 2J8NA 1S7FA 1S7KA 3F0AA 2H5MA 2R7HA 2JDCA 2B5GB 4ZBGA 2AE6A 5C88A 2VEZA 5IB0A 2FL4A 2Y0MA 1S3ZA 4MY0A 4CAVA 3ZZIA 3S6FA 2VBQA 2PDOA 3TO9A 4BMHA 4JWPA 2VQYA 1IB1E 3I9SA 4J3GA 4MHDA 4II9A 1R57A 4U5YA 1I21A 3W6XA 1S60A 4X5KA 2EUIA 4IF5A 4FD6A 2WPWA 1QSRA 3IGRA 1RO5A 2ZXVA 3JUWA 5ISVA 2G3AA 4FD5A 1P4NA 5J8FA 3UY5A 4KOVA 1WWZA 2P6EA 2BUEA 4B5PB 2Q7BA 3GYAA 4KOXA 1YX0A 5H84A 4H6UA 1MJAA 1KUVA 4XPDB 2VZZA 4QUSA 4KLWA 1UFHA 4PSWA 2GANA 3DR8A 4HNXB 5IX3A 1SQHA 1YREA 4KUBA 3LODA 1YK3A 4NEXA 3D2PA 1Z9UA 1M4IA 5EC4A 4E8OA 3EC4A 4FD4A 3R96A 4MI4A 3B8GA 2WPXA 4QVTA 4QBJA 1QSNA 1FY7A 2AJ6A 4FD7A 2J8MA 5F49A 4DNCA 2FSRA 2HV2A 4KORA 2PR8A 3C26A 5F47A 2FS5A 2B3UA 1ON0A 1OZPA 1XIXA 3DDDA 4OADA 1I1DA 3OWCA 3F8KA 3TOAA 1YGHA 4LUAA 4M85A 1IYLA 4NXYA 4R3KA 4CS0B 3FRMA 4GS4A 3RYOA 2B4BA 2P0WA 2GE3A 2I00A 3NE7A 1Z4RA 2GIVA 5DWNA 3H4QA 3QB8A 5FVJA 2Q04A 1YR0A 3E0KA 2CY2A 2REFA 4CRYB 3W91A 2B4DA 4KOTA 2Z0ZA 4I49A 3TE4A 4ONUA 1YVKA 3S6GA 3R9GA 3TTHA 1IICA 2VZYA 3DR6A 4F6AA 4R3LA 3CXPA 4KVOE 2B3VA 2Z10A 2O28A 3EY5A 1Y7RA 3QAHA 4F0YA 3PZJA 2R98A 4QB9A 4PK2A 1M4DA 2B58A 4PK3A 4JXRA 1NE9A 1Z4EA 4E0AA 3D2MA 1B6BA 3SXOA 4QC6A 1NMTA 3FBUA 5J8CA 5KTAA 4CRZB 2BL1A 4B5OA 2BSWA 1PUAA 3BJ8A 3R9EA 4JJXA 3V8IA 3TO7A 2ZPAA 1KZFA 4R9MA 2R1IA 2NMTA 2BEIA 4LX9A 3TOBA 2OZHA 4HNYB 2OZGA 5HMNA 3CXSA 4XNHB 1Q2YA 2HQYA 3G8WA 2D4OA 1XE4A 4U9YA 5H86A 3TT2A 3GY9A 4AVBA 4UWIA 1VKCA 3SHPA 2OU2A 4KLVA 5KTDA 3R1KA 5F48A 3TCVA 1RXTA 5CNPA 4YGOA 1L0CA 2FE7A 3T9YA 1Q2DA 2B4DB 4XNHC 3BLNA 4XPDC 1VHSA 3S6HA 3FYNA 3KKWA 3FB3A 3G3SA 4Y49B 4AVCA 2ZW5A 3TFYA 4AG9A 1KUYA 1BO4A 4YFJA 3IWGA 2PQ8A 2D4PA 4L8AA 3TO6A 4PSXA 2ZW4A 1N71A 4UBRA 1CM0A 3DNSA 4JLYA 3I3GA 3PP9A 3FXTA 1IIDA 2HUZA 2FIAA 1MK4A 2QMLA 3P2FA 2Q44A 5KTCA 3MGDA 3VWEA 5IV0A 1Y9WA 1YVOA 2QIRA 3CXQA 1IYKA 2Q0YA 2F5IA 2CNSA 5C82A 2P6GA 3VWDA 2OZUA 4R57A 3EFAA 3D8PA 2PRBA 1M1DA 3EO4A 5DWMA 4K30A 4U9ZA 4PV6A 2G0BA 2ZW6A 3ZJ0A 4KVXA 1M4GA 4XPKA 2C27A 3SXNA 1BOBA 1M44A 1I12A 2FIWA 2OB0A 4OLLA 2FT0A 2CNMA 2FXFA 1PU9A 3S6KA 4KOYA 3R9FA 3K9UA 3FNCA 2JDDA 1XEBA 5JPHA 2P6FA 1NSLA 1WK4A 2ARHA 4MBUA 4XPLA 4NSQA 1MJ9A 1K4JA 2DXQA 4CAWA 1Y9KA 4KOUA 2QECA 1GHEA 4KUAA 1LRZA 2RC4A 4UWJA 2EVNA 1CJWA 4MJ8A 4RS2A 4ORFA 4L89A 2B5GA 2FCKA 4H6ZA 1S7NA 4NCZA 3N7ZA 3R95A 1B87A 2JLMA 5F46A 5JQ4A 1MJBA 1Q2CA 2I79A 4M3SA 3DSBA 1P0HA 4E2AA
chains in the Genus database with same CATH superfamily
2XEFA 4GXHA 4H89A 1YLEA 1XMTA 4MY3A 5LRGA 2Z11A 3KGQA 4NGPA 3WR7A 3K2KA 4JD6A 4R87A 2Q7SA 2DPSA 4MRIA 4OAEA 4P4FA 1KUXA 4EVYA 3F5BA 5I0CA 4NF1A 1S7LA 2Q4YA 5AG4A 5E96A 4MCRA 2EK8A 4WJBA 4A32A 1J4JA 1CG2A 3BJ7A 4CGLA 1U6MA 4R6TA 2JBJA 2ABZA 1ARLA 3JVNA 4UFWA 1Y0YA 5G1ZA 3WABA 1XRYA 2HB6A 2VXKA 4IUSA 1HDUA 4NGTA 3IU1A 2Q4VA 1H8LA 3JTKA 3ISXA 4JZ0A 3GKRA 3MRUA 3SJEA 1QSOA 2PSWA 2OH1A 4KOWA 2F7VA 2J8RA 2JBKA 4AB7A 4Y49C 1TIQA 3D3SA 3PGPA 2G3TA 2X7BA 4HNWB 4C68A 1IOIA 3ISZA 3LD2A 4RI1A 4B10A 3DGVA 4MFJA 4ZX8A 4AVAA 3FEEA 4NFRA 3SI0A 2K5TA 4UEEA 2ATRA 5GCNA 3T90A 3EXNA 1IY7A 4B12A 4CAXA 2VI7A 3FIXA 1XF8A 2G9DA 2KCWA 3N5FA 4KZTA 2Q43A 3SJGA 4P4DA 1V0CA 4HKFA 2PR1A 5AGEA 5IB9A 3V7ZA 3P2HA 1XBUA 4B5PA 2AFWA 3KASA 3FVLA 4KOSA 1RTQA 1QSMA 1VHEA 2REEA 2CNTA 4R8FA 2GU2A 5EBVA 5HH1A 4LQGA 2JEVA 4AG7A 2R8VA 1HDQA 4UA3A 4YRHA 2YNDA 3W6SA 3H8EA 1S5KA 2ZW7A 2CTBA 2PC1A 3SJXA 1LCPA 3D67A 5CBMA 4OC5A 4KVME 1F2OA 2XEGA 1QSTA 6CPAA 2A4NA 3D7HA 4JXQA 2WUUA 2IL4A 1ZO0A 3D7GA 2J8NA 1S7FA 3FF3A 2AFOA 1S7KA 4P4BA 3F0AA 2H5MA 2R7HA 5K8PA 2JDCA 3GUXA 3H8FA 4OC4A 3D7DA 2B5GB 1AYEA 2AE6A 4ZBGA 3IIBA 5C88A 4OIDA 2VEZA 5D8NA 5IB0A 2FL4A 2WSAA 4X2TA 3WC5A 3CPXA 2Y0MA 1ZLIA 4PXDA 1PCAA 1S3ZA 3CDXA 4IK2A 5THWA 4MY0A 4CAVA 1TF8A 2OR4A 2WZNA 4PQAA 3WC6A 1VHOA 3VH9A 3ZZIA 2WYRA 3S6FA 1Z2LA 1LAMA 2VBQA 2PDOA 4M6IA 4A30A 3FH4A 3TO9A 4BMHA 4JWPA 3PB7X 2C6PA 2ZEPA 2Z3MA 2VQYA 4MFZA 1YSJA 4P4EA 2OOTA 4KSFA 1PYTB 3VATA 2PJ6A 1IB1E 3I9SA 1ARMA 1F2PA 4J3GA 5K8MA 1VGYA 4P6YA 4P4JA 3B3TA 2HC9A 4NGQA 4C2ZA 3PB4X 2CF4A 4MHDA 2V77A 1R57A 4II9A 2GLFA 1HEEA 2PJ3A 2YNCC 4HPSA 4U5YA 1I21A 3W6XA 1CX8A 4F9UA 1S60A 4X5KA 4Q7AA 2EUIA 4IF5A 4UCPA 3H5ZA 4FD6A 2WPWA 1QSRA 4CYQA 3RAMA 3IGRA 1RO5A 3PB9X 3D7FA 2ZXVA 3JUWA 4CAEA 5ISVA 4DUKA 3QAYA 2G3AA 3SI2A 4FD5A 1GYTA 1P4NA 5J8FA 3UY5A 5LRJA 4KOVA 4UIAA 4A39A 1LAPA 1BLLE 3IC1A 1WWZA 2P6EA 2RB7A 2BUEA 4B5PB 3TX8A 3IJ3A 3IU2A 2Q7BA 3D66A 5AG7A 2BO9A 2ZEEA 5HXDA 3GYAA 4MFQA 1Z8LA 4KOXA 1YX0A 5H84A 3FJUA 3KI9A 4H6UA 1CPXA 1MJAA 1KUVA 5HVHA 4MHZA 2BCOA 4XPDB 2VL1A 2VZZA 4QUSA 4KLWA 3IWEA 4WWVA 4FBEA 5LYDA 1UFHA 2IJZA 4PSWA 2GANA 2GFQA 3DR8A 4AXVA 4HNXB 1M4LA 5IX3A 1SQHA 1YREA 4P4IA 4KUBA 1R43A 1XOVA 3LODA 1YK3A 4NEXA 3D2PA 1Z9UA 1Z8TA 1R3NA 4UCNA 3B3SA 4PXCA 1M4IA 2QYVA 4TNUA 5EC4A 3S9NA 4UCMA 5LYLA 2NSMA 1XMBA 4E8OA 3EC4A 2PRQA 2XEJA 4FD4A 7CPAA 1A2ZA 3R96A 1Z8WA 4MI4A 3B8GA 4Q38A 2WPXA 4QVTA 4QBJA 2PJ0A 4CYNA 1QSNA 5D29A 1FY7A 1ZG7A 2AJ6A 3NH5A 4FD7A 2J8MA 5F49A 3PB6X 4PXEA 4DNCA 3S9MA 2FSRA 2HV2A 3SI1A 4KORA 2PR8A 5LYFA 3C26A 4MMOA 2PJAA 5F47A 2FS5A 2RFHA 4LQ6A 5AG6A 2XEIA 2B3UA 1ON0A 1OZPA 1XIXA 3DDDA 3IO1A 4M6GA 2PVVA 4OADA 1I1DA 2V8DA 4OMEA 4UFXA 4C7HA 3OWCA 5LRKA 1YW4A 2I3CA 3F8KA 3TOAA 4P44A 4FAIA 3KR5A 1YGHA 4X8IA 4KSIA 2PJ4A 4LUAA 4MHPA 5A27A 4M85A 1Z5RA 4A94A 1IYLA 4MCSA 5G20A 1QQ9A 3L2NA 4NXYA 1DTDA 3VARA 4R3KA 4CS0B 3FRMA 3V38A 2O4HA 4GS4A 4W9YA 3RYOA 2PE3A 4YU9A 4B13A 2B4BA 2P0WA 2GE3A 2I00A 1ZG9A 3NE7A 1Z4RA 4CGMA 2PJ1A 2GIVA 5DWNA 3H4QA 4ZY1A 2PJ7A 2AFXA 3QB8A 4KSAA 4PXBA 4MFKA 5FVJA 2Q04A 1YR0A 2ZOFA 4OIWA 3B35A 3E0KA 5G22A 4ZY0A 2CY2A 3CPAA 3FEDA 2REFA 4CRYB 4NGSA 3W91A 2B4DA 3RBUA 4K3NA 2C6GA 5HVGA 1TKFA 2PVWA 2Z0ZA 4KOTA 4I49A 3TE4A 3LWUA 1Y0RA 1TKHA 2ODFA 4ONUA 4UEZA 1YVKA 1LOKA 3S6GA 3R9GA 3TTHA 1IICA 2VZYA 3DR6A 4F6AA 4R3LA 4Z65A 3CXPA 1X10A 4KVOE 2B3VA 4ZX9A 2Z10A 2O28A 3EY5A 1X12A 1Y7RA 3QAHA 2EO8A 3B2YA 5G21A 4A37A 4F0YA 5EMIA 4C7IA 1TKJA 1QMUA 3PZJA 2R98A 3TC8A 2EBJA 4QB9A 1LFWA 4PK2A 5AG5A 4EFDA 1M4DA 2B58A 4PK3A 1YMEA 4JXRA 2V8GA 1TF9A 3PB8X 3FECA 2V8VA 4B11A 1NE9A 3WC7A 3PRTA 5I4MA 2YGWA 4UFVA 1Z4EA 4E0AA 3D2MA 2ZEGA 4YWYA 4O23A 4P45A 4FWUA 1B6BA 1VIXA 3SXOA 4QC6A 4CGNA 4MHNA 4CYOA 3SJFA 1NMTA 3KQZA 1CPSA 3FBUA 4R76A 4C2XA 5J8CA 4CRZB 5KTAA 3HLPA 2BL1A 3D4UA 4B5OA 4EWTA 2BSWA 1PUAA 2Z3LA 3BJ8A 2DPTA 3R9EA 4IAVA 4OC3A 5J1QA 2ZOGA 4JJXA 3V8IA 1CP6A 2PJBA 2ZEMA 3DLJA 4A95A 3RO0A 2ZPAA 1KZFA 1JWQA 3TO7A 4R9MA 1ELLP 2R1IA 2NMTA 2BEIA 4LX9A 3TOBA 4CAFA 2OZHA 1CP7A 4HNYB 1XFOA 2OZGA 5HMNA 4BD9A 3LMSA 3NE8A 3CXSA 4XNHB 4BBHA 1Q2YA 1LANA 2HQYA 3G8WA 2D4OA 2PJ2A 2ZELA 3NH8A 1XE4A 3LACA 3RZAA 4CGOA 2DF5A 4U9YA 2Z3OA 5H86A 4ONWA 3TT2A 3GY9A 3S9LA 1TXRA 4MFLA 4Q36A 1VKCA 2GLJA 4OC0A 4UWIA 3SHPA 4AVBA 4NGNA 2OU2A 4KLVA 4F8ZA 5KTDA 3A9LA 3R1KA 5F48A 3K9TA 2YNCA 3TCVA 1RXTA 5CNPA 4YGOA 3GB0A 1L0CA 4OP4A 1F57A 2FE7A 2JEWA 1Q2DA 2B4DB 5ELYA 3T9YA 4EMEA 4XNHC 3BLNA 4XPDC 1Q7LA 2Z3PA 1VHSA 4ZY2A 3FYNA 3S6HA 3MN8A 1UWYA 3KKWA 3BI0A 3FB3A 3PBEA 3G3SA 4Y49B 4AVCA 2ZW5A 1Z8XA 5BWAB 5HVFA 4OC2A 3TFYA 4AG9A 1BPNA 1IOFA 1KUYA 1XJOA 1EE3P 1YW6A 4RUHA 1BO4A 3BXMA 3IFEA 4CYPA 4TWEA 4YFJA 1OBRA 3IWGA 2PQ8A 4ZYQA 5K8NA 2D4PA 4L8AA 3TO6A 4PSXA 4A33A 4MHYA 1AUGA 3IWWA 2ZW4A 5K8OA 1N71A 4CGPA 4A2ZA 5A28A 4UBRA 5JH9A 1CM0A 3WT4A 3KZWA 3DNSA 4JLYA 4PPZA 3I3GA 3PP9A 1ZLHA 3FXTA 1IIDA 2HUZA 4ZI6A 2FIAA 1MK4A 2QMLA 2ZEFA 3FX6A 3P2FA 4DJLA 2Q44A 4OC1A 5KTCA 4C2YA 4GM5A 3MGDA 3T8WA 3VWEA 2AFMA 4BINA 5IV0A 2PJCA 2F8HA 3D68A 4H2KA 1Y9WA 1YVOA 1ZG8A 2QIRA 3CXQA 1IU8A 1IYKA 4NJRA 2Q0YA 1AMPA 2F5IA 3B3CA 3GLJA 4KS9A 2DEAA 1DE4C 2CNSA 4MCQA 3CZXA 1ELMP 5C82A 2C1CA 4A38A 2PIYA 2ANPA 2P6GA 3VWDA 3BI1A 3B7IA 4NJQA 2OZUA 1YLOA 4UIBA 4R57A 2NYQA 3EFAA 3D8PA 2PRBA 2Z3KA 4A31A 1M1DA 2PJ9A 3B3VA 3EO4A 5JM6A 5DWMA 4K30A 3KHZA 3I1UA 3JRUA 4PV6A 4U9ZA 2G0BA 2ZW6A 3ZJ0A 3CT9A 3PBBA 2O53A 4KVXA 1M4GA 2PJ8A 5LYIA 4XPKA 2C27A 2Q4ZA 4UEFA 2GREA 3B3WA 4MXUA 3FMCA 2Z3NA 3SXNA 1BOBA 1M44A 3PFEA 5JGFA 1I12A 2FIWA 2OB0A 4OLLA 2FT0A 2CNMA 2POKA 2EWBA 2ZEHA 2ZENA 2FXFA 3IEHA 1PU9A 3KL9A 4KOYA 3GIUA 4NGRA 4NGMA 3R9FA 3S6KA 2CIJA 3K9UA 2IMOA 3FNCA 2JDDA 3NFZA 1XEBA 2EK9A 5JPHA 2CTCA 3KQXA 2P6FA 2AFUA 1NSLA 2PCUA 1WK4A 1FNOA 2ARHA 4MBUA 4FUUA 3NH4A 4XPLA 2AFSA 4NSQA 5DS0A 1MJ9A 1NSAA 1K4JA 4R7MA 2DXQA 4F9VA 1YQEA 2PJ5A 4G1PA 4JYWA 4CAWA 1Y9KA 4KOUA 4DYOA 4CPAA 2QECA 4ZGYB 1GHEA 1KWMA 4MCPA 1CBXA 3PFOA 2J9AA 3KHXA 2AFZA 3RNZA 4OKOA 4KUAA 3QNVA 4X3RA 3BHXA 1LRZA 2C6CA 4P10A 1BPMA 2RC4A 4IHMA 3HUVA 5F09A 4UWJA 4F0XA 2EVNA 3NA6A 1CJWA 4B6ZA 8CPAA 3PEIA 4MJ8A 2QJ8A 4RS2A 1Y7EA 2CXAA 4ORFA 4L89A 2B5GA 2FCKA 4H6ZA 1S7NA 4NCZA 5CPAA 1BAVA 1JQGA 3N7ZA 3R95A 2PIZA 4M6HA 2ZEDA 2QVPA 4MFPA 1IGBA 2IQ6A 1B87A 2JLMA 1FT7A 2Q51A 5F46A 2FVGA 2YNEA 5JQ4A 1MJBA 1Q2CA 2V8HA 3H8GA 4B14A 2I79A 4M3SA 4RN7A 3DSBA 4UF4A 2BOAA 1P0HA 2ZEOA 3KR4A 4E2AA
chains in the Genus database with same CATH topology
4H89A 1YLEA 1XMTA 4MY3A 2Z11A 3WR7A 4JD6A 4R87A 2DPSA 4OAEA 4EVYA 5I0CA 1KUXA 3F5BA 4NF1A 1S7LA 2Q4YA 5AG4A 5E96A 4A32A 1J4JA 3BJ7A 4CGLA 1U6MA 3JVNA 4UFWA 5G1ZA 2VXKA 4IUSA 3IU1A 2Q4VA 3JTKA 3GKRA 1QSOA 2PSWA 2OH1A 4KOWA 2J8RA 4AB7A 4Y49C 1TIQA 3D3SA 3PGPA 2G3TA 2X7BA 4HNWB 4C68A 3LD2A 4RI1A 4B10A 4MFJA 4AVAA 2K5TA 2ATRA 5GCNA 3T90A 3EXNA 4B12A 4CAXA 2VI7A 3FIXA 1XF8A 2KCWA 4KZTA 5AGEA 1V0CA 4HKFA 2PR1A 3P2HA 4B5PA 4KOSA 1QSMA 2REEA 2CNTA 5HH1A 5EBVA 4AG7A 2JEVA 2R8VA 4UA3A 4YRHA 2YNDA 3W6SA 1S5KA 2ZW7A 2PC1A 4KVME 1QSTA 2A4NA 4JXQA 2WUUA 2IL4A 1ZO0A 2J8NA 1S7FA 1S7KA 3F0AA 2H5MA 2R7HA 2JDCA 2B5GB 4ZBGA 2AE6A 5C88A 2VEZA 5IB0A 2FL4A 2WSAA 2Y0MA 1S3ZA 4MY0A 4CAVA 3ZZIA 3S6FA 2VBQA 2PDOA 4A30A 3TO9A 4BMHA 4JWPA 4MFZA 2Z3MA 2VQYA 4KSFA 1IB1E 3I9SA 4J3GA 4C2ZA 4MHDA 4II9A 1R57A 2YNCC 4U5YA 1I21A 3W6XA 1S60A 4X5KA 2EUIA 4IF5A 4UCPA 3H5ZA 4FD6A 2WPWA 1QSRA 4CYQA 3IGRA 1RO5A 2ZXVA 3JUWA 4CAEA 5ISVA 2G3AA 4FD5A 1P4NA 5J8FA 3UY5A 4KOVA 1WWZA 2P6EA 2BUEA 4B5PB 3IU2A 2Q7BA 5AG7A 3GYAA 4MFQA 4KOXA 1YX0A 5H84A 4H6UA 1MJAA 1KUVA 4XPDB 2VZZA 4QUSA 4KLWA 3IWEA 1UFHA 4PSWA 2GANA 3DR8A 4HNXB 5IX3A 1SQHA 1YREA 4KUBA 3LODA 1YK3A 4NEXA 3D2PA 1Z9UA 4UCNA 1M4IA 5EC4A 4UCMA 4E8OA 3EC4A 4FD4A 3R96A 4MI4A 3B8GA 4Q38A 2WPXA 4QVTA 4QBJA 4CYNA 1QSNA 1FY7A 2AJ6A 4FD7A 2J8MA 5F49A 4DNCA 2FSRA 2HV2A 4KORA 2PR8A 3C26A 5F47A 2FS5A 5AG6A 2B3UA 1ON0A 1OZPA 1XIXA 3DDDA 4OADA 1I1DA 4UFXA 4C7HA 3OWCA 3F8KA 3TOAA 1YGHA 4LUAA 5A27A 4M85A 1IYLA 5G20A 4NXYA 4R3KA 4CS0B 3FRMA 4GS4A 3RYOA 4B13A 2B4BA 2P0WA 2GE3A 2I00A 3NE7A 4CGMA 1Z4RA 2GIVA 5DWNA 3H4QA 3QB8A 4KSAA 4MFKA 5FVJA 2Q04A 1YR0A 3E0KA 5G22A 2CY2A 2REFA 4CRYB 3W91A 2B4DA 2Z0ZA 4KOTA 4I49A 3TE4A 4ONUA 1YVKA 3S6GA 3R9GA 3TTHA 1IICA 2VZYA 3DR6A 4F6AA 4R3LA 3CXPA 4KVOE 2B3VA 2Z10A 2O28A 3EY5A 1Y7RA 3QAHA 4F0YA 5G21A 4C7IA 3PZJA 2R98A 4QB9A 4PK2A 5AG5A 1M4DA 2B58A 4PK3A 4JXRA 4B11A 1NE9A 2YGWA 4UFVA 1Z4EA 4E0AA 3D2MA 1B6BA 3SXOA 4QC6A 4CGNA 4CYOA 1NMTA 3FBUA 4C2XA 5J8CA 5KTAA 4CRZB 2BL1A 4B5OA 2BSWA 1PUAA 2Z3LA 3BJ8A 2DPTA 3R9EA 4JJXA 3V8IA 4A95A 3TO7A 2ZPAA 1KZFA 4R9MA 2R1IA 2NMTA 2BEIA 4LX9A 3TOBA 4CAFA 2OZHA 4HNYB 2OZGA 5HMNA 3CXSA 4XNHB 4BBHA 1Q2YA 2HQYA 3G8WA 2D4OA 1XE4A 4CGOA 4U9YA 2Z3OA 5H86A 3TT2A 3GY9A 4MFLA 4Q36A 4UWIA 1VKCA 4AVBA 3SHPA 2OU2A 4KLVA 5KTDA 3A9LA 3R1KA 5F48A 2YNCA 3TCVA 1RXTA 5CNPA 4YGOA 1L0CA 2FE7A 3T9YA 1Q2DA 2B4DB 4XNHC 3BLNA 4XPDC 2Z3PA 1VHSA 3S6HA 3FYNA 3KKWA 3FB3A 3G3SA 4Y49B 4AVCA 2ZW5A 5BWAB 3TFYA 4AG9A 1KUYA 1BO4A 4CYPA 4YFJA 3IWGA 2PQ8A 2D4PA 4L8AA 3TO6A 4PSXA 4A33A 2ZW4A 1N71A 4CGPA 4A2ZA 5A28A 4UBRA 1CM0A 3DNSA 4JLYA 3I3GA 3PP9A 3FXTA 1IIDA 2HUZA 2FIAA 1MK4A 2QMLA 3P2FA 2Q44A 5KTCA 4C2YA 3MGDA 3VWEA 5IV0A 1Y9WA 1YVOA 2QIRA 3CXQA 1IYKA 2Q0YA 2F5IA 4KS9A 2CNSA 5C82A 2P6GA 3VWDA 2OZUA 4R57A 3EFAA 3D8PA 2PRBA 2Z3KA 4A31A 1M1DA 3EO4A 5DWMA 4K30A 4U9ZA 4PV6A 2G0BA 2ZW6A 3ZJ0A 4KVXA 1M4GA 4XPKA 2C27A 3SXNA 2Z3NA 1BOBA 1M44A 1I12A 2FIWA 2OB0A 4OLLA 2FT0A 2CNMA 2FXFA 1PU9A 3S6KA 4KOYA 3R9FA 3K9UA 3FNCA 2JDDA 1XEBA 5JPHA 2P6FA 1NSLA 1WK4A 2ARHA 4MBUA 4XPLA 4NSQA 1MJ9A 1K4JA 2DXQA 4CAWA 1Y9KA 4KOUA 2QECA 4ZGYB 1GHEA 4KUAA 1LRZA 2RC4A 4UWJA 4F0XA 2EVNA 1CJWA 4MJ8A 4RS2A 2CXAA 4ORFA 4L89A 2B5GA 2FCKA 4H6ZA 1S7NA 4NCZA 3N7ZA 3R95A 4MFPA 1B87A 2JLMA 5F46A 5JQ4A 2YNEA 1MJBA 1Q2CA 4B14A 2I79A 4M3SA 3DSBA 1P0HA 4E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H89 A;  1YLE A;  1XMT A;  4MY3 A;  2Z11 A;  3WR7 A;  4JD6 A;  4R87 A;  4OAE A;  4EVY A;  5I0C A;  1KUX A;  3F5B A;  4NF1 A;  1S7L A;  2Q4Y A;  5E96 A;  1J4J A;  3BJ7 A;  1U6M A;  3JVN A;  2VXK A;  4IUS A;  2Q4V A;  3GKR A;  1QSO A;  2PSW A;  2OH1 A;  4KOW A;  2J8R A;  4AB7 A;  4Y49 C;  1TIQ A;  3D3S A;  3PGP A;  2G3T A;  2X7B A;  4HNW B;  3LD2 A;  4RI1 A;  4AVA A;  2K5T A;  2ATR A;  5GCN A;  3T90 A;  3EXN A;  4CAX A;  2VI7 A;  3FIX A;  1XF8 A;  2KCW A;  4KZT A;  1V0C A;  4HKF A;  2PR1 A;  3P2H A;  4B5P A;  4KOS A;  1QSM A;  2REE A;  2CNT A;  5HH1 A;  5EBV A;  4AG7 A;  2JEV A;  2R8V A;  4UA3 A;  4YRH A;  3W6S A;  1S5K A;  2ZW7 A;  2PC1 A;  4KVM E;  1QST A;  2A4N A;  4JXQ A;  2IL4 A;  2J8N A;  1S7F A;  1S7K A;  3F0A A;  2H5M A;  2R7H A;  2JDC A;  2B5G B;  4ZBG A;  2AE6 A;  5C88 A;  2VEZ A;  5IB0 A;  2FL4 A;  2Y0M A;  1S3Z A;  4MY0 A;  4CAV A;  3ZZI A;  3S6F A;  2VBQ A;  2PDO A;  3TO9 A;  4BMH A;  4JWP A;  2VQY A;  1IB1 E;  3I9S A;  4J3G A;  4MHD A;  4II9 A;  1R57 A;  4U5Y A;  1I21 A;  3W6X A;  1S60 A;  4X5K A;  2EUI A;  4IF5 A;  4FD6 A;  2WPW A;  1QSR A;  3IGR A;  1RO5 A;  2ZXV A;  3JUW A;  5ISV A;  2G3A A;  4FD5 A;  1P4N A;  5J8F A;  3UY5 A;  4KOV A;  1WWZ A;  2P6E A;  2BUE A;  4B5P B;  2Q7B A;  3GYA A;  4KOX A;  1YX0 A;  5H84 A;  4H6U A;  1MJA A;  1KUV A;  4XPD B;  2VZZ A;  4QUS A;  4KLW A;  1UFH A;  4PSW A;  2GAN A;  3DR8 A;  4HNX B;  5IX3 A;  1SQH A;  1YRE A;  4KUB A;  3LOD A;  1YK3 A;  4NEX A;  3D2P A;  1Z9U A;  1M4I A;  5EC4 A;  4E8O A;  3EC4 A;  4FD4 A;  3R96 A;  4MI4 A;  3B8G A;  2WPX A;  4QVT A;  4QBJ A;  1QSN A;  1FY7 A;  2AJ6 A;  4FD7 A;  2J8M A;  5F49 A;  4DNC A;  2FSR A;  2HV2 A;  4KOR A;  2PR8 A;  3C26 A;  5F47 A;  2FS5 A;  2B3U A;  1ON0 A;  1OZP A;  1XIX A;  3DDD A;  4OAD A;  1I1D A;  3OWC A;  3F8K A;  3TOA A;  1YGH A;  4LUA A;  4M85 A;  1IYL A;  4NXY A;  4R3K A;  4CS0 B;  3FRM A;  4GS4 A;  3RYO A;  2B4B A;  2P0W A;  2GE3 A;  2I00 A;  3NE7 A;  1Z4R A;  2GIV A;  5DWN A;  3H4Q A;  3QB8 A;  5FVJ A;  2Q04 A;  1YR0 A;  3E0K A;  2CY2 A;  2REF A;  4CRY B;  3W91 A;  2B4D A;  4KOT A;  2Z0Z A;  4I49 A;  3TE4 A;  4ONU A;  1YVK A;  3S6G A;  3R9G A;  3TTH A;  1IIC A;  2VZY A;  3DR6 A;  4F6A A;  4R3L A;  3CXP A;  4KVO E;  2B3V A;  2Z10 A;  2O28 A;  3EY5 A;  1Y7R A;  3QAH A;  4F0Y A;  3PZJ A;  2R98 A;  4QB9 A;  4PK2 A;  1M4D A;  2B58 A;  4PK3 A;  4JXR A;  1NE9 A;  1Z4E A;  4E0A A;  3D2M A;  1B6B A;  3SXO A;  4QC6 A;  1NMT A;  3FBU A;  5J8C A;  5KTA A;  4CRZ B;  2BL1 A;  4B5O A;  2BSW A;  1PUA A;  3BJ8 A;  3R9E A;  4JJX A;  3V8I A;  3TO7 A;  2ZPA A;  1KZF A;  4R9M A;  2R1I A;  2NMT A;  2BEI A;  4LX9 A;  3TOB A;  2OZH A;  4HNY B;  2OZG A;  5HMN A;  3CXS A;  4XNH B;  1Q2Y A;  2HQY A;  3G8W A;  2D4O A;  1XE4 A;  4U9Y A;  5H86 A;  3TT2 A;  3GY9 A;  4AVB A;  4UWI A;  1VKC A;  3SHP A;  2OU2 A;  4KLV A;  5KTD A;  3R1K A;  5F48 A;  3TCV A;  1RXT A;  5CNP A;  4YGO A;  1L0C A;  2FE7 A;  3T9Y A;  1Q2D A;  2B4D B;  4XNH C;  3BLN A;  4XPD C;  1VHS A;  3S6H A;  3FYN A;  3KKW A;  3FB3 A;  3G3S A;  4Y49 B;  4AVC A;  2ZW5 A;  3TFY A;  4AG9 A;  1KUY A;  1BO4 A;  4YFJ A;  3IWG A;  2PQ8 A;  2D4P A;  4L8A A;  3TO6 A;  4PSX A;  2ZW4 A;  1N71 A;  4UBR A;  1CM0 A;  3DNS A;  4JLY A;  3I3G A;  3PP9 A;  3FXT A;  1IID A;  2HUZ A;  2FIA A;  1MK4 A;  2QML A;  3P2F A;  2Q44 A;  5KTC A;  3MGD A;  3VWE A;  5IV0 A;  1Y9W A;  1YVO A;  2QIR A;  3CXQ A;  1IYK A;  2Q0Y A;  2F5I A;  2CNS A;  5C82 A;  2P6G A;  3VWD A;  2OZU A;  4R57 A;  3EFA A;  3D8P A;  2PRB A;  1M1D A;  3EO4 A;  5DWM A;  4K30 A;  4U9Z A;  4PV6 A;  2G0B A;  2ZW6 A;  3ZJ0 A;  4KVX A;  1M4G A;  4XPK A;  2C27 A;  3SXN A;  1BOB A;  1M44 A;  1I12 A;  2FIW A;  2OB0 A;  4OLL A;  2FT0 A;  2CNM A;  2FXF A;  1PU9 A;  3S6K A;  4KOY A;  3R9F A;  3K9U A;  3FNC A;  2JDD A;  1XEB A;  5JPH A;  2P6F A;  1NSL A;  1WK4 A;  2ARH A;  4MBU A;  4XPL A;  4NSQ A;  1MJ9 A;  1K4J A;  2DXQ A;  4CAW A;  1Y9K A;  4KOU A;  2QEC A;  1GHE A;  4KUA A;  1LRZ A;  2RC4 A;  4UWJ A;  2EVN A;  1CJW A;  4MJ8 A;  4RS2 A;  4ORF A;  4L89 A;  2B5G A;  2FCK A;  4H6Z A;  1S7N A;  4NCZ A;  3N7Z A;  3R95 A;  1B87 A;  2JLM A;  5F46 A;  5JQ4 A;  1MJB A;  1Q2C A;  2I79 A;  4M3S A;  3DSB A;  1P0H A;  4E2A A; 
#chains in the Genus database with same CATH topology
 2XEF A;  4GXH A;  4H89 A;  1YLE A;  1XMT A;  4MY3 A;  5LRG A;  2Z11 A;  3KGQ A;  4NGP A;  3WR7 A;  3K2K A;  4JD6 A;  4R87 A;  2Q7S A;  2DPS A;  4MRI A;  4OAE A;  4P4F A;  1KUX A;  4EVY A;  3F5B A;  5I0C A;  4NF1 A;  1S7L A;  2Q4Y A;  5AG4 A;  5E96 A;  4MCR A;  2EK8 A;  4WJB A;  4A32 A;  1J4J A;  1CG2 A;  3BJ7 A;  4CGL A;  1U6M A;  4R6T A;  2JBJ A;  2ABZ A;  1ARL A;  3JVN A;  4UFW A;  1Y0Y A;  5G1Z A;  3WAB A;  1XRY A;  2HB6 A;  2VXK A;  4IUS A;  1HDU A;  4NGT A;  3IU1 A;  2Q4V A;  1H8L A;  3JTK A;  3ISX A;  4JZ0 A;  3GKR A;  3MRU A;  3SJE A;  1QSO A;  2PSW A;  2OH1 A;  4KOW A;  2F7V A;  2J8R A;  2JBK A;  4AB7 A;  4Y49 C;  1TIQ A;  3D3S A;  3PGP A;  2G3T A;  2X7B A;  4HNW B;  4C68 A;  1IOI A;  3ISZ A;  3LD2 A;  4RI1 A;  4B10 A;  3DGV A;  4MFJ A;  4ZX8 A;  4AVA A;  3FEE A;  4NFR A;  3SI0 A;  2K5T A;  4UEE A;  2ATR A;  5GCN A;  3T90 A;  3EXN A;  1IY7 A;  4B12 A;  4CAX A;  2VI7 A;  3FIX A;  1XF8 A;  2G9D A;  2KCW A;  3N5F A;  4KZT A;  2Q43 A;  3SJG A;  4P4D A;  1V0C A;  4HKF A;  2PR1 A;  5AGE A;  5IB9 A;  3V7Z A;  3P2H A;  1XBU A;  4B5P A;  2AFW A;  3KAS A;  3FVL A;  4KOS A;  1RTQ A;  1QSM A;  1VHE A;  2REE A;  2CNT A;  4R8F A;  2GU2 A;  5EBV A;  5HH1 A;  4LQG A;  2JEV A;  4AG7 A;  2R8V A;  1HDQ A;  4UA3 A;  4YRH A;  2YND A;  3W6S A;  3H8E A;  1S5K A;  2ZW7 A;  2CTB A;  2PC1 A;  3SJX A;  1LCP A;  3D67 A;  5CBM A;  4OC5 A;  4KVM E;  1F2O A;  2XEG A;  1QST A;  6CPA A;  2A4N A;  3D7H A;  4JXQ A;  2WUU A;  2IL4 A;  1ZO0 A;  3D7G A;  2J8N A;  1S7F A;  3FF3 A;  2AFO A;  1S7K A;  4P4B A;  3F0A A;  2H5M A;  2R7H A;  5K8P A;  2JDC A;  3GUX A;  3H8F A;  4OC4 A;  3D7D A;  2B5G B;  1AYE A;  2AE6 A;  4ZBG A;  3IIB A;  5C88 A;  4OID A;  2VEZ A;  5D8N A;  5IB0 A;  2FL4 A;  2WSA A;  4X2T A;  3WC5 A;  3CPX A;  2Y0M A;  1ZLI A;  4PXD A;  1PCA A;  1S3Z A;  3CDX A;  4IK2 A;  5THW A;  4MY0 A;  4CAV A;  1TF8 A;  2OR4 A;  2WZN A;  4PQA A;  3WC6 A;  1VHO A;  3VH9 A;  3ZZI A;  2WYR A;  3S6F A;  1Z2L A;  1LAM A;  2VBQ A;  2PDO A;  4M6I A;  4A30 A;  3FH4 A;  3TO9 A;  4BMH A;  4JWP A;  3PB7 X;  2C6P A;  2ZEP A;  2Z3M A;  2VQY A;  4MFZ A;  1YSJ A;  4P4E A;  2OOT A;  4KSF A;  1PYT B;  3VAT A;  2PJ6 A;  1IB1 E;  3I9S A;  1ARM A;  1F2P A;  4J3G A;  5K8M A;  1VGY A;  4P6Y A;  4P4J A;  3B3T A;  2HC9 A;  4NGQ A;  4C2Z A;  3PB4 X;  2CF4 A;  4MHD A;  2V77 A;  1R57 A;  4II9 A;  2GLF A;  1HEE A;  2PJ3 A;  2YNC C;  4HPS A;  4U5Y A;  1I21 A;  3W6X A;  1CX8 A;  4F9U A;  1S60 A;  4X5K A;  4Q7A A;  2EUI A;  4IF5 A;  4UCP A;  3H5Z A;  4FD6 A;  2WPW A;  1QSR A;  4CYQ A;  3RAM A;  3IGR A;  1RO5 A;  3PB9 X;  3D7F A;  2ZXV A;  3JUW A;  4CAE A;  5ISV A;  4DUK A;  3QAY A;  2G3A A;  3SI2 A;  4FD5 A;  1GYT A;  1P4N A;  5J8F A;  3UY5 A;  5LRJ A;  4KOV A;  4UIA A;  4A39 A;  1LAP A;  1BLL E;  3IC1 A;  1WWZ A;  2P6E A;  2RB7 A;  2BUE A;  4B5P B;  3TX8 A;  3IJ3 A;  3IU2 A;  2Q7B A;  3D66 A;  5AG7 A;  2BO9 A;  2ZEE A;  5HXD A;  3GYA A;  4MFQ A;  1Z8L A;  4KOX A;  1YX0 A;  5H84 A;  3FJU A;  3KI9 A;  4H6U A;  1CPX A;  1MJA A;  1KUV A;  5HVH A;  4MHZ A;  2BCO A;  4XPD B;  2VL1 A;  2VZZ A;  4QUS A;  4KLW A;  3IWE A;  4WWV A;  4FBE A;  5LYD A;  1UFH A;  2IJZ A;  4PSW A;  2GAN A;  2GFQ A;  3DR8 A;  4AXV A;  4HNX B;  1M4L A;  5IX3 A;  1SQH A;  1YRE A;  4P4I A;  4KUB A;  1R43 A;  1XOV A;  3LOD A;  1YK3 A;  4NEX A;  3D2P A;  1Z9U A;  1Z8T A;  1R3N A;  4UCN A;  3B3S A;  4PXC A;  1M4I A;  2QYV A;  4TNU A;  5EC4 A;  3S9N A;  4UCM A;  5LYL A;  2NSM A;  1XMB A;  4E8O A;  3EC4 A;  2PRQ A;  2XEJ A;  4FD4 A;  7CPA A;  1A2Z A;  3R96 A;  1Z8W A;  4MI4 A;  3B8G A;  4Q38 A;  2WPX A;  4QVT A;  4QBJ A;  2PJ0 A;  4CYN A;  1QSN A;  5D29 A;  1FY7 A;  1ZG7 A;  2AJ6 A;  3NH5 A;  4FD7 A;  2J8M A;  5F49 A;  3PB6 X;  4PXE A;  4DNC A;  3S9M A;  2FSR A;  2HV2 A;  3SI1 A;  4KOR A;  2PR8 A;  5LYF A;  3C26 A;  4MMO A;  2PJA A;  5F47 A;  2FS5 A;  2RFH A;  4LQ6 A;  5AG6 A;  2XEI A;  2B3U A;  1ON0 A;  1OZP A;  1XIX A;  3DDD A;  3IO1 A;  4M6G A;  2PVV A;  4OAD A;  1I1D A;  2V8D A;  4OME A;  4UFX A;  4C7H A;  3OWC A;  5LRK A;  1YW4 A;  2I3C A;  3F8K A;  3TOA A;  4P44 A;  4FAI A;  3KR5 A;  1YGH A;  4X8I A;  4KSI A;  2PJ4 A;  4LUA A;  4MHP A;  5A27 A;  4M85 A;  1Z5R A;  4A94 A;  1IYL A;  4MCS A;  5G20 A;  1QQ9 A;  3L2N A;  4NXY A;  1DTD A;  3VAR A;  4R3K A;  4CS0 B;  3FRM A;  3V38 A;  2O4H A;  4GS4 A;  4W9Y A;  3RYO A;  2PE3 A;  4YU9 A;  4B13 A;  2B4B A;  2P0W A;  2GE3 A;  2I00 A;  1ZG9 A;  3NE7 A;  1Z4R A;  4CGM A;  2PJ1 A;  2GIV A;  5DWN A;  3H4Q A;  4ZY1 A;  2PJ7 A;  2AFX A;  3QB8 A;  4KSA A;  4PXB A;  4MFK A;  5FVJ A;  2Q04 A;  1YR0 A;  2ZOF A;  4OIW A;  3B35 A;  3E0K A;  5G22 A;  4ZY0 A;  2CY2 A;  3CPA A;  3FED A;  2REF A;  4CRY B;  4NGS A;  3W91 A;  2B4D A;  3RBU A;  4K3N A;  2C6G A;  5HVG A;  1TKF A;  2PVW A;  2Z0Z A;  4KOT A;  4I49 A;  3TE4 A;  3LWU A;  1Y0R A;  1TKH A;  2ODF A;  4ONU A;  4UEZ A;  1YVK A;  1LOK A;  3S6G A;  3R9G A;  3TTH A;  1IIC A;  2VZY A;  3DR6 A;  4F6A A;  4R3L A;  4Z65 A;  3CXP A;  1X10 A;  4KVO E;  2B3V A;  4ZX9 A;  2Z10 A;  2O28 A;  3EY5 A;  1X12 A;  1Y7R A;  3QAH A;  2EO8 A;  3B2Y A;  5G21 A;  4A37 A;  4F0Y A;  5EMI A;  4C7I A;  1TKJ A;  1QMU A;  3PZJ A;  2R98 A;  3TC8 A;  2EBJ A;  4QB9 A;  1LFW A;  4PK2 A;  5AG5 A;  4EFD A;  1M4D A;  2B58 A;  4PK3 A;  1YME A;  4JXR A;  2V8G A;  1TF9 A;  3PB8 X;  3FEC A;  2V8V A;  4B11 A;  1NE9 A;  3WC7 A;  3PRT A;  5I4M A;  2YGW A;  4UFV A;  1Z4E A;  4E0A A;  3D2M A;  2ZEG A;  4YWY A;  4O23 A;  4P45 A;  4FWU A;  1B6B A;  1VIX A;  3SXO A;  4QC6 A;  4CGN A;  4MHN A;  4CYO A;  3SJF A;  1NMT A;  3KQZ A;  1CPS A;  3FBU A;  4R76 A;  4C2X A;  5J8C A;  4CRZ B;  5KTA A;  3HLP A;  2BL1 A;  3D4U A;  4B5O A;  4EWT A;  2BSW A;  1PUA A;  2Z3L A;  3BJ8 A;  2DPT A;  3R9E A;  4IAV A;  4OC3 A;  5J1Q A;  2ZOG A;  4JJX A;  3V8I A;  1CP6 A;  2PJB A;  2ZEM A;  3DLJ A;  4A95 A;  3RO0 A;  2ZPA A;  1KZF A;  1JWQ A;  3TO7 A;  4R9M A;  1ELL P;  2R1I A;  2NMT A;  2BEI A;  4LX9 A;  3TOB A;  4CAF A;  2OZH A;  1CP7 A;  4HNY B;  1XFO A;  2OZG A;  5HMN A;  4BD9 A;  3LMS A;  3NE8 A;  3CXS A;  4XNH B;  4BBH A;  1Q2Y A;  1LAN A;  2HQY A;  3G8W A;  2D4O A;  2PJ2 A;  2ZEL A;  3NH8 A;  1XE4 A;  3LAC A;  3RZA A;  4CGO A;  2DF5 A;  4U9Y A;  2Z3O A;  5H86 A;  4ONW A;  3TT2 A;  3GY9 A;  3S9L A;  1TXR A;  4MFL A;  4Q36 A;  1VKC A;  2GLJ A;  4OC0 A;  4UWI A;  3SHP A;  4AVB A;  4NGN A;  2OU2 A;  4KLV A;  4F8Z A;  5KTD A;  3A9L A;  3R1K A;  5F48 A;  3K9T A;  2YNC A;  3TCV A;  1RXT A;  5CNP A;  4YGO A;  3GB0 A;  1L0C A;  4OP4 A;  1F57 A;  2FE7 A;  2JEW A;  1Q2D A;  2B4D B;  5ELY A;  3T9Y A;  4EME A;  4XNH C;  3BLN A;  4XPD C;  1Q7L A;  2Z3P A;  1VHS A;  4ZY2 A;  3FYN A;  3S6H A;  3MN8 A;  1UWY A;  3KKW A;  3BI0 A;  3FB3 A;  3PBE A;  3G3S A;  4Y49 B;  4AVC A;  2ZW5 A;  1Z8X A;  5BWA B;  5HVF A;  4OC2 A;  3TFY A;  4AG9 A;  1BPN A;  1IOF A;  1KUY A;  1XJO A;  1EE3 P;  1YW6 A;  4RUH A;  1BO4 A;  3BXM A;  3IFE A;  4CYP A;  4TWE A;  4YFJ A;  1OBR A;  3IWG A;  2PQ8 A;  4ZYQ A;  5K8N A;  2D4P A;  4L8A A;  3TO6 A;  4PSX A;  4A33 A;  4MHY A;  1AUG A;  3IWW A;  2ZW4 A;  5K8O A;  1N71 A;  4CGP A;  4A2Z A;  5A28 A;  4UBR A;  5JH9 A;  1CM0 A;  3WT4 A;  3KZW A;  3DNS A;  4JLY A;  4PPZ A;  3I3G A;  3PP9 A;  1ZLH A;  3FXT A;  1IID A;  2HUZ A;  4ZI6 A;  2FIA A;  1MK4 A;  2QML A;  2ZEF A;  3FX6 A;  3P2F A;  4DJL A;  2Q44 A;  4OC1 A;  5KTC A;  4C2Y A;  4GM5 A;  3MGD A;  3T8W A;  3VWE A;  2AFM A;  4BIN A;  5IV0 A;  2PJC A;  2F8H A;  3D68 A;  4H2K A;  1Y9W A;  1YVO A;  1ZG8 A;  2QIR A;  3CXQ A;  1IU8 A;  1IYK A;  4NJR A;  2Q0Y A;  1AMP A;  2F5I A;  3B3C A;  3GLJ A;  4KS9 A;  2DEA A;  1DE4 C;  2CNS A;  4MCQ A;  3CZX A;  1ELM P;  5C82 A;  2C1C A;  4A38 A;  2PIY A;  2ANP A;  2P6G A;  3VWD A;  3BI1 A;  3B7I A;  4NJQ A;  2OZU A;  1YLO A;  4UIB A;  4R57 A;  2NYQ A;  3EFA A;  3D8P A;  2PRB A;  2Z3K A;  4A31 A;  1M1D A;  2PJ9 A;  3B3V A;  3EO4 A;  5JM6 A;  5DWM A;  4K30 A;  3KHZ A;  3I1U A;  3JRU A;  4PV6 A;  4U9Z A;  2G0B A;  2ZW6 A;  3ZJ0 A;  3CT9 A;  3PBB A;  2O53 A;  4KVX A;  1M4G A;  2PJ8 A;  5LYI A;  4XPK A;  2C27 A;  2Q4Z A;  4UEF A;  2GRE A;  3B3W A;  4MXU A;  3FMC A;  2Z3N A;  3SXN A;  1BOB A;  1M44 A;  3PFE A;  5JGF A;  1I12 A;  2FIW A;  2OB0 A;  4OLL A;  2FT0 A;  2CNM A;  2POK A;  2EWB A;  2ZEH A;  2ZEN A;  2FXF A;  3IEH A;  1PU9 A;  3KL9 A;  4KOY A;  3GIU A;  4NGR A;  4NGM A;  3R9F A;  3S6K A;  2CIJ A;  3K9U A;  2IMO A;  3FNC A;  2JDD A;  3NFZ A;  1XEB A;  2EK9 A;  5JPH A;  2CTC A;  3KQX A;  2P6F A;  2AFU A;  1NSL A;  2PCU A;  1WK4 A;  1FNO A;  2ARH A;  4MBU A;  4FUU A;  3NH4 A;  4XPL A;  2AFS A;  4NSQ A;  5DS0 A;  1MJ9 A;  1NSA A;  1K4J A;  4R7M A;  2DXQ A;  4F9V A;  1YQE A;  2PJ5 A;  4G1P A;  4JYW A;  4CAW A;  1Y9K A;  4KOU A;  4DYO A;  4CPA A;  2QEC A;  4ZGY B;  1GHE A;  1KWM A;  4MCP A;  1CBX A;  3PFO A;  2J9A A;  3KHX A;  2AFZ A;  3RNZ A;  4OKO A;  4KUA A;  3QNV A;  4X3R A;  3BHX A;  1LRZ A;  2C6C A;  4P10 A;  1BPM A;  2RC4 A;  4IHM A;  3HUV A;  5F09 A;  4UWJ A;  4F0X A;  2EVN A;  3NA6 A;  1CJW A;  4B6Z A;  8CPA A;  3PEI A;  4MJ8 A;  2QJ8 A;  4RS2 A;  1Y7E A;  2CXA A;  4ORF A;  4L89 A;  2B5G A;  2FCK A;  4H6Z A;  1S7N A;  4NCZ A;  5CPA A;  1BAV A;  1JQG A;  3N7Z A;  3R95 A;  2PIZ A;  4M6H A;  2ZED A;  2QVP A;  4MFP A;  1IGB A;  2IQ6 A;  1B87 A;  2JLM A;  1FT7 A;  2Q51 A;  5F46 A;  2FVG A;  2YNE A;  5JQ4 A;  1MJB A;  1Q2C A;  2V8H A;  3H8G A;  4B14 A;  2I79 A;  4M3S A;  4RN7 A;  3DSB A;  4UF4 A;  2BOA A;  1P0H A;  2ZEO A;  3KR4 A;  4E2A A; 
#chains in the Genus database with same CATH homology
 4H89 A;  1YLE A;  1XMT A;  4MY3 A;  2Z11 A;  3WR7 A;  4JD6 A;  4R87 A;  2DPS A;  4OAE A;  4EVY A;  5I0C A;  1KUX A;  3F5B A;  4NF1 A;  1S7L A;  2Q4Y A;  5AG4 A;  5E96 A;  4A32 A;  1J4J A;  3BJ7 A;  4CGL A;  1U6M A;  3JVN A;  4UFW A;  5G1Z A;  2VXK A;  4IUS A;  3IU1 A;  2Q4V A;  3JTK A;  3GKR A;  1QSO A;  2PSW A;  2OH1 A;  4KOW A;  2J8R A;  4AB7 A;  4Y49 C;  1TIQ A;  3D3S A;  3PGP A;  2G3T A;  2X7B A;  4HNW B;  4C68 A;  3LD2 A;  4RI1 A;  4B10 A;  4MFJ A;  4AVA A;  2K5T A;  2ATR A;  5GCN A;  3T90 A;  3EXN A;  4B12 A;  4CAX A;  2VI7 A;  3FIX A;  1XF8 A;  2KCW A;  4KZT A;  5AGE A;  1V0C A;  4HKF A;  2PR1 A;  3P2H A;  4B5P A;  4KOS A;  1QSM A;  2REE A;  2CNT A;  5HH1 A;  5EBV A;  4AG7 A;  2JEV A;  2R8V A;  4UA3 A;  4YRH A;  2YND A;  3W6S A;  1S5K A;  2ZW7 A;  2PC1 A;  4KVM E;  1QST A;  2A4N A;  4JXQ A;  2WUU A;  2IL4 A;  1ZO0 A;  2J8N A;  1S7F A;  1S7K A;  3F0A A;  2H5M A;  2R7H A;  2JDC A;  2B5G B;  4ZBG A;  2AE6 A;  5C88 A;  2VEZ A;  5IB0 A;  2FL4 A;  2WSA A;  2Y0M A;  1S3Z A;  4MY0 A;  4CAV A;  3ZZI A;  3S6F A;  2VBQ A;  2PDO A;  4A30 A;  3TO9 A;  4BMH A;  4JWP A;  4MFZ A;  2Z3M A;  2VQY A;  4KSF A;  1IB1 E;  3I9S A;  4J3G A;  4C2Z A;  4MHD A;  4II9 A;  1R57 A;  2YNC C;  4U5Y A;  1I21 A;  3W6X A;  1S60 A;  4X5K A;  2EUI A;  4IF5 A;  4UCP A;  3H5Z A;  4FD6 A;  2WPW A;  1QSR A;  4CYQ A;  3IGR A;  1RO5 A;  2ZXV A;  3JUW A;  4CAE A;  5ISV A;  2G3A A;  4FD5 A;  1P4N A;  5J8F A;  3UY5 A;  4KOV A;  1WWZ A;  2P6E A;  2BUE A;  4B5P B;  3IU2 A;  2Q7B A;  5AG7 A;  3GYA A;  4MFQ A;  4KOX A;  1YX0 A;  5H84 A;  4H6U A;  1MJA A;  1KUV A;  4XPD B;  2VZZ A;  4QUS A;  4KLW A;  3IWE A;  1UFH A;  4PSW A;  2GAN A;  3DR8 A;  4HNX B;  5IX3 A;  1SQH A;  1YRE A;  4KUB A;  3LOD A;  1YK3 A;  4NEX A;  3D2P A;  1Z9U A;  4UCN A;  1M4I A;  5EC4 A;  4UCM A;  4E8O A;  3EC4 A;  4FD4 A;  3R96 A;  4MI4 A;  3B8G A;  4Q38 A;  2WPX A;  4QVT A;  4QBJ A;  4CYN A;  1QSN A;  1FY7 A;  2AJ6 A;  4FD7 A;  2J8M A;  5F49 A;  4DNC A;  2FSR A;  2HV2 A;  4KOR A;  2PR8 A;  3C26 A;  5F47 A;  2FS5 A;  5AG6 A;  2B3U A;  1ON0 A;  1OZP A;  1XIX A;  3DDD A;  4OAD A;  1I1D A;  4UFX A;  4C7H A;  3OWC A;  3F8K A;  3TOA A;  1YGH A;  4LUA A;  5A27 A;  4M85 A;  1IYL A;  5G20 A;  4NXY A;  4R3K A;  4CS0 B;  3FRM A;  4GS4 A;  3RYO A;  4B13 A;  2B4B A;  2P0W A;  2GE3 A;  2I00 A;  3NE7 A;  4CGM A;  1Z4R A;  2GIV A;  5DWN A;  3H4Q A;  3QB8 A;  4KSA A;  4MFK A;  5FVJ A;  2Q04 A;  1YR0 A;  3E0K A;  5G22 A;  2CY2 A;  2REF A;  4CRY B;  3W91 A;  2B4D A;  2Z0Z A;  4KOT A;  4I49 A;  3TE4 A;  4ONU A;  1YVK A;  3S6G A;  3R9G A;  3TTH A;  1IIC A;  2VZY A;  3DR6 A;  4F6A A;  4R3L A;  3CXP A;  4KVO E;  2B3V A;  2Z10 A;  2O28 A;  3EY5 A;  1Y7R A;  3QAH A;  4F0Y A;  5G21 A;  4C7I A;  3PZJ A;  2R98 A;  4QB9 A;  4PK2 A;  5AG5 A;  1M4D A;  2B58 A;  4PK3 A;  4JXR A;  4B11 A;  1NE9 A;  2YGW A;  4UFV A;  1Z4E A;  4E0A A;  3D2M A;  1B6B A;  3SXO A;  4QC6 A;  4CGN A;  4CYO A;  1NMT A;  3FBU A;  4C2X A;  5J8C A;  5KTA A;  4CRZ B;  2BL1 A;  4B5O A;  2BSW A;  1PUA A;  2Z3L A;  3BJ8 A;  2DPT A;  3R9E A;  4JJX A;  3V8I A;  4A95 A;  3TO7 A;  2ZPA A;  1KZF A;  4R9M A;  2R1I A;  2NMT A;  2BEI A;  4LX9 A;  3TOB A;  4CAF A;  2OZH A;  4HNY B;  2OZG A;  5HMN A;  3CXS A;  4XNH B;  4BBH A;  1Q2Y A;  2HQY A;  3G8W A;  2D4O A;  1XE4 A;  4CGO A;  4U9Y A;  2Z3O A;  5H86 A;  3TT2 A;  3GY9 A;  4MFL A;  4Q36 A;  4UWI A;  1VKC A;  4AVB A;  3SHP A;  2OU2 A;  4KLV A;  5KTD A;  3A9L A;  3R1K A;  5F48 A;  2YNC A;  3TCV A;  1RXT A;  5CNP A;  4YGO A;  1L0C A;  2FE7 A;  3T9Y A;  1Q2D A;  2B4D B;  4XNH C;  3BLN A;  4XPD C;  2Z3P A;  1VHS A;  3S6H A;  3FYN A;  3KKW A;  3FB3 A;  3G3S A;  4Y49 B;  4AVC A;  2ZW5 A;  5BWA B;  3TFY A;  4AG9 A;  1KUY A;  1BO4 A;  4CYP A;  4YFJ A;  3IWG A;  2PQ8 A;  2D4P A;  4L8A A;  3TO6 A;  4PSX A;  4A33 A;  2ZW4 A;  1N71 A;  4CGP A;  4A2Z A;  5A28 A;  4UBR A;  1CM0 A;  3DNS A;  4JLY A;  3I3G A;  3PP9 A;  3FXT A;  1IID A;  2HUZ A;  2FIA A;  1MK4 A;  2QML A;  3P2F A;  2Q44 A;  5KTC A;  4C2Y A;  3MGD A;  3VWE A;  5IV0 A;  1Y9W A;  1YVO A;  2QIR A;  3CXQ A;  1IYK A;  2Q0Y A;  2F5I A;  4KS9 A;  2CNS A;  5C82 A;  2P6G A;  3VWD A;  2OZU A;  4R57 A;  3EFA A;  3D8P A;  2PRB A;  2Z3K A;  4A31 A;  1M1D A;  3EO4 A;  5DWM A;  4K30 A;  4U9Z A;  4PV6 A;  2G0B A;  2ZW6 A;  3ZJ0 A;  4KVX A;  1M4G A;  4XPK A;  2C27 A;  3SXN A;  2Z3N A;  1BOB A;  1M44 A;  1I12 A;  2FIW A;  2OB0 A;  4OLL A;  2FT0 A;  2CNM A;  2FXF A;  1PU9 A;  3S6K A;  4KOY A;  3R9F A;  3K9U A;  3FNC A;  2JDD A;  1XEB A;  5JPH A;  2P6F A;  1NSL A;  1WK4 A;  2ARH A;  4MBU A;  4XPL A;  4NSQ A;  1MJ9 A;  1K4J A;  2DXQ A;  4CAW A;  1Y9K A;  4KOU A;  2QEC A;  4ZGY B;  1GHE A;  4KUA A;  1LRZ A;  2RC4 A;  4UWJ A;  4F0X A;  2EVN A;  1CJW A;  4MJ8 A;  4RS2 A;  2CXA A;  4ORF A;  4L89 A;  2B5G A;  2FCK A;  4H6Z A;  1S7N A;  4NCZ A;  3N7Z A;  3R95 A;  4MFP A;  1B87 A;  2JLM A;  5F46 A;  5JQ4 A;  2YNE A;  1MJB A;  1Q2C A;  4B14 A;  2I79 A;  4M3S A;  3DSB A;  1P0H A;  4E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...