5F49A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with malonyl-coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 33
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f49A00
1XEBA 4JD6A 4AVAA 1BO4A 4JXQA 4PSWA 4R57A 2K5TA 2Q7BA 2C27A 4F0YA 2Q4YA 2ATRA 2OH1A 5C88A 2B4DA 3EFAA 2BL1A 5I0CA 2KCWA 1U6MA 4KORA 2ZW4A 4PK3A 4BMHA 3EXNA 4ZBGA 4AB7A 3QB8A 1IIDA 4KOUA 2GIVA 2Z0ZA 4CRYB 2B3VA 3ZZIA 2PR8A 4JXRA 4KOVA 3SHPA 4NCZA 4PV6A 5F49A 2FT0A 1VHSA 3EO4A 2GE3A 4H89A 4KVXA 4KUBA 4M85A 2FIWA 1Q2DA 2B5GB 1K4JA 4NEXA 2R1IA 3V8IA 1S7NA 2I00A 1PU9A 2EUIA 3R1KA 4QC6A 1S5KA 3LODA 4XPDC 3TT2A 1M4GA 3BJ7A 1YGHA 4K30A 2D4OA 2ZW7A 3DNSA 3F5BA 3TTHA 5E96A 5IX3A 3W6SA 3F8KA 2NMTA 1OZPA 1B6BA 4JJXA 4KVOE 2G0BA 4ONUA 1QSMA 2DXQA 3G3SA 5JQ4A 4L8AA 3G8WA 1S60A 4MI4A 1KUXA 4JWPA 4NF1A 3H4QA 1IICA 1I12A 4UWJA 4XPKA 2FS5A 2FIAA 4XPDB 3N7ZA 1I1DA 1SQHA 2BSWA 1QSNA 2FSRA 2IL4A 5GCNA 4MHDA 2PDOA 2OZUA 3BLNA 5C82A 3NE7A 2CNSA 4B5PB 3S6FA 2ZW6A 2R8VA 3MGDA 4CAVA 4DNCA 2PR1A 4HNXB 2AE6A 3TO6A 1KZFA 2P6EA 2OZGA 3GKRA 3IWGA 5IV0A 2G3TA 2CNMA 3TCVA 4OLLA 4KZTA 3I3GA 4E2AA 2Q0YA 5H86A 4KOXA 2RC4A 1RO5A 3S6KA 1TIQA 3ZJ0A 3R96A 4KOSA 3QAHA 2QMLA 4KLWA 4OAEA 1KUYA 1Q2CA 4YRHA 2QECA 3P2FA 2Y0MA 3P2HA 3E0KA 3OWCA 2GANA 1Z4EA 2R98A 3FYNA 1WWZA 3LD2A 3FIXA 3R95A 4RS2A 2VZZA 2B4DB 5DWNA 3JUWA 4KOWA 2B3UA 3S6GA 3EY5A 5ISVA 1YK3A 4NXYA 4GS4A 2I79A 4MJ8A 3D2MA 4AVCA 1GHEA 3CXQA 1V0CA 1XMTA 1Y9KA 2H5MA 1YLEA 4L89A 1M1DA 3B8GA 2HQYA 3TO7A 2VQYA 1M44A 1Z4RA 5H84A 1M4DA 1YVKA 2FCKA 4R87A 5J8CA 4FD6A 3VWEA 4MBUA 1RXTA 4F6AA 1YR0A 2REFA 5EBVA 4M3SA 2Q04A 3GY9A 4UWIA 3TFYA 3K9UA 4LX9A 4YFJA 3FXTA 4H6ZA 5HMNA 2O28A 4KUAA 1CM0A 1Y7RA 1N71A 1LRZA 3D8PA 4R3LA 4AVBA 3CXSA 1P0HA 2ARHA 2J8MA 2Z10A 3VWDA 2VI7A 2HUZA 2CY2A 1M4IA 2HV2A 3TOBA 5F47A 1S3ZA 2BEIA 4II9A 3DDDA 1NSLA 2Q44A 4LUAA 3R9EA 4EVYA 4QB9A 3IGRA 1XF8A 2OU2A 2J8RA 3UY5A 3EC4A 4FD7A 3F0AA 1WK4A 2Z11A 4JLYA 3JVNA 2JLMA 4QBJA 3RYOA 2FXFA 4U9YA 1MJAA 4KOYA 2ZPAA 1XIXA 3DR6A 5F46A 3PP9A 3R9GA 1YX0A 4HKFA 3W91A 2P0WA 1QSOA 2REEA 2PC1A 1QSRA 4MY0A 2G3AA 2B58A 2OZHA 4Y49C 3FBUA 4UBRA 1S7LA 2WPXA 2WPWA 4R9MA 1S7FA 1YREA 4XNHC 1UFHA 2P6GA 2BUEA 2PQ8A 1IYLA 3TOAA 1IYKA 4CAWA 4R3KA 3FNCA 4IF5A 1B87A 4AG9A 3BJ8A 4ORFA 2CNTA 1L0CA 1FY7A 5CNPA 4XPLA 5KTDA 4AG7A 5IB0A 5DWMA 2OB0A 4Y49B 2B5GA 1NMTA 3T9YA 5J8FA 1IB1E 2F5IA 3FRMA 3D3SA 1MJ9A 1QSTA 2J8NA 3DR8A 3T90A 4XNHB 3SXNA 2FE7A 2ZW5A 3PZJA 2PSWA 2VZYA 4IUSA 4NSQA 2VBQA 4PSXA 4UA3A 3DSBA 3TE4A 4U9ZA 4KLVA 4QVTA 1VKCA 1YVOA 4QUSA 4B5OA 4YGOA 4CRZB 1CJWA 1XE4A 2FL4A 5HH1A 1MK4A 1Z9UA 5EC4A 1P4NA 4HNWB 4RI1A 4X5KA 2JEVA 4CAXA 5JPHA 3C26A 3GYAA 3I9SA 4FD5A 2AJ6A 2EVNA 3KKWA 4H6UA 3CXPA 4J3GA 1MJBA 2D4PA 4PK2A 1I21A 2QIRA 4E8OA 1PUAA 3FB3A 5KTCA 1Q2YA 2P6FA 1ON0A 1NE9A 2ZXVA 2A4NA 3W6XA 4CS0B 5F48A 2VEZA 4HNYB 1Y9WA 1KUVA 4B5PA 2R7HA 2PRBA 4KVME 4FD4A 4U5YA 2VXKA 1S7KA 4OADA 3SXOA 4KOTA 4I49A 4MY3A 1J4JA 1R57A 4E0AA 3WR7A 2Q4VA 3D2PA 2JDDA 2JDCA 5KTAA 2B4BA 5FVJA 3TO9A 1BOBA 3R9FA 2X7BA 3S6HA 3PGPA
chains in the Genus database with same CATH superfamily
1XEBA 5HVHA 4MFZA 4JD6A 4AVAA 1CPXA 1VHOA 3NH8A 1BO4A 4JXQA 2Z3MA 1Y0YA 4PSWA 4R57A 1YMEA 2G9DA 3D68A 4LQ6A 1F57A 2K5TA 1BPNA 2Q7BA 3S9MA 3WC6A 3D7FA 2C27A 4F0YA 5AG7A 2Q4YA 4A38A 2ATRA 3HLPA 2JBJA 2OH1A 4MCSA 4DYOA 3FEDA 2C6CA 5C88A 4M6IA 4JZ0A 2B4DA 2JEWA 4CPAA 3EFAA 3PEIA 2QYVA 2BL1A 4PXBA 4PPZA 2ODFA 5I0CA 2PE3A 1RTQA 2KCWA 1BPMA 1U6MA 3KHXA 4KORA 2ZW4A 4PK3A 4ZGYB 3S9NA 4KS9A 1Z8WA 4BMHA 3EXNA 4M6HA 4NJQA 4ZBGA 4AB7A 4ZX9A 2NSMA 1YW6A 3QB8A 1IIDA 4UFXA 5F09A 4KOUA 3B3CA 5EMIA 4CGNA 5G20A 2GIVA 2Z0ZA 2I3CA 5D29A 4OC3A 2ZEHA 2B3VA 2Q51A 4CRYB 3ZZIA 2PR8A 3NH4A 1ZG8A 4H2KA 4DJLA 4JXRA 4OC0A 1IGBA 4KOVA 3SHPA 4NCZA 2BO9A 4PV6A 5F49A 4CAFA 3CPAA 2FT0A 1VHSA 3EO4A 2PJ4A 3D66A 2GE3A 3B3VA 4H89A 2DF5A 2CIJA 4KVXA 4KUBA 4M85A 1BAVA 3H8FA 5JM6A 3IIBA 5HVGA 2FIWA 1Q2DA 3BXMA 2B5GB 4MCQA 1K4JA 4NEXA 2R1IA 3PB8X 3V8IA 1S7NA 3I1UA 4YWYA 1LAMA 2I00A 1PU9A 5LRJA 2V8DA 1TKFA 2EUIA 3R1KA 4QC6A 1S5KA 4A95A 1Q7LA 3PBBA 5CBMA 3LODA 4XPDC 4MCPA 3TT2A 1M4GA 3BJ7A 1X12A 3H8GA 4NGSA 4UCMA 1YGHA 4K30A 4RUHA 2D4OA 4UFVA 2ZW7A 3DNSA 4C2ZA 3S9LA 1HDQA 3B3TA 3F5BA 3KR4A 3TTHA 4KSIA 5E96A 5IX3A 3KR5A 3W6SA 3KZWA 3F8KA 4P4EA 5AG4A 2NYQA 3HUVA 1TXRA 2NMTA 4EWTA 2F7VA 4X3RA 1OZPA 1B6BA 4JJXA 4KVOE 2G0BA 4ONUA 1QSMA 3SI0A 2DXQA 2PJAA 4IAVA 4CAEA 3G3SA 4ZYQA 1XRYA 5JQ4A 1CBXA 4L8AA 3G8WA 1S60A 2V8VA 1KUXA 4MI4A 1IU8A 4MXUA 4JWPA 4NF1A 2ZOFA 3IJ3A 2DEAA 4ZX8A 3H4QA 1IICA 4JYWA 1I12A 4UWJA 1VGYA 4XPKA 2FS5A 2IMOA 1H8LA 2FIAA 1PCAA 4P44A 4XPDB 3RNZA 3N7ZA 2ZEOA 1I1DA 1SQHA 2AFOA 2BSWA 1IY7A 1QSNA 3IU2A 2GFQA 2FSRA 2IL4A 4BD9A 3KQZA 5GCNA 3N5FA 3SJXA 4MHDA 4NFRA 5HVFA 3V7ZA 4ZI6A 2PDOA 2HC9A 2OZUA 3PFEA 3BLNA 2PJ3A 5C82A 3NE7A 3TX8A 2HB6A 3ISZA 2EWBA 5JH9A 2CNSA 4B5PB 3S6FA 2WUUA 2ZW6A 4C2XA 2R8VA 3MGDA 4MRIA 4PXDA 4CAVA 4DNCA 2PR1A 4FBEA 4B6ZA 4HNXB 2AE6A 3TO6A 1KZFA 3NH5A 2P6EA 2OZGA 3GUXA 4XNHC 1VHEA 3GKRA 3IWGA 4C68A 5IV0A 3FEEA 2G3TA 2CNMA 3TCVA 4ZY0A 4OLLA 4KZTA 1ARLA 2QVPA 3I3GA 2RFHA 3B35A 4CYNA 2Q0YA 4E2AA 4WWVA 5H86A 4W9YA 2ZEMA 2PJ6A 2RC4A 1RO5A 3IC1A 1TIQA 3QAYA 4KOXA 3RAMA 3S6KA 3R96A 3ZJ0A 4KOSA 4A37A 4B13A 3QAHA 2C6GA 4A33A 2Z3NA 1ZO0A 4OP4A 1IOFA 2QMLA 4OC1A 4KLWA 5G1ZA 3DLJA 4BINA 4OAEA 2PIYA 4PXEA 1KUYA 2ZELA 3IO1A 2YNEA 1Q2CA 4UF4A 4X2TA 4YRHA 5ELYA 2QECA 3P2FA 2PJ9A 2Y0MA 3P2HA 3PFOA 3E0KA 3OWCA 1PYTB 4PXCA 2ZEFA 3D7HA 1CP7A 2GANA 1Z4EA 2R98A 3FYNA 3RZAA 2PJ5A 1WWZA 3LD2A 2EO8A 3FIXA 3IFEA 4NGPA 3B3SA 3R95A 2GLFA 1IOIA 4RS2A 2VZZA 2B4DB 2PJ8A 5DWNA 2PRQA 3JUWA 4KOWA 2B3UA 3S6GA 1TF9A 3EY5A 1LANA 6CPAA 3KQXA 2QJ8A 5ISVA 1YK3A 2ZEGA 2CF4A 4OC5A 4NXYA 4GS4A 2I79A 2GLJA 2PVWA 4MJ8A 3D2MA 4AVCA 1GHEA 1F2OA 3CXQA 3VATA 1V0CA 1XMTA 1YW4A 1Y9KA 1YQEA 1YLEA 2H5MA 4L89A 4MFPA 4A39A 1M1DA 4UCPA 3B8GA 1XFOA 2HQYA 3RBUA 5K8MA 3TO7A 4FAIA 2AFWA 1TKJA 2VQYA 3JRUA 1GYTA 1M44A 1XMBA 1Z4RA 3SJGA 4B14A 5A27A 5K8OA 2XEGA 3LWUA 4A30A 1R43A 4UIAA 2ANPA 5H84A 1M4DA 4OC2A 1YVKA 2FCKA 4R87A 3BI1A 2WZNA 1R3NA 3WC5A 5J8CA 2ZEEA 4FD6A 3VWEA 2AFXA 5BWAB 4B12A 4MBUA 1RXTA 1VIXA 4F6AA 2J9AA 1YR0A 2REFA 2WYRA 2PCUA 4MFJA 5EBVA 4MHZA 4CGMA 4M3SA 2Q04A 1Z5RA 3GY9A 4UWIA 3TFYA 4ZY2A 2WSAA 3K9UA 3KL9A 4LX9A 4K3NA 4A32A 4TWEA 4YFJA 5G21A 3FXTA 2XEFA 4H6ZA 5HMNA 3FJUA 1TKHA 2O28A 1CM0A 3MRUA 3D7DA 1Y7RA 4KUAA 1N71A 1JQGA 1LRZA 3D8PA 4R3LA 4A2ZA 5AG6A 4AVBA 2BOAA 2EBJA 5I4MA 3CXSA 1BLLE 1P0HA 2ARHA 3FMCA 4MCRA 4HPSA 3B2YA 3PB4X 2ZEDA 2J8MA 2Z10A 3VWDA 1CPSA 2VI7A 3GB0A 4CGOA 3PRTA 8CPAA 2HUZA 2CY2A 4UEZA 4CYPA 1M4IA 2HV2A 3TOBA 5F47A 1S3ZA 3H8EA 2FVGA 2PJ7A 3FVLA 2BEIA 1YLOA 4UEFA 2F8HA 4P4IA 4II9A 3CDXA 3DDDA 4OC4A 1NSLA 2Z3LA 2OOTA 4IK2A 1F2PA 2Q44A 4LUAA 4P4DA 3R9EA 1CG2A 1KWMA 2JBKA 4P45A 5JGFA 4EVYA 4EMEA 3WC7A 4PQAA 4C7IA 4MFKA 1XBUA 2ABZA 4QB9A 3IGRA 1XF8A 4RN7A 2OU2A 2J8RA 3UY5A 1HDUA 2DPSA 2AFZA 3GLJA 1AMPA 3EC4A 2C6PA 4UFWA 4CGPA 2XEJA 4A31A 5HXDA 2ZENA 4NGRA 5LRGA 4R76A 4FD7A 1X10A 3F0AA 5AGEA 1ZLHA 1WK4A 2Z11A 4C7HA 4JLYA 2V8HA 1Y0RA 1CX8A 3JVNA 4NGQA 3A9LA 3LACA 1AUGA 3PB6X 5A28A 2JLMA 3NA6A 2O4HA 4QBJA 3RYOA 1FT7A 3TC8A 1OBRA 1DTDA 3D4UA 1ZG7A 4NGNA 2FXFA 4U9YA 3VARA 1MJAA 3PB9X 2OR4A 4KOYA 4KSAA 3H5ZA 4AXVA 2ZPAA 1M4LA 3SI2A 1XIXA 3DR6A 5F46A 4FWUA 3SI1A 2ZEPA 3PP9A 3R9GA 2PJ0A 1YX0A 3D7GA 4HKFA 3W91A 2GREA 4O23A 4GXHA 1A2ZA 2RB7A 4Q7AA 5LYIA 2P0WA 1QSOA 2REEA 2PC1A 1QSRA 1LAPA 1ARMA 2O53A 4P6YA 3CZXA 4MY0A 2G3AA 2PIZA 3FF3A 2B58A 4CGLA 2OZHA 4EFDA 2Z3OA 2ZOGA 3QNVA 3WABA 3NFZA 5G22A 4Y49C 2C1CA 3FBUA 4UBRA 2Q7SA 1S7LA 2WPXA 7CPAA 3MN8A 4MFLA 2WPWA 3LMSA 4R9MA 1S7FA 1YREA 1LOKA 1Z8TA 1UFHA 2P6GA 2BUEA 2CTBA 1IYLA 2PQ8A 2Q43A 3BHXA 4UCNA 5AG5A 2PJ2A 3TOAA 1IYKA 4CAWA 4R3KA 1Z2LA 1B87A 3FNCA 4IF5A 4AG9A 3BJ8A 4ORFA 5LYLA 2CNTA 1L0CA 3B3WA 1AYEA 3IEHA 1FY7A 5CNPA 1HEEA 2DPTA 2AFSA 2YNCC 4NJRA 4R7MA 5D8NA 3KHZA 4XPLA 3CT9A 4ONWA 5KTDA 4Q38A 4AG7A 4OKOA 2GU2A 5DWMA 5IB0A 5LRKA 2OB0A 3BI0A 3IWWA 4Y49B 4IHMA 2B5GA 1NMTA 3T9YA 5J8FA 1IB1E 5LYDA 2F5IA 4A94A 1UWYA 4UEEA 3FRMA 1XOVA 4B10A 3D3SA 2Z3PA 1MJ9A 2YNCA 1QSTA 3FH4A 4P4FA 5K8PA 2J8NA 3DR8A 3K9TA 3T90A 4XNHB 3SXNA 3DGVA 2FE7A 1ZLIA 4MHNA 2ZW5A 4ZY1A 3L2NA 2CXAA 3PZJA 1QQ9A 2CTCA 2PSWA 2VZYA 4IUSA 4NSQA 2VBQA 4PSXA 4UIBA 4UA3A 3DSBA 2YNDA 4MHPA 3TE4A 4U9ZA 1TF8A 3PBEA 4LQGA 3JTKA 4KLVA 4QVTA 1VKCA 4F8ZA 1LFWA 1YVOA 2IQ6A 2VL1A 4QUSA 1ELMP 4F9VA 4Z65A 3PB7X 3CPXA 4F0XA 4B5OA 4CYQA 4R8FA 3VH9A 3IU1A 4YGOA 4CRZB 1CJWA 1XE4A 2BCOA 1CP6A 2FL4A 5HH1A 4M6GA 1YSJA 1LCPA 1MK4A 1JWQA 1Z9UA 4MMOA 5EC4A 1P4NA 4HNWB 3IWEA 4RI1A 4X5KA 3RO0A 2JEVA 4CAXA 4P10A 4CYOA 3C26A 3GYAA 5JPHA 3I9SA 5CPAA 5THWA 4FD5A 5J1QA 2AJ6A 1EE3P 4YU9A 2EVNA 2POKA 3KKWA 4FUUA 4H6UA 2IJZA 3CXPA 3KI9A 4J3GA 1MJBA 3KASA 2D4PA 2EK8A 4PK2A 4P4BA 1I21A 2QIRA 2V77A 1PUAA 2Z3KA 4DUKA 3GIUA 5DS0A 3FB3A 4E8OA 1Q2YA 2P6FA 5K8NA 5KTCA 1ON0A 4MFQA 3D67A 1NE9A 2Q4ZA 2ZXVA 2A4NA 4WJBA 3W6XA 3SJEA 4CS0B 1NSAA 3FECA 4NGTA 5F48A 2VEZA 4R6TA 4HNYB 1Y9WA 1DE4C 1KUVA 4B5PA 2R7HA 4BBHA 2PRBA 1QMUA 2EK9A 4KVME 3V38A 1ZG9A 4FD4A 1ELLP 4NGMA 4OMEA 4U5YA 3WT4A 2VXKA 4X8IA 1S7KA 1Z8LA 2YGWA 4OADA 3SXOA 4KOTA 4I49A 4MY3A 4B11A 1J4JA 1XJOA 2V8GA 5IB9A 1R57A 2PVVA 4G1PA 4E0AA 4P4JA 5LYFA 1FNOA 3T8WA 2PJCA 3WR7A 4TNUA 2Q4VA 3D2PA 3ISXA 3NE8A 2JDDA 4KSFA 2JDCA 5KTAA 3SJFA 3FX6A 2B4BA 2XEIA 3K2KA 1Y7EA 4OIDA 2PJ1A 5FVJA 4OIWA 3TO9A 4F9UA 3B7IA 4GM5A 1BOBA 3R9FA 3KGQA 2AFMA 2X7BA 4C2YA 3S6HA 3PGPA 2PJBA 2AFUA 1Z8XA 4MHYA 4Q36A
chains in the Genus database with same CATH topology
1XEBA 4MFZA 4JD6A 4AVAA 1BO4A 4JXQA 2Z3MA 4PSWA 4R57A 2K5TA 2Q7BA 2C27A 4F0YA 5AG7A 2Q4YA 2ATRA 2OH1A 5C88A 2B4DA 3EFAA 2BL1A 5I0CA 2KCWA 1U6MA 4KORA 4ZGYB 2ZW4A 4PK3A 4KS9A 4BMHA 3EXNA 4ZBGA 4AB7A 3QB8A 1IIDA 4UFXA 4KOUA 4CGNA 5G20A 2GIVA 2Z0ZA 4CRYB 2B3VA 3ZZIA 2PR8A 4JXRA 4KOVA 3SHPA 4NCZA 4PV6A 5F49A 4CAFA 2FT0A 1VHSA 3EO4A 2GE3A 4H89A 4KVXA 4KUBA 4M85A 2FIWA 1Q2DA 2B5GB 1K4JA 4NEXA 2R1IA 3V8IA 1S7NA 2I00A 1PU9A 2EUIA 3R1KA 4QC6A 1S5KA 4A95A 3LODA 4XPDC 3TT2A 1M4GA 3BJ7A 4UCMA 1YGHA 4K30A 2D4OA 4UFVA 2ZW7A 3DNSA 4C2ZA 3F5BA 3TTHA 5E96A 5IX3A 3W6SA 3F8KA 5AG4A 2NMTA 1OZPA 1B6BA 4JJXA 4KVOE 2G0BA 4ONUA 1QSMA 2DXQA 4CAEA 3G3SA 5JQ4A 4L8AA 3G8WA 1S60A 4MI4A 1KUXA 4JWPA 4NF1A 3H4QA 1IICA 1I12A 4UWJA 4XPKA 2FS5A 2FIAA 4XPDB 3N7ZA 1I1DA 1SQHA 2BSWA 1QSNA 3IU2A 2FSRA 2IL4A 5GCNA 4MHDA 2PDOA 2OZUA 3BLNA 5C82A 3NE7A 2CNSA 4B5PB 3S6FA 2WUUA 2ZW6A 4C2XA 2R8VA 3MGDA 4CAVA 4DNCA 2PR1A 4HNXB 2AE6A 3TO6A 1KZFA 2P6EA 2OZGA 3GKRA 3IWGA 4C68A 5IV0A 2G3TA 2CNMA 3TCVA 4OLLA 4KZTA 3I3GA 4CYNA 4E2AA 2Q0YA 5H86A 4KOXA 2RC4A 1RO5A 3S6KA 1TIQA 3ZJ0A 3R96A 4B13A 4KOSA 3QAHA 4A33A 2Z3NA 1ZO0A 2QMLA 4KLWA 5G1ZA 4OAEA 1KUYA 2YNEA 1Q2CA 4YRHA 2QECA 3P2FA 2Y0MA 3P2HA 3E0KA 3OWCA 2GANA 1Z4EA 2R98A 3FYNA 1WWZA 3LD2A 3FIXA 3R95A 4RS2A 2VZZA 2B4DB 5DWNA 3JUWA 4KOWA 2B3UA 3S6GA 3EY5A 5ISVA 1YK3A 4NXYA 4GS4A 2I79A 4MJ8A 3D2MA 4AVCA 1GHEA 3CXQA 1V0CA 1XMTA 1Y9KA 2H5MA 1YLEA 4L89A 4MFPA 1M1DA 4UCPA 3B8GA 2HQYA 3TO7A 2VQYA 1M44A 1Z4RA 4B14A 5A27A 4A30A 5H84A 1M4DA 1YVKA 2FCKA 4R87A 5J8CA 4FD6A 3VWEA 5BWAB 4B12A 4MBUA 1RXTA 4F6AA 1YR0A 2REFA 4MFJA 5EBVA 4CGMA 4M3SA 2Q04A 3GY9A 4UWIA 3TFYA 2WSAA 3K9UA 4LX9A 4A32A 4YFJA 5G21A 3FXTA 4H6ZA 5HMNA 2O28A 4KUAA 1CM0A 4A2ZA 1Y7RA 1N71A 1LRZA 3D8PA 4R3LA 4AVBA 5AG6A 3CXSA 1P0HA 2ARHA 2J8MA 2Z10A 3VWDA 2VI7A 4CGOA 2HUZA 2CY2A 4CYPA 1M4IA 2HV2A 3TOBA 5F47A 1S3ZA 2BEIA 4II9A 3DDDA 1NSLA 2Z3LA 2Q44A 4LUAA 3R9EA 4EVYA 4C7IA 4MFKA 4QB9A 3IGRA 1XF8A 2OU2A 2J8RA 3UY5A 2DPSA 3EC4A 4UFWA 4CGPA 4A31A 4FD7A 3F0AA 5AGEA 1WK4A 2Z11A 4C7HA 4JLYA 3JVNA 5A28A 3A9LA 2JLMA 4QBJA 3RYOA 2FXFA 4U9YA 1MJAA 4KOYA 4KSAA 3H5ZA 2ZPAA 1XIXA 3DR6A 5F46A 3PP9A 3R9GA 1YX0A 4HKFA 3W91A 2P0WA 1QSOA 2REEA 2PC1A 1QSRA 4MY0A 2G3AA 2B58A 4CGLA 2OZHA 2Z3OA 5G22A 4Y49C 3FBUA 4UBRA 1S7LA 2WPXA 4MFLA 2WPWA 4R9MA 1S7FA 1YREA 4XNHC 1UFHA 2P6GA 2BUEA 2PQ8A 1IYLA 4UCNA 5AG5A 3TOAA 1IYKA 4CAWA 4R3KA 3FNCA 4IF5A 1B87A 4AG9A 3BJ8A 4ORFA 2CNTA 1L0CA 1FY7A 5CNPA 2DPTA 2YNCC 4XPLA 5KTDA 4Q38A 4AG7A 5IB0A 5DWMA 2OB0A 4Y49B 2B5GA 1NMTA 3T9YA 5J8FA 1IB1E 2F5IA 3FRMA 4B10A 3D3SA 2Z3PA 1MJ9A 2YNCA 1QSTA 2J8NA 3DR8A 3T90A 4XNHB 3SXNA 2FE7A 2ZW5A 2CXAA 3PZJA 2PSWA 2VZYA 4IUSA 4NSQA 2VBQA 4PSXA 4UA3A 3DSBA 2YNDA 3TE4A 4U9ZA 3JTKA 4KLVA 4QVTA 1VKCA 1YVOA 4QUSA 4F0XA 4B5OA 4CYQA 3IU1A 4YGOA 4CRZB 1CJWA 1XE4A 2FL4A 5HH1A 1MK4A 1Z9UA 5EC4A 1P4NA 4HNWB 3IWEA 4RI1A 4X5KA 2JEVA 4CAXA 4CYOA 3C26A 3GYAA 5JPHA 3I9SA 4FD5A 2AJ6A 2EVNA 3KKWA 4H6UA 3CXPA 4J3GA 1MJBA 2D4PA 4PK2A 1I21A 2QIRA 2Z3KA 1PUAA 4E8OA 3FB3A 5KTCA 1Q2YA 2P6FA 1ON0A 4MFQA 1NE9A 2ZXVA 2A4NA 3W6XA 4CS0B 5F48A 2VEZA 4HNYB 1Y9WA 1KUVA 4B5PA 2R7HA 4BBHA 2PRBA 4KVME 4FD4A 4U5YA 2VXKA 1S7KA 2YGWA 4OADA 3SXOA 4KOTA 4I49A 4MY3A 4B11A 1J4JA 1R57A 4E0AA 3WR7A 2Q4VA 3D2PA 2JDDA 4KSFA 2JDCA 5KTAA 2B4BA 5FVJA 3TO9A 1BOBA 3R9FA 4C2YA 2X7BA 3S6HA 3PGPA 4Q36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEB A;  4JD6 A;  4AVA A;  1BO4 A;  4JXQ A;  4PSW A;  4R57 A;  2K5T A;  2Q7B A;  2C27 A;  4F0Y A;  2Q4Y A;  2ATR A;  2OH1 A;  5C88 A;  2B4D A;  3EFA A;  2BL1 A;  5I0C A;  2KCW A;  1U6M A;  4KOR A;  2ZW4 A;  4PK3 A;  4BMH A;  3EXN A;  4ZBG A;  4AB7 A;  3QB8 A;  1IID A;  4KOU A;  2GIV A;  2Z0Z A;  4CRY B;  2B3V A;  3ZZI A;  2PR8 A;  4JXR A;  4KOV A;  3SHP A;  4NCZ A;  4PV6 A;  5F49 A;  2FT0 A;  1VHS A;  3EO4 A;  2GE3 A;  4H89 A;  4KVX A;  4KUB A;  4M85 A;  2FIW A;  1Q2D A;  2B5G B;  1K4J A;  4NEX A;  2R1I A;  3V8I A;  1S7N A;  2I00 A;  1PU9 A;  2EUI A;  3R1K A;  4QC6 A;  1S5K A;  3LOD A;  4XPD C;  3TT2 A;  1M4G A;  3BJ7 A;  1YGH A;  4K30 A;  2D4O A;  2ZW7 A;  3DNS A;  3F5B A;  3TTH A;  5E96 A;  5IX3 A;  3W6S A;  3F8K A;  2NMT A;  1OZP A;  1B6B A;  4JJX A;  4KVO E;  2G0B A;  4ONU A;  1QSM A;  2DXQ A;  3G3S A;  5JQ4 A;  4L8A A;  3G8W A;  1S60 A;  4MI4 A;  1KUX A;  4JWP A;  4NF1 A;  3H4Q A;  1IIC A;  1I12 A;  4UWJ A;  4XPK A;  2FS5 A;  2FIA A;  4XPD B;  3N7Z A;  1I1D A;  1SQH A;  2BSW A;  1QSN A;  2FSR A;  2IL4 A;  5GCN A;  4MHD A;  2PDO A;  2OZU A;  3BLN A;  5C82 A;  3NE7 A;  2CNS A;  4B5P B;  3S6F A;  2ZW6 A;  2R8V A;  3MGD A;  4CAV A;  4DNC A;  2PR1 A;  4HNX B;  2AE6 A;  3TO6 A;  1KZF A;  2P6E A;  2OZG A;  3GKR A;  3IWG A;  5IV0 A;  2G3T A;  2CNM A;  3TCV A;  4OLL A;  4KZT A;  3I3G A;  4E2A A;  2Q0Y A;  5H86 A;  4KOX A;  2RC4 A;  1RO5 A;  3S6K A;  1TIQ A;  3ZJ0 A;  3R96 A;  4KOS A;  3QAH A;  2QML A;  4KLW A;  4OAE A;  1KUY A;  1Q2C A;  4YRH A;  2QEC A;  3P2F A;  2Y0M A;  3P2H A;  3E0K A;  3OWC A;  2GAN A;  1Z4E A;  2R98 A;  3FYN A;  1WWZ A;  3LD2 A;  3FIX A;  3R95 A;  4RS2 A;  2VZZ A;  2B4D B;  5DWN A;  3JUW A;  4KOW A;  2B3U A;  3S6G A;  3EY5 A;  5ISV A;  1YK3 A;  4NXY A;  4GS4 A;  2I79 A;  4MJ8 A;  3D2M A;  4AVC A;  1GHE A;  3CXQ A;  1V0C A;  1XMT A;  1Y9K A;  2H5M A;  1YLE A;  4L89 A;  1M1D A;  3B8G A;  2HQY A;  3TO7 A;  2VQY A;  1M44 A;  1Z4R A;  5H84 A;  1M4D A;  1YVK A;  2FCK A;  4R87 A;  5J8C A;  4FD6 A;  3VWE A;  4MBU A;  1RXT A;  4F6A A;  1YR0 A;  2REF A;  5EBV A;  4M3S A;  2Q04 A;  3GY9 A;  4UWI A;  3TFY A;  3K9U A;  4LX9 A;  4YFJ A;  3FXT A;  4H6Z A;  5HMN A;  2O28 A;  4KUA A;  1CM0 A;  1Y7R A;  1N71 A;  1LRZ A;  3D8P A;  4R3L A;  4AVB A;  3CXS A;  1P0H A;  2ARH A;  2J8M A;  2Z10 A;  3VWD A;  2VI7 A;  2HUZ A;  2CY2 A;  1M4I A;  2HV2 A;  3TOB A;  5F47 A;  1S3Z A;  2BEI A;  4II9 A;  3DDD A;  1NSL A;  2Q44 A;  4LUA A;  3R9E A;  4EVY A;  4QB9 A;  3IGR A;  1XF8 A;  2OU2 A;  2J8R A;  3UY5 A;  3EC4 A;  4FD7 A;  3F0A A;  1WK4 A;  2Z11 A;  4JLY A;  3JVN A;  2JLM A;  4QBJ A;  3RYO A;  2FXF A;  4U9Y A;  1MJA A;  4KOY A;  2ZPA A;  1XIX A;  3DR6 A;  5F46 A;  3PP9 A;  3R9G A;  1YX0 A;  4HKF A;  3W91 A;  2P0W A;  1QSO A;  2REE A;  2PC1 A;  1QSR A;  4MY0 A;  2G3A A;  2B58 A;  2OZH A;  4Y49 C;  3FBU A;  4UBR A;  1S7L A;  2WPX A;  2WPW A;  4R9M A;  1S7F A;  1YRE A;  4XNH C;  1UFH A;  2P6G A;  2BUE A;  2PQ8 A;  1IYL A;  3TOA A;  1IYK A;  4CAW A;  4R3K A;  3FNC A;  4IF5 A;  1B87 A;  4AG9 A;  3BJ8 A;  4ORF A;  2CNT A;  1L0C A;  1FY7 A;  5CNP A;  4XPL A;  5KTD A;  4AG7 A;  5IB0 A;  5DWM A;  2OB0 A;  4Y49 B;  2B5G A;  1NMT A;  3T9Y A;  5J8F A;  1IB1 E;  2F5I A;  3FRM A;  3D3S A;  1MJ9 A;  1QST A;  2J8N A;  3DR8 A;  3T90 A;  4XNH B;  3SXN A;  2FE7 A;  2ZW5 A;  3PZJ A;  2PSW A;  2VZY A;  4IUS A;  4NSQ A;  2VBQ A;  4PSX A;  4UA3 A;  3DSB A;  3TE4 A;  4U9Z A;  4KLV A;  4QVT A;  1VKC A;  1YVO A;  4QUS A;  4B5O A;  4YGO A;  4CRZ B;  1CJW A;  1XE4 A;  2FL4 A;  5HH1 A;  1MK4 A;  1Z9U A;  5EC4 A;  1P4N A;  4HNW B;  4RI1 A;  4X5K A;  2JEV A;  4CAX A;  5JPH A;  3C26 A;  3GYA A;  3I9S A;  4FD5 A;  2AJ6 A;  2EVN A;  3KKW A;  4H6U A;  3CXP A;  4J3G A;  1MJB A;  2D4P A;  4PK2 A;  1I21 A;  2QIR A;  4E8O A;  1PUA A;  3FB3 A;  5KTC A;  1Q2Y A;  2P6F A;  1ON0 A;  1NE9 A;  2ZXV A;  2A4N A;  3W6X A;  4CS0 B;  5F48 A;  2VEZ A;  4HNY B;  1Y9W A;  1KUV A;  4B5P A;  2R7H A;  2PRB A;  4KVM E;  4FD4 A;  4U5Y A;  2VXK A;  1S7K A;  4OAD A;  3SXO A;  4KOT A;  4I49 A;  4MY3 A;  1J4J A;  1R57 A;  4E0A A;  3WR7 A;  2Q4V A;  3D2P A;  2JDD A;  2JDC A;  5KTA A;  2B4B A;  5FVJ A;  3TO9 A;  1BOB A;  3R9F A;  2X7B A;  3S6H A;  3PGP A; 
#chains in the Genus database with same CATH topology
 1XEB A;  5HVH A;  4MFZ A;  4JD6 A;  4AVA A;  1CPX A;  1VHO A;  3NH8 A;  1BO4 A;  4JXQ A;  2Z3M A;  1Y0Y A;  4PSW A;  4R57 A;  1YME A;  2G9D A;  3D68 A;  4LQ6 A;  1F57 A;  2K5T A;  1BPN A;  2Q7B A;  3S9M A;  3WC6 A;  3D7F A;  2C27 A;  4F0Y A;  5AG7 A;  2Q4Y A;  4A38 A;  2ATR A;  3HLP A;  2JBJ A;  2OH1 A;  4MCS A;  4DYO A;  3FED A;  2C6C A;  5C88 A;  4M6I A;  4JZ0 A;  2B4D A;  2JEW A;  4CPA A;  3EFA A;  3PEI A;  2QYV A;  2BL1 A;  4PXB A;  4PPZ A;  2ODF A;  5I0C A;  2PE3 A;  1RTQ A;  2KCW A;  1BPM A;  1U6M A;  3KHX A;  4KOR A;  2ZW4 A;  4PK3 A;  4ZGY B;  3S9N A;  4KS9 A;  1Z8W A;  4BMH A;  3EXN A;  4M6H A;  4NJQ A;  4ZBG A;  4AB7 A;  4ZX9 A;  2NSM A;  1YW6 A;  3QB8 A;  1IID A;  4UFX A;  5F09 A;  4KOU A;  3B3C A;  5EMI A;  4CGN A;  5G20 A;  2GIV A;  2Z0Z A;  2I3C A;  5D29 A;  4OC3 A;  2ZEH A;  2B3V A;  2Q51 A;  4CRY B;  3ZZI A;  2PR8 A;  3NH4 A;  1ZG8 A;  4H2K A;  4DJL A;  4JXR A;  4OC0 A;  1IGB A;  4KOV A;  3SHP A;  4NCZ A;  2BO9 A;  4PV6 A;  5F49 A;  4CAF A;  3CPA A;  2FT0 A;  1VHS A;  3EO4 A;  2PJ4 A;  3D66 A;  2GE3 A;  3B3V A;  4H89 A;  2DF5 A;  2CIJ A;  4KVX A;  4KUB A;  4M85 A;  1BAV A;  3H8F A;  5JM6 A;  3IIB A;  5HVG A;  2FIW A;  1Q2D A;  3BXM A;  2B5G B;  4MCQ A;  1K4J A;  4NEX A;  2R1I A;  3PB8 X;  3V8I A;  1S7N A;  3I1U A;  4YWY A;  1LAM A;  2I00 A;  1PU9 A;  5LRJ A;  2V8D A;  1TKF A;  2EUI A;  3R1K A;  4QC6 A;  1S5K A;  4A95 A;  1Q7L A;  3PBB A;  5CBM A;  3LOD A;  4XPD C;  4MCP A;  3TT2 A;  1M4G A;  3BJ7 A;  1X12 A;  3H8G A;  4NGS A;  4UCM A;  1YGH A;  4K30 A;  4RUH A;  2D4O A;  4UFV A;  2ZW7 A;  3DNS A;  4C2Z A;  3S9L A;  1HDQ A;  3B3T A;  3F5B A;  3KR4 A;  3TTH A;  4KSI A;  5E96 A;  5IX3 A;  3KR5 A;  3W6S A;  3KZW A;  3F8K A;  4P4E A;  5AG4 A;  2NYQ A;  3HUV A;  1TXR A;  2NMT A;  4EWT A;  2F7V A;  4X3R A;  1OZP A;  1B6B A;  4JJX A;  4KVO E;  2G0B A;  4ONU A;  1QSM A;  3SI0 A;  2DXQ A;  2PJA A;  4IAV A;  4CAE A;  3G3S A;  4ZYQ A;  1XRY A;  5JQ4 A;  1CBX A;  4L8A A;  3G8W A;  1S60 A;  2V8V A;  1KUX A;  4MI4 A;  1IU8 A;  4MXU A;  4JWP A;  4NF1 A;  2ZOF A;  3IJ3 A;  2DEA A;  4ZX8 A;  3H4Q A;  1IIC A;  4JYW A;  1I12 A;  4UWJ A;  1VGY A;  4XPK A;  2FS5 A;  2IMO A;  1H8L A;  2FIA A;  1PCA A;  4P44 A;  4XPD B;  3RNZ A;  3N7Z A;  2ZEO A;  1I1D A;  1SQH A;  2AFO A;  2BSW A;  1IY7 A;  1QSN A;  3IU2 A;  2GFQ A;  2FSR A;  2IL4 A;  4BD9 A;  3KQZ A;  5GCN A;  3N5F A;  3SJX A;  4MHD A;  4NFR A;  5HVF A;  3V7Z A;  4ZI6 A;  2PDO A;  2HC9 A;  2OZU A;  3PFE A;  3BLN A;  2PJ3 A;  5C82 A;  3NE7 A;  3TX8 A;  2HB6 A;  3ISZ A;  2EWB A;  5JH9 A;  2CNS A;  4B5P B;  3S6F A;  2WUU A;  2ZW6 A;  4C2X A;  2R8V A;  3MGD A;  4MRI A;  4PXD A;  4CAV A;  4DNC A;  2PR1 A;  4FBE A;  4B6Z A;  4HNX B;  2AE6 A;  3TO6 A;  1KZF A;  3NH5 A;  2P6E A;  2OZG A;  3GUX A;  4XNH C;  1VHE A;  3GKR A;  3IWG A;  4C68 A;  5IV0 A;  3FEE A;  2G3T A;  2CNM A;  3TCV A;  4ZY0 A;  4OLL A;  4KZT A;  1ARL A;  2QVP A;  3I3G A;  2RFH A;  3B35 A;  4CYN A;  2Q0Y A;  4E2A A;  4WWV A;  5H86 A;  4W9Y A;  2ZEM A;  2PJ6 A;  2RC4 A;  1RO5 A;  3IC1 A;  1TIQ A;  3QAY A;  4KOX A;  3RAM A;  3S6K A;  3R96 A;  3ZJ0 A;  4KOS A;  4A37 A;  4B13 A;  3QAH A;  2C6G A;  4A33 A;  2Z3N A;  1ZO0 A;  4OP4 A;  1IOF A;  2QML A;  4OC1 A;  4KLW A;  5G1Z A;  3DLJ A;  4BIN A;  4OAE A;  2PIY A;  4PXE A;  1KUY A;  2ZEL A;  3IO1 A;  2YNE A;  1Q2C A;  4UF4 A;  4X2T A;  4YRH A;  5ELY A;  2QEC A;  3P2F A;  2PJ9 A;  2Y0M A;  3P2H A;  3PFO A;  3E0K A;  3OWC A;  1PYT B;  4PXC A;  2ZEF A;  3D7H A;  1CP7 A;  2GAN A;  1Z4E A;  2R98 A;  3FYN A;  3RZA A;  2PJ5 A;  1WWZ A;  3LD2 A;  2EO8 A;  3FIX A;  3IFE A;  4NGP A;  3B3S A;  3R95 A;  2GLF A;  1IOI A;  4RS2 A;  2VZZ A;  2B4D B;  2PJ8 A;  5DWN A;  2PRQ A;  3JUW A;  4KOW A;  2B3U A;  3S6G A;  1TF9 A;  3EY5 A;  1LAN A;  6CPA A;  3KQX A;  2QJ8 A;  5ISV A;  1YK3 A;  2ZEG A;  2CF4 A;  4OC5 A;  4NXY A;  4GS4 A;  2I79 A;  2GLJ A;  2PVW A;  4MJ8 A;  3D2M A;  4AVC A;  1GHE A;  1F2O A;  3CXQ A;  3VAT A;  1V0C A;  1XMT A;  1YW4 A;  1Y9K A;  1YQE A;  1YLE A;  2H5M A;  4L89 A;  4MFP A;  4A39 A;  1M1D A;  4UCP A;  3B8G A;  1XFO A;  2HQY A;  3RBU A;  5K8M A;  3TO7 A;  4FAI A;  2AFW A;  1TKJ A;  2VQY A;  3JRU A;  1GYT A;  1M44 A;  1XMB A;  1Z4R A;  3SJG A;  4B14 A;  5A27 A;  5K8O A;  2XEG A;  3LWU A;  4A30 A;  1R43 A;  4UIA A;  2ANP A;  5H84 A;  1M4D A;  4OC2 A;  1YVK A;  2FCK A;  4R87 A;  3BI1 A;  2WZN A;  1R3N A;  3WC5 A;  5J8C A;  2ZEE A;  4FD6 A;  3VWE A;  2AFX A;  5BWA B;  4B12 A;  4MBU A;  1RXT A;  1VIX A;  4F6A A;  2J9A A;  1YR0 A;  2REF A;  2WYR A;  2PCU A;  4MFJ A;  5EBV A;  4MHZ A;  4CGM A;  4M3S A;  2Q04 A;  1Z5R A;  3GY9 A;  4UWI A;  3TFY A;  4ZY2 A;  2WSA A;  3K9U A;  3KL9 A;  4LX9 A;  4K3N A;  4A32 A;  4TWE A;  4YFJ A;  5G21 A;  3FXT A;  2XEF A;  4H6Z A;  5HMN A;  3FJU A;  1TKH A;  2O28 A;  1CM0 A;  3MRU A;  3D7D A;  1Y7R A;  4KUA A;  1N71 A;  1JQG A;  1LRZ A;  3D8P A;  4R3L A;  4A2Z A;  5AG6 A;  4AVB A;  2BOA A;  2EBJ A;  5I4M A;  3CXS A;  1BLL E;  1P0H A;  2ARH A;  3FMC A;  4MCR A;  4HPS A;  3B2Y A;  3PB4 X;  2ZED A;  2J8M A;  2Z10 A;  3VWD A;  1CPS A;  2VI7 A;  3GB0 A;  4CGO A;  3PRT A;  8CPA A;  2HUZ A;  2CY2 A;  4UEZ A;  4CYP A;  1M4I A;  2HV2 A;  3TOB A;  5F47 A;  1S3Z A;  3H8E A;  2FVG A;  2PJ7 A;  3FVL A;  2BEI A;  1YLO A;  4UEF A;  2F8H A;  4P4I A;  4II9 A;  3CDX A;  3DDD A;  4OC4 A;  1NSL A;  2Z3L A;  2OOT A;  4IK2 A;  1F2P A;  2Q44 A;  4LUA A;  4P4D A;  3R9E A;  1CG2 A;  1KWM A;  2JBK A;  4P45 A;  5JGF A;  4EVY A;  4EME A;  3WC7 A;  4PQA A;  4C7I A;  4MFK A;  1XBU A;  2ABZ A;  4QB9 A;  3IGR A;  1XF8 A;  4RN7 A;  2OU2 A;  2J8R A;  3UY5 A;  1HDU A;  2DPS A;  2AFZ A;  3GLJ A;  1AMP A;  3EC4 A;  2C6P A;  4UFW A;  4CGP A;  2XEJ A;  4A31 A;  5HXD A;  2ZEN A;  4NGR A;  5LRG A;  4R76 A;  4FD7 A;  1X10 A;  3F0A A;  5AGE A;  1ZLH A;  1WK4 A;  2Z11 A;  4C7H A;  4JLY A;  2V8H A;  1Y0R A;  1CX8 A;  3JVN A;  4NGQ A;  3A9L A;  3LAC A;  1AUG A;  3PB6 X;  5A28 A;  2JLM A;  3NA6 A;  2O4H A;  4QBJ A;  3RYO A;  1FT7 A;  3TC8 A;  1OBR A;  1DTD A;  3D4U A;  1ZG7 A;  4NGN A;  2FXF A;  4U9Y A;  3VAR A;  1MJA A;  3PB9 X;  2OR4 A;  4KOY A;  4KSA A;  3H5Z A;  4AXV A;  2ZPA A;  1M4L A;  3SI2 A;  1XIX A;  3DR6 A;  5F46 A;  4FWU A;  3SI1 A;  2ZEP A;  3PP9 A;  3R9G A;  2PJ0 A;  1YX0 A;  3D7G A;  4HKF A;  3W91 A;  2GRE A;  4O23 A;  4GXH A;  1A2Z A;  2RB7 A;  4Q7A A;  5LYI A;  2P0W A;  1QSO A;  2REE A;  2PC1 A;  1QSR A;  1LAP A;  1ARM A;  2O53 A;  4P6Y A;  3CZX A;  4MY0 A;  2G3A A;  2PIZ A;  3FF3 A;  2B58 A;  4CGL A;  2OZH A;  4EFD A;  2Z3O A;  2ZOG A;  3QNV A;  3WAB A;  3NFZ A;  5G22 A;  4Y49 C;  2C1C A;  3FBU A;  4UBR A;  2Q7S A;  1S7L A;  2WPX A;  7CPA A;  3MN8 A;  4MFL A;  2WPW A;  3LMS A;  4R9M A;  1S7F A;  1YRE A;  1LOK A;  1Z8T A;  1UFH A;  2P6G A;  2BUE A;  2CTB A;  1IYL A;  2PQ8 A;  2Q43 A;  3BHX A;  4UCN A;  5AG5 A;  2PJ2 A;  3TOA A;  1IYK A;  4CAW A;  4R3K A;  1Z2L A;  1B87 A;  3FNC A;  4IF5 A;  4AG9 A;  3BJ8 A;  4ORF A;  5LYL A;  2CNT A;  1L0C A;  3B3W A;  1AYE A;  3IEH A;  1FY7 A;  5CNP A;  1HEE A;  2DPT A;  2AFS A;  2YNC C;  4NJR A;  4R7M A;  5D8N A;  3KHZ A;  4XPL A;  3CT9 A;  4ONW A;  5KTD A;  4Q38 A;  4AG7 A;  4OKO A;  2GU2 A;  5DWM A;  5IB0 A;  5LRK A;  2OB0 A;  3BI0 A;  3IWW A;  4Y49 B;  4IHM A;  2B5G A;  1NMT A;  3T9Y A;  5J8F A;  1IB1 E;  5LYD A;  2F5I A;  4A94 A;  1UWY A;  4UEE A;  3FRM A;  1XOV A;  4B10 A;  3D3S A;  2Z3P A;  1MJ9 A;  2YNC A;  1QST A;  3FH4 A;  4P4F A;  5K8P A;  2J8N A;  3DR8 A;  3K9T A;  3T90 A;  4XNH B;  3SXN A;  3DGV A;  2FE7 A;  1ZLI A;  4MHN A;  2ZW5 A;  4ZY1 A;  3L2N A;  2CXA A;  3PZJ A;  1QQ9 A;  2CTC A;  2PSW A;  2VZY A;  4IUS A;  4NSQ A;  2VBQ A;  4PSX A;  4UIB A;  4UA3 A;  3DSB A;  2YND A;  4MHP A;  3TE4 A;  4U9Z A;  1TF8 A;  3PBE A;  4LQG A;  3JTK A;  4KLV A;  4QVT A;  1VKC A;  4F8Z A;  1LFW A;  1YVO A;  2IQ6 A;  2VL1 A;  4QUS A;  1ELM P;  4F9V A;  4Z65 A;  3PB7 X;  3CPX A;  4F0X A;  4B5O A;  4CYQ A;  4R8F A;  3VH9 A;  3IU1 A;  4YGO A;  4CRZ B;  1CJW A;  1XE4 A;  2BCO A;  1CP6 A;  2FL4 A;  5HH1 A;  4M6G A;  1YSJ A;  1LCP A;  1MK4 A;  1JWQ A;  1Z9U A;  4MMO A;  5EC4 A;  1P4N A;  4HNW B;  3IWE A;  4RI1 A;  4X5K A;  3RO0 A;  2JEV A;  4CAX A;  4P10 A;  4CYO A;  3C26 A;  3GYA A;  5JPH A;  3I9S A;  5CPA A;  5THW A;  4FD5 A;  5J1Q A;  2AJ6 A;  1EE3 P;  4YU9 A;  2EVN A;  2POK A;  3KKW A;  4FUU A;  4H6U A;  2IJZ A;  3CXP A;  3KI9 A;  4J3G A;  1MJB A;  3KAS A;  2D4P A;  2EK8 A;  4PK2 A;  4P4B A;  1I21 A;  2QIR A;  2V77 A;  1PUA A;  2Z3K A;  4DUK A;  3GIU A;  5DS0 A;  3FB3 A;  4E8O A;  1Q2Y A;  2P6F A;  5K8N A;  5KTC A;  1ON0 A;  4MFQ A;  3D67 A;  1NE9 A;  2Q4Z A;  2ZXV A;  2A4N A;  4WJB A;  3W6X A;  3SJE A;  4CS0 B;  1NSA A;  3FEC A;  4NGT A;  5F48 A;  2VEZ A;  4R6T A;  4HNY B;  1Y9W A;  1DE4 C;  1KUV A;  4B5P A;  2R7H A;  4BBH A;  2PRB A;  1QMU A;  2EK9 A;  4KVM E;  3V38 A;  1ZG9 A;  4FD4 A;  1ELL P;  4NGM A;  4OME A;  4U5Y A;  3WT4 A;  2VXK A;  4X8I A;  1S7K A;  1Z8L A;  2YGW A;  4OAD A;  3SXO A;  4KOT A;  4I49 A;  4MY3 A;  4B11 A;  1J4J A;  1XJO A;  2V8G A;  5IB9 A;  1R57 A;  2PVV A;  4G1P A;  4E0A A;  4P4J A;  5LYF A;  1FNO A;  3T8W A;  2PJC A;  3WR7 A;  4TNU A;  2Q4V A;  3D2P A;  3ISX A;  3NE8 A;  2JDD A;  4KSF A;  2JDC A;  5KTA A;  3SJF A;  3FX6 A;  2B4B A;  2XEI A;  3K2K A;  1Y7E A;  4OID A;  2PJ1 A;  5FVJ A;  4OIW A;  3TO9 A;  4F9U A;  3B7I A;  4GM5 A;  1BOB A;  3R9F A;  3KGQ A;  2AFM A;  2X7B A;  4C2Y A;  3S6H A;  3PGP A;  2PJB A;  2AFU A;  1Z8X A;  4MHY A;  4Q36 A; 
#chains in the Genus database with same CATH homology
 1XEB A;  4MFZ A;  4JD6 A;  4AVA A;  1BO4 A;  4JXQ A;  2Z3M A;  4PSW A;  4R57 A;  2K5T A;  2Q7B A;  2C27 A;  4F0Y A;  5AG7 A;  2Q4Y A;  2ATR A;  2OH1 A;  5C88 A;  2B4D A;  3EFA A;  2BL1 A;  5I0C A;  2KCW A;  1U6M A;  4KOR A;  4ZGY B;  2ZW4 A;  4PK3 A;  4KS9 A;  4BMH A;  3EXN A;  4ZBG A;  4AB7 A;  3QB8 A;  1IID A;  4UFX A;  4KOU A;  4CGN A;  5G20 A;  2GIV A;  2Z0Z A;  4CRY B;  2B3V A;  3ZZI A;  2PR8 A;  4JXR A;  4KOV A;  3SHP A;  4NCZ A;  4PV6 A;  5F49 A;  4CAF A;  2FT0 A;  1VHS A;  3EO4 A;  2GE3 A;  4H89 A;  4KVX A;  4KUB A;  4M85 A;  2FIW A;  1Q2D A;  2B5G B;  1K4J A;  4NEX A;  2R1I A;  3V8I A;  1S7N A;  2I00 A;  1PU9 A;  2EUI A;  3R1K A;  4QC6 A;  1S5K A;  4A95 A;  3LOD A;  4XPD C;  3TT2 A;  1M4G A;  3BJ7 A;  4UCM A;  1YGH A;  4K30 A;  2D4O A;  4UFV A;  2ZW7 A;  3DNS A;  4C2Z A;  3F5B A;  3TTH A;  5E96 A;  5IX3 A;  3W6S A;  3F8K A;  5AG4 A;  2NMT A;  1OZP A;  1B6B A;  4JJX A;  4KVO E;  2G0B A;  4ONU A;  1QSM A;  2DXQ A;  4CAE A;  3G3S A;  5JQ4 A;  4L8A A;  3G8W A;  1S60 A;  4MI4 A;  1KUX A;  4JWP A;  4NF1 A;  3H4Q A;  1IIC A;  1I12 A;  4UWJ A;  4XPK A;  2FS5 A;  2FIA A;  4XPD B;  3N7Z A;  1I1D A;  1SQH A;  2BSW A;  1QSN A;  3IU2 A;  2FSR A;  2IL4 A;  5GCN A;  4MHD A;  2PDO A;  2OZU A;  3BLN A;  5C82 A;  3NE7 A;  2CNS A;  4B5P B;  3S6F A;  2WUU A;  2ZW6 A;  4C2X A;  2R8V A;  3MGD A;  4CAV A;  4DNC A;  2PR1 A;  4HNX B;  2AE6 A;  3TO6 A;  1KZF A;  2P6E A;  2OZG A;  3GKR A;  3IWG A;  4C68 A;  5IV0 A;  2G3T A;  2CNM A;  3TCV A;  4OLL A;  4KZT A;  3I3G A;  4CYN A;  4E2A A;  2Q0Y A;  5H86 A;  4KOX A;  2RC4 A;  1RO5 A;  3S6K A;  1TIQ A;  3ZJ0 A;  3R96 A;  4B13 A;  4KOS A;  3QAH A;  4A33 A;  2Z3N A;  1ZO0 A;  2QML A;  4KLW A;  5G1Z A;  4OAE A;  1KUY A;  2YNE A;  1Q2C A;  4YRH A;  2QEC A;  3P2F A;  2Y0M A;  3P2H A;  3E0K A;  3OWC A;  2GAN A;  1Z4E A;  2R98 A;  3FYN A;  1WWZ A;  3LD2 A;  3FIX A;  3R95 A;  4RS2 A;  2VZZ A;  2B4D B;  5DWN A;  3JUW A;  4KOW A;  2B3U A;  3S6G A;  3EY5 A;  5ISV A;  1YK3 A;  4NXY A;  4GS4 A;  2I79 A;  4MJ8 A;  3D2M A;  4AVC A;  1GHE A;  3CXQ A;  1V0C A;  1XMT A;  1Y9K A;  2H5M A;  1YLE A;  4L89 A;  4MFP A;  1M1D A;  4UCP A;  3B8G A;  2HQY A;  3TO7 A;  2VQY A;  1M44 A;  1Z4R A;  4B14 A;  5A27 A;  4A30 A;  5H84 A;  1M4D A;  1YVK A;  2FCK A;  4R87 A;  5J8C A;  4FD6 A;  3VWE A;  5BWA B;  4B12 A;  4MBU A;  1RXT A;  4F6A A;  1YR0 A;  2REF A;  4MFJ A;  5EBV A;  4CGM A;  4M3S A;  2Q04 A;  3GY9 A;  4UWI A;  3TFY A;  2WSA A;  3K9U A;  4LX9 A;  4A32 A;  4YFJ A;  5G21 A;  3FXT A;  4H6Z A;  5HMN A;  2O28 A;  4KUA A;  1CM0 A;  4A2Z A;  1Y7R A;  1N71 A;  1LRZ A;  3D8P A;  4R3L A;  4AVB A;  5AG6 A;  3CXS A;  1P0H A;  2ARH A;  2J8M A;  2Z10 A;  3VWD A;  2VI7 A;  4CGO A;  2HUZ A;  2CY2 A;  4CYP A;  1M4I A;  2HV2 A;  3TOB A;  5F47 A;  1S3Z A;  2BEI A;  4II9 A;  3DDD A;  1NSL A;  2Z3L A;  2Q44 A;  4LUA A;  3R9E A;  4EVY A;  4C7I A;  4MFK A;  4QB9 A;  3IGR A;  1XF8 A;  2OU2 A;  2J8R A;  3UY5 A;  2DPS A;  3EC4 A;  4UFW A;  4CGP A;  4A31 A;  4FD7 A;  3F0A A;  5AGE A;  1WK4 A;  2Z11 A;  4C7H A;  4JLY A;  3JVN A;  5A28 A;  3A9L A;  2JLM A;  4QBJ A;  3RYO A;  2FXF A;  4U9Y A;  1MJA A;  4KOY A;  4KSA A;  3H5Z A;  2ZPA A;  1XIX A;  3DR6 A;  5F46 A;  3PP9 A;  3R9G A;  1YX0 A;  4HKF A;  3W91 A;  2P0W A;  1QSO A;  2REE A;  2PC1 A;  1QSR A;  4MY0 A;  2G3A A;  2B58 A;  4CGL A;  2OZH A;  2Z3O A;  5G22 A;  4Y49 C;  3FBU A;  4UBR A;  1S7L A;  2WPX A;  4MFL A;  2WPW A;  4R9M A;  1S7F A;  1YRE A;  4XNH C;  1UFH A;  2P6G A;  2BUE A;  2PQ8 A;  1IYL A;  4UCN A;  5AG5 A;  3TOA A;  1IYK A;  4CAW A;  4R3K A;  3FNC A;  4IF5 A;  1B87 A;  4AG9 A;  3BJ8 A;  4ORF A;  2CNT A;  1L0C A;  1FY7 A;  5CNP A;  2DPT A;  2YNC C;  4XPL A;  5KTD A;  4Q38 A;  4AG7 A;  5IB0 A;  5DWM A;  2OB0 A;  4Y49 B;  2B5G A;  1NMT A;  3T9Y A;  5J8F A;  1IB1 E;  2F5I A;  3FRM A;  4B10 A;  3D3S A;  2Z3P A;  1MJ9 A;  2YNC A;  1QST A;  2J8N A;  3DR8 A;  3T90 A;  4XNH B;  3SXN A;  2FE7 A;  2ZW5 A;  2CXA A;  3PZJ A;  2PSW A;  2VZY A;  4IUS A;  4NSQ A;  2VBQ A;  4PSX A;  4UA3 A;  3DSB A;  2YND A;  3TE4 A;  4U9Z A;  3JTK A;  4KLV A;  4QVT A;  1VKC A;  1YVO A;  4QUS A;  4F0X A;  4B5O A;  4CYQ A;  3IU1 A;  4YGO A;  4CRZ B;  1CJW A;  1XE4 A;  2FL4 A;  5HH1 A;  1MK4 A;  1Z9U A;  5EC4 A;  1P4N A;  4HNW B;  3IWE A;  4RI1 A;  4X5K A;  2JEV A;  4CAX A;  4CYO A;  3C26 A;  3GYA A;  5JPH A;  3I9S A;  4FD5 A;  2AJ6 A;  2EVN A;  3KKW A;  4H6U A;  3CXP A;  4J3G A;  1MJB A;  2D4P A;  4PK2 A;  1I21 A;  2QIR A;  2Z3K A;  1PUA A;  4E8O A;  3FB3 A;  5KTC A;  1Q2Y A;  2P6F A;  1ON0 A;  4MFQ A;  1NE9 A;  2ZXV A;  2A4N A;  3W6X A;  4CS0 B;  5F48 A;  2VEZ A;  4HNY B;  1Y9W A;  1KUV A;  4B5P A;  2R7H A;  4BBH A;  2PRB A;  4KVM E;  4FD4 A;  4U5Y A;  2VXK A;  1S7K A;  2YGW A;  4OAD A;  3SXO A;  4KOT A;  4I49 A;  4MY3 A;  4B11 A;  1J4J A;  1R57 A;  4E0A A;  3WR7 A;  2Q4V A;  3D2P A;  2JDD A;  4KSF A;  2JDC A;  5KTA A;  2B4B A;  5FVJ A;  3TO9 A;  1BOB A;  3R9F A;  4C2Y A;  2X7B A;  3S6H A;  3PGP A;  4Q36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...