5F49A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with malonyl-coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 33
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f49A00
2HQYA 4KVME 4QVTA 1Z9UA 2PDOA 1YX0A 5HMNA 4JXQA 2IL4A 1B6BA 1S5KA 4R87A 4Y49B 4AVCA 5IB0A 4JD6A 1QSTA 4PSXA 1XF8A 2HUZA 2FT0A 2G3TA 4UA3A 4NCZA 1M44A 4R3LA 4U5YA 5F49A 2F5IA 2GIVA 1PU9A 3TOBA 2PRBA 4KORA 2Q7BA 2GE3A 5HH1A 3BJ8A 3E0KA 1IB1E 2CNSA 2VBQA 3P2HA 2OB0A 1Y7RA 3DR6A 4R9MA 5H84A 2FSRA 4Y49C 2OU2A 1V0CA 1Z4EA 4NXYA 2ARHA 5IX3A 2I79A 4ZBGA 4L8AA 1VKCA 2P6GA 4CAXA 3FB3A 1WWZA 1S7KA 4EVYA 4LUAA 2VEZA 3EFAA 3LD2A 5CNPA 1N71A 1TIQA 3S6KA 2OH1A 1MK4A 1YVKA 4KZTA 4CAWA 3CXPA 3CXQA 4KUAA 2ZW5A 3EO4A 4B5PA 1XE4A 2Q4VA 2JEVA 4RS2A 2Q4YA 1YVOA 2J8RA 1YLEA 3R9EA 3B8GA 4GS4A 3PP9A 3N7ZA 4DNCA 2PR1A 4UBRA 3C26A 4AB7A 4M85A 1Q2DA 3GY9A 3JVNA 1VHSA 2ZPAA 3UY5A 3R9GA 2EUIA 5J8CA 3I9SA 3K9UA 4II9A 1XIXA 4HNXB 4RI1A 3FIXA 4NF1A 2B4DA 4U9YA 4J3GA 1WK4A 4AVAA 3DR8A 2ATRA 1KUVA 3FNCA 3FRMA 3IGRA 5IV0A 4FD6A 2Y0MA 1MJBA 4F0YA 3RYOA 3F8KA 3BLNA 4MJ8A 2B4BA 4OAEA 3TO9A 4OLLA 1S60A 2PC1A 2VI7A 2FS5A 2Z10A 1NE9A 5C88A 4QB9A 4X5KA 2ZW4A 4JLYA 1M1DA 1S7NA 4ONUA 1FY7A 2P6FA 4KOSA 3D2MA 1PUAA 2D4PA 2Z11A 2KCWA 3FBUA 4PSWA 1CM0A 2JDDA 2A4NA 4KOWA 2PSWA 3TTHA 1CJWA 5J8FA 5F46A 5F48A 4B5OA 3ZZIA 3VWEA 3JUWA 2R98A 4KVOE 1M4IA 1YREA 3SHPA 5KTCA 3BJ7A 3SXOA 2PR8A 5JPHA 2HV2A 3IWGA 4HKFA 3TFYA 4ORFA 4MBUA 2D4OA 5JQ4A 3TO7A 2B5GB 4XNHB 4K30A 3S6FA 2JDCA 3R96A 1U6MA 4F6AA 4OADA 2Q44A 1XEBA 2BEIA 3R9FA 4FD7A 2ZXVA 3EXNA 2CNTA 1KUXA 1YGHA 4H89A 1KUYA 4KOVA 2FE7A 4QBJA 2J8MA 2Q0YA 4XNHC 3S6HA 2K5TA 1K4JA 4JXRA 1Q2CA 5F47A 3D2PA 3W6XA 3TE4A 3T9YA 4IUSA 4E8OA 2O28A 3FXTA 4KOYA 1NSLA 2BSWA 2Q04A 1YK3A 4MI4A 5EBVA 1S3ZA 2QMLA 1I12A 3KKWA 2CNMA 1J4JA 3R1KA 4XPLA 4JJXA 2FIAA 2AJ6A 1UFHA 2REEA 4E2AA 5FVJA 4KLVA 2QECA 1LRZA 2P6EA 4YGOA 2PQ8A 1ON0A 2CY2A 4B5PB 4KOXA 1KZFA 1XMTA 3SXNA 3MGDA 3OWCA 1IYLA 4R3KA 2BUEA 1P0HA 1QSNA 2OZHA 2R1IA 3H4QA 3WR7A 4MY0A 2X7BA 3T90A 2EVNA 1IICA 3G3SA 2JLMA 2OZGA 4FD4A 2B58A 2R8VA 2FL4A 2ZW6A 3NE7A 1M4GA 4NEXA 4H6ZA 3W91A 2J8NA 4AVBA 4BMHA 3V8IA 1Q2YA 2BL1A 1Z4RA 4UWIA 3F0AA 1R57A 2DXQA 1IYKA 2B4DB 4AG7A 3QB8A 4YFJA 3F5BA 5KTDA 4KLWA 4HNWB 3TT2A 4CRZB 2VQYA 2FXFA 3D3SA 1Y9KA 3CXSA 4PK3A 1YR0A 1NMTA 4E0AA 2FIWA 1P4NA 3G8WA 2R7HA 4R57A 1B87A 2RC4A 3W6SA 2Z0ZA 3S6GA 2VXKA 2NMTA 4XPKA 4CAVA 3FYNA 4CRYB 5ISVA 3P2FA 1IIDA 2VZZA 1M4DA 4FD5A 2VZYA 1Y9WA 3ZJ0A 5DWMA 2C27A 3DSBA 1I1DA 1BOBA 2G0BA 4PK2A 2WPXA 1S7FA 2G3AA 1QSMA 3I3GA 3PGPA 4HNYB 3D8PA 3VWDA 4L89A 5GCNA 3LODA 4KOTA 5E96A 4KVXA 4CS0B 4U9ZA 3EC4A 1SQHA 3DNSA 4XPDB 5H86A 3GKRA 2P0WA 3QAHA 2QIRA 5C82A 2B3UA 1GHEA 1S7LA 4LX9A 2B3VA 4M3SA 3DDDA 4KOUA 1MJ9A 3TO6A 1QSOA 3TCVA 1MJAA 4PV6A 1I21A 4YRHA 3EY5A 3TOAA 5I0CA 4H6UA 2REFA 2WPWA 2OZUA 1RXTA 5DWNA 4MY3A 4I49A 5KTAA 2AE6A 2H5MA 3GYAA 4XPDC 2FCKA 4QC6A 4IF5A 1OZPA 4KUBA 2B5GA 1RO5A 2ZW7A 5EC4A 4JWPA 4NSQA 1QSRA 2GANA 4MHDA 2I00A 3PZJA 4QUSA 1BO4A 4UWJA 4AG9A 1L0CA 3R95A
chains in the Genus database with same CATH superfamily
2HQYA 4KVME 2PJAA 1F2OA 1Z9UA 2PDOA 3N5FA 4MFKA 4QVTA 1YX0A 4F9UA 5HMNA 4JXQA 2IL4A 1B6BA 1S5KA 4R87A 4A30A 3B3TA 4PXEA 4Q7AA 4Y49B 4AVCA 2DF5A 5D8NA 1Z8LA 4PXDA 5LRGA 2JBJA 5IB0A 4JD6A 1QSTA 4NGMA 1AUGA 5A27A 4PSXA 3SI2A 4C2YA 1XF8A 1NSAA 1CPSA 2HUZA 2FT0A 2G3TA 4UF4A 7CPAA 4UA3A 4NCZA 4BINA 2Z3OA 4OC4A 2XEFA 3B35A 1M44A 4R3LA 4U5YA 5F49A 3KGQA 2F5IA 2GIVA 3B3CA 1BPMA 2O53A 4MCQA 4HPSA 2XEGA 1PU9A 3TOBA 2PRBA 4KORA 2Q7BA 2GE3A 5HH1A 1XOVA 4JYWA 3BJ8A 2WUUA 2Z3MA 2PJ3A 2F8HA 1R3NA 3E0KA 1IB1E 2CNSA 2VBQA 3P2HA 2OB0A 1Y7RA 3DR6A 4R9MA 3SI1A 5H84A 4P4DA 4A2ZA 3QAYA 3D7HA 4WWVA 5LYDA 2FSRA 4ZI6A 4G1PA 4Y49C 3H8GA 2OU2A 1V0CA 3DGVA 1Z4EA 4GXHA 4NXYA 1XFOA 2ZENA 1IOFA 2ARHA 5IX3A 5AG6A 2I79A 2ZEFA 4ZBGA 4L8AA 1VKCA 2P6GA 1Z8TA 4CAXA 4YU9A 3SJFA 4CPAA 3FB3A 1WWZA 3KHXA 1S7KA 4EVYA 1Z8XA 2CIJA 2YNCC 2NYQA 4LUAA 5JGFA 3GLJA 2VEZA 3EFAA 1YQEA 2Z3KA 3DLJA 3LD2A 1N71A 5CNPA 3SJGA 4B6ZA 2ZOGA 1TIQA 3S6KA 1XBUA 2OH1A 1MK4A 2ZOFA 4NGQA 1YVKA 4KZTA 4MXUA 1UWYA 2PJCA 3CXPA 4CAWA 3CXQA 4OC1A 4KUAA 3KL9A 4X8IA 1TKHA 2ZW5A 3EO4A 3PFEA 5G22A 4B5PA 1XE4A 2Q4VA 2JEVA 4RS2A 2Q4YA 4B12A 3NFZA 1VHEA 1YVOA 2J8RA 3IJ3A 1YLEA 3R9EA 1QQ9A 3CT9A 2IMOA 3MRUA 3B8GA 4GS4A 3PP9A 4B11A 3N7ZA 5G21A 2EK8A 2PJ5A 1LFWA 3A9LA 3GIUA 5I4MA 4DNCA 2PR1A 4O23A 4UBRA 3RNZA 2QYVA 3C26A 1ZLIA 4AB7A 5JM6A 2AFMA 4M85A 1Q2DA 3GY9A 3JVNA 4MHYA 1VHSA 3FECA 2ZPAA 5BWAB 1EE3P 3SJXA 3UY5A 2AFUA 2EUIA 2ODFA 3R9GA 1DE4C 3KQZA 3I9SA 3KQXA 5J8CA 2QJ8A 4UCMA 3K9UA 4II9A 1XIXA 4OC3A 2XEIA 4HNXB 4RI1A 3IIBA 2AFXA 1FT7A 3FIXA 1IOIA 4NF1A 4NGNA 2B4DA 4U9YA 1IGBA 3I1UA 4J3GA 4CGLA 1WK4A 4AVAA 3DR8A 3KZWA 1YSJA 2ATRA 1KUVA 1LOKA 1FNOA 4IAVA 4EWTA 3KASA 2BOAA 1Z2LA 3FNCA 3QNVA 3FRMA 3IGRA 2JEWA 4Z65A 5IV0A 3JTKA 2V8HA 4MHNA 4FD6A 2Y0MA 1MJBA 3FVLA 4F0YA 2F7VA 3RYOA 4AXVA 3GB0A 3PEIA 4FWUA 2C1CA 5J1QA 3F8KA 3B2YA 4CYOA 4MHZA 4ZX8A 3BLNA 4MJ8A 2PJ9A 2B4BA 5LRJA 3D7GA 1KWMA 4P10A 4UFWA 3IEHA 4OAEA 2YGWA 4UIAA 3CZXA 3TO9A 4OLLA 2HB6A 2G9DA 2ZEOA 1S60A 2PC1A 1TXRA 2VI7A 2FS5A 2Z10A 1NE9A 2GU2A 5C88A 4QB9A 4X5KA 2ZW4A 1VHOA 2BO9A 1M1DA 1S7NA 2VL1A 4JLYA 1FY7A 2P6FA 4KOSA 4NJRA 4ONUA 4RN7A 2ANPA 5LYLA 5G1ZA 3D2MA 3FX6A 3LMSA 4K3NA 4OMEA 1PUAA 2D4PA 2Z11A 2KCWA 3FBUA 4ZX9A 2AFWA 4PSWA 4YWYA 5AG4A 4C2ZA 3TX8A 4PQAA 1CM0A 4A39A 2JDDA 2A4NA 3B7IA 4KOWA 4KS9A 2PSWA 4CYQA 4KSFA 3TTHA 5F09A 1CJWA 2WSAA 4UFVA 5J8FA 2C6PA 1TF8A 3FF3A 5F48A 3WC6A 4B5OA 5F46A 3ZZIA 4C7HA 3D68A 4CYPA 3VWEA 3D7FA 3WABA 3D4UA 1YMEA 2PCUA 3CDXA 3V38A 3JUWA 2PJ6A 1IU8A 5HXDA 2WZNA 3WT4A 2R98A 4KVOE 4WJBA 1CG2A 4H2KA 4CAFA 2ZEHA 3R95A 3V7ZA 1YLOA 1M4IA 1YREA 3SHPA 5KTCA 4KSIA 2PRQA 3BJ7A 4MFJA 3B3VA 3SXOA 4CYNA 2PR8A 3B3WA 5JPHA 3PBBA 2HV2A 5CPAA 4A33A 3IWGA 4C7IA 4HKFA 5HVFA 5DS0A 4NGRA 2AFSA 2YNEA 4P4FA 4ORFA 3TFYA 4MBUA 2POKA 4FUUA 2D4OA 4UCNA 5JQ4A 3ISZA 3TO7A 2B5GB 2ZEPA 5HVGA 4XNHB 5AG5A 4UEEA 2PIZA 5A28A 4K30A 2Z3LA 3S6FA 3D7DA 4R6TA 2JDCA 2EO8A 3R96A 1U6MA 4F6AA 4OADA 1A2ZA 2DEAA 2I3CA 1XEBA 2Q44A 4UEZA 1BPNA 2BEIA 3R9FA 4DYOA 1ZG9A 2PJ0A 2IQ6A 3RBUA 3NH5A 4FD7A 2ZXVA 3EXNA 3IC1A 2OR4A 2CNTA 1KUXA 1YGHA 2PJ8A 4OC0A 4B14A 2PJ7A 4H89A 1KUYA 4BD9A 3BI1A 2O4HA 4KOVA 2FE7A 4LQGA 2PE3A 4QBJA 2PJBA 3PB7X 2J8MA 1TKJA 4EMEA 3RO0A 2QVPA 2Q0YA 3NH4A 4A38A 1XJOA 5K8NA 5LRKA 4XNHC 5G20A 3S6HA 2K5TA 4FAIA 2FVGA 1K4JA 3NH8A 4P44A 2PIYA 1VGYA 1JQGA 4JXRA 4OIWA 1Q2CA 5AG7A 5F47A 3FEEA 1Y7EA 3D2PA 6CPAA 2OOTA 2GLFA 3W6XA 3TE4A 3KR4A 3T9YA 3HUVA 4IUSA 4E8OA 2O28A 4X2TA 3FXTA 2PJ4A 4KOYA 1NSLA 2ZEMA 2BSWA 2Q04A 4P45A 1YK3A 2YNCA 4MFQA 4MI4A 5EBVA 1S3ZA 2QMLA 3S9MA 1I12A 3SJEA 3KKWA 2CNMA 3BI0A 1J4JA 3R1KA 4ZY1A 1DTDA 4OP4A 3WC7A 4MRIA 2WYRA 1Q7LA 4XPLA 4OC5A 4JJXA 2FIAA 3IU1A 1X12A 2AJ6A 1Y0RA 4A37A 5LYFA 1UFHA 4P6YA 2REEA 2Q51A 4BBHA 4E2AA 4OC2A 5FVJA 3VARA 4KLVA 2QECA 1LRZA 2CXAA 2RFHA 5ELYA 4UFXA 2P6EA 3NE8A 2ZEGA 4YGOA 2PVVA 1F57A 2PQ8A 1ON0A 5K8OA 3T8WA 4OKOA 2GFQA 1CBXA 2CY2A 2PJ1A 4A31A 4B5PB 4KOXA 1KZFA 1XMTA 3SXNA 4NJQA 3MGDA 4CGMA 3OWCA 4LQ6A 2IJZA 1LAPA 1IYLA 1LANA 4R3KA 3PBEA 5K8MA 4ZY2A 2BUEA 1P0HA 5EMIA 1VIXA 1F2PA 1QSNA 2OZHA 2R1IA 3H4QA 4PPZA 3WR7A 1ZO0A 4MMOA 4MY0A 4UIBA 2X7BA 3T90A 4F0XA 2EVNA 1IICA 3IWEA 3G3SA 2JLMA 2OZGA 4MCSA 4GM5A 3VH9A 2EK9A 3WC5A 4FD4A 2B58A 1CP6A 1RTQA 2R8VA 5CBMA 2FL4A 2ZW6A 3NE7A 1M4GA 4NEXA 3K9TA 4MFZA 2GLJA 2C6CA 4P4BA 4ZY0A 1AYEA 4H6ZA 4CGOA 1Y0YA 3W91A 2J8NA 4AVBA 3FH4A 2CTCA 2V8DA 3V8IA 4BMHA 3CPXA 1BLLE 3PRTA 3FJUA 1OBRA 2NSMA 1Q2YA 1TKFA 1XMBA 2BL1A 3D66A 5K8PA 1Z4RA 4UWIA 3SI0A 1M4LA 1PYTB 3F0AA 2EBJA 3D67A 4C2XA 1R57A 1Z5RA 2DXQA 2RB7A 1IYKA 2B4DB 4AG7A 2ZELA 1LCPA 4ONWA 3QB8A 4IK2A 2V8GA 4YFJA 1ZG7A 3F5BA 5KTDA 4HNWB 2YNDA 4KLWA 4F8ZA 2Q43A 3FMCA 3TT2A 2ZEDA 4CRZB 2VQYA 2FXFA 3D3SA 3BXMA 4MCPA 1ELMP 1JWQA 1Y9KA 3KI9A 3GUXA 3CXSA 2ABZA 4PK3A 1YR0A 4Q38A 1NMTA 2Q7SA 3IFEA 1PCAA 1ARMA 3HLPA 4E0AA 3PB8X 3TC8A 2FIWA 1HDUA 1P4NA 3RAMA 4MHPA 2GREA 4B10A 4F9VA 5AGEA 4RUHA 4NFRA 3G8WA 1CPXA 1ARLA 2R7HA 4CGPA 1YW6A 1B87A 2RC4A 3IU2A 4MCRA 4R57A 3W6SA 3S9LA 2Z0ZA 3S6GA 2VXKA 1BAVA 2NMTA 3H8EA 1IY7A 3PB6X 4Q36A 4KSAA 4A94A 4XPKA 4CAVA 8CPAA 3FYNA 2DPSA 4A32A 4CRYB 5ISVA 3L2NA 4R76A 4CAEA 3CPAA 3P2FA 1IIDA 4P4IA 2Q4ZA 2VZZA 1M4DA 4FD5A 2VZYA 4P4JA 1Y9WA 4X3RA 1X10A 3MN8A 3ZJ0A 4ZGYB 5DWMA 2C27A 1HDQA 3DSBA 1I1DA 1BOBA 2G0BA 4PK2A 4M6HA 4UCPA 2WPXA 1S7FA 2G3AA 3LWUA 1QSMA 4ZYQA 3I3GA 3PGPA 1ZG8A 4HNYB 3D8PA 3IWWA 1YW4A 3VWDA 3PFOA 4UEFA 4CGNA 4JZ0A 3H8FA 3IO1A 3ISXA 4MFLA 3S9NA 2JBKA 3PB4X 4L89A 5GCNA 3LODA 4KOTA 2ZEEA 2CF4A 4B13A 4DJLA 5E96A 3KHZA 1QMUA 4KVXA 1TF9A 2DPTA 2Z3NA 4CS0B 4NGPA 5THWA 4OIDA 2V8VA 4U9ZA 4W9YA 3EC4A 1XRYA 1SQHA 3DNSA 1ZLHA 3BHXA 4XPDB 5H86A 2EWBA 3B3SA 4IHMA 3GKRA 4FBEA 2P0WA 3JRUA 3QAHA 2QIRA 3K2KA 5C82A 4DUKA 1ELLP 2B3UA 2BCOA 1GHEA 2C6GA 3KR5A 1S7LA 4TWEA 4A95A 4LX9A 1H8LA 2B3VA 3VATA 2Z3PA 3DDDA 4KOUA 1MJ9A 4M3SA 4M6GA 1QSOA 3TCVA 3TO6A 3RZAA 1LAMA 1MJAA 4PV6A 3LACA 5D29A 2AFOA 1CP7A 1I21A 4PXCA 4YRHA 3EY5A 5IB9A 3TOAA 5I0CA 4C68A 3NA6A 4H6UA 5LYIA 2REFA 2WPWA 2OZUA 1RXTA 4NGTA 4P4EA 5DWNA 2PVWA 4MY3A 4I49A 4TNUA 4NGSA 5KTAA 4PXBA 2AE6A 2H5MA 3GYAA 2XEJA 4XPDC 1R43A 2FCKA 4QC6A 5HVHA 2PJ2A 4IF5A 3PB9X 1OZPA 2V77A 4KUBA 2B5GA 1RO5A 1CX8A 2ZW7A 5EC4A 4JWPA 4NSQA 1AMPA 1QSRA 2GANA 3FEDA 4MFPA 4MHDA 3H5ZA 2CTBA 4R7MA 4M6IA 2I00A 5JH9A 2AFZA 4R8FA 4EFDA 1Z8WA 3PZJA 4QUSA 1BO4A 4UWJA 4AG9A 2HC9A 1L0CA 1GYTA 1HEEA 2J9AA
chains in the Genus database with same CATH topology
2HQYA 4KVME 4QVTA 1Z9UA 2PDOA 4MFKA 1YX0A 5HMNA 4JXQA 2IL4A 1B6BA 1S5KA 4R87A 4A30A 4Y49B 4AVCA 5IB0A 4JD6A 1QSTA 5A27A 4PSXA 4C2YA 1XF8A 2HUZA 2FT0A 2G3TA 4UA3A 4NCZA 2Z3OA 1M44A 4R3LA 4U5YA 5F49A 2F5IA 2GIVA 1PU9A 3TOBA 2PRBA 4KORA 2Q7BA 2GE3A 5HH1A 3BJ8A 2WUUA 2Z3MA 3E0KA 1IB1E 2CNSA 2VBQA 3P2HA 2OB0A 1Y7RA 3DR6A 4R9MA 5H84A 4A2ZA 2FSRA 4Y49C 2OU2A 1V0CA 1Z4EA 4NXYA 2ARHA 5IX3A 5AG6A 2I79A 4ZBGA 4L8AA 1VKCA 2P6GA 4CAXA 3FB3A 1WWZA 1S7KA 4EVYA 2YNCC 4LUAA 2VEZA 3EFAA 3LD2A 2Z3KA 5CNPA 1N71A 1TIQA 3S6KA 2OH1A 1MK4A 1YVKA 4KZTA 4CAWA 3CXPA 3CXQA 4KUAA 2ZW5A 3EO4A 5G22A 4B5PA 1XE4A 2Q4VA 2JEVA 4RS2A 2Q4YA 4B12A 1YVOA 2J8RA 1YLEA 3R9EA 4B11A 3B8GA 4GS4A 3PP9A 3N7ZA 5G21A 3A9LA 4DNCA 2PR1A 4UBRA 3C26A 4AB7A 4M85A 1Q2DA 3GY9A 3JVNA 1VHSA 2ZPAA 5BWAB 3UY5A 3R9GA 2EUIA 5J8CA 3I9SA 4UCMA 3K9UA 4II9A 1XIXA 4HNXB 4RI1A 3FIXA 4NF1A 2B4DA 4U9YA 4J3GA 4CGLA 1WK4A 4AVAA 3DR8A 2ATRA 1KUVA 3FNCA 3FRMA 3IGRA 5IV0A 3JTKA 4FD6A 2Y0MA 1MJBA 4F0YA 3RYOA 3F8KA 4CYOA 3BLNA 4MJ8A 2B4BA 4UFWA 4OAEA 2YGWA 3TO9A 4OLLA 1S60A 2PC1A 2VI7A 2FS5A 2Z10A 1NE9A 5C88A 4QB9A 4X5KA 2ZW4A 4JLYA 1M1DA 1S7NA 4ONUA 1FY7A 2P6FA 4KOSA 5G1ZA 3D2MA 1PUAA 2D4PA 2Z11A 2KCWA 3FBUA 4PSWA 5AG4A 4C2ZA 1CM0A 2JDDA 2A4NA 4KOWA 4KS9A 2PSWA 4CYQA 4KSFA 3TTHA 1CJWA 2WSAA 4UFVA 5J8FA 5F46A 5F48A 4B5OA 3ZZIA 4C7HA 4CYPA 3VWEA 3JUWA 2R98A 4KVOE 4CAFA 1M4IA 1YREA 3SHPA 5KTCA 3BJ7A 4MFJA 3SXOA 4CYNA 2PR8A 5JPHA 2HV2A 4A33A 3IWGA 4C7IA 4HKFA 3TFYA 2YNEA 4ORFA 4MBUA 2D4OA 4UCNA 5JQ4A 3TO7A 2B5GB 4XNHB 5AG5A 5A28A 4K30A 2Z3LA 3S6FA 2JDCA 3R96A 1U6MA 4F6AA 4OADA 2Q44A 1XEBA 2BEIA 3R9FA 4FD7A 2ZXVA 3EXNA 2CNTA 1KUXA 1YGHA 4B14A 4H89A 1KUYA 4KOVA 2FE7A 4QBJA 2J8MA 2Q0YA 4XNHC 5G20A 3S6HA 2K5TA 1K4JA 4JXRA 1Q2CA 5AG7A 5F47A 3D2PA 3W6XA 3TE4A 3T9YA 4IUSA 4E8OA 2O28A 3FXTA 4KOYA 1NSLA 2BSWA 2Q04A 1YK3A 2YNCA 4MFQA 4MI4A 5EBVA 1S3ZA 2QMLA 1I12A 3KKWA 2CNMA 1J4JA 3R1KA 4XPLA 4JJXA 2FIAA 3IU1A 2AJ6A 1UFHA 2REEA 4BBHA 4E2AA 5FVJA 4KLVA 2QECA 1LRZA 2CXAA 4UFXA 2P6EA 4YGOA 2PQ8A 1ON0A 2CY2A 4B5PB 4A31A 4KOXA 1KZFA 1XMTA 3SXNA 3MGDA 4CGMA 3OWCA 1IYLA 4R3KA 2BUEA 1P0HA 1QSNA 2OZHA 2R1IA 3H4QA 3WR7A 1ZO0A 4MY0A 4F0XA 2X7BA 3T90A 2EVNA 1IICA 3IWEA 3G3SA 2JLMA 2OZGA 4FD4A 2B58A 2R8VA 2FL4A 2ZW6A 3NE7A 1M4GA 4NEXA 4MFZA 4H6ZA 4CGOA 3W91A 2J8NA 4AVBA 4BMHA 3V8IA 1Q2YA 2BL1A 1Z4RA 4UWIA 3F0AA 4C2XA 1R57A 2DXQA 1IYKA 2B4DB 4AG7A 3QB8A 4YFJA 3F5BA 5KTDA 4HNWB 2YNDA 4KLWA 3TT2A 4CRZB 2VQYA 2FXFA 3D3SA 1Y9KA 3CXSA 4PK3A 1YR0A 4Q38A 1NMTA 4E0AA 2FIWA 1P4NA 4B10A 5AGEA 3G8WA 2R7HA 4CGPA 4R57A 1B87A 2RC4A 3IU2A 3W6SA 2Z0ZA 3S6GA 2VXKA 2NMTA 4Q36A 4KSAA 4XPKA 4CAVA 3FYNA 2DPSA 4A32A 4CRYB 5ISVA 4CAEA 3P2FA 1IIDA 2VZZA 1M4DA 4FD5A 2VZYA 1Y9WA 3ZJ0A 4ZGYB 5DWMA 2C27A 3DSBA 1I1DA 1BOBA 2G0BA 4PK2A 4UCPA 2WPXA 1S7FA 2G3AA 1QSMA 3I3GA 3PGPA 4HNYB 3D8PA 3VWDA 4CGNA 4MFLA 4L89A 5GCNA 3LODA 4KOTA 4B13A 5E96A 4KVXA 2DPTA 2Z3NA 4CS0B 4U9ZA 3EC4A 1SQHA 3DNSA 4XPDB 5H86A 3GKRA 2P0WA 3QAHA 2QIRA 5C82A 2B3UA 4A95A 1GHEA 1S7LA 4LX9A 2B3VA 2Z3PA 3DDDA 4KOUA 1MJ9A 4M3SA 3TO6A 1QSOA 3TCVA 1MJAA 4PV6A 1I21A 4YRHA 3EY5A 3TOAA 5I0CA 4C68A 4H6UA 2REFA 2WPWA 2OZUA 1RXTA 5DWNA 4MY3A 4I49A 5KTAA 2AE6A 2H5MA 3GYAA 4XPDC 2FCKA 4QC6A 4IF5A 1OZPA 4KUBA 2B5GA 1RO5A 2ZW7A 5EC4A 4JWPA 4NSQA 1QSRA 2GANA 4MFPA 4MHDA 3H5ZA 2I00A 3PZJA 4QUSA 1BO4A 4UWJA 4AG9A 1L0CA 3R95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQY A;  4KVM E;  4QVT A;  1Z9U A;  2PDO A;  1YX0 A;  5HMN A;  4JXQ A;  2IL4 A;  1B6B A;  1S5K A;  4R87 A;  4Y49 B;  4AVC A;  5IB0 A;  4JD6 A;  1QST A;  4PSX A;  1XF8 A;  2HUZ A;  2FT0 A;  2G3T A;  4UA3 A;  4NCZ A;  1M44 A;  4R3L A;  4U5Y A;  5F49 A;  2F5I A;  2GIV A;  1PU9 A;  3TOB A;  2PRB A;  4KOR A;  2Q7B A;  2GE3 A;  5HH1 A;  3BJ8 A;  3E0K A;  1IB1 E;  2CNS A;  2VBQ A;  3P2H A;  2OB0 A;  1Y7R A;  3DR6 A;  4R9M A;  5H84 A;  2FSR A;  4Y49 C;  2OU2 A;  1V0C A;  1Z4E A;  4NXY A;  2ARH A;  5IX3 A;  2I79 A;  4ZBG A;  4L8A A;  1VKC A;  2P6G A;  4CAX A;  3FB3 A;  1WWZ A;  1S7K A;  4EVY A;  4LUA A;  2VEZ A;  3EFA A;  3LD2 A;  5CNP A;  1N71 A;  1TIQ A;  3S6K A;  2OH1 A;  1MK4 A;  1YVK A;  4KZT A;  4CAW A;  3CXP A;  3CXQ A;  4KUA A;  2ZW5 A;  3EO4 A;  4B5P A;  1XE4 A;  2Q4V A;  2JEV A;  4RS2 A;  2Q4Y A;  1YVO A;  2J8R A;  1YLE A;  3R9E A;  3B8G A;  4GS4 A;  3PP9 A;  3N7Z A;  4DNC A;  2PR1 A;  4UBR A;  3C26 A;  4AB7 A;  4M85 A;  1Q2D A;  3GY9 A;  3JVN A;  1VHS A;  2ZPA A;  3UY5 A;  3R9G A;  2EUI A;  5J8C A;  3I9S A;  3K9U A;  4II9 A;  1XIX A;  4HNX B;  4RI1 A;  3FIX A;  4NF1 A;  2B4D A;  4U9Y A;  4J3G A;  1WK4 A;  4AVA A;  3DR8 A;  2ATR A;  1KUV A;  3FNC A;  3FRM A;  3IGR A;  5IV0 A;  4FD6 A;  2Y0M A;  1MJB A;  4F0Y A;  3RYO A;  3F8K A;  3BLN A;  4MJ8 A;  2B4B A;  4OAE A;  3TO9 A;  4OLL A;  1S60 A;  2PC1 A;  2VI7 A;  2FS5 A;  2Z10 A;  1NE9 A;  5C88 A;  4QB9 A;  4X5K A;  2ZW4 A;  4JLY A;  1M1D A;  1S7N A;  4ONU A;  1FY7 A;  2P6F A;  4KOS A;  3D2M A;  1PUA A;  2D4P A;  2Z11 A;  2KCW A;  3FBU A;  4PSW A;  1CM0 A;  2JDD A;  2A4N A;  4KOW A;  2PSW A;  3TTH A;  1CJW A;  5J8F A;  5F46 A;  5F48 A;  4B5O A;  3ZZI A;  3VWE A;  3JUW A;  2R98 A;  4KVO E;  1M4I A;  1YRE A;  3SHP A;  5KTC A;  3BJ7 A;  3SXO A;  2PR8 A;  5JPH A;  2HV2 A;  3IWG A;  4HKF A;  3TFY A;  4ORF A;  4MBU A;  2D4O A;  5JQ4 A;  3TO7 A;  2B5G B;  4XNH B;  4K30 A;  3S6F A;  2JDC A;  3R96 A;  1U6M A;  4F6A A;  4OAD A;  2Q44 A;  1XEB A;  2BEI A;  3R9F A;  4FD7 A;  2ZXV A;  3EXN A;  2CNT A;  1KUX A;  1YGH A;  4H89 A;  1KUY A;  4KOV A;  2FE7 A;  4QBJ A;  2J8M A;  2Q0Y A;  4XNH C;  3S6H A;  2K5T A;  1K4J A;  4JXR A;  1Q2C A;  5F47 A;  3D2P A;  3W6X A;  3TE4 A;  3T9Y A;  4IUS A;  4E8O A;  2O28 A;  3FXT A;  4KOY A;  1NSL A;  2BSW A;  2Q04 A;  1YK3 A;  4MI4 A;  5EBV A;  1S3Z A;  2QML A;  1I12 A;  3KKW A;  2CNM A;  1J4J A;  3R1K A;  4XPL A;  4JJX A;  2FIA A;  2AJ6 A;  1UFH A;  2REE A;  4E2A A;  5FVJ A;  4KLV A;  2QEC A;  1LRZ A;  2P6E A;  4YGO A;  2PQ8 A;  1ON0 A;  2CY2 A;  4B5P B;  4KOX A;  1KZF A;  1XMT A;  3SXN A;  3MGD A;  3OWC A;  1IYL A;  4R3K A;  2BUE A;  1P0H A;  1QSN A;  2OZH A;  2R1I A;  3H4Q A;  3WR7 A;  4MY0 A;  2X7B A;  3T90 A;  2EVN A;  1IIC A;  3G3S A;  2JLM A;  2OZG A;  4FD4 A;  2B58 A;  2R8V A;  2FL4 A;  2ZW6 A;  3NE7 A;  1M4G A;  4NEX A;  4H6Z A;  3W91 A;  2J8N A;  4AVB A;  4BMH A;  3V8I A;  1Q2Y A;  2BL1 A;  1Z4R A;  4UWI A;  3F0A A;  1R57 A;  2DXQ A;  1IYK A;  2B4D B;  4AG7 A;  3QB8 A;  4YFJ A;  3F5B A;  5KTD A;  4KLW A;  4HNW B;  3TT2 A;  4CRZ B;  2VQY A;  2FXF A;  3D3S A;  1Y9K A;  3CXS A;  4PK3 A;  1YR0 A;  1NMT A;  4E0A A;  2FIW A;  1P4N A;  3G8W A;  2R7H A;  4R57 A;  1B87 A;  2RC4 A;  3W6S A;  2Z0Z A;  3S6G A;  2VXK A;  2NMT A;  4XPK A;  4CAV A;  3FYN A;  4CRY B;  5ISV A;  3P2F A;  1IID A;  2VZZ A;  1M4D A;  4FD5 A;  2VZY A;  1Y9W A;  3ZJ0 A;  5DWM A;  2C27 A;  3DSB A;  1I1D A;  1BOB A;  2G0B A;  4PK2 A;  2WPX A;  1S7F A;  2G3A A;  1QSM A;  3I3G A;  3PGP A;  4HNY B;  3D8P A;  3VWD A;  4L89 A;  5GCN A;  3LOD A;  4KOT A;  5E96 A;  4KVX A;  4CS0 B;  4U9Z A;  3EC4 A;  1SQH A;  3DNS A;  4XPD B;  5H86 A;  3GKR A;  2P0W A;  3QAH A;  2QIR A;  5C82 A;  2B3U A;  1GHE A;  1S7L A;  4LX9 A;  2B3V A;  4M3S A;  3DDD A;  4KOU A;  1MJ9 A;  3TO6 A;  1QSO A;  3TCV A;  1MJA A;  4PV6 A;  1I21 A;  4YRH A;  3EY5 A;  3TOA A;  5I0C A;  4H6U A;  2REF A;  2WPW A;  2OZU A;  1RXT A;  5DWN A;  4MY3 A;  4I49 A;  5KTA A;  2AE6 A;  2H5M A;  3GYA A;  4XPD C;  2FCK A;  4QC6 A;  4IF5 A;  1OZP A;  4KUB A;  2B5G A;  1RO5 A;  2ZW7 A;  5EC4 A;  4JWP A;  4NSQ A;  1QSR A;  2GAN A;  4MHD A;  2I00 A;  3PZJ A;  4QUS A;  1BO4 A;  4UWJ A;  4AG9 A;  1L0C A;  3R95 A; 
#chains in the Genus database with same CATH topology
 2HQY A;  4KVM E;  2PJA A;  1F2O A;  1Z9U A;  2PDO A;  3N5F A;  4MFK A;  4QVT A;  1YX0 A;  4F9U A;  5HMN A;  4JXQ A;  2IL4 A;  1B6B A;  1S5K A;  4R87 A;  4A30 A;  3B3T A;  4PXE A;  4Q7A A;  4Y49 B;  4AVC A;  2DF5 A;  5D8N A;  1Z8L A;  4PXD A;  5LRG A;  2JBJ A;  5IB0 A;  4JD6 A;  1QST A;  4NGM A;  1AUG A;  5A27 A;  4PSX A;  3SI2 A;  4C2Y A;  1XF8 A;  1NSA A;  1CPS A;  2HUZ A;  2FT0 A;  2G3T A;  4UF4 A;  7CPA A;  4UA3 A;  4NCZ A;  4BIN A;  2Z3O A;  4OC4 A;  2XEF A;  3B35 A;  1M44 A;  4R3L A;  4U5Y A;  5F49 A;  3KGQ A;  2F5I A;  2GIV A;  3B3C A;  1BPM A;  2O53 A;  4MCQ A;  4HPS A;  2XEG A;  1PU9 A;  3TOB A;  2PRB A;  4KOR A;  2Q7B A;  2GE3 A;  5HH1 A;  1XOV A;  4JYW A;  3BJ8 A;  2WUU A;  2Z3M A;  2PJ3 A;  2F8H A;  1R3N A;  3E0K A;  1IB1 E;  2CNS A;  2VBQ A;  3P2H A;  2OB0 A;  1Y7R A;  3DR6 A;  4R9M A;  3SI1 A;  5H84 A;  4P4D A;  4A2Z A;  3QAY A;  3D7H A;  4WWV A;  5LYD A;  2FSR A;  4ZI6 A;  4G1P A;  4Y49 C;  3H8G A;  2OU2 A;  1V0C A;  3DGV A;  1Z4E A;  4GXH A;  4NXY A;  1XFO A;  2ZEN A;  1IOF A;  2ARH A;  5IX3 A;  5AG6 A;  2I79 A;  2ZEF A;  4ZBG A;  4L8A A;  1VKC A;  2P6G A;  1Z8T A;  4CAX A;  4YU9 A;  3SJF A;  4CPA A;  3FB3 A;  1WWZ A;  3KHX A;  1S7K A;  4EVY A;  1Z8X A;  2CIJ A;  2YNC C;  2NYQ A;  4LUA A;  5JGF A;  3GLJ A;  2VEZ A;  3EFA A;  1YQE A;  2Z3K A;  3DLJ A;  3LD2 A;  1N71 A;  5CNP A;  3SJG A;  4B6Z A;  2ZOG A;  1TIQ A;  3S6K A;  1XBU A;  2OH1 A;  1MK4 A;  2ZOF A;  4NGQ A;  1YVK A;  4KZT A;  4MXU A;  1UWY A;  2PJC A;  3CXP A;  4CAW A;  3CXQ A;  4OC1 A;  4KUA A;  3KL9 A;  4X8I A;  1TKH A;  2ZW5 A;  3EO4 A;  3PFE A;  5G22 A;  4B5P A;  1XE4 A;  2Q4V A;  2JEV A;  4RS2 A;  2Q4Y A;  4B12 A;  3NFZ A;  1VHE A;  1YVO A;  2J8R A;  3IJ3 A;  1YLE A;  3R9E A;  1QQ9 A;  3CT9 A;  2IMO A;  3MRU A;  3B8G A;  4GS4 A;  3PP9 A;  4B11 A;  3N7Z A;  5G21 A;  2EK8 A;  2PJ5 A;  1LFW A;  3A9L A;  3GIU A;  5I4M A;  4DNC A;  2PR1 A;  4O23 A;  4UBR A;  3RNZ A;  2QYV A;  3C26 A;  1ZLI A;  4AB7 A;  5JM6 A;  2AFM A;  4M85 A;  1Q2D A;  3GY9 A;  3JVN A;  4MHY A;  1VHS A;  3FEC A;  2ZPA A;  5BWA B;  1EE3 P;  3SJX A;  3UY5 A;  2AFU A;  2EUI A;  2ODF A;  3R9G A;  1DE4 C;  3KQZ A;  3I9S A;  3KQX A;  5J8C A;  2QJ8 A;  4UCM A;  3K9U A;  4II9 A;  1XIX A;  4OC3 A;  2XEI A;  4HNX B;  4RI1 A;  3IIB A;  2AFX A;  1FT7 A;  3FIX A;  1IOI A;  4NF1 A;  4NGN A;  2B4D A;  4U9Y A;  1IGB A;  3I1U A;  4J3G A;  4CGL A;  1WK4 A;  4AVA A;  3DR8 A;  3KZW A;  1YSJ A;  2ATR A;  1KUV A;  1LOK A;  1FNO A;  4IAV A;  4EWT A;  3KAS A;  2BOA A;  1Z2L A;  3FNC A;  3QNV A;  3FRM A;  3IGR A;  2JEW A;  4Z65 A;  5IV0 A;  3JTK A;  2V8H A;  4MHN A;  4FD6 A;  2Y0M A;  1MJB A;  3FVL A;  4F0Y A;  2F7V A;  3RYO A;  4AXV A;  3GB0 A;  3PEI A;  4FWU A;  2C1C A;  5J1Q A;  3F8K A;  3B2Y A;  4CYO A;  4MHZ A;  4ZX8 A;  3BLN A;  4MJ8 A;  2PJ9 A;  2B4B A;  5LRJ A;  3D7G A;  1KWM A;  4P10 A;  4UFW A;  3IEH A;  4OAE A;  2YGW A;  4UIA A;  3CZX A;  3TO9 A;  4OLL A;  2HB6 A;  2G9D A;  2ZEO A;  1S60 A;  2PC1 A;  1TXR A;  2VI7 A;  2FS5 A;  2Z10 A;  1NE9 A;  2GU2 A;  5C88 A;  4QB9 A;  4X5K A;  2ZW4 A;  1VHO A;  2BO9 A;  1M1D A;  1S7N A;  2VL1 A;  4JLY A;  1FY7 A;  2P6F A;  4KOS A;  4NJR A;  4ONU A;  4RN7 A;  2ANP A;  5LYL A;  5G1Z A;  3D2M A;  3FX6 A;  3LMS A;  4K3N A;  4OME A;  1PUA A;  2D4P A;  2Z11 A;  2KCW A;  3FBU A;  4ZX9 A;  2AFW A;  4PSW A;  4YWY A;  5AG4 A;  4C2Z A;  3TX8 A;  4PQA A;  1CM0 A;  4A39 A;  2JDD A;  2A4N A;  3B7I A;  4KOW A;  4KS9 A;  2PSW A;  4CYQ A;  4KSF A;  3TTH A;  5F09 A;  1CJW A;  2WSA A;  4UFV A;  5J8F A;  2C6P A;  1TF8 A;  3FF3 A;  5F48 A;  3WC6 A;  4B5O A;  5F46 A;  3ZZI A;  4C7H A;  3D68 A;  4CYP A;  3VWE A;  3D7F A;  3WAB A;  3D4U A;  1YME A;  2PCU A;  3CDX A;  3V38 A;  3JUW A;  2PJ6 A;  1IU8 A;  5HXD A;  2WZN A;  3WT4 A;  2R98 A;  4KVO E;  4WJB A;  1CG2 A;  4H2K A;  4CAF A;  2ZEH A;  3R95 A;  3V7Z A;  1YLO A;  1M4I A;  1YRE A;  3SHP A;  5KTC A;  4KSI A;  2PRQ A;  3BJ7 A;  4MFJ A;  3B3V A;  3SXO A;  4CYN A;  2PR8 A;  3B3W A;  5JPH A;  3PBB A;  2HV2 A;  5CPA A;  4A33 A;  3IWG A;  4C7I A;  4HKF A;  5HVF A;  5DS0 A;  4NGR A;  2AFS A;  2YNE A;  4P4F A;  4ORF A;  3TFY A;  4MBU A;  2POK A;  4FUU A;  2D4O A;  4UCN A;  5JQ4 A;  3ISZ A;  3TO7 A;  2B5G B;  2ZEP A;  5HVG A;  4XNH B;  5AG5 A;  4UEE A;  2PIZ A;  5A28 A;  4K30 A;  2Z3L A;  3S6F A;  3D7D A;  4R6T A;  2JDC A;  2EO8 A;  3R96 A;  1U6M A;  4F6A A;  4OAD A;  1A2Z A;  2DEA A;  2I3C A;  1XEB A;  2Q44 A;  4UEZ A;  1BPN A;  2BEI A;  3R9F A;  4DYO A;  1ZG9 A;  2PJ0 A;  2IQ6 A;  3RBU A;  3NH5 A;  4FD7 A;  2ZXV A;  3EXN A;  3IC1 A;  2OR4 A;  2CNT A;  1KUX A;  1YGH A;  2PJ8 A;  4OC0 A;  4B14 A;  2PJ7 A;  4H89 A;  1KUY A;  4BD9 A;  3BI1 A;  2O4H A;  4KOV A;  2FE7 A;  4LQG A;  2PE3 A;  4QBJ A;  2PJB A;  3PB7 X;  2J8M A;  1TKJ A;  4EME A;  3RO0 A;  2QVP A;  2Q0Y A;  3NH4 A;  4A38 A;  1XJO A;  5K8N A;  5LRK A;  4XNH C;  5G20 A;  3S6H A;  2K5T A;  4FAI A;  2FVG A;  1K4J A;  3NH8 A;  4P44 A;  2PIY A;  1VGY A;  1JQG A;  4JXR A;  4OIW A;  1Q2C A;  5AG7 A;  5F47 A;  3FEE A;  1Y7E A;  3D2P A;  6CPA A;  2OOT A;  2GLF A;  3W6X A;  3TE4 A;  3KR4 A;  3T9Y A;  3HUV A;  4IUS A;  4E8O A;  2O28 A;  4X2T A;  3FXT A;  2PJ4 A;  4KOY A;  1NSL A;  2ZEM A;  2BSW A;  2Q04 A;  4P45 A;  1YK3 A;  2YNC A;  4MFQ A;  4MI4 A;  5EBV A;  1S3Z A;  2QML A;  3S9M A;  1I12 A;  3SJE A;  3KKW A;  2CNM A;  3BI0 A;  1J4J A;  3R1K A;  4ZY1 A;  1DTD A;  4OP4 A;  3WC7 A;  4MRI A;  2WYR A;  1Q7L A;  4XPL A;  4OC5 A;  4JJX A;  2FIA A;  3IU1 A;  1X12 A;  2AJ6 A;  1Y0R A;  4A37 A;  5LYF A;  1UFH A;  4P6Y A;  2REE A;  2Q51 A;  4BBH A;  4E2A A;  4OC2 A;  5FVJ A;  3VAR A;  4KLV A;  2QEC A;  1LRZ A;  2CXA A;  2RFH A;  5ELY A;  4UFX A;  2P6E A;  3NE8 A;  2ZEG A;  4YGO A;  2PVV A;  1F57 A;  2PQ8 A;  1ON0 A;  5K8O A;  3T8W A;  4OKO A;  2GFQ A;  1CBX A;  2CY2 A;  2PJ1 A;  4A31 A;  4B5P B;  4KOX A;  1KZF A;  1XMT A;  3SXN A;  4NJQ A;  3MGD A;  4CGM A;  3OWC A;  4LQ6 A;  2IJZ A;  1LAP A;  1IYL A;  1LAN A;  4R3K A;  3PBE A;  5K8M A;  4ZY2 A;  2BUE A;  1P0H A;  5EMI A;  1VIX A;  1F2P A;  1QSN A;  2OZH A;  2R1I A;  3H4Q A;  4PPZ A;  3WR7 A;  1ZO0 A;  4MMO A;  4MY0 A;  4UIB A;  2X7B A;  3T90 A;  4F0X A;  2EVN A;  1IIC A;  3IWE A;  3G3S A;  2JLM A;  2OZG A;  4MCS A;  4GM5 A;  3VH9 A;  2EK9 A;  3WC5 A;  4FD4 A;  2B58 A;  1CP6 A;  1RTQ A;  2R8V A;  5CBM A;  2FL4 A;  2ZW6 A;  3NE7 A;  1M4G A;  4NEX A;  3K9T A;  4MFZ A;  2GLJ A;  2C6C A;  4P4B A;  4ZY0 A;  1AYE A;  4H6Z A;  4CGO A;  1Y0Y A;  3W91 A;  2J8N A;  4AVB A;  3FH4 A;  2CTC A;  2V8D A;  3V8I A;  4BMH A;  3CPX A;  1BLL E;  3PRT A;  3FJU A;  1OBR A;  2NSM A;  1Q2Y A;  1TKF A;  1XMB A;  2BL1 A;  3D66 A;  5K8P A;  1Z4R A;  4UWI A;  3SI0 A;  1M4L A;  1PYT B;  3F0A A;  2EBJ A;  3D67 A;  4C2X A;  1R57 A;  1Z5R A;  2DXQ A;  2RB7 A;  1IYK A;  2B4D B;  4AG7 A;  2ZEL A;  1LCP A;  4ONW A;  3QB8 A;  4IK2 A;  2V8G A;  4YFJ A;  1ZG7 A;  3F5B A;  5KTD A;  4HNW B;  2YND A;  4KLW A;  4F8Z A;  2Q43 A;  3FMC A;  3TT2 A;  2ZED A;  4CRZ B;  2VQY A;  2FXF A;  3D3S A;  3BXM A;  4MCP A;  1ELM P;  1JWQ A;  1Y9K A;  3KI9 A;  3GUX A;  3CXS A;  2ABZ A;  4PK3 A;  1YR0 A;  4Q38 A;  1NMT A;  2Q7S A;  3IFE A;  1PCA A;  1ARM A;  3HLP A;  4E0A A;  3PB8 X;  3TC8 A;  2FIW A;  1HDU A;  1P4N A;  3RAM A;  4MHP A;  2GRE A;  4B10 A;  4F9V A;  5AGE A;  4RUH A;  4NFR A;  3G8W A;  1CPX A;  1ARL A;  2R7H A;  4CGP A;  1YW6 A;  1B87 A;  2RC4 A;  3IU2 A;  4MCR A;  4R57 A;  3W6S A;  3S9L A;  2Z0Z A;  3S6G A;  2VXK A;  1BAV A;  2NMT A;  3H8E A;  1IY7 A;  3PB6 X;  4Q36 A;  4KSA A;  4A94 A;  4XPK A;  4CAV A;  8CPA A;  3FYN A;  2DPS A;  4A32 A;  4CRY B;  5ISV A;  3L2N A;  4R76 A;  4CAE A;  3CPA A;  3P2F A;  1IID A;  4P4I A;  2Q4Z A;  2VZZ A;  1M4D A;  4FD5 A;  2VZY A;  4P4J A;  1Y9W A;  4X3R A;  1X10 A;  3MN8 A;  3ZJ0 A;  4ZGY B;  5DWM A;  2C27 A;  1HDQ A;  3DSB A;  1I1D A;  1BOB A;  2G0B A;  4PK2 A;  4M6H A;  4UCP A;  2WPX A;  1S7F A;  2G3A A;  3LWU A;  1QSM A;  4ZYQ A;  3I3G A;  3PGP A;  1ZG8 A;  4HNY B;  3D8P A;  3IWW A;  1YW4 A;  3VWD A;  3PFO A;  4UEF A;  4CGN A;  4JZ0 A;  3H8F A;  3IO1 A;  3ISX A;  4MFL A;  3S9N A;  2JBK A;  3PB4 X;  4L89 A;  5GCN A;  3LOD A;  4KOT A;  2ZEE A;  2CF4 A;  4B13 A;  4DJL A;  5E96 A;  3KHZ A;  1QMU A;  4KVX A;  1TF9 A;  2DPT A;  2Z3N A;  4CS0 B;  4NGP A;  5THW A;  4OID A;  2V8V A;  4U9Z A;  4W9Y A;  3EC4 A;  1XRY A;  1SQH A;  3DNS A;  1ZLH A;  3BHX A;  4XPD B;  5H86 A;  2EWB A;  3B3S A;  4IHM A;  3GKR A;  4FBE A;  2P0W A;  3JRU A;  3QAH A;  2QIR A;  3K2K A;  5C82 A;  4DUK A;  1ELL P;  2B3U A;  2BCO A;  1GHE A;  2C6G A;  3KR5 A;  1S7L A;  4TWE A;  4A95 A;  4LX9 A;  1H8L A;  2B3V A;  3VAT A;  2Z3P A;  3DDD A;  4KOU A;  1MJ9 A;  4M3S A;  4M6G A;  1QSO A;  3TCV A;  3TO6 A;  3RZA A;  1LAM A;  1MJA A;  4PV6 A;  3LAC A;  5D29 A;  2AFO A;  1CP7 A;  1I21 A;  4PXC A;  4YRH A;  3EY5 A;  5IB9 A;  3TOA A;  5I0C A;  4C68 A;  3NA6 A;  4H6U A;  5LYI A;  2REF A;  2WPW A;  2OZU A;  1RXT A;  4NGT A;  4P4E A;  5DWN A;  2PVW A;  4MY3 A;  4I49 A;  4TNU A;  4NGS A;  5KTA A;  4PXB A;  2AE6 A;  2H5M A;  3GYA A;  2XEJ A;  4XPD C;  1R43 A;  2FCK A;  4QC6 A;  5HVH A;  2PJ2 A;  4IF5 A;  3PB9 X;  1OZP A;  2V77 A;  4KUB A;  2B5G A;  1RO5 A;  1CX8 A;  2ZW7 A;  5EC4 A;  4JWP A;  4NSQ A;  1AMP A;  1QSR A;  2GAN A;  3FED A;  4MFP A;  4MHD A;  3H5Z A;  2CTB A;  4R7M A;  4M6I A;  2I00 A;  5JH9 A;  2AFZ A;  4R8F A;  4EFD A;  1Z8W A;  3PZJ A;  4QUS A;  1BO4 A;  4UWJ A;  4AG9 A;  2HC9 A;  1L0C A;  1GYT A;  1HEE A;  2J9A A; 
#chains in the Genus database with same CATH homology
 2HQY A;  4KVM E;  4QVT A;  1Z9U A;  2PDO A;  4MFK A;  1YX0 A;  5HMN A;  4JXQ A;  2IL4 A;  1B6B A;  1S5K A;  4R87 A;  4A30 A;  4Y49 B;  4AVC A;  5IB0 A;  4JD6 A;  1QST A;  5A27 A;  4PSX A;  4C2Y A;  1XF8 A;  2HUZ A;  2FT0 A;  2G3T A;  4UA3 A;  4NCZ A;  2Z3O A;  1M44 A;  4R3L A;  4U5Y A;  5F49 A;  2F5I A;  2GIV A;  1PU9 A;  3TOB A;  2PRB A;  4KOR A;  2Q7B A;  2GE3 A;  5HH1 A;  3BJ8 A;  2WUU A;  2Z3M A;  3E0K A;  1IB1 E;  2CNS A;  2VBQ A;  3P2H A;  2OB0 A;  1Y7R A;  3DR6 A;  4R9M A;  5H84 A;  4A2Z A;  2FSR A;  4Y49 C;  2OU2 A;  1V0C A;  1Z4E A;  4NXY A;  2ARH A;  5IX3 A;  5AG6 A;  2I79 A;  4ZBG A;  4L8A A;  1VKC A;  2P6G A;  4CAX A;  3FB3 A;  1WWZ A;  1S7K A;  4EVY A;  2YNC C;  4LUA A;  2VEZ A;  3EFA A;  3LD2 A;  2Z3K A;  5CNP A;  1N71 A;  1TIQ A;  3S6K A;  2OH1 A;  1MK4 A;  1YVK A;  4KZT A;  4CAW A;  3CXP A;  3CXQ A;  4KUA A;  2ZW5 A;  3EO4 A;  5G22 A;  4B5P A;  1XE4 A;  2Q4V A;  2JEV A;  4RS2 A;  2Q4Y A;  4B12 A;  1YVO A;  2J8R A;  1YLE A;  3R9E A;  4B11 A;  3B8G A;  4GS4 A;  3PP9 A;  3N7Z A;  5G21 A;  3A9L A;  4DNC A;  2PR1 A;  4UBR A;  3C26 A;  4AB7 A;  4M85 A;  1Q2D A;  3GY9 A;  3JVN A;  1VHS A;  2ZPA A;  5BWA B;  3UY5 A;  3R9G A;  2EUI A;  5J8C A;  3I9S A;  4UCM A;  3K9U A;  4II9 A;  1XIX A;  4HNX B;  4RI1 A;  3FIX A;  4NF1 A;  2B4D A;  4U9Y A;  4J3G A;  4CGL A;  1WK4 A;  4AVA A;  3DR8 A;  2ATR A;  1KUV A;  3FNC A;  3FRM A;  3IGR A;  5IV0 A;  3JTK A;  4FD6 A;  2Y0M A;  1MJB A;  4F0Y A;  3RYO A;  3F8K A;  4CYO A;  3BLN A;  4MJ8 A;  2B4B A;  4UFW A;  4OAE A;  2YGW A;  3TO9 A;  4OLL A;  1S60 A;  2PC1 A;  2VI7 A;  2FS5 A;  2Z10 A;  1NE9 A;  5C88 A;  4QB9 A;  4X5K A;  2ZW4 A;  4JLY A;  1M1D A;  1S7N A;  4ONU A;  1FY7 A;  2P6F A;  4KOS A;  5G1Z A;  3D2M A;  1PUA A;  2D4P A;  2Z11 A;  2KCW A;  3FBU A;  4PSW A;  5AG4 A;  4C2Z A;  1CM0 A;  2JDD A;  2A4N A;  4KOW A;  4KS9 A;  2PSW A;  4CYQ A;  4KSF A;  3TTH A;  1CJW A;  2WSA A;  4UFV A;  5J8F A;  5F46 A;  5F48 A;  4B5O A;  3ZZI A;  4C7H A;  4CYP A;  3VWE A;  3JUW A;  2R98 A;  4KVO E;  4CAF A;  1M4I A;  1YRE A;  3SHP A;  5KTC A;  3BJ7 A;  4MFJ A;  3SXO A;  4CYN A;  2PR8 A;  5JPH A;  2HV2 A;  4A33 A;  3IWG A;  4C7I A;  4HKF A;  3TFY A;  2YNE A;  4ORF A;  4MBU A;  2D4O A;  4UCN A;  5JQ4 A;  3TO7 A;  2B5G B;  4XNH B;  5AG5 A;  5A28 A;  4K30 A;  2Z3L A;  3S6F A;  2JDC A;  3R96 A;  1U6M A;  4F6A A;  4OAD A;  2Q44 A;  1XEB A;  2BEI A;  3R9F A;  4FD7 A;  2ZXV A;  3EXN A;  2CNT A;  1KUX A;  1YGH A;  4B14 A;  4H89 A;  1KUY A;  4KOV A;  2FE7 A;  4QBJ A;  2J8M A;  2Q0Y A;  4XNH C;  5G20 A;  3S6H A;  2K5T A;  1K4J A;  4JXR A;  1Q2C A;  5AG7 A;  5F47 A;  3D2P A;  3W6X A;  3TE4 A;  3T9Y A;  4IUS A;  4E8O A;  2O28 A;  3FXT A;  4KOY A;  1NSL A;  2BSW A;  2Q04 A;  1YK3 A;  2YNC A;  4MFQ A;  4MI4 A;  5EBV A;  1S3Z A;  2QML A;  1I12 A;  3KKW A;  2CNM A;  1J4J A;  3R1K A;  4XPL A;  4JJX A;  2FIA A;  3IU1 A;  2AJ6 A;  1UFH A;  2REE A;  4BBH A;  4E2A A;  5FVJ A;  4KLV A;  2QEC A;  1LRZ A;  2CXA A;  4UFX A;  2P6E A;  4YGO A;  2PQ8 A;  1ON0 A;  2CY2 A;  4B5P B;  4A31 A;  4KOX A;  1KZF A;  1XMT A;  3SXN A;  3MGD A;  4CGM A;  3OWC A;  1IYL A;  4R3K A;  2BUE A;  1P0H A;  1QSN A;  2OZH A;  2R1I A;  3H4Q A;  3WR7 A;  1ZO0 A;  4MY0 A;  4F0X A;  2X7B A;  3T90 A;  2EVN A;  1IIC A;  3IWE A;  3G3S A;  2JLM A;  2OZG A;  4FD4 A;  2B58 A;  2R8V A;  2FL4 A;  2ZW6 A;  3NE7 A;  1M4G A;  4NEX A;  4MFZ A;  4H6Z A;  4CGO A;  3W91 A;  2J8N A;  4AVB A;  4BMH A;  3V8I A;  1Q2Y A;  2BL1 A;  1Z4R A;  4UWI A;  3F0A A;  4C2X A;  1R57 A;  2DXQ A;  1IYK A;  2B4D B;  4AG7 A;  3QB8 A;  4YFJ A;  3F5B A;  5KTD A;  4HNW B;  2YND A;  4KLW A;  3TT2 A;  4CRZ B;  2VQY A;  2FXF A;  3D3S A;  1Y9K A;  3CXS A;  4PK3 A;  1YR0 A;  4Q38 A;  1NMT A;  4E0A A;  2FIW A;  1P4N A;  4B10 A;  5AGE A;  3G8W A;  2R7H A;  4CGP A;  4R57 A;  1B87 A;  2RC4 A;  3IU2 A;  3W6S A;  2Z0Z A;  3S6G A;  2VXK A;  2NMT A;  4Q36 A;  4KSA A;  4XPK A;  4CAV A;  3FYN A;  2DPS A;  4A32 A;  4CRY B;  5ISV A;  4CAE A;  3P2F A;  1IID A;  2VZZ A;  1M4D A;  4FD5 A;  2VZY A;  1Y9W A;  3ZJ0 A;  4ZGY B;  5DWM A;  2C27 A;  3DSB A;  1I1D A;  1BOB A;  2G0B A;  4PK2 A;  4UCP A;  2WPX A;  1S7F A;  2G3A A;  1QSM A;  3I3G A;  3PGP A;  4HNY B;  3D8P A;  3VWD A;  4CGN A;  4MFL A;  4L89 A;  5GCN A;  3LOD A;  4KOT A;  4B13 A;  5E96 A;  4KVX A;  2DPT A;  2Z3N A;  4CS0 B;  4U9Z A;  3EC4 A;  1SQH A;  3DNS A;  4XPD B;  5H86 A;  3GKR A;  2P0W A;  3QAH A;  2QIR A;  5C82 A;  2B3U A;  4A95 A;  1GHE A;  1S7L A;  4LX9 A;  2B3V A;  2Z3P A;  3DDD A;  4KOU A;  1MJ9 A;  4M3S A;  3TO6 A;  1QSO A;  3TCV A;  1MJA A;  4PV6 A;  1I21 A;  4YRH A;  3EY5 A;  3TOA A;  5I0C A;  4C68 A;  4H6U A;  2REF A;  2WPW A;  2OZU A;  1RXT A;  5DWN A;  4MY3 A;  4I49 A;  5KTA A;  2AE6 A;  2H5M A;  3GYA A;  4XPD C;  2FCK A;  4QC6 A;  4IF5 A;  1OZP A;  4KUB A;  2B5G A;  1RO5 A;  2ZW7 A;  5EC4 A;  4JWP A;  4NSQ A;  1QSR A;  2GAN A;  4MFP A;  4MHD A;  3H5Z A;  2I00 A;  3PZJ A;  4QUS A;  1BO4 A;  4UWJ A;  4AG9 A;  1L0C A;  3R95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...