5F49A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with malonyl-coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
b'DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 33
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f49A00
4UWIA 2B58A 2JEVA 3VWDA 3PZJA 4MI4A 5C82A 1S60A 2P6GA 2FT0A 3E0KA 4R87A 2BUEA 2I00A 3F0AA 2KCWA 1WK4A 1RXTA 3TTHA 3S6HA 2VBQA 4HNXB 2CY2A 4JD6A 3CXPA 3TFYA 3OWCA 3TOAA 2VI7A 1NMTA 4QUSA 1MJAA 2J8MA 1XEBA 1YLEA 1TIQA 2PQ8A 2ZW7A 2Z11A 4OLLA 2Z10A 5E96A 3DSBA 2PDOA 3CXQA 1IYKA 3FNCA 2R1IA 3TO7A 2CNSA 4KUAA 3T9YA 3IGRA 4R57A 2Q4VA 2G3TA 4XPDC 2Z0ZA 1S7FA 3NE7A 4FD4A 3DR8A 2ZW6A 4UA3A 4H6UA 1YREA 2G0BA 2K5TA 1GHEA 2B3UA 4CRZB 1M4DA 2OH1A 4OAEA 4U5YA 1M4GA 5KTCA 2VEZA 4GS4A 4KVME 3CXSA 4HNWB 4KLWA 2BEIA 4CRYB 2PR8A 2G3AA 4KOXA 2OU2A 4QB9A 1PU9A 4KLVA 4Y49C 4JJXA 3T90A 4IUSA 1IB1E 4KOUA 3TCVA 3VWEA 2Q0YA 3ZJ0A 4AVBA 2ZPAA 1Z4RA 3TT2A 4ORFA 3C26A 1S7KA 2R98A 2JLMA 5H84A 3S6GA 4MJ8A 4DNCA 4MY3A 3K9UA 3D2PA 2X7BA 2A4NA 1CM0A 1P4NA 3D8PA 4QVTA 3GKRA 3PGPA 1I21A 4CAWA 4YGOA 2FE7A 2AE6A 1IICA 3TOBA 4XPKA 4KUBA 5C88A 1Z9UA 3QB8A 2Q44A 1KUXA 5F46A 4YFJA 3JUWA 1OZPA 2F5IA 2JDDA 2Q4YA 2QECA 1L0CA 4B5PB 3RYOA 4L89A 5GCNA 4NEXA 4E0AA 2WPWA 2VZZA 2OB0A 2QMLA 4PK3A 4B5PA 3QAHA 4F0YA 2AJ6A 2EUIA 5EC4A 1Q2CA 1NSLA 1RO5A 2OZUA 3EC4A 4IF5A 1QSRA 1ON0A 4X5KA 4NSQA 2B3VA 1YX0A 1Z4EA 4K30A 2JDCA 2FS5A 2Q7BA 4LX9A 3ZZIA 4ONUA 4AVAA 1QSMA 4UWJA 2O28A 5HH1A 4B5OA 2ATRA 1IYLA 3B8GA 5H86A 1BOBA 3R9FA 4AG9A 4KOWA 3P2FA 5F48A 3SXNA 4PV6A 1MJBA 2P6FA 4M3SA 3W91A 4EVYA 3EXNA 1XE4A 1YGHA 2B4BA 4UBRA 3FIXA 4HKFA 5JPHA 2PR1A 1S3ZA 2VQYA 4U9YA 2ZXVA 2GANA 5KTDA 1QSOA 3BLNA 4FD5A 1LRZA 5I0CA 3WR7A 1V0CA 2FIWA 2Q04A 3TO6A 3F5BA 1U6MA 1NE9A 1CJWA 2ZW4A 4H89A 2RC4A 4QC6A 1MK4A 2Y0MA 3UY5A 2REFA 4MHDA 5J8CA 1P0HA 5DWNA 2R8VA 4JXQA 4RI1A 1WWZA 1M44A 3TO9A 2ARHA 4KVXA 5ISVA 4KVOE 3DDDA 1B6BA 4KORA 1BO4A 1S5KA 3EY5A 1KZFA 2R7HA 3I3GA 4CS0B 4KOSA 3TE4A 1M4IA 1KUVA 2HV2A 1K4JA 5JQ4A 2HQYA 1XMTA 5IX3A 5IB0A 1S7LA 1Y7RA 2VZYA 4XNHB 3FRMA 4E8OA 3FB3A 4U9ZA 3V8IA 2I79A 4PK2A 2FXFA 4FD6A 2ZW5A 3DNSA 1UFHA 3DR6A 3D3SA 4F6AA 3FXTA 4MY0A 3IWGA 2BL1A 2VXKA 4NF1A 5F49A 1J4JA 3F8KA 4YRHA 1FY7A 3R1KA 2D4OA 3W6SA 4BMHA 2FSRA 2GE3A 1Y9KA 2FL4A 3BJ8A 4E2AA 1I12A 2P0WA 4I49A 4NCZA 3G8WA 1M1DA 1XIXA 4J3GA 1IIDA 1MJ9A 4RS2A 4KOYA 4PSWA 3H4QA 4HNYB 3EO4A 3MGDA 2PSWA 1B87A 2B5GB 1PUAA 2BSWA 3R9GA 4XPLA 2C27A 2FCKA 2H5MA 2EVNA 2J8NA 3PP9A 1Q2DA 4KOVA 5KTAA 2OZHA 1SQHA 4FD7A 2B5GA 2IL4A 4CAVA 4JLYA 1QSNA 1VHSA 2D4PA 4XPDB 4NXYA 1YR0A 2REEA 3FBUA 2P6EA 3EFAA 4II9A 5EBVA 4R3LA 2FIAA 4CAXA 2DXQA 2CNMA 3R95A 2GIVA 3D2MA 5FVJA 2NMTA 4M85A 2HUZA 1I1DA 3S6KA 4LUAA 2WPXA 3LODA 4MBUA 4JWPA 4AB7A 4JXRA 3G3SA 2CNTA 4PSXA 4KOTA 3I9SA 4Y49B 3N7ZA 2PC1A 4AVCA 3JVNA 2QIRA 5F47A 4QBJA 3GY9A 3BJ7A 3FYNA 3LD2A 2B4DB 1S7NA 1Q2YA 4XNHC 4R9MA 5HMNA 4KZTA 4AG7A 1YK3A 2J8RA 5J8FA 1Y9WA 2OZGA 3R9EA 4L8AA 3GYAA 1KUYA 2B4DA 3W6XA 3SHPA 3S6FA 1R57A 3R96A 4OADA 1VKCA 3KKWA 4H6ZA 1XF8A 4R3KA 5CNPA 1QSTA 3P2HA 5IV0A 2PRBA 4ZBGA 5DWMA 1N71A 1YVKA 1YVOA 3SXOA
chains in the Genus database with same CATH superfamily
4UWIA 2B58A 2JEVA 5F09A 3VWDA 2G9DA 3BI1A 3PZJA 4MI4A 5C82A 1S60A 2ZENA 1CPXA 3KZWA 2Q43A 2C1CA 1LFWA 2P6GA 4OIDA 2FT0A 3E0KA 4ZY2A 4R87A 3D68A 1HDUA 1VHEA 1M4LA 3GLJA 4X3RA 2BUEA 2I00A 3F0AA 5J1QA 3PFOA 4MFKA 2KCWA 1WK4A 1RXTA 3TTHA 3S6HA 5ELYA 2VBQA 2Z3MA 3D7DA 4HNXB 3JRUA 2CY2A 4JD6A 3CXPA 5AG5A 3VH9A 3TFYA 3OWCA 3TOAA 2VI7A 1NMTA 3FEEA 3FX6A 2PVVA 1XBUA 4QUSA 1MJAA 2J8MA 1Z8LA 2Z3NA 1XEBA 1YLEA 3B35A 1TIQA 2PQ8A 1CP6A 2ZW7A 4NGNA 2Z11A 4CYOA 4OLLA 2Z10A 1YW4A 5E96A 3DSBA 2PDOA 3N5FA 1ZG7A 3CXQA 1IYKA 3HLPA 3FNCA 4MHYA 2BOAA 2R1IA 3TO7A 2CNSA 4KUAA 3T9YA 1IY7A 2JBKA 3IIBA 3IGRA 4R57A 3SJXA 3V38A 1Z5RA 1ZO0A 3RBUA 2Q4VA 2G3TA 4XPDC 4OC3A 4C7HA 3B3TA 2Z0ZA 4M6GA 1S7FA 3NE7A 4FD4A 3DR8A 1VHOA 3I1UA 2DPTA 4F8ZA 2ZW6A 4LQ6A 4UA3A 4H6UA 1YREA 2G0BA 2K5TA 3SI0A 1GHEA 2C6CA 2B3UA 1IOFA 3FEDA 2WZNA 2DF5A 1BPNA 2AFUA 3D7GA 1XRYA 5I4MA 4CRZB 1M4DA 2OH1A 3CDXA 1LAPA 4OAEA 4OC2A 1M4GA 4U5YA 1Z8XA 5KTCA 3PB4X 4MFQA 2VEZA 4GS4A 4KVME 3CXSA 5CPAA 4HNWB 4EMEA 4KLWA 1R43A 4DUKA 5K8OA 2BEIA 4CRYB 2PR8A 2G3AA 1F57A 4UCPA 2RFHA 3SI2A 1IU8A 2ZEGA 4KOXA 2OU2A 4QB9A 1PU9A 4KLVA 4Y49C 4JJXA 3T90A 1Y0YA 4IUSA 4UEFA 3D7FA 2QVPA 1IB1E 4F9UA 4KOUA 3TCVA 3VWEA 3VARA 4BD9A 2Q0YA 3ZJ0A 3WT4A 3RNZA 4AVBA 4Q7AA 3B2YA 4R8FA 1FT7A 2GREA 1H8LA 2YNEA 2ZPAA 1Z4RA 3TT2A 2BCOA 2EK8A 2XEGA 1NSAA 4PXDA 4ORFA 4MFPA 2O4HA 4PPZA 2AFZA 4G1PA 5D8NA 3C26A 4ZY0A 1S7KA 1ELLP 5LYIA 4RUHA 3PBBA 2R98A 3IC1A 1YSJA 5DS0A 5G21A 3IU1A 2JLMA 3IEHA 4ZBGA 5H84A 4UCNA 3S6GA 2PJ0A 3JTKA 4MJ8A 4DNCA 4MY3A 1PYTB 1UWYA 3D2PA 2X7BA 3K9UA 2A4NA 4MCQA 2OR4A 1CM0A 1P4NA 3FJUA 1XMBA 4DYOA 3D8PA 1IGBA 3FVLA 1BLLE 4QVTA 4TNUA 5HVGA 3GKRA 4R6TA 3PGPA 1I21A 4KS9A 4CAWA 4PXEA 2I3CA 4YGOA 2FE7A 3PRTA 2AE6A 1IICA 4MHZA 4UF4A 3TOBA 4P4JA 4XPKA 1CG2A 4ZX8A 3WC5A 4KUBA 5G1ZA 4MHNA 1Z9UA 4CAFA 1YW6A 2Z3LA 5C88A 3QB8A 2QJ8A 2Q44A 1KUXA 5F46A 4YFJA 3KR4A 3JUWA 1TKJA 4B6ZA 1OZPA 4UFWA 2PE3A 3KQZA 2F5IA 2V8VA 3GUXA 2JDDA 2IMOA 3SJEA 2Q4YA 2QECA 2ZOGA 3CPAA 1L0CA 4PXCA 4B5PB 3PFEA 4UIAA 1ZG8A 4L89A 3RYOA 4CAEA 5GCNA 3HUVA 4B13A 2CTBA 4YU9A 3FF3A 3FECA 4NEXA 4E0AA 2JEWA 2WPWA 4A37A 1CX8A 1DE4C 2VZZA 2WUUA 4EFDA 2OB0A 2Q51A 2QMLA 2QYVA 4PK3A 4B5PA 1ZLIA 3V7ZA 5LYFA 3QAHA 4F0YA 2AJ6A 2NYQA 3KR5A 4JZ0A 2EUIA 5EC4A 2Z3KA 1Q2CA 4MRIA 1NSLA 2XEFA 3D67A 4OC1A 1RO5A 2OZUA 4CPAA 3RO0A 3EC4A 3CZXA 3IWWA 3SI1A 1HEEA 4IF5A 4ZY1A 3S9LA 1QSRA 2F7VA 2IQ6A 1ON0A 4F9VA 4X5KA 4NSQA 4FAIA 1A2ZA 1EE3P 4NGPA 2B3VA 1YX0A 1X10A 1Z4EA 4A38A 4K30A 4OC4A 2GU2A 4FBEA 4A94A 2JBJA 2JDCA 1AUGA 3RZAA 2FS5A 2PJ9A 3K2KA 2XEJA 2EK9A 2Q7BA 4LX9A 2V77A 3ZZIA 3L2NA 4C7IA 2PJBA 3B7IA 2ZOFA 4ONUA 4AVAA 4ZGYB 3CT9A 3H8GA 1QSMA 4PQAA 2O28A 4UWJA 5HH1A 5JM6A 4GM5A 5AG4A 4B5OA 3S9NA 2YNCA 2ATRA 4MCSA 1R3NA 1IOIA 4YWYA 2PIYA 1Q7LA 1QQ9A 1Z2LA 3BI0A 3D7HA 1PCAA 2NSMA 1IYLA 3B8GA 5H86A 2PJ3A 1BOBA 4P4DA 4FWUA 5D29A 4M6HA 3R9FA 4AG9A 2V8HA 4KOWA 5BWAB 1ARLA 4W9YA 3P2FA 5F48A 3GB0A 2EBJA 3SXNA 4PV6A 4A32A 4IHMA 4MXUA 1MJBA 1VGYA 3BXMA 4A31A 4X8IA 2P6FA 4M3SA 2OOTA 3W91A 1CBXA 3QAYA 3A9LA 4MMOA 4EVYA 5LRKA 3EXNA 1XE4A 2ZEFA 1GYTA 1BAVA 2CF4A 4C2XA 1YGHA 2B4BA 3NH4A 4UBRA 5JH9A 2F8HA 3FIXA 4HKFA 4R7MA 4A39A 2CTCA 5JPHA 2GLJA 4ZYQA 2PR1A 1S3ZA 5LYDA 5HVHA 2VQYA 4U9YA 2ZXVA 4CGNA 3ISZA 2GANA 3B3WA 4P45A 2PJ2A 5KTDA 3MRUA 1QSOA 4KSFA 1OBRA 3BLNA 3NFZA 4FD5A 3IJ3A 1LRZA 2XEIA 2EWBA 1V0CA 3IO1A 3WR7A 5I0CA 2FIWA 2Q04A 3TO6A 3F5BA 1U6MA 1NE9A 2AFSA 2ZELA 1CJWA 1F2PA 1TKFA 5K8MA 5A28A 2ZW4A 4H89A 4AXVA 2RC4A 1QMUA 1MK4A 4QC6A 4CYQA 2Y0MA 3UY5A 2REFA 4MHDA 5J8CA 4P4IA 5G20A 4LQGA 3H8EA 1P0HA 2ABZA 1DTDA 2Q4ZA 5DWNA 2R8VA 5A27A 4JXQA 4RI1A 2IJZA 1WWZA 1M44A 2J9AA 1TKHA 1AMPA 3IWEA 4H2KA 4IAVA 4ZX9A 2ARHA 3LMSA 3TO9A 4KVXA 2O53A 3KGQA 2ZEMA 5ISVA 4KVOE 4P4BA 4NJQA 3DDDA 1KWMA 1B6BA 4B12A 4KORA 1BO4A 1S5KA 4Q36A 3EY5A 3KHXA 1KZFA 7CPAA 5IB9A 4Z65A 2Q7SA 4GXHA 4CGLA 4MCPA 4OIWA 4NGMA 2R7HA 3I3GA 4OKOA 3NA6A 3TX8A 4CS0B 4A33A 4KOSA 3TE4A 4A2ZA 2CIJA 4MHPA 1M4IA 1KUVA 3DLJA 4C2YA 2PJ6A 2V8DA 2HV2A 2GFQA 2AFMA 4NJRA 1K4JA 5JQ4A 1AYEA 2GLFA 2HQYA 1F2OA 3BHXA 2AFOA 1LCPA 1XMTA 5IX3A 2ZEOA 2Z3PA 5IB0A 2PJ4A 1S7LA 1Y7RA 2VZYA 2PJCA 3QNVA 1BPMA 4M6IA 3NE8A 4NGTA 4XNHB 1RTQA 4UFXA 4C2ZA 2AFWA 3FRMA 5JGFA 3SJFA 2C6GA 4E8OA 3PB9X 3FB3A 4U9ZA 3TC8A 3V8IA 1ARMA 2I79A 3PB7X 1FNOA 4PK2A 4UCMA 4ZI6A 2FXFA 4FUUA 1XJOA 5AG6A 4P44A 2C6PA 3IFEA 2V8GA 4FD6A 4R76A 2ZW5A 3DNSA 3B3SA 3WC6A 1UFHA 3RAMA 4UFVA 3DR6A 3D3SA 4F6AA 3KI9A 3LACA 4WJBA 4NGRA 3FXTA 4MY0A 2VL1A 3IWGA 2BL1A 2VXKA 1LOKA 3DGVA 4NF1A 5F49A 1J4JA 3F8KA 4YRHA 1FY7A 2ZEDA 3PEIA 2D4OA 3R1KA 4B11A 3W6SA 2WSAA 4P6YA 4BMHA 2FSRA 2FVGA 5THWA 4B14A 1Z8WA 2GE3A 1Y9KA 3ISXA 3NH5A 4O23A 2FL4A 3BJ8A 4E2AA 1VIXA 4PXBA 2PJ8A 1I12A 3KQXA 2P0WA 4I49A 2RB7A 4NCZA 3G8WA 1M1DA 1HDQA 3S9MA 3FMCA 4CGOA 1XIXA 4J3GA 4K3NA 1IIDA 1MJ9A 4RS2A 4KOYA 2POKA 4PSWA 3H4QA 4HNYB 3EO4A 1ZG9A 3MGDA 2PSWA 5LRJA 4C68A 1B87A 2B5GB 1PUAA 2BSWA 1TF8A 4OMEA 4XPLA 3R9GA 3WC7A 4EWTA 2C27A 2ZEHA 2ZEEA 2BO9A 2FCKA 2EVNA 2H5MA 4HPSA 5CBMA 2J8NA 3PP9A 2ODFA 1ZLHA 4BINA 4MFJA 1JQGA 1Q2DA 4KOVA 5AGEA 5KTAA 2PCUA 2OZHA 1SQHA 4FD7A 4IK2A 4NFRA 2B5GA 1JWQA 4A95A 4Q38A 2IL4A 4CAVA 3CPXA 1X12A 1Z8TA 5HVFA 3KASA 2PJ7A 2DEAA 4JLYA 2AFXA 1QSNA 1VHSA 2D4PA 3B3CA 4NXYA 1YR0A 4XPDB 2REEA 3FH4A 3KHZA 3FBUA 2ZEPA 3K9TA 2P6EA 3EFAA 3SJGA 4CYPA 5LYLA 1YLOA 4II9A 5EBVA 1ELMP 3PB8X 2EO8A 4KSAA 4R3LA 2FIAA 6CPAA 1LANA 3T8WA 4CAXA 2DXQA 2CNMA 4OC5A 4MFLA 4UIBA 3R95A 2GIVA 1YQEA 4KSIA 4OP4A 3D2MA 3D4UA 5FVJA 4B10A 2NMTA 1YMEA 4RN7A 2PRQA 1LAMA 4M85A 2HUZA 3LWUA 1XFOA 1I1DA 4OC0A 4CGPA 3S6KA 4X2TA 3GIUA 3MN8A 4LUAA 4ONWA 2WPXA 3LODA 4MBUA 3D66A 4JWPA 4AB7A 5HXDA 2HB6A 3PBEA 4JXRA 5G22A 4JYWA 3G3SA 2CNTA 4PSXA 4KOTA 3I9SA 4Y49B 1TF9A 2YNDA 3N7ZA 2PC1A 4A30A 2Z3OA 4AVCA 3JVNA 2HC9A 2QIRA 5F47A 4QBJA 2PJ5A 3BJ7A 3FYNA 3GY9A 3LD2A 3VATA 3WABA 2B4DB 2PVWA 1S7NA 1Q2YA 4XNHC 4R9MA 5HMNA 5K8PA 4KZTA 4P4FA 1XOVA 4AG7A 5K8NA 1CPSA 2YGWA 1YK3A 2J8RA 2PIZA 5J8FA 4CGMA 1Y9WA 2OZGA 4P10A 3R9EA 4L8AA 3GYAA 4CYNA 1KUYA 2B4DA 3W6XA 2CXAA 3SHPA 4MCRA 3S6FA 1R57A 3R96A 2PJAA 1CP7A 4OADA 2WYRA 1VKCA 3KKWA 8CPAA 4BBHA 4H6ZA 4DJLA 2PJ1A 1Y0RA 4F0XA 5EMIA 1XF8A 4R3KA 3H8FA 4TWEA 5CNPA 1QSTA 3P2HA 4MFZA 4NGSA 4UEZA 5IV0A 2DPSA 2PRBA 3H5ZA 5DWMA 3KL9A 4NGQA 1Y7EA 1N71A 1YVKA 2YNCC 3B3VA 1YVOA 3IU2A 3NH8A 3PB6X 4UEEA 5LRGA 1TXRA 3SXOA 2ANPA 4P4EA 4WWVA 5AG7A
chains in the Genus database with same CATH topology
4UWIA 2B58A 2JEVA 3VWDA 3PZJA 4MI4A 5C82A 1S60A 2P6GA 2FT0A 3E0KA 4R87A 2BUEA 2I00A 3F0AA 4MFKA 2KCWA 1WK4A 1RXTA 3TTHA 3S6HA 2VBQA 2Z3MA 4HNXB 2CY2A 4JD6A 3CXPA 5AG5A 3TFYA 3OWCA 3TOAA 2VI7A 1NMTA 4QUSA 1MJAA 2J8MA 2Z3NA 1XEBA 1YLEA 1TIQA 2PQ8A 2ZW7A 2Z11A 4CYOA 4OLLA 2Z10A 5E96A 3DSBA 2PDOA 3CXQA 1IYKA 3FNCA 2R1IA 3TO7A 2CNSA 4KUAA 3T9YA 3IGRA 4R57A 1ZO0A 2Q4VA 2G3TA 4XPDC 4C7HA 2Z0ZA 1S7FA 3NE7A 4FD4A 3DR8A 2DPTA 2ZW6A 4UA3A 4H6UA 1YREA 2G0BA 2K5TA 1GHEA 2B3UA 4CRZB 1M4DA 2OH1A 4OAEA 4U5YA 1M4GA 5KTCA 4MFQA 2VEZA 4GS4A 4KVME 3CXSA 4HNWB 4KLWA 2BEIA 4CRYB 2PR8A 2G3AA 4UCPA 4KOXA 2OU2A 4QB9A 1PU9A 4KLVA 4Y49C 4JJXA 3T90A 4IUSA 1IB1E 4KOUA 3TCVA 3VWEA 2Q0YA 3ZJ0A 4AVBA 2YNEA 2ZPAA 1Z4RA 3TT2A 4ORFA 4MFPA 3C26A 1S7KA 2R98A 5G21A 3IU1A 2JLMA 5H84A 4UCNA 3S6GA 3JTKA 4MJ8A 4DNCA 4MY3A 3K9UA 3D2PA 2X7BA 2A4NA 1CM0A 1P4NA 3D8PA 4QVTA 3GKRA 3PGPA 1I21A 4KS9A 4CAWA 4YGOA 2FE7A 2AE6A 1IICA 3TOBA 4XPKA 4KUBA 5G1ZA 5C88A 1Z9UA 4CAFA 2Z3LA 3QB8A 2Q44A 1KUXA 5F46A 4YFJA 3JUWA 1OZPA 4UFWA 2F5IA 2JDDA 2Q4YA 2QECA 1L0CA 4B5PB 3RYOA 4L89A 5GCNA 4B13A 4NEXA 4E0AA 2WPWA 2VZZA 2WUUA 2OB0A 2QMLA 4PK3A 4B5PA 3QAHA 4F0YA 2AJ6A 2EUIA 5EC4A 2Z3KA 1Q2CA 1NSLA 1RO5A 2OZUA 3EC4A 4IF5A 1QSRA 1ON0A 4X5KA 4NSQA 2B3VA 1YX0A 1Z4EA 4K30A 2JDCA 2FS5A 2Q7BA 4LX9A 3ZZIA 4C7IA 4ONUA 4AVAA 4ZGYB 1QSMA 4UWJA 2O28A 5HH1A 5AG4A 4B5OA 2YNCA 2ATRA 1IYLA 3B8GA 5H86A 1BOBA 3R9FA 4AG9A 4KOWA 5BWAB 3P2FA 5F48A 4A32A 3SXNA 4PV6A 4CAEA 1MJBA 4A31A 2P6FA 4M3SA 3W91A 3A9LA 4EVYA 3EXNA 1XE4A 4C2XA 1YGHA 2B4BA 4UBRA 3FIXA 4HKFA 5JPHA 2PR1A 1S3ZA 2VQYA 4U9YA 2ZXVA 4CGNA 2GANA 5KTDA 1QSOA 4KSFA 3BLNA 4FD5A 1LRZA 5I0CA 3WR7A 1V0CA 2FIWA 2Q04A 3TO6A 3F5BA 1U6MA 1NE9A 1CJWA 5A28A 2ZW4A 4H89A 2RC4A 4QC6A 1MK4A 4CYQA 2Y0MA 3UY5A 2REFA 4MHDA 5J8CA 5G20A 5A27A 1P0HA 5DWNA 2R8VA 4JXQA 4RI1A 1WWZA 1M44A 3TO9A 3IWEA 2ARHA 4KVXA 5ISVA 4KVOE 3DDDA 1B6BA 4B12A 4KORA 1BO4A 1S5KA 4Q36A 3EY5A 1KZFA 4CGLA 2R7HA 3I3GA 4CS0B 4A33A 4KOSA 3TE4A 4A2ZA 1M4IA 1KUVA 4C2YA 2HV2A 1K4JA 5JQ4A 2HQYA 1XMTA 5IX3A 2Z3PA 5IB0A 1S7LA 1Y7RA 2VZYA 4XNHB 4UFXA 4C2ZA 3FRMA 4E8OA 3FB3A 4U9ZA 3V8IA 2I79A 4UCMA 4PK2A 2FXFA 5AG6A 4FD6A 2ZW5A 3DNSA 1UFHA 4UFVA 3DR6A 3D3SA 4F6AA 3FXTA 4MY0A 3IWGA 2BL1A 2VXKA 4NF1A 5F49A 1J4JA 3F8KA 4YRHA 1FY7A 3R1KA 2D4OA 4B11A 3W6SA 2WSAA 4BMHA 2FSRA 4B14A 2GE3A 1Y9KA 2FL4A 3BJ8A 4E2AA 1I12A 2P0WA 4I49A 4NCZA 3G8WA 1M1DA 4CGOA 1XIXA 4J3GA 1IIDA 1MJ9A 4RS2A 4KOYA 4PSWA 3H4QA 4HNYB 3EO4A 3MGDA 2PSWA 4C68A 1B87A 2B5GB 1PUAA 2BSWA 3R9GA 4XPLA 2C27A 2FCKA 2H5MA 2EVNA 2J8NA 3PP9A 4MFJA 1Q2DA 4KOVA 5AGEA 5KTAA 2OZHA 1SQHA 4FD7A 2B5GA 4A95A 4Q38A 2IL4A 4CAVA 4JLYA 1QSNA 1VHSA 2D4PA 4XPDB 4NXYA 1YR0A 2REEA 3FBUA 2P6EA 3EFAA 4CYPA 4II9A 5EBVA 4KSAA 4R3LA 2FIAA 4CAXA 2DXQA 2CNMA 4MFLA 3R95A 2GIVA 3D2MA 4B10A 5FVJA 2NMTA 4M85A 2HUZA 1I1DA 4CGPA 3S6KA 4LUAA 2WPXA 3LODA 4MBUA 4JWPA 4AB7A 4JXRA 5G22A 3G3SA 2CNTA 4PSXA 4KOTA 3I9SA 4Y49B 2YNDA 3N7ZA 2PC1A 4A30A 2Z3OA 4AVCA 3JVNA 2QIRA 5F47A 4QBJA 3GY9A 3BJ7A 3FYNA 3LD2A 2B4DB 1S7NA 1Q2YA 4XNHC 4R9MA 5HMNA 4KZTA 4AG7A 2YGWA 1YK3A 2J8RA 5J8FA 4CGMA 1Y9WA 2OZGA 3R9EA 4L8AA 3GYAA 4CYNA 1KUYA 2B4DA 3W6XA 2CXAA 3SHPA 3S6FA 1R57A 3R96A 4OADA 1VKCA 3KKWA 4BBHA 4H6ZA 4F0XA 1XF8A 4R3KA 5CNPA 1QSTA 3P2HA 4MFZA 5IV0A 2DPSA 2PRBA 3H5ZA 5DWMA 4ZBGA 2YNCC 1N71A 1YVKA 3IU2A 1YVOA 3SXOA 5AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWI A;  2B58 A;  2JEV A;  3VWD A;  3PZJ A;  4MI4 A;  5C82 A;  1S60 A;  2P6G A;  2FT0 A;  3E0K A;  4R87 A;  2BUE A;  2I00 A;  3F0A A;  2KCW A;  1WK4 A;  1RXT A;  3TTH A;  3S6H A;  2VBQ A;  4HNX B;  2CY2 A;  4JD6 A;  3CXP A;  3TFY A;  3OWC A;  3TOA A;  2VI7 A;  1NMT A;  4QUS A;  1MJA A;  2J8M A;  1XEB A;  1YLE A;  1TIQ A;  2PQ8 A;  2ZW7 A;  2Z11 A;  4OLL A;  2Z10 A;  5E96 A;  3DSB A;  2PDO A;  3CXQ A;  1IYK A;  3FNC A;  2R1I A;  3TO7 A;  2CNS A;  4KUA A;  3T9Y A;  3IGR A;  4R57 A;  2Q4V A;  2G3T A;  4XPD C;  2Z0Z A;  1S7F A;  3NE7 A;  4FD4 A;  3DR8 A;  2ZW6 A;  4UA3 A;  4H6U A;  1YRE A;  2G0B A;  2K5T A;  1GHE A;  2B3U A;  4CRZ B;  1M4D A;  2OH1 A;  4OAE A;  4U5Y A;  1M4G A;  5KTC A;  2VEZ A;  4GS4 A;  4KVM E;  3CXS A;  4HNW B;  4KLW A;  2BEI A;  4CRY B;  2PR8 A;  2G3A A;  4KOX A;  2OU2 A;  4QB9 A;  1PU9 A;  4KLV A;  4Y49 C;  4JJX A;  3T90 A;  4IUS A;  1IB1 E;  4KOU A;  3TCV A;  3VWE A;  2Q0Y A;  3ZJ0 A;  4AVB A;  2ZPA A;  1Z4R A;  3TT2 A;  4ORF A;  3C26 A;  1S7K A;  2R98 A;  2JLM A;  5H84 A;  3S6G A;  4MJ8 A;  4DNC A;  4MY3 A;  3K9U A;  3D2P A;  2X7B A;  2A4N A;  1CM0 A;  1P4N A;  3D8P A;  4QVT A;  3GKR A;  3PGP A;  1I21 A;  4CAW A;  4YGO A;  2FE7 A;  2AE6 A;  1IIC A;  3TOB A;  4XPK A;  4KUB A;  5C88 A;  1Z9U A;  3QB8 A;  2Q44 A;  1KUX A;  5F46 A;  4YFJ A;  3JUW A;  1OZP A;  2F5I A;  2JDD A;  2Q4Y A;  2QEC A;  1L0C A;  4B5P B;  3RYO A;  4L89 A;  5GCN A;  4NEX A;  4E0A A;  2WPW A;  2VZZ A;  2OB0 A;  2QML A;  4PK3 A;  4B5P A;  3QAH A;  4F0Y A;  2AJ6 A;  2EUI A;  5EC4 A;  1Q2C A;  1NSL A;  1RO5 A;  2OZU A;  3EC4 A;  4IF5 A;  1QSR A;  1ON0 A;  4X5K A;  4NSQ A;  2B3V A;  1YX0 A;  1Z4E A;  4K30 A;  2JDC A;  2FS5 A;  2Q7B A;  4LX9 A;  3ZZI A;  4ONU A;  4AVA A;  1QSM A;  4UWJ A;  2O28 A;  5HH1 A;  4B5O A;  2ATR A;  1IYL A;  3B8G A;  5H86 A;  1BOB A;  3R9F A;  4AG9 A;  4KOW A;  3P2F A;  5F48 A;  3SXN A;  4PV6 A;  1MJB A;  2P6F A;  4M3S A;  3W91 A;  4EVY A;  3EXN A;  1XE4 A;  1YGH A;  2B4B A;  4UBR A;  3FIX A;  4HKF A;  5JPH A;  2PR1 A;  1S3Z A;  2VQY A;  4U9Y A;  2ZXV A;  2GAN A;  5KTD A;  1QSO A;  3BLN A;  4FD5 A;  1LRZ A;  5I0C A;  3WR7 A;  1V0C A;  2FIW A;  2Q04 A;  3TO6 A;  3F5B A;  1U6M A;  1NE9 A;  1CJW A;  2ZW4 A;  4H89 A;  2RC4 A;  4QC6 A;  1MK4 A;  2Y0M A;  3UY5 A;  2REF A;  4MHD A;  5J8C A;  1P0H A;  5DWN A;  2R8V A;  4JXQ A;  4RI1 A;  1WWZ A;  1M44 A;  3TO9 A;  2ARH A;  4KVX A;  5ISV A;  4KVO E;  3DDD A;  1B6B A;  4KOR A;  1BO4 A;  1S5K A;  3EY5 A;  1KZF A;  2R7H A;  3I3G A;  4CS0 B;  4KOS A;  3TE4 A;  1M4I A;  1KUV A;  2HV2 A;  1K4J A;  5JQ4 A;  2HQY A;  1XMT A;  5IX3 A;  5IB0 A;  1S7L A;  1Y7R A;  2VZY A;  4XNH B;  3FRM A;  4E8O A;  3FB3 A;  4U9Z A;  3V8I A;  2I79 A;  4PK2 A;  2FXF A;  4FD6 A;  2ZW5 A;  3DNS A;  1UFH A;  3DR6 A;  3D3S A;  4F6A A;  3FXT A;  4MY0 A;  3IWG A;  2BL1 A;  2VXK A;  4NF1 A;  5F49 A;  1J4J A;  3F8K A;  4YRH A;  1FY7 A;  3R1K A;  2D4O A;  3W6S A;  4BMH A;  2FSR A;  2GE3 A;  1Y9K A;  2FL4 A;  3BJ8 A;  4E2A A;  1I12 A;  2P0W A;  4I49 A;  4NCZ A;  3G8W A;  1M1D A;  1XIX A;  4J3G A;  1IID A;  1MJ9 A;  4RS2 A;  4KOY A;  4PSW A;  3H4Q A;  4HNY B;  3EO4 A;  3MGD A;  2PSW A;  1B87 A;  2B5G B;  1PUA A;  2BSW A;  3R9G A;  4XPL A;  2C27 A;  2FCK A;  2H5M A;  2EVN A;  2J8N A;  3PP9 A;  1Q2D A;  4KOV A;  5KTA A;  2OZH A;  1SQH A;  4FD7 A;  2B5G A;  2IL4 A;  4CAV A;  4JLY A;  1QSN A;  1VHS A;  2D4P A;  4XPD B;  4NXY A;  1YR0 A;  2REE A;  3FBU A;  2P6E A;  3EFA A;  4II9 A;  5EBV A;  4R3L A;  2FIA A;  4CAX A;  2DXQ A;  2CNM A;  3R95 A;  2GIV A;  3D2M A;  5FVJ A;  2NMT A;  4M85 A;  2HUZ A;  1I1D A;  3S6K A;  4LUA A;  2WPX A;  3LOD A;  4MBU A;  4JWP A;  4AB7 A;  4JXR A;  3G3S A;  2CNT A;  4PSX A;  4KOT A;  3I9S A;  4Y49 B;  3N7Z A;  2PC1 A;  4AVC A;  3JVN A;  2QIR A;  5F47 A;  4QBJ A;  3GY9 A;  3BJ7 A;  3FYN A;  3LD2 A;  2B4D B;  1S7N A;  1Q2Y A;  4XNH C;  4R9M A;  5HMN A;  4KZT A;  4AG7 A;  1YK3 A;  2J8R A;  5J8F A;  1Y9W A;  2OZG A;  3R9E A;  4L8A A;  3GYA A;  1KUY A;  2B4D A;  3W6X A;  3SHP A;  3S6F A;  1R57 A;  3R96 A;  4OAD A;  1VKC A;  3KKW A;  4H6Z A;  1XF8 A;  4R3K A;  5CNP A;  1QST A;  3P2H A;  5IV0 A;  2PRB A;  4ZBG A;  5DWM A;  1N71 A;  1YVK A;  1YVO A;  3SXO A; 
#chains in the Genus database with same CATH topology
 4UWI A;  2B58 A;  2JEV A;  5F09 A;  3VWD A;  2G9D A;  3BI1 A;  3PZJ A;  4MI4 A;  5C82 A;  1S60 A;  2ZEN A;  1CPX A;  3KZW A;  2Q43 A;  2C1C A;  1LFW A;  2P6G A;  4OID A;  2FT0 A;  3E0K A;  4ZY2 A;  4R87 A;  3D68 A;  1HDU A;  1VHE A;  1M4L A;  3GLJ A;  4X3R A;  2BUE A;  2I00 A;  3F0A A;  5J1Q A;  3PFO A;  4MFK A;  2KCW A;  1WK4 A;  1RXT A;  3TTH A;  3S6H A;  5ELY A;  2VBQ A;  2Z3M A;  3D7D A;  4HNX B;  3JRU A;  2CY2 A;  4JD6 A;  3CXP A;  5AG5 A;  3VH9 A;  3TFY A;  3OWC A;  3TOA A;  2VI7 A;  1NMT A;  3FEE A;  3FX6 A;  2PVV A;  1XBU A;  4QUS A;  1MJA A;  2J8M A;  1Z8L A;  2Z3N A;  1XEB A;  1YLE A;  3B35 A;  1TIQ A;  2PQ8 A;  1CP6 A;  2ZW7 A;  4NGN A;  2Z11 A;  4CYO A;  4OLL A;  2Z10 A;  1YW4 A;  5E96 A;  3DSB A;  2PDO A;  3N5F A;  1ZG7 A;  3CXQ A;  1IYK A;  3HLP A;  3FNC A;  4MHY A;  2BOA A;  2R1I A;  3TO7 A;  2CNS A;  4KUA A;  3T9Y A;  1IY7 A;  2JBK A;  3IIB A;  3IGR A;  4R57 A;  3SJX A;  3V38 A;  1Z5R A;  1ZO0 A;  3RBU A;  2Q4V A;  2G3T A;  4XPD C;  4OC3 A;  4C7H A;  3B3T A;  2Z0Z A;  4M6G A;  1S7F A;  3NE7 A;  4FD4 A;  3DR8 A;  1VHO A;  3I1U A;  2DPT A;  4F8Z A;  2ZW6 A;  4LQ6 A;  4UA3 A;  4H6U A;  1YRE A;  2G0B A;  2K5T A;  3SI0 A;  1GHE A;  2C6C A;  2B3U A;  1IOF A;  3FED A;  2WZN A;  2DF5 A;  1BPN A;  2AFU A;  3D7G A;  1XRY A;  5I4M A;  4CRZ B;  1M4D A;  2OH1 A;  3CDX A;  1LAP A;  4OAE A;  4OC2 A;  1M4G A;  4U5Y A;  1Z8X A;  5KTC A;  3PB4 X;  4MFQ A;  2VEZ A;  4GS4 A;  4KVM E;  3CXS A;  5CPA A;  4HNW B;  4EME A;  4KLW A;  1R43 A;  4DUK A;  5K8O A;  2BEI A;  4CRY B;  2PR8 A;  2G3A A;  1F57 A;  4UCP A;  2RFH A;  3SI2 A;  1IU8 A;  2ZEG A;  4KOX A;  2OU2 A;  4QB9 A;  1PU9 A;  4KLV A;  4Y49 C;  4JJX A;  3T90 A;  1Y0Y A;  4IUS A;  4UEF A;  3D7F A;  2QVP A;  1IB1 E;  4F9U A;  4KOU A;  3TCV A;  3VWE A;  3VAR A;  4BD9 A;  2Q0Y A;  3ZJ0 A;  3WT4 A;  3RNZ A;  4AVB A;  4Q7A A;  3B2Y A;  4R8F A;  1FT7 A;  2GRE A;  1H8L A;  2YNE A;  2ZPA A;  1Z4R A;  3TT2 A;  2BCO A;  2EK8 A;  2XEG A;  1NSA A;  4PXD A;  4ORF A;  4MFP A;  2O4H A;  4PPZ A;  2AFZ A;  4G1P A;  5D8N A;  3C26 A;  4ZY0 A;  1S7K A;  1ELL P;  5LYI A;  4RUH A;  3PBB A;  2R98 A;  3IC1 A;  1YSJ A;  5DS0 A;  5G21 A;  3IU1 A;  2JLM A;  3IEH A;  4ZBG A;  5H84 A;  4UCN A;  3S6G A;  2PJ0 A;  3JTK A;  4MJ8 A;  4DNC A;  4MY3 A;  1PYT B;  1UWY A;  3D2P A;  2X7B A;  3K9U A;  2A4N A;  4MCQ A;  2OR4 A;  1CM0 A;  1P4N A;  3FJU A;  1XMB A;  4DYO A;  3D8P A;  1IGB A;  3FVL A;  1BLL E;  4QVT A;  4TNU A;  5HVG A;  3GKR A;  4R6T A;  3PGP A;  1I21 A;  4KS9 A;  4CAW A;  4PXE A;  2I3C A;  4YGO A;  2FE7 A;  3PRT A;  2AE6 A;  1IIC A;  4MHZ A;  4UF4 A;  3TOB A;  4P4J A;  4XPK A;  1CG2 A;  4ZX8 A;  3WC5 A;  4KUB A;  5G1Z A;  4MHN A;  1Z9U A;  4CAF A;  1YW6 A;  2Z3L A;  5C88 A;  3QB8 A;  2QJ8 A;  2Q44 A;  1KUX A;  5F46 A;  4YFJ A;  3KR4 A;  3JUW A;  1TKJ A;  4B6Z A;  1OZP A;  4UFW A;  2PE3 A;  3KQZ A;  2F5I A;  2V8V A;  3GUX A;  2JDD A;  2IMO A;  3SJE A;  2Q4Y A;  2QEC A;  2ZOG A;  3CPA A;  1L0C A;  4PXC A;  4B5P B;  3PFE A;  4UIA A;  1ZG8 A;  4L89 A;  3RYO A;  4CAE A;  5GCN A;  3HUV A;  4B13 A;  2CTB A;  4YU9 A;  3FF3 A;  3FEC A;  4NEX A;  4E0A A;  2JEW A;  2WPW A;  4A37 A;  1CX8 A;  1DE4 C;  2VZZ A;  2WUU A;  4EFD A;  2OB0 A;  2Q51 A;  2QML A;  2QYV A;  4PK3 A;  4B5P A;  1ZLI A;  3V7Z A;  5LYF A;  3QAH A;  4F0Y A;  2AJ6 A;  2NYQ A;  3KR5 A;  4JZ0 A;  2EUI A;  5EC4 A;  2Z3K A;  1Q2C A;  4MRI A;  1NSL A;  2XEF A;  3D67 A;  4OC1 A;  1RO5 A;  2OZU A;  4CPA A;  3RO0 A;  3EC4 A;  3CZX A;  3IWW A;  3SI1 A;  1HEE A;  4IF5 A;  4ZY1 A;  3S9L A;  1QSR A;  2F7V A;  2IQ6 A;  1ON0 A;  4F9V A;  4X5K A;  4NSQ A;  4FAI A;  1A2Z A;  1EE3 P;  4NGP A;  2B3V A;  1YX0 A;  1X10 A;  1Z4E A;  4A38 A;  4K30 A;  4OC4 A;  2GU2 A;  4FBE A;  4A94 A;  2JBJ A;  2JDC A;  1AUG A;  3RZA A;  2FS5 A;  2PJ9 A;  3K2K A;  2XEJ A;  2EK9 A;  2Q7B A;  4LX9 A;  2V77 A;  3ZZI A;  3L2N A;  4C7I A;  2PJB A;  3B7I A;  2ZOF A;  4ONU A;  4AVA A;  4ZGY B;  3CT9 A;  3H8G A;  1QSM A;  4PQA A;  2O28 A;  4UWJ A;  5HH1 A;  5JM6 A;  4GM5 A;  5AG4 A;  4B5O A;  3S9N A;  2YNC A;  2ATR A;  4MCS A;  1R3N A;  1IOI A;  4YWY A;  2PIY A;  1Q7L A;  1QQ9 A;  1Z2L A;  3BI0 A;  3D7H A;  1PCA A;  2NSM A;  1IYL A;  3B8G A;  5H86 A;  2PJ3 A;  1BOB A;  4P4D A;  4FWU A;  5D29 A;  4M6H A;  3R9F A;  4AG9 A;  2V8H A;  4KOW A;  5BWA B;  1ARL A;  4W9Y A;  3P2F A;  5F48 A;  3GB0 A;  2EBJ A;  3SXN A;  4PV6 A;  4A32 A;  4IHM A;  4MXU A;  1MJB A;  1VGY A;  3BXM A;  4A31 A;  4X8I A;  2P6F A;  4M3S A;  2OOT A;  3W91 A;  1CBX A;  3QAY A;  3A9L A;  4MMO A;  4EVY A;  5LRK A;  3EXN A;  1XE4 A;  2ZEF A;  1GYT A;  1BAV A;  2CF4 A;  4C2X A;  1YGH A;  2B4B A;  3NH4 A;  4UBR A;  5JH9 A;  2F8H A;  3FIX A;  4HKF A;  4R7M A;  4A39 A;  2CTC A;  5JPH A;  2GLJ A;  4ZYQ A;  2PR1 A;  1S3Z A;  5LYD A;  5HVH A;  2VQY A;  4U9Y A;  2ZXV A;  4CGN A;  3ISZ A;  2GAN A;  3B3W A;  4P45 A;  2PJ2 A;  5KTD A;  3MRU A;  1QSO A;  4KSF A;  1OBR A;  3BLN A;  3NFZ A;  4FD5 A;  3IJ3 A;  1LRZ A;  2XEI A;  2EWB A;  1V0C A;  3IO1 A;  3WR7 A;  5I0C A;  2FIW A;  2Q04 A;  3TO6 A;  3F5B A;  1U6M A;  1NE9 A;  2AFS A;  2ZEL A;  1CJW A;  1F2P A;  1TKF A;  5K8M A;  5A28 A;  2ZW4 A;  4H89 A;  4AXV A;  2RC4 A;  1QMU A;  1MK4 A;  4QC6 A;  4CYQ A;  2Y0M A;  3UY5 A;  2REF A;  4MHD A;  5J8C A;  4P4I A;  5G20 A;  4LQG A;  3H8E A;  1P0H A;  2ABZ A;  1DTD A;  2Q4Z A;  5DWN A;  2R8V A;  5A27 A;  4JXQ A;  4RI1 A;  2IJZ A;  1WWZ A;  1M44 A;  2J9A A;  1TKH A;  1AMP A;  3IWE A;  4H2K A;  4IAV A;  4ZX9 A;  2ARH A;  3LMS A;  3TO9 A;  4KVX A;  2O53 A;  3KGQ A;  2ZEM A;  5ISV A;  4KVO E;  4P4B A;  4NJQ A;  3DDD A;  1KWM A;  1B6B A;  4B12 A;  4KOR A;  1BO4 A;  1S5K A;  4Q36 A;  3EY5 A;  3KHX A;  1KZF A;  7CPA A;  5IB9 A;  4Z65 A;  2Q7S A;  4GXH A;  4CGL A;  4MCP A;  4OIW A;  4NGM A;  2R7H A;  3I3G A;  4OKO A;  3NA6 A;  3TX8 A;  4CS0 B;  4A33 A;  4KOS A;  3TE4 A;  4A2Z A;  2CIJ A;  4MHP A;  1M4I A;  1KUV A;  3DLJ A;  4C2Y A;  2PJ6 A;  2V8D A;  2HV2 A;  2GFQ A;  2AFM A;  4NJR A;  1K4J A;  5JQ4 A;  1AYE A;  2GLF A;  2HQY A;  1F2O A;  3BHX A;  2AFO A;  1LCP A;  1XMT A;  5IX3 A;  2ZEO A;  2Z3P A;  5IB0 A;  2PJ4 A;  1S7L A;  1Y7R A;  2VZY A;  2PJC A;  3QNV A;  1BPM A;  4M6I A;  3NE8 A;  4NGT A;  4XNH B;  1RTQ A;  4UFX A;  4C2Z A;  2AFW A;  3FRM A;  5JGF A;  3SJF A;  2C6G A;  4E8O A;  3PB9 X;  3FB3 A;  4U9Z A;  3TC8 A;  3V8I A;  1ARM A;  2I79 A;  3PB7 X;  1FNO A;  4PK2 A;  4UCM A;  4ZI6 A;  2FXF A;  4FUU A;  1XJO A;  5AG6 A;  4P44 A;  2C6P A;  3IFE A;  2V8G A;  4FD6 A;  4R76 A;  2ZW5 A;  3DNS A;  3B3S A;  3WC6 A;  1UFH A;  3RAM A;  4UFV A;  3DR6 A;  3D3S A;  4F6A A;  3KI9 A;  3LAC A;  4WJB A;  4NGR A;  3FXT A;  4MY0 A;  2VL1 A;  3IWG A;  2BL1 A;  2VXK A;  1LOK A;  3DGV A;  4NF1 A;  5F49 A;  1J4J A;  3F8K A;  4YRH A;  1FY7 A;  2ZED A;  3PEI A;  2D4O A;  3R1K A;  4B11 A;  3W6S A;  2WSA A;  4P6Y A;  4BMH A;  2FSR A;  2FVG A;  5THW A;  4B14 A;  1Z8W A;  2GE3 A;  1Y9K A;  3ISX A;  3NH5 A;  4O23 A;  2FL4 A;  3BJ8 A;  4E2A A;  1VIX A;  4PXB A;  2PJ8 A;  1I12 A;  3KQX A;  2P0W A;  4I49 A;  2RB7 A;  4NCZ A;  3G8W A;  1M1D A;  1HDQ A;  3S9M A;  3FMC A;  4CGO A;  1XIX A;  4J3G A;  4K3N A;  1IID A;  1MJ9 A;  4RS2 A;  4KOY A;  2POK A;  4PSW A;  3H4Q A;  4HNY B;  3EO4 A;  1ZG9 A;  3MGD A;  2PSW A;  5LRJ A;  4C68 A;  1B87 A;  2B5G B;  1PUA A;  2BSW A;  1TF8 A;  4OME A;  4XPL A;  3R9G A;  3WC7 A;  4EWT A;  2C27 A;  2ZEH A;  2ZEE A;  2BO9 A;  2FCK A;  2EVN A;  2H5M A;  4HPS A;  5CBM A;  2J8N A;  3PP9 A;  2ODF A;  1ZLH A;  4BIN A;  4MFJ A;  1JQG A;  1Q2D A;  4KOV A;  5AGE A;  5KTA A;  2PCU A;  2OZH A;  1SQH A;  4FD7 A;  4IK2 A;  4NFR A;  2B5G A;  1JWQ A;  4A95 A;  4Q38 A;  2IL4 A;  4CAV A;  3CPX A;  1X12 A;  1Z8T A;  5HVF A;  3KAS A;  2PJ7 A;  2DEA A;  4JLY A;  2AFX A;  1QSN A;  1VHS A;  2D4P A;  3B3C A;  4NXY A;  1YR0 A;  4XPD B;  2REE A;  3FH4 A;  3KHZ A;  3FBU A;  2ZEP A;  3K9T A;  2P6E A;  3EFA A;  3SJG A;  4CYP A;  5LYL A;  1YLO A;  4II9 A;  5EBV A;  1ELM P;  3PB8 X;  2EO8 A;  4KSA A;  4R3L A;  2FIA A;  6CPA A;  1LAN A;  3T8W A;  4CAX A;  2DXQ A;  2CNM A;  4OC5 A;  4MFL A;  4UIB A;  3R95 A;  2GIV A;  1YQE A;  4KSI A;  4OP4 A;  3D2M A;  3D4U A;  5FVJ A;  4B10 A;  2NMT A;  1YME A;  4RN7 A;  2PRQ A;  1LAM A;  4M85 A;  2HUZ A;  3LWU A;  1XFO A;  1I1D A;  4OC0 A;  4CGP A;  3S6K A;  4X2T A;  3GIU A;  3MN8 A;  4LUA A;  4ONW A;  2WPX A;  3LOD A;  4MBU A;  3D66 A;  4JWP A;  4AB7 A;  5HXD A;  2HB6 A;  3PBE A;  4JXR A;  5G22 A;  4JYW A;  3G3S A;  2CNT A;  4PSX A;  4KOT A;  3I9S A;  4Y49 B;  1TF9 A;  2YND A;  3N7Z A;  2PC1 A;  4A30 A;  2Z3O A;  4AVC A;  3JVN A;  2HC9 A;  2QIR A;  5F47 A;  4QBJ A;  2PJ5 A;  3BJ7 A;  3FYN A;  3GY9 A;  3LD2 A;  3VAT A;  3WAB A;  2B4D B;  2PVW A;  1S7N A;  1Q2Y A;  4XNH C;  4R9M A;  5HMN A;  5K8P A;  4KZT A;  4P4F A;  1XOV A;  4AG7 A;  5K8N A;  1CPS A;  2YGW A;  1YK3 A;  2J8R A;  2PIZ A;  5J8F A;  4CGM A;  1Y9W A;  2OZG A;  4P10 A;  3R9E A;  4L8A A;  3GYA A;  4CYN A;  1KUY A;  2B4D A;  3W6X A;  2CXA A;  3SHP A;  4MCR A;  3S6F A;  1R57 A;  3R96 A;  2PJA A;  1CP7 A;  4OAD A;  2WYR A;  1VKC A;  3KKW A;  8CPA A;  4BBH A;  4H6Z A;  4DJL A;  2PJ1 A;  1Y0R A;  4F0X A;  5EMI A;  1XF8 A;  4R3K A;  3H8F A;  4TWE A;  5CNP A;  1QST A;  3P2H A;  4MFZ A;  4NGS A;  4UEZ A;  5IV0 A;  2DPS A;  2PRB A;  3H5Z A;  5DWM A;  3KL9 A;  4NGQ A;  1Y7E A;  1N71 A;  1YVK A;  2YNC C;  3B3V A;  1YVO A;  3IU2 A;  3NH8 A;  3PB6 X;  4UEE A;  5LRG A;  1TXR A;  3SXO A;  2ANP A;  4P4E A;  4WWV A;  5AG7 A; 
#chains in the Genus database with same CATH homology
 4UWI A;  2B58 A;  2JEV A;  3VWD A;  3PZJ A;  4MI4 A;  5C82 A;  1S60 A;  2P6G A;  2FT0 A;  3E0K A;  4R87 A;  2BUE A;  2I00 A;  3F0A A;  4MFK A;  2KCW A;  1WK4 A;  1RXT A;  3TTH A;  3S6H A;  2VBQ A;  2Z3M A;  4HNX B;  2CY2 A;  4JD6 A;  3CXP A;  5AG5 A;  3TFY A;  3OWC A;  3TOA A;  2VI7 A;  1NMT A;  4QUS A;  1MJA A;  2J8M A;  2Z3N A;  1XEB A;  1YLE A;  1TIQ A;  2PQ8 A;  2ZW7 A;  2Z11 A;  4CYO A;  4OLL A;  2Z10 A;  5E96 A;  3DSB A;  2PDO A;  3CXQ A;  1IYK A;  3FNC A;  2R1I A;  3TO7 A;  2CNS A;  4KUA A;  3T9Y A;  3IGR A;  4R57 A;  1ZO0 A;  2Q4V A;  2G3T A;  4XPD C;  4C7H A;  2Z0Z A;  1S7F A;  3NE7 A;  4FD4 A;  3DR8 A;  2DPT A;  2ZW6 A;  4UA3 A;  4H6U A;  1YRE A;  2G0B A;  2K5T A;  1GHE A;  2B3U A;  4CRZ B;  1M4D A;  2OH1 A;  4OAE A;  4U5Y A;  1M4G A;  5KTC A;  4MFQ A;  2VEZ A;  4GS4 A;  4KVM E;  3CXS A;  4HNW B;  4KLW A;  2BEI A;  4CRY B;  2PR8 A;  2G3A A;  4UCP A;  4KOX A;  2OU2 A;  4QB9 A;  1PU9 A;  4KLV A;  4Y49 C;  4JJX A;  3T90 A;  4IUS A;  1IB1 E;  4KOU A;  3TCV A;  3VWE A;  2Q0Y A;  3ZJ0 A;  4AVB A;  2YNE A;  2ZPA A;  1Z4R A;  3TT2 A;  4ORF A;  4MFP A;  3C26 A;  1S7K A;  2R98 A;  5G21 A;  3IU1 A;  2JLM A;  5H84 A;  4UCN A;  3S6G A;  3JTK A;  4MJ8 A;  4DNC A;  4MY3 A;  3K9U A;  3D2P A;  2X7B A;  2A4N A;  1CM0 A;  1P4N A;  3D8P A;  4QVT A;  3GKR A;  3PGP A;  1I21 A;  4KS9 A;  4CAW A;  4YGO A;  2FE7 A;  2AE6 A;  1IIC A;  3TOB A;  4XPK A;  4KUB A;  5G1Z A;  5C88 A;  1Z9U A;  4CAF A;  2Z3L A;  3QB8 A;  2Q44 A;  1KUX A;  5F46 A;  4YFJ A;  3JUW A;  1OZP A;  4UFW A;  2F5I A;  2JDD A;  2Q4Y A;  2QEC A;  1L0C A;  4B5P B;  3RYO A;  4L89 A;  5GCN A;  4B13 A;  4NEX A;  4E0A A;  2WPW A;  2VZZ A;  2WUU A;  2OB0 A;  2QML A;  4PK3 A;  4B5P A;  3QAH A;  4F0Y A;  2AJ6 A;  2EUI A;  5EC4 A;  2Z3K A;  1Q2C A;  1NSL A;  1RO5 A;  2OZU A;  3EC4 A;  4IF5 A;  1QSR A;  1ON0 A;  4X5K A;  4NSQ A;  2B3V A;  1YX0 A;  1Z4E A;  4K30 A;  2JDC A;  2FS5 A;  2Q7B A;  4LX9 A;  3ZZI A;  4C7I A;  4ONU A;  4AVA A;  4ZGY B;  1QSM A;  4UWJ A;  2O28 A;  5HH1 A;  5AG4 A;  4B5O A;  2YNC A;  2ATR A;  1IYL A;  3B8G A;  5H86 A;  1BOB A;  3R9F A;  4AG9 A;  4KOW A;  5BWA B;  3P2F A;  5F48 A;  4A32 A;  3SXN A;  4PV6 A;  4CAE A;  1MJB A;  4A31 A;  2P6F A;  4M3S A;  3W91 A;  3A9L A;  4EVY A;  3EXN A;  1XE4 A;  4C2X A;  1YGH A;  2B4B A;  4UBR A;  3FIX A;  4HKF A;  5JPH A;  2PR1 A;  1S3Z A;  2VQY A;  4U9Y A;  2ZXV A;  4CGN A;  2GAN A;  5KTD A;  1QSO A;  4KSF A;  3BLN A;  4FD5 A;  1LRZ A;  5I0C A;  3WR7 A;  1V0C A;  2FIW A;  2Q04 A;  3TO6 A;  3F5B A;  1U6M A;  1NE9 A;  1CJW A;  5A28 A;  2ZW4 A;  4H89 A;  2RC4 A;  4QC6 A;  1MK4 A;  4CYQ A;  2Y0M A;  3UY5 A;  2REF A;  4MHD A;  5J8C A;  5G20 A;  5A27 A;  1P0H A;  5DWN A;  2R8V A;  4JXQ A;  4RI1 A;  1WWZ A;  1M44 A;  3TO9 A;  3IWE A;  2ARH A;  4KVX A;  5ISV A;  4KVO E;  3DDD A;  1B6B A;  4B12 A;  4KOR A;  1BO4 A;  1S5K A;  4Q36 A;  3EY5 A;  1KZF A;  4CGL A;  2R7H A;  3I3G A;  4CS0 B;  4A33 A;  4KOS A;  3TE4 A;  4A2Z A;  1M4I A;  1KUV A;  4C2Y A;  2HV2 A;  1K4J A;  5JQ4 A;  2HQY A;  1XMT A;  5IX3 A;  2Z3P A;  5IB0 A;  1S7L A;  1Y7R A;  2VZY A;  4XNH B;  4UFX A;  4C2Z A;  3FRM A;  4E8O A;  3FB3 A;  4U9Z A;  3V8I A;  2I79 A;  4UCM A;  4PK2 A;  2FXF A;  5AG6 A;  4FD6 A;  2ZW5 A;  3DNS A;  1UFH A;  4UFV A;  3DR6 A;  3D3S A;  4F6A A;  3FXT A;  4MY0 A;  3IWG A;  2BL1 A;  2VXK A;  4NF1 A;  5F49 A;  1J4J A;  3F8K A;  4YRH A;  1FY7 A;  3R1K A;  2D4O A;  4B11 A;  3W6S A;  2WSA A;  4BMH A;  2FSR A;  4B14 A;  2GE3 A;  1Y9K A;  2FL4 A;  3BJ8 A;  4E2A A;  1I12 A;  2P0W A;  4I49 A;  4NCZ A;  3G8W A;  1M1D A;  4CGO A;  1XIX A;  4J3G A;  1IID A;  1MJ9 A;  4RS2 A;  4KOY A;  4PSW A;  3H4Q A;  4HNY B;  3EO4 A;  3MGD A;  2PSW A;  4C68 A;  1B87 A;  2B5G B;  1PUA A;  2BSW A;  3R9G A;  4XPL A;  2C27 A;  2FCK A;  2H5M A;  2EVN A;  2J8N A;  3PP9 A;  4MFJ A;  1Q2D A;  4KOV A;  5AGE A;  5KTA A;  2OZH A;  1SQH A;  4FD7 A;  2B5G A;  4A95 A;  4Q38 A;  2IL4 A;  4CAV A;  4JLY A;  1QSN A;  1VHS A;  2D4P A;  4XPD B;  4NXY A;  1YR0 A;  2REE A;  3FBU A;  2P6E A;  3EFA A;  4CYP A;  4II9 A;  5EBV A;  4KSA A;  4R3L A;  2FIA A;  4CAX A;  2DXQ A;  2CNM A;  4MFL A;  3R95 A;  2GIV A;  3D2M A;  4B10 A;  5FVJ A;  2NMT A;  4M85 A;  2HUZ A;  1I1D A;  4CGP A;  3S6K A;  4LUA A;  2WPX A;  3LOD A;  4MBU A;  4JWP A;  4AB7 A;  4JXR A;  5G22 A;  3G3S A;  2CNT A;  4PSX A;  4KOT A;  3I9S A;  4Y49 B;  2YND A;  3N7Z A;  2PC1 A;  4A30 A;  2Z3O A;  4AVC A;  3JVN A;  2QIR A;  5F47 A;  4QBJ A;  3GY9 A;  3BJ7 A;  3FYN A;  3LD2 A;  2B4D B;  1S7N A;  1Q2Y A;  4XNH C;  4R9M A;  5HMN A;  4KZT A;  4AG7 A;  2YGW A;  1YK3 A;  2J8R A;  5J8F A;  4CGM A;  1Y9W A;  2OZG A;  3R9E A;  4L8A A;  3GYA A;  4CYN A;  1KUY A;  2B4D A;  3W6X A;  2CXA A;  3SHP A;  3S6F A;  1R57 A;  3R96 A;  4OAD A;  1VKC A;  3KKW A;  4BBH A;  4H6Z A;  4F0X A;  1XF8 A;  4R3K A;  5CNP A;  1QST A;  3P2H A;  4MFZ A;  5IV0 A;  2DPS A;  2PRB A;  3H5Z A;  5DWM A;  4ZBG A;  2YNC C;  1N71 A;  1YVK A;  3IU2 A;  1YVO A;  3SXO A;  5AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...