5F49A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with malonyl-coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 33
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f49A00
2ZW7A 3T90A 3WR7A 4HNWB 2WPWA 1MK4A 3T9YA 1Z4EA 3QB8A 3F5BA 2P6GA 4NSQA 2P6EA 3SXOA 2FIWA 2ZW5A 1SQHA 2GIVA 3FXTA 4H6UA 1Q2DA 3UY5A 1XE4A 4KZTA 2BUEA 3DDDA 4JJXA 4NEXA 4KVME 5KTCA 1BOBA 4ZBGA 3OWCA 2OB0A 2FL4A 2QECA 4E2AA 4MY3A 1I12A 4CAXA 2ZXVA 4U5YA 1B87A 3B8GA 5IB0A 3D8PA 1S3ZA 2AE6A 2PDOA 5DWMA 1GHEA 4MY0A 3TO6A 2B4BA 2BEIA 2OU2A 3TT2A 5IV0A 4AVCA 4R3KA 1I21A 2DXQA 1FY7A 4U9ZA 2G0BA 5C88A 2NMTA 4XNHB 2VZZA 4AG9A 3EFAA 4UA3A 4KLWA 4OAEA 3DR6A 2GANA 2ARHA 3IWGA 3D3SA 2KCWA 2J8MA 2Z11A 2FE7A 3D2PA 1Q2YA 3R9GA 4HNXB 1WK4A 3NE7A 4XPDC 3I9SA 3TCVA 2PRBA 1Y9KA 2PQ8A 4QUSA 2B3VA 5JPHA 4J3GA 1L0CA 4MI4A 5KTDA 4FD4A 3RYOA 3LD2A 2FSRA 2Q4VA 3SXNA 2FS5A 4KORA 4R3LA 2G3AA 1LRZA 2JDDA 3R9FA 4E0AA 5C82A 1BO4A 4CS0B 5HH1A 5ISVA 1MJBA 4QBJA 2VI7A 3EO4A 3W91A 1B6BA 2R98A 4QVTA 5CNPA 3H4QA 3S6FA 1NE9A 3S6HA 5F49A 2JEVA 4DNCA 4PK3A 1YX0A 2ZW4A 2JDCA 2HV2A 3F0AA 2Q7BA 5F46A 3R95A 4YFJA 2HQYA 4H6ZA 2REFA 3FIXA 3DR8A 4KOTA 4K30A 5I0CA 4FD7A 4QC6A 3ZZIA 2B4DB 3BJ7A 4ONUA 1QSNA 2Y0MA 4NCZA 1XMTA 4B5OA 4U9YA 5H84A 3MGDA 3JUWA 1J4JA 3PP9A 2PR8A 5F47A 1KZFA 2H5MA 2IL4A 2AJ6A 4UWIA 4PSWA 3R96A 2EUIA 4UWJA 1XF8A 1R57A 2C27A 3DNSA 1IIDA 2R8VA 2OZHA 3TFYA 1I1DA 3P2FA 2Z10A 3F8KA 4EVYA 2VXKA 2QIRA 1M4IA 1YR0A 2J8NA 3R1KA 1Q2CA 1P4NA 2Q0YA 3CXPA 3G8WA 3R9EA 3SHPA 5JQ4A 1YVOA 1V0CA 1PUAA 4NF1A 4XNHC 5IX3A 2K5TA 1Z9UA 4R9MA 2VZYA 3N7ZA 4B5PB 2FT0A 2J8RA 3VWDA 3E0KA 1QSTA 2PSWA 4IF5A 1U6MA 3D2MA 4YRHA 4XPDB 2VEZA 1S7FA 2BSWA 4JXQA 2EVNA 2A4NA 4M85A 4II9A 4CRZB 2FXFA 4KOWA 3EY5A 3I3GA 4MHDA 3FYNA 4KOXA 4KVOE 4XPLA 4PV6A 2OZUA 3LODA 3PGPA 4JXRA 3CXSA 1WWZA 2R1IA 4M3SA 5J8FA 1N71A 3FNCA 3BJ8A 3GY9A 4AVBA 4I49A 4RS2A 2Q4YA 4KUBA 1MJ9A 4OADA 2GE3A 4L8AA 4Y49C 1CM0A 3FBUA 1IB1E 1QSOA 1KUYA 1M4GA 1KUVA 2PR1A 2O28A 4MJ8A 3S6KA 5E96A 4CAVA 3TOAA 2RC4A 5HMNA 4KOVA 4H89A 2BL1A 3KKWA 1KUXA 2B58A 4F6AA 4KVXA 1YGHA 2P0WA 3TO9A 4HNYB 1M4DA 5FVJA 3P2HA 3TOBA 1RXTA 1UFHA 1P0HA 2F5IA 4KLVA 3GKRA 5KTAA 1QSRA 1S7NA 4CRYB 4AB7A 1MJAA 1K4JA 4FD6A 1OZPA 3W6XA 3FRMA 3JVNA 3TO7A 2JLMA 2X7BA 4AVAA 4L89A 3IGRA 4XPKA 2CY2A 4YGOA 4JLYA 2PC1A 4UBRA 2OZGA 2B4DA 2FIAA 5GCNA 5EBVA 2D4OA 2ATRA 3C26A 4CAWA 1S60A 2FCKA 2R7HA 2D4PA 3VWEA 5DWNA 4R87A 1NMTA 2B5GB 1S5KA 1TIQA 2QMLA 1YLEA 2B3UA 1YREA 3PZJA 2I00A 4GS4A 2OH1A 4JD6A 1CJWA 2G3TA 1IYLA 4IUSA 2CNTA 2Q44A 4FD5A 4QB9A 4R57A 1Z4RA 3EXNA 3TE4A 1M44A 1S7LA 2P6FA 4KOSA 3QAHA 2CNSA 2ZPAA 4X5KA 3S6GA 4NXYA 1XIXA 3GYAA 3CXQA 1NSLA 1VKCA 4F0YA 4MBUA 3V8IA 2REEA 1YK3A 1ON0A 1Y9WA 1XEBA 4KUAA 3DSBA 2Q04A 3G3SA 3W6SA 1S7KA 5F48A 2ZW6A 2CNMA 3EC4A 2Z0ZA 4AG7A 4PK2A 4PSXA 1QSMA 5H86A 1IICA 1M1DA 2VQYA 4B5PA 4HKFA 5EC4A 4OLLA 3K9UA 4E8OA 3ZJ0A 5J8CA 2VBQA 1PU9A 2I79A 3BLNA 4ORFA 3TTHA 1VHSA 1Y7RA 4BMHA 2B5GA 4JWPA 3FB3A 4LUAA 4KOUA 2HUZA 4RI1A 1RO5A 4KOYA 1YVKA 1IYKA 2WPXA 4Y49B 4LX9A
chains in the Genus database with same CATH superfamily
4R6TA 2ZW7A 5CPAA 1DE4C 4UF4A 3T90A 5AG6A 3PRTA 3WR7A 4HNWB 2WPWA 2PJ2A 1MK4A 4M6GA 4A38A 2VL1A 3FMCA 2XEFA 1AYEA 3RNZA 3T9YA 1Z8TA 1Z4EA 3QB8A 2Z3OA 3F5BA 2P6GA 4NSQA 5LRGA 1AUGA 2P6EA 1IY7A 2FIWA 3SXOA 2ZW5A 1SQHA 2CXAA 2GIVA 3FXTA 1FT7A 2ODFA 2OOTA 1BPNA 2PIZA 4H6UA 1Q2DA 4KSIA 3UY5A 2C6PA 2IMOA 1XE4A 4CGPA 1CPSA 4UCMA 4KZTA 2BUEA 3DDDA 4ZY0A 3CDXA 4JJXA 1ARLA 4NEXA 4KVME 4GXHA 3DLJA 1BOBA 1TKFA 4ZBGA 5KTCA 3OWCA 2OB0A 2FL4A 2QECA 5G21A 4E2AA 4MY3A 1CG2A 1I12A 2BCOA 4A2ZA 4PPZA 4Q38A 4CAXA 2QVPA 2ZXVA 4OC3A 1B87A 4U5YA 3B8GA 2WZNA 3PB7X 5IB0A 3D8PA 1S3ZA 1VHOA 2AE6A 2PDOA 4MHZA 5AG7A 4TWEA 2PJCA 3TX8A 5DWMA 1GHEA 3CZXA 1QQ9A 3BI0A 5HXDA 4MY0A 3TO6A 2J9AA 2B4BA 1YSJA 1ZG8A 3MN8A 2BEIA 2OU2A 3TT2A 3LWUA 5IV0A 2RB7A 4NGRA 4AVCA 4R3KA 1I21A 2POKA 2DXQA 3CT9A 1FY7A 3H5ZA 4A95A 4U9ZA 2G0BA 3KQXA 1ELMP 2GLFA 2JBJA 3N5FA 4CYNA 2NMTA 5C88A 3SJXA 3B35A 2Z3PA 2IJZA 4XNHB 2VZZA 5LRKA 4CYQA 3L2NA 5BWAB 4AG9A 3EFAA 4R7MA 4NGQA 4UA3A 4KLWA 2ZENA 2XEJA 4OAEA 2NSMA 2GANA 3DR6A 4C2YA 1TKJA 2ARHA 3IWGA 2EBJA 3D3SA 3S9LA 2KCWA 2J8MA 2Z11A 2FE7A 1Z8WA 3KI9A 3D2PA 3RBUA 1Q2YA 2AFMA 2ZEDA 3R9GA 1TF9A 4HNXB 5LYIA 4G1PA 1WK4A 3NE7A 4EFDA 4XPDC 1Z8XA 3I9SA 3TCVA 3D7DA 2PRBA 1Y9KA 2PQ8A 4QUSA 1M4LA 1PCAA 4NJRA 3FECA 2B3VA 2C1CA 3KHZA 4OC2A 4J3GA 5JPHA 1GYTA 1L0CA 4IHMA 4MI4A 2PJ1A 4FD4A 3RYOA 5KTDA 2YNEA 3K9TA 3LD2A 4M6HA 2FSRA 2Q4VA 4P4EA 3SXNA 4Z65A 2AFUA 2DPTA 4Q7AA 4UFWA 3IIBA 2FS5A 4KORA 4ZGYB 4R3LA 2G3AA 3VH9A 1QMUA 1LRZA 1ZLIA 2JDDA 4MRIA 3R9FA 4A33A 4E0AA 5C82A 4ZI6A 1BO4A 4B11A 1JQGA 1XBUA 3D66A 3MRUA 4P10A 3KQZA 4DUKA 4CS0B 1KWMA 5HH1A 1YW4A 2BO9A 2ZEGA 5ISVA 1ZLHA 2PJ6A 1MJBA 4MFPA 4MHNA 4QBJA 1ZO0A 2VI7A 3TC8A 4IAVA 3EO4A 3ISXA 4UIAA 3W91A 1B6BA 4YU9A 2R98A 4QVTA 5CNPA 3H4QA 4MFKA 3GUXA 2PVVA 3JTKA 3S6FA 1NE9A 3S6HA 5F49A 2JEVA 4DYOA 3WC7A 4A31A 4DNCA 4MFLA 4JYWA 1LCPA 4OIWA 1F57A 4FUUA 4PK3A 1YX0A 4MFQA 3B3WA 2ZW4A 2JDCA 4A39A 2HV2A 3F0AA 2Q7BA 4ZY1A 5F46A 1XFOA 3JRUA 3R95A 4YFJA 5ELYA 2HQYA 4ZX9A 4H6ZA 2REFA 4F9VA 1A2ZA 5G1ZA 4C7HA 2O53A 3FIXA 1IGBA 3DR8A 1H8LA 4KOTA 4K30A 5I0CA 4FD7A 3BI1A 3FEEA 4KS9A 4QC6A 3ZZIA 2B4DB 3BJ7A 3PBEA 4ONUA 3HUVA 1QSNA 2Y0MA 3SJFA 4NCZA 1XMTA 2ZEHA 2RFHA 4B5OA 4U9YA 2DEAA 5D8NA 5H84A 4FAIA 1CP6A 3MGDA 3K2KA 2PJ0A 2BOAA 3JUWA 4UEFA 1J4JA 3PP9A 2PR8A 3GB0A 4UIBA 1YQEA 1KZFA 5F47A 2V8GA 2I3CA 3BXMA 2H5MA 3NH8A 3NH4A 2IL4A 2AJ6A 4MCPA 4UWIA 1YW6A 1DTDA 5AG5A 4BINA 3T8WA 4PSWA 3HLPA 2EUIA 2PJBA 1XF8A 1R57A 2C27A 3DNSA 3ISZA 4UWJA 4WJBA 3SI1A 1IIDA 3V7ZA 2PJ3A 4B14A 2F7VA 2R8VA 5J1QA 2OZHA 5IB9A 2YNCA 3TFYA 1I1DA 2C6CA 3FF3A 3P2FA 2Z10A 3B3TA 3H8FA 1LANA 3PEIA 2ZEMA 4P4FA 4CAFA 4F0XA 1YLOA 4F8ZA 3F8KA 4EVYA 4A94A 2VXKA 2QIRA 1M4IA 2V77A 1R43A 1YR0A 4OC4A 2J8NA 3R1KA 5A28A 1Q2CA 2PJ7A 3WC5A 4P4IA 2ZEEA 3H8EA 2HC9A 4PXCA 1P4NA 4GM5A 3B3VA 2Q0YA 3CXPA 4R76A 3G8WA 3R9EA 4KSAA 3SHPA 5JQ4A 1YVOA 1V0CA 2Z3KA 1ZG7A 1TKHA 4MCSA 1PUAA 4NF1A 4XNHC 5IX3A 2EK9A 2K5TA 3WC6A 1VHEA 1Z5RA 1Z9UA 2DPSA 3D67A 4MCQA 4R9MA 2QYVA 2VZYA 2WSAA 1Z8LA 3N7ZA 3D68A 1HEEA 4B5PB 2JEWA 3IFEA 4JZ0A 5THWA 2FT0A 2J8RA 4A30A 4NGTA 5K8PA 1LFWA 4OIDA 1XRYA 3VWDA 4LQGA 2Q4ZA 3E0KA 1QSTA 5HVFA 2PSWA 2PJ9A 3KR5A 2AFXA 4P4JA 4IF5A 4A37A 1CX8A 1U6MA 3D2MA 4YRHA 2V8VA 3NFZA 4OMEA 4ZY2A 4XPDB 2VEZA 3B3CA 4C68A 1F2PA 2V8DA 4RN7A 1CP7A 1BAVA 1S7FA 4MXUA 3IU2A 2BSWA 4JXQA 2EVNA 2C6GA 4MHYA 2PJ4A 3W6SA 2A4NA 4M85A 1HDUA 3SJGA 3FJUA 5DS0A 4II9A 4P4BA 3SI2A 2QJ8A 4CRZB 2ZEPA 4NJQA 2FXFA 2CTBA 3DGVA 4KOWA 5G22A 3EY5A 3I3GA 4MHDA 3FYNA 4KOXA 4KVOE 4XPLA 5HVHA 5A27A 4PV6A 1Z2LA 2OZUA 1OBRA 3LODA 4PXEA 3PGPA 4JXRA 3CXSA 1RTQA 3H8GA 2ZEOA 4P6YA 3WABA 2DF5A 4X8IA 4MFZA 2IQ6A 3RZAA 1WWZA 4C7IA 2CTCA 2R1IA 4K3NA 4M3SA 2PJAA 5J8FA 1N71A 3FNCA 3SI0A 4ZYQA 3FEDA 1R3NA 3BJ8A 3GY9A 4AVBA 4B10A 2WUUA 1EE3P 4I49A 1UWYA 5HVGA 4RS2A 7CPAA 2Q4YA 4LQ6A 4KUBA 1MJ9A 4EWTA 4UCNA 4CYPA 4OADA 4MCRA 3I1UA 2GE3A 4ONWA 4L8AA 2ZOGA 3LACA 4Y49C 4NGPA 1CM0A 5LYFA 3FBUA 2XEIA 2ANPA 1X12A 1CBXA 1IB1E 2YNCC 1YMEA 1QSOA 1KUYA 3D4UA 1M4GA 1KUVA 4NFRA 4CGOA 3WT4A 3S9MA 2PR1A 3PBBA 4BBHA 5G20A 4A32A 5LRJA 4M6IA 2O28A 4MJ8A 4P44A 4X3RA 2NYQA 1TF8A 5E96A 3S6KA 4O23A 3SJEA 4CAVA 3PB4X 3TOAA 4CAEA 2RC4A 5HMNA 4KOVA 3FVLA 4H89A 2BL1A 3KKWA 8CPAA 2O4HA 4CGMA 1KUXA 2B58A 4F6AA 2YNDA 4KVXA 2AFOA 2PRQA 2WYRA 1YGHA 1XOVA 2P0WA 3IWEA 3KASA 3NA6A 4HNYB 3TO9A 3PB6X 1M4DA 5FVJA 3P2HA 3TOBA 1Y7EA 2GLJA 2ZELA 1RXTA 5K8MA 1NSAA 1P0HA 1UFHA 4CYOA 1VGYA 2G9DA 1Y0RA 2F5IA 4KLVA 2FVGA 2Q51A 3GKRA 5KTAA 1QSRA 3V38A 4UEEA 1S7NA 3S9NA 2ZOFA 3GLJA 4YWYA 5CBMA 4W9YA 4CRYB 4AB7A 3NH5A 1MJAA 4B13A 4PXBA 1K4JA 3LMSA 4FD6A 4CPAA 4EMEA 1OZPA 2CIJA 3CPXA 3W6XA 4CGLA 3GIUA 3FRMA 3JVNA 3TO7A 2JLMA 5K8OA 5JGFA 2X7BA 4CGNA 4AVAA 4NGSA 4L89A 3IGRA 2ABZA 4XPKA 2CY2A 1XMBA 1BLLE 4YGOA 6CPAA 3B7IA 4F9UA 1FNOA 2PJ5A 2PJ8A 3IWWA 4JLYA 3B2YA 2JBKA 2PC1A 3VATA 4P45A 4UBRA 2Q7SA 3IEHA 2OZGA 4IK2A 1Q7LA 2B4DA 2FIAA 4UCPA 3D7FA 5GCNA 5EBVA 3PFEA 5EMIA 2D4OA 1IOFA 2ATRA 3C26A 2V8HA 4CAWA 1S60A 2FCKA 4B6ZA 3BHXA 2R7HA 2D4PA 4WWVA 3RAMA 2PIYA 3VWEA 4C2XA 3A9LA 3QAYA 4R87A 1NMTA 2B5GB 3D7HA 3KZWA 5DWNA 1S5KA 1TIQA 4R8FA 2QMLA 1X10A 1YLEA 3CPAA 3KHXA 5I4MA 4OC5A 1AMPA 2B3UA 2Z3LA 1YREA 3PZJA 2I00A 4GS4A 4UFVA 1CPXA 1JWQA 3R96A 2OH1A 4JD6A 4NGMA 1CJWA 2G3TA 3IJ3A 1IYLA 2GU2A 4IUSA 2CNTA 4P4DA 4PXDA 2Q44A 1VIXA 4FD5A 4QB9A 1Z4RA 4R57A 3EXNA 3TE4A 2AFZA 3RO0A 1M44A 1S7LA 4BD9A 3KGQA 2P6FA 2Z3NA 4KOSA 5JH9A 3PB9X 2Q43A 2CNSA 3QAHA 2ZPAA 4X5KA 2CF4A 3S6GA 4NXYA 2ZEFA 3D7GA 2EK8A 3VARA 4AXVA 1XIXA 3GYAA 2HB6A 3CXQA 1NSLA 1VKCA 4UFXA 1ZG9A 4Q36A 4F0YA 4MBUA 2F8HA 5AGEA 3V8IA 5JM6A 2REEA 1HDQA 1ON0A 1YK3A 3KR4A 1PYTB 1XEBA 1Y9WA 2Z3MA 2Q04A 3DSBA 3FX6A 3G3SA 2XEGA 1S7KA 4KUAA 4OC0A 2PCUA 4H2KA 5F09A 2PE3A 1Y0YA 5F48A 2YGWA 2ZW6A 2CNMA 3EC4A 1XJOA 2Z0ZA 4AG7A 3KL9A 4PK2A 4KSFA 4OP4A 3B3SA 1QSMA 4PSXA 5H86A 1IICA 1M1DA 2VQYA 3PB8X 4B5PA 4HKFA 1BPMA 4OLLA 3K9UA 5EC4A 1F2OA 4E8OA 2EWBA 4MHPA 3ZJ0A 2OR4A 3IU1A 1LAPA 4UEZA 4B12A 5J8CA 2VBQA 4MFJA 1PU9A 1IOIA 2I79A 3NE8A 4OKOA 3BLNA 4NGNA 4ORFA 3TTHA 2EO8A 4C2ZA 1VHSA 2PVWA 1Y7RA 4BMHA 5AG4A 1IU8A 1LAMA 2B5GA 4HPSA 1ELLP 3IC1A 3FB3A 4JWPA 5LYDA 4X2TA 4LUAA 3FH4A 4KOUA 2HUZA 4PQAA 2GREA 4ZX8A 3IO1A 3QNVA 4RI1A 4FBEA 4RUHA 1ARMA 2GFQA 1RO5A 4KOYA 1LOKA 1YVKA 4DJLA 2AFSA 1IYKA 2WPXA 2AFWA 4FWUA 4Y49B 3PFOA 5LYLA 4OC1A 4LX9A 4MMOA 5D29A 4TNUA 1TXRA 5K8NA
chains in the Genus database with same CATH topology
2ZW7A 3T90A 5AG6A 3WR7A 4HNWB 2WPWA 1MK4A 3T9YA 1Z4EA 3QB8A 2Z3OA 3F5BA 2P6GA 4NSQA 2P6EA 3SXOA 2FIWA 2ZW5A 1SQHA 2CXAA 2GIVA 3FXTA 4H6UA 1Q2DA 3UY5A 1XE4A 4CGPA 4UCMA 4KZTA 2BUEA 3DDDA 4JJXA 4NEXA 4KVME 5KTCA 1BOBA 4ZBGA 3OWCA 2OB0A 2FL4A 2QECA 5G21A 4E2AA 4MY3A 1I12A 4A2ZA 4Q38A 4CAXA 2ZXVA 4U5YA 1B87A 3B8GA 5IB0A 3D8PA 1S3ZA 2AE6A 2PDOA 5AG7A 5DWMA 1GHEA 4MY0A 3TO6A 2B4BA 2BEIA 2OU2A 3TT2A 5IV0A 4AVCA 4R3KA 1I21A 2DXQA 1FY7A 3H5ZA 4A95A 4U9ZA 2G0BA 4CYNA 5C88A 2NMTA 2Z3PA 4XNHB 2VZZA 4CYQA 5BWAB 4AG9A 3EFAA 4UA3A 4KLWA 4OAEA 3DR6A 2GANA 4C2YA 2ARHA 3IWGA 3D3SA 2KCWA 2J8MA 2Z11A 2FE7A 3D2PA 1Q2YA 3R9GA 4HNXB 1WK4A 3NE7A 4XPDC 3I9SA 3TCVA 2PRBA 1Y9KA 2PQ8A 4QUSA 2B3VA 5JPHA 4J3GA 1L0CA 4MI4A 5KTDA 4FD4A 3RYOA 2YNEA 3LD2A 2FSRA 2Q4VA 3SXNA 2DPTA 4UFWA 2FS5A 4KORA 4ZGYB 4R3LA 2G3AA 1LRZA 2JDDA 3R9FA 4A33A 4E0AA 5C82A 1BO4A 4B11A 4CS0B 5HH1A 5ISVA 1MJBA 4MFPA 4QBJA 1ZO0A 2VI7A 3EO4A 3W91A 1B6BA 2R98A 4QVTA 5CNPA 3H4QA 4MFKA 3JTKA 3S6FA 1NE9A 3S6HA 5F49A 2JEVA 4A31A 4DNCA 4MFLA 4PK3A 1YX0A 4MFQA 2ZW4A 2JDCA 2HV2A 3F0AA 2Q7BA 5F46A 3R95A 4YFJA 2HQYA 4H6ZA 2REFA 5G1ZA 4C7HA 3FIXA 3DR8A 4KOTA 4K30A 5I0CA 4FD7A 4KS9A 4QC6A 3ZZIA 2B4DB 3BJ7A 4ONUA 1QSNA 2Y0MA 4NCZA 1XMTA 4B5OA 4U9YA 5H84A 3MGDA 3JUWA 1J4JA 3PP9A 2PR8A 5F47A 1KZFA 2H5MA 2IL4A 2AJ6A 4UWIA 5AG5A 4PSWA 3R96A 2EUIA 4UWJA 1XF8A 1R57A 2C27A 3DNSA 4B14A 1IIDA 2R8VA 2OZHA 2YNCA 3TFYA 1I1DA 3P2FA 2Z10A 4CAFA 4F0XA 3F8KA 4EVYA 2VXKA 2QIRA 1M4IA 1YR0A 2J8NA 3R1KA 5A28A 1Q2CA 1P4NA 2Q0YA 3CXPA 3G8WA 3R9EA 4KSAA 3SHPA 5JQ4A 1YVOA 1V0CA 2Z3KA 1PUAA 4NF1A 4XNHC 5IX3A 2K5TA 1Z9UA 2DPSA 4R9MA 2VZYA 2WSAA 3N7ZA 4B5PB 2FT0A 2J8RA 4A30A 3VWDA 3E0KA 1QSTA 2PSWA 4IF5A 1U6MA 3D2MA 4YRHA 4XPDB 2VEZA 4C68A 1S7FA 3IU2A 2BSWA 4JXQA 2EVNA 2A4NA 4M85A 4II9A 4CRZB 2FXFA 4KOWA 5G22A 3EY5A 3I3GA 4MHDA 3FYNA 4KOXA 4KVOE 4XPLA 5A27A 4PV6A 2OZUA 3LODA 3PGPA 4JXRA 3CXSA 4MFZA 4C7IA 1WWZA 2R1IA 4M3SA 5J8FA 1N71A 3FNCA 3BJ8A 3GY9A 4AVBA 4B10A 2WUUA 4I49A 4RS2A 2Q4YA 4KUBA 1MJ9A 4UCNA 4CYPA 4OADA 2GE3A 4L8AA 4Y49C 1CM0A 3FBUA 1IB1E 2YNCC 1QSOA 1KUYA 1M4GA 1KUVA 4CGOA 4BBHA 2PR1A 5G20A 2O28A 4MJ8A 3S6KA 4CAEA 5E96A 4CAVA 3TOAA 2RC4A 5HMNA 4KOVA 4H89A 2BL1A 3KKWA 4CGMA 1KUXA 2B58A 4F6AA 2YNDA 4KVXA 1YGHA 2P0WA 3TO9A 3IWEA 4HNYB 1M4DA 5FVJA 3P2HA 3TOBA 1RXTA 1UFHA 1P0HA 4CYOA 2F5IA 4KLVA 3GKRA 5KTAA 1QSRA 1S7NA 4CRYB 4AB7A 1MJAA 4B13A 1K4JA 4FD6A 1OZPA 3W6XA 4CGLA 3FRMA 3JVNA 3TO7A 2JLMA 2X7BA 4CGNA 4AVAA 4L89A 3IGRA 4XPKA 2CY2A 4YGOA 4JLYA 2PC1A 4UBRA 2OZGA 2B4DA 2FIAA 4UCPA 5GCNA 5EBVA 2D4OA 2ATRA 3C26A 4CAWA 1S60A 2FCKA 2R7HA 2D4PA 3VWEA 4C2XA 3A9LA 5DWNA 4R87A 1NMTA 2B5GB 1S5KA 1TIQA 2QMLA 1YLEA 2B3UA 2Z3LA 1YREA 3PZJA 2I00A 4GS4A 4UFVA 2OH1A 4JD6A 1CJWA 2G3TA 1IYLA 4IUSA 2CNTA 2Q44A 4FD5A 4QB9A 4R57A 1Z4RA 3EXNA 3TE4A 1M44A 1S7LA 2P6FA 2Z3NA 4KOSA 3QAHA 2CNSA 2ZPAA 4X5KA 3S6GA 4NXYA 1XIXA 3GYAA 3CXQA 1NSLA 1VKCA 4UFXA 4Q36A 4F0YA 4MBUA 5AGEA 3V8IA 2REEA 1YK3A 1ON0A 1Y9WA 1XEBA 2Z3MA 3DSBA 2Q04A 3G3SA 4KUAA 3W6SA 1S7KA 5F48A 2YGWA 2ZW6A 2CNMA 3EC4A 2Z0ZA 4AG7A 4PK2A 4KSFA 4PSXA 1QSMA 5H86A 1IICA 1M1DA 2VQYA 4B5PA 4HKFA 5EC4A 4OLLA 3K9UA 4E8OA 3ZJ0A 3IU1A 4B12A 5J8CA 2VBQA 4MFJA 1PU9A 2I79A 3BLNA 4ORFA 3TTHA 4C2ZA 1VHSA 5AG4A 1Y7RA 4BMHA 2B5GA 4JWPA 3FB3A 4LUAA 4KOUA 2HUZA 4RI1A 1RO5A 4KOYA 1YVKA 1IYKA 2WPXA 4Y49B 4LX9A 4A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW7 A;  3T90 A;  3WR7 A;  4HNW B;  2WPW A;  1MK4 A;  3T9Y A;  1Z4E A;  3QB8 A;  3F5B A;  2P6G A;  4NSQ A;  2P6E A;  3SXO A;  2FIW A;  2ZW5 A;  1SQH A;  2GIV A;  3FXT A;  4H6U A;  1Q2D A;  3UY5 A;  1XE4 A;  4KZT A;  2BUE A;  3DDD A;  4JJX A;  4NEX A;  4KVM E;  5KTC A;  1BOB A;  4ZBG A;  3OWC A;  2OB0 A;  2FL4 A;  2QEC A;  4E2A A;  4MY3 A;  1I12 A;  4CAX A;  2ZXV A;  4U5Y A;  1B87 A;  3B8G A;  5IB0 A;  3D8P A;  1S3Z A;  2AE6 A;  2PDO A;  5DWM A;  1GHE A;  4MY0 A;  3TO6 A;  2B4B A;  2BEI A;  2OU2 A;  3TT2 A;  5IV0 A;  4AVC A;  4R3K A;  1I21 A;  2DXQ A;  1FY7 A;  4U9Z A;  2G0B A;  5C88 A;  2NMT A;  4XNH B;  2VZZ A;  4AG9 A;  3EFA A;  4UA3 A;  4KLW A;  4OAE A;  3DR6 A;  2GAN A;  2ARH A;  3IWG A;  3D3S A;  2KCW A;  2J8M A;  2Z11 A;  2FE7 A;  3D2P A;  1Q2Y A;  3R9G A;  4HNX B;  1WK4 A;  3NE7 A;  4XPD C;  3I9S A;  3TCV A;  2PRB A;  1Y9K A;  2PQ8 A;  4QUS A;  2B3V A;  5JPH A;  4J3G A;  1L0C A;  4MI4 A;  5KTD A;  4FD4 A;  3RYO A;  3LD2 A;  2FSR A;  2Q4V A;  3SXN A;  2FS5 A;  4KOR A;  4R3L A;  2G3A A;  1LRZ A;  2JDD A;  3R9F A;  4E0A A;  5C82 A;  1BO4 A;  4CS0 B;  5HH1 A;  5ISV A;  1MJB A;  4QBJ A;  2VI7 A;  3EO4 A;  3W91 A;  1B6B A;  2R98 A;  4QVT A;  5CNP A;  3H4Q A;  3S6F A;  1NE9 A;  3S6H A;  5F49 A;  2JEV A;  4DNC A;  4PK3 A;  1YX0 A;  2ZW4 A;  2JDC A;  2HV2 A;  3F0A A;  2Q7B A;  5F46 A;  3R95 A;  4YFJ A;  2HQY A;  4H6Z A;  2REF A;  3FIX A;  3DR8 A;  4KOT A;  4K30 A;  5I0C A;  4FD7 A;  4QC6 A;  3ZZI A;  2B4D B;  3BJ7 A;  4ONU A;  1QSN A;  2Y0M A;  4NCZ A;  1XMT A;  4B5O A;  4U9Y A;  5H84 A;  3MGD A;  3JUW A;  1J4J A;  3PP9 A;  2PR8 A;  5F47 A;  1KZF A;  2H5M A;  2IL4 A;  2AJ6 A;  4UWI A;  4PSW A;  3R96 A;  2EUI A;  4UWJ A;  1XF8 A;  1R57 A;  2C27 A;  3DNS A;  1IID A;  2R8V A;  2OZH A;  3TFY A;  1I1D A;  3P2F A;  2Z10 A;  3F8K A;  4EVY A;  2VXK A;  2QIR A;  1M4I A;  1YR0 A;  2J8N A;  3R1K A;  1Q2C A;  1P4N A;  2Q0Y A;  3CXP A;  3G8W A;  3R9E A;  3SHP A;  5JQ4 A;  1YVO A;  1V0C A;  1PUA A;  4NF1 A;  4XNH C;  5IX3 A;  2K5T A;  1Z9U A;  4R9M A;  2VZY A;  3N7Z A;  4B5P B;  2FT0 A;  2J8R A;  3VWD A;  3E0K A;  1QST A;  2PSW A;  4IF5 A;  1U6M A;  3D2M A;  4YRH A;  4XPD B;  2VEZ A;  1S7F A;  2BSW A;  4JXQ A;  2EVN A;  2A4N A;  4M85 A;  4II9 A;  4CRZ B;  2FXF A;  4KOW A;  3EY5 A;  3I3G A;  4MHD A;  3FYN A;  4KOX A;  4KVO E;  4XPL A;  4PV6 A;  2OZU A;  3LOD A;  3PGP A;  4JXR A;  3CXS A;  1WWZ A;  2R1I A;  4M3S A;  5J8F A;  1N71 A;  3FNC A;  3BJ8 A;  3GY9 A;  4AVB A;  4I49 A;  4RS2 A;  2Q4Y A;  4KUB A;  1MJ9 A;  4OAD A;  2GE3 A;  4L8A A;  4Y49 C;  1CM0 A;  3FBU A;  1IB1 E;  1QSO A;  1KUY A;  1M4G A;  1KUV A;  2PR1 A;  2O28 A;  4MJ8 A;  3S6K A;  5E96 A;  4CAV A;  3TOA A;  2RC4 A;  5HMN A;  4KOV A;  4H89 A;  2BL1 A;  3KKW A;  1KUX A;  2B58 A;  4F6A A;  4KVX A;  1YGH A;  2P0W A;  3TO9 A;  4HNY B;  1M4D A;  5FVJ A;  3P2H A;  3TOB A;  1RXT A;  1UFH A;  1P0H A;  2F5I A;  4KLV A;  3GKR A;  5KTA A;  1QSR A;  1S7N A;  4CRY B;  4AB7 A;  1MJA A;  1K4J A;  4FD6 A;  1OZP A;  3W6X A;  3FRM A;  3JVN A;  3TO7 A;  2JLM A;  2X7B A;  4AVA A;  4L89 A;  3IGR A;  4XPK A;  2CY2 A;  4YGO A;  4JLY A;  2PC1 A;  4UBR A;  2OZG A;  2B4D A;  2FIA A;  5GCN A;  5EBV A;  2D4O A;  2ATR A;  3C26 A;  4CAW A;  1S60 A;  2FCK A;  2R7H A;  2D4P A;  3VWE A;  5DWN A;  4R87 A;  1NMT A;  2B5G B;  1S5K A;  1TIQ A;  2QML A;  1YLE A;  2B3U A;  1YRE A;  3PZJ A;  2I00 A;  4GS4 A;  2OH1 A;  4JD6 A;  1CJW A;  2G3T A;  1IYL A;  4IUS A;  2CNT A;  2Q44 A;  4FD5 A;  4QB9 A;  4R57 A;  1Z4R A;  3EXN A;  3TE4 A;  1M44 A;  1S7L A;  2P6F A;  4KOS A;  3QAH A;  2CNS A;  2ZPA A;  4X5K A;  3S6G A;  4NXY A;  1XIX A;  3GYA A;  3CXQ A;  1NSL A;  1VKC A;  4F0Y A;  4MBU A;  3V8I A;  2REE A;  1YK3 A;  1ON0 A;  1Y9W A;  1XEB A;  4KUA A;  3DSB A;  2Q04 A;  3G3S A;  3W6S A;  1S7K A;  5F48 A;  2ZW6 A;  2CNM A;  3EC4 A;  2Z0Z A;  4AG7 A;  4PK2 A;  4PSX A;  1QSM A;  5H86 A;  1IIC A;  1M1D A;  2VQY A;  4B5P A;  4HKF A;  5EC4 A;  4OLL A;  3K9U A;  4E8O A;  3ZJ0 A;  5J8C A;  2VBQ A;  1PU9 A;  2I79 A;  3BLN A;  4ORF A;  3TTH A;  1VHS A;  1Y7R A;  4BMH A;  2B5G A;  4JWP A;  3FB3 A;  4LUA A;  4KOU A;  2HUZ A;  4RI1 A;  1RO5 A;  4KOY A;  1YVK A;  1IYK A;  2WPX A;  4Y49 B;  4LX9 A; 
#chains in the Genus database with same CATH topology
 4R6T A;  2ZW7 A;  5CPA A;  1DE4 C;  4UF4 A;  3T90 A;  5AG6 A;  3PRT A;  3WR7 A;  4HNW B;  2WPW A;  2PJ2 A;  1MK4 A;  4M6G A;  4A38 A;  2VL1 A;  3FMC A;  2XEF A;  1AYE A;  3RNZ A;  3T9Y A;  1Z8T A;  1Z4E A;  3QB8 A;  2Z3O A;  3F5B A;  2P6G A;  4NSQ A;  5LRG A;  1AUG A;  2P6E A;  1IY7 A;  2FIW A;  3SXO A;  2ZW5 A;  1SQH A;  2CXA A;  2GIV A;  3FXT A;  1FT7 A;  2ODF A;  2OOT A;  1BPN A;  2PIZ A;  4H6U A;  1Q2D A;  4KSI A;  3UY5 A;  2C6P A;  2IMO A;  1XE4 A;  4CGP A;  1CPS A;  4UCM A;  4KZT A;  2BUE A;  3DDD A;  4ZY0 A;  3CDX A;  4JJX A;  1ARL A;  4NEX A;  4KVM E;  4GXH A;  3DLJ A;  1BOB A;  1TKF A;  4ZBG A;  5KTC A;  3OWC A;  2OB0 A;  2FL4 A;  2QEC A;  5G21 A;  4E2A A;  4MY3 A;  1CG2 A;  1I12 A;  2BCO A;  4A2Z A;  4PPZ A;  4Q38 A;  4CAX A;  2QVP A;  2ZXV A;  4OC3 A;  1B87 A;  4U5Y A;  3B8G A;  2WZN A;  3PB7 X;  5IB0 A;  3D8P A;  1S3Z A;  1VHO A;  2AE6 A;  2PDO A;  4MHZ A;  5AG7 A;  4TWE A;  2PJC A;  3TX8 A;  5DWM A;  1GHE A;  3CZX A;  1QQ9 A;  3BI0 A;  5HXD A;  4MY0 A;  3TO6 A;  2J9A A;  2B4B A;  1YSJ A;  1ZG8 A;  3MN8 A;  2BEI A;  2OU2 A;  3TT2 A;  3LWU A;  5IV0 A;  2RB7 A;  4NGR A;  4AVC A;  4R3K A;  1I21 A;  2POK A;  2DXQ A;  3CT9 A;  1FY7 A;  3H5Z A;  4A95 A;  4U9Z A;  2G0B A;  3KQX A;  1ELM P;  2GLF A;  2JBJ A;  3N5F A;  4CYN A;  2NMT A;  5C88 A;  3SJX A;  3B35 A;  2Z3P A;  2IJZ A;  4XNH B;  2VZZ A;  5LRK A;  4CYQ A;  3L2N A;  5BWA B;  4AG9 A;  3EFA A;  4R7M A;  4NGQ A;  4UA3 A;  4KLW A;  2ZEN A;  2XEJ A;  4OAE A;  2NSM A;  2GAN A;  3DR6 A;  4C2Y A;  1TKJ A;  2ARH A;  3IWG A;  2EBJ A;  3D3S A;  3S9L A;  2KCW A;  2J8M A;  2Z11 A;  2FE7 A;  1Z8W A;  3KI9 A;  3D2P A;  3RBU A;  1Q2Y A;  2AFM A;  2ZED A;  3R9G A;  1TF9 A;  4HNX B;  5LYI A;  4G1P A;  1WK4 A;  3NE7 A;  4EFD A;  4XPD C;  1Z8X A;  3I9S A;  3TCV A;  3D7D A;  2PRB A;  1Y9K A;  2PQ8 A;  4QUS A;  1M4L A;  1PCA A;  4NJR A;  3FEC A;  2B3V A;  2C1C A;  3KHZ A;  4OC2 A;  4J3G A;  5JPH A;  1GYT A;  1L0C A;  4IHM A;  4MI4 A;  2PJ1 A;  4FD4 A;  3RYO A;  5KTD A;  2YNE A;  3K9T A;  3LD2 A;  4M6H A;  2FSR A;  2Q4V A;  4P4E A;  3SXN A;  4Z65 A;  2AFU A;  2DPT A;  4Q7A A;  4UFW A;  3IIB A;  2FS5 A;  4KOR A;  4ZGY B;  4R3L A;  2G3A A;  3VH9 A;  1QMU A;  1LRZ A;  1ZLI A;  2JDD A;  4MRI A;  3R9F A;  4A33 A;  4E0A A;  5C82 A;  4ZI6 A;  1BO4 A;  4B11 A;  1JQG A;  1XBU A;  3D66 A;  3MRU A;  4P10 A;  3KQZ A;  4DUK A;  4CS0 B;  1KWM A;  5HH1 A;  1YW4 A;  2BO9 A;  2ZEG A;  5ISV A;  1ZLH A;  2PJ6 A;  1MJB A;  4MFP A;  4MHN A;  4QBJ A;  1ZO0 A;  2VI7 A;  3TC8 A;  4IAV A;  3EO4 A;  3ISX A;  4UIA A;  3W91 A;  1B6B A;  4YU9 A;  2R98 A;  4QVT A;  5CNP A;  3H4Q A;  4MFK A;  3GUX A;  2PVV A;  3JTK A;  3S6F A;  1NE9 A;  3S6H A;  5F49 A;  2JEV A;  4DYO A;  3WC7 A;  4A31 A;  4DNC A;  4MFL A;  4JYW A;  1LCP A;  4OIW A;  1F57 A;  4FUU A;  4PK3 A;  1YX0 A;  4MFQ A;  3B3W A;  2ZW4 A;  2JDC A;  4A39 A;  2HV2 A;  3F0A A;  2Q7B A;  4ZY1 A;  5F46 A;  1XFO A;  3JRU A;  3R95 A;  4YFJ A;  5ELY A;  2HQY A;  4ZX9 A;  4H6Z A;  2REF A;  4F9V A;  1A2Z A;  5G1Z A;  4C7H A;  2O53 A;  3FIX A;  1IGB A;  3DR8 A;  1H8L A;  4KOT A;  4K30 A;  5I0C A;  4FD7 A;  3BI1 A;  3FEE A;  4KS9 A;  4QC6 A;  3ZZI A;  2B4D B;  3BJ7 A;  3PBE A;  4ONU A;  3HUV A;  1QSN A;  2Y0M A;  3SJF A;  4NCZ A;  1XMT A;  2ZEH A;  2RFH A;  4B5O A;  4U9Y A;  2DEA A;  5D8N A;  5H84 A;  4FAI A;  1CP6 A;  3MGD A;  3K2K A;  2PJ0 A;  2BOA A;  3JUW A;  4UEF A;  1J4J A;  3PP9 A;  2PR8 A;  3GB0 A;  4UIB A;  1YQE A;  1KZF A;  5F47 A;  2V8G A;  2I3C A;  3BXM A;  2H5M A;  3NH8 A;  3NH4 A;  2IL4 A;  2AJ6 A;  4MCP A;  4UWI A;  1YW6 A;  1DTD A;  5AG5 A;  4BIN A;  3T8W A;  4PSW A;  3HLP A;  2EUI A;  2PJB A;  1XF8 A;  1R57 A;  2C27 A;  3DNS A;  3ISZ A;  4UWJ A;  4WJB A;  3SI1 A;  1IID A;  3V7Z A;  2PJ3 A;  4B14 A;  2F7V A;  2R8V A;  5J1Q A;  2OZH A;  5IB9 A;  2YNC A;  3TFY A;  1I1D A;  2C6C A;  3FF3 A;  3P2F A;  2Z10 A;  3B3T A;  3H8F A;  1LAN A;  3PEI A;  2ZEM A;  4P4F A;  4CAF A;  4F0X A;  1YLO A;  4F8Z A;  3F8K A;  4EVY A;  4A94 A;  2VXK A;  2QIR A;  1M4I A;  2V77 A;  1R43 A;  1YR0 A;  4OC4 A;  2J8N A;  3R1K A;  5A28 A;  1Q2C A;  2PJ7 A;  3WC5 A;  4P4I A;  2ZEE A;  3H8E A;  2HC9 A;  4PXC A;  1P4N A;  4GM5 A;  3B3V A;  2Q0Y A;  3CXP A;  4R76 A;  3G8W A;  3R9E A;  4KSA A;  3SHP A;  5JQ4 A;  1YVO A;  1V0C A;  2Z3K A;  1ZG7 A;  1TKH A;  4MCS A;  1PUA A;  4NF1 A;  4XNH C;  5IX3 A;  2EK9 A;  2K5T A;  3WC6 A;  1VHE A;  1Z5R A;  1Z9U A;  2DPS A;  3D67 A;  4MCQ A;  4R9M A;  2QYV A;  2VZY A;  2WSA A;  1Z8L A;  3N7Z A;  3D68 A;  1HEE A;  4B5P B;  2JEW A;  3IFE A;  4JZ0 A;  5THW A;  2FT0 A;  2J8R A;  4A30 A;  4NGT A;  5K8P A;  1LFW A;  4OID A;  1XRY A;  3VWD A;  4LQG A;  2Q4Z A;  3E0K A;  1QST A;  5HVF A;  2PSW A;  2PJ9 A;  3KR5 A;  2AFX A;  4P4J A;  4IF5 A;  4A37 A;  1CX8 A;  1U6M A;  3D2M A;  4YRH A;  2V8V A;  3NFZ A;  4OME A;  4ZY2 A;  4XPD B;  2VEZ A;  3B3C A;  4C68 A;  1F2P A;  2V8D A;  4RN7 A;  1CP7 A;  1BAV A;  1S7F A;  4MXU A;  3IU2 A;  2BSW A;  4JXQ A;  2EVN A;  2C6G A;  4MHY A;  2PJ4 A;  3W6S A;  2A4N A;  4M85 A;  1HDU A;  3SJG A;  3FJU A;  5DS0 A;  4II9 A;  4P4B A;  3SI2 A;  2QJ8 A;  4CRZ B;  2ZEP A;  4NJQ A;  2FXF A;  2CTB A;  3DGV A;  4KOW A;  5G22 A;  3EY5 A;  3I3G A;  4MHD A;  3FYN A;  4KOX A;  4KVO E;  4XPL A;  5HVH A;  5A27 A;  4PV6 A;  1Z2L A;  2OZU A;  1OBR A;  3LOD A;  4PXE A;  3PGP A;  4JXR A;  3CXS A;  1RTQ A;  3H8G A;  2ZEO A;  4P6Y A;  3WAB A;  2DF5 A;  4X8I A;  4MFZ A;  2IQ6 A;  3RZA A;  1WWZ A;  4C7I A;  2CTC A;  2R1I A;  4K3N A;  4M3S A;  2PJA A;  5J8F A;  1N71 A;  3FNC A;  3SI0 A;  4ZYQ A;  3FED A;  1R3N A;  3BJ8 A;  3GY9 A;  4AVB A;  4B10 A;  2WUU A;  1EE3 P;  4I49 A;  1UWY A;  5HVG A;  4RS2 A;  7CPA A;  2Q4Y A;  4LQ6 A;  4KUB A;  1MJ9 A;  4EWT A;  4UCN A;  4CYP A;  4OAD A;  4MCR A;  3I1U A;  2GE3 A;  4ONW A;  4L8A A;  2ZOG A;  3LAC A;  4Y49 C;  4NGP A;  1CM0 A;  5LYF A;  3FBU A;  2XEI A;  2ANP A;  1X12 A;  1CBX A;  1IB1 E;  2YNC C;  1YME A;  1QSO A;  1KUY A;  3D4U A;  1M4G A;  1KUV A;  4NFR A;  4CGO A;  3WT4 A;  3S9M A;  2PR1 A;  3PBB A;  4BBH A;  5G20 A;  4A32 A;  5LRJ A;  4M6I A;  2O28 A;  4MJ8 A;  4P44 A;  4X3R A;  2NYQ A;  1TF8 A;  5E96 A;  3S6K A;  4O23 A;  3SJE A;  4CAV A;  3PB4 X;  3TOA A;  4CAE A;  2RC4 A;  5HMN A;  4KOV A;  3FVL A;  4H89 A;  2BL1 A;  3KKW A;  8CPA A;  2O4H A;  4CGM A;  1KUX A;  2B58 A;  4F6A A;  2YND A;  4KVX A;  2AFO A;  2PRQ A;  2WYR A;  1YGH A;  1XOV A;  2P0W A;  3IWE A;  3KAS A;  3NA6 A;  4HNY B;  3TO9 A;  3PB6 X;  1M4D A;  5FVJ A;  3P2H A;  3TOB A;  1Y7E A;  2GLJ A;  2ZEL A;  1RXT A;  5K8M A;  1NSA A;  1P0H A;  1UFH A;  4CYO A;  1VGY A;  2G9D A;  1Y0R A;  2F5I A;  4KLV A;  2FVG A;  2Q51 A;  3GKR A;  5KTA A;  1QSR A;  3V38 A;  4UEE A;  1S7N A;  3S9N A;  2ZOF A;  3GLJ A;  4YWY A;  5CBM A;  4W9Y A;  4CRY B;  4AB7 A;  3NH5 A;  1MJA A;  4B13 A;  4PXB A;  1K4J A;  3LMS A;  4FD6 A;  4CPA A;  4EME A;  1OZP A;  2CIJ A;  3CPX A;  3W6X A;  4CGL A;  3GIU A;  3FRM A;  3JVN A;  3TO7 A;  2JLM A;  5K8O A;  5JGF A;  2X7B A;  4CGN A;  4AVA A;  4NGS A;  4L89 A;  3IGR A;  2ABZ A;  4XPK A;  2CY2 A;  1XMB A;  1BLL E;  4YGO A;  6CPA A;  3B7I A;  4F9U A;  1FNO A;  2PJ5 A;  2PJ8 A;  3IWW A;  4JLY A;  3B2Y A;  2JBK A;  2PC1 A;  3VAT A;  4P45 A;  4UBR A;  2Q7S A;  3IEH A;  2OZG A;  4IK2 A;  1Q7L A;  2B4D A;  2FIA A;  4UCP A;  3D7F A;  5GCN A;  5EBV A;  3PFE A;  5EMI A;  2D4O A;  1IOF A;  2ATR A;  3C26 A;  2V8H A;  4CAW A;  1S60 A;  2FCK A;  4B6Z A;  3BHX A;  2R7H A;  2D4P A;  4WWV A;  3RAM A;  2PIY A;  3VWE A;  4C2X A;  3A9L A;  3QAY A;  4R87 A;  1NMT A;  2B5G B;  3D7H A;  3KZW A;  5DWN A;  1S5K A;  1TIQ A;  4R8F A;  2QML A;  1X10 A;  1YLE A;  3CPA A;  3KHX A;  5I4M A;  4OC5 A;  1AMP A;  2B3U A;  2Z3L A;  1YRE A;  3PZJ A;  2I00 A;  4GS4 A;  4UFV A;  1CPX A;  1JWQ A;  3R96 A;  2OH1 A;  4JD6 A;  4NGM A;  1CJW A;  2G3T A;  3IJ3 A;  1IYL A;  2GU2 A;  4IUS A;  2CNT A;  4P4D A;  4PXD A;  2Q44 A;  1VIX A;  4FD5 A;  4QB9 A;  1Z4R A;  4R57 A;  3EXN A;  3TE4 A;  2AFZ A;  3RO0 A;  1M44 A;  1S7L A;  4BD9 A;  3KGQ A;  2P6F A;  2Z3N A;  4KOS A;  5JH9 A;  3PB9 X;  2Q43 A;  2CNS A;  3QAH A;  2ZPA A;  4X5K A;  2CF4 A;  3S6G A;  4NXY A;  2ZEF A;  3D7G A;  2EK8 A;  3VAR A;  4AXV A;  1XIX A;  3GYA A;  2HB6 A;  3CXQ A;  1NSL A;  1VKC A;  4UFX A;  1ZG9 A;  4Q36 A;  4F0Y A;  4MBU A;  2F8H A;  5AGE A;  3V8I A;  5JM6 A;  2REE A;  1HDQ A;  1ON0 A;  1YK3 A;  3KR4 A;  1PYT B;  1XEB A;  1Y9W A;  2Z3M A;  2Q04 A;  3DSB A;  3FX6 A;  3G3S A;  2XEG A;  1S7K A;  4KUA A;  4OC0 A;  2PCU A;  4H2K A;  5F09 A;  2PE3 A;  1Y0Y A;  5F48 A;  2YGW A;  2ZW6 A;  2CNM A;  3EC4 A;  1XJO A;  2Z0Z A;  4AG7 A;  3KL9 A;  4PK2 A;  4KSF A;  4OP4 A;  3B3S A;  1QSM A;  4PSX A;  5H86 A;  1IIC A;  1M1D A;  2VQY A;  3PB8 X;  4B5P A;  4HKF A;  1BPM A;  4OLL A;  3K9U A;  5EC4 A;  1F2O A;  4E8O A;  2EWB A;  4MHP A;  3ZJ0 A;  2OR4 A;  3IU1 A;  1LAP A;  4UEZ A;  4B12 A;  5J8C A;  2VBQ A;  4MFJ A;  1PU9 A;  1IOI A;  2I79 A;  3NE8 A;  4OKO A;  3BLN A;  4NGN A;  4ORF A;  3TTH A;  2EO8 A;  4C2Z A;  1VHS A;  2PVW A;  1Y7R A;  4BMH A;  5AG4 A;  1IU8 A;  1LAM A;  2B5G A;  4HPS A;  1ELL P;  3IC1 A;  3FB3 A;  4JWP A;  5LYD A;  4X2T A;  4LUA A;  3FH4 A;  4KOU A;  2HUZ A;  4PQA A;  2GRE A;  4ZX8 A;  3IO1 A;  3QNV A;  4RI1 A;  4FBE A;  4RUH A;  1ARM A;  2GFQ A;  1RO5 A;  4KOY A;  1LOK A;  1YVK A;  4DJL A;  2AFS A;  1IYK A;  2WPX A;  2AFW A;  4FWU A;  4Y49 B;  3PFO A;  5LYL A;  4OC1 A;  4LX9 A;  4MMO A;  5D29 A;  4TNU A;  1TXR A;  5K8N A; 
#chains in the Genus database with same CATH homology
 2ZW7 A;  3T90 A;  5AG6 A;  3WR7 A;  4HNW B;  2WPW A;  1MK4 A;  3T9Y A;  1Z4E A;  3QB8 A;  2Z3O A;  3F5B A;  2P6G A;  4NSQ A;  2P6E A;  3SXO A;  2FIW A;  2ZW5 A;  1SQH A;  2CXA A;  2GIV A;  3FXT A;  4H6U A;  1Q2D A;  3UY5 A;  1XE4 A;  4CGP A;  4UCM A;  4KZT A;  2BUE A;  3DDD A;  4JJX A;  4NEX A;  4KVM E;  5KTC A;  1BOB A;  4ZBG A;  3OWC A;  2OB0 A;  2FL4 A;  2QEC A;  5G21 A;  4E2A A;  4MY3 A;  1I12 A;  4A2Z A;  4Q38 A;  4CAX A;  2ZXV A;  4U5Y A;  1B87 A;  3B8G A;  5IB0 A;  3D8P A;  1S3Z A;  2AE6 A;  2PDO A;  5AG7 A;  5DWM A;  1GHE A;  4MY0 A;  3TO6 A;  2B4B A;  2BEI A;  2OU2 A;  3TT2 A;  5IV0 A;  4AVC A;  4R3K A;  1I21 A;  2DXQ A;  1FY7 A;  3H5Z A;  4A95 A;  4U9Z A;  2G0B A;  4CYN A;  5C88 A;  2NMT A;  2Z3P A;  4XNH B;  2VZZ A;  4CYQ A;  5BWA B;  4AG9 A;  3EFA A;  4UA3 A;  4KLW A;  4OAE A;  3DR6 A;  2GAN A;  4C2Y A;  2ARH A;  3IWG A;  3D3S A;  2KCW A;  2J8M A;  2Z11 A;  2FE7 A;  3D2P A;  1Q2Y A;  3R9G A;  4HNX B;  1WK4 A;  3NE7 A;  4XPD C;  3I9S A;  3TCV A;  2PRB A;  1Y9K A;  2PQ8 A;  4QUS A;  2B3V A;  5JPH A;  4J3G A;  1L0C A;  4MI4 A;  5KTD A;  4FD4 A;  3RYO A;  2YNE A;  3LD2 A;  2FSR A;  2Q4V A;  3SXN A;  2DPT A;  4UFW A;  2FS5 A;  4KOR A;  4ZGY B;  4R3L A;  2G3A A;  1LRZ A;  2JDD A;  3R9F A;  4A33 A;  4E0A A;  5C82 A;  1BO4 A;  4B11 A;  4CS0 B;  5HH1 A;  5ISV A;  1MJB A;  4MFP A;  4QBJ A;  1ZO0 A;  2VI7 A;  3EO4 A;  3W91 A;  1B6B A;  2R98 A;  4QVT A;  5CNP A;  3H4Q A;  4MFK A;  3JTK A;  3S6F A;  1NE9 A;  3S6H A;  5F49 A;  2JEV A;  4A31 A;  4DNC A;  4MFL A;  4PK3 A;  1YX0 A;  4MFQ A;  2ZW4 A;  2JDC A;  2HV2 A;  3F0A A;  2Q7B A;  5F46 A;  3R95 A;  4YFJ A;  2HQY A;  4H6Z A;  2REF A;  5G1Z A;  4C7H A;  3FIX A;  3DR8 A;  4KOT A;  4K30 A;  5I0C A;  4FD7 A;  4KS9 A;  4QC6 A;  3ZZI A;  2B4D B;  3BJ7 A;  4ONU A;  1QSN A;  2Y0M A;  4NCZ A;  1XMT A;  4B5O A;  4U9Y A;  5H84 A;  3MGD A;  3JUW A;  1J4J A;  3PP9 A;  2PR8 A;  5F47 A;  1KZF A;  2H5M A;  2IL4 A;  2AJ6 A;  4UWI A;  5AG5 A;  4PSW A;  3R96 A;  2EUI A;  4UWJ A;  1XF8 A;  1R57 A;  2C27 A;  3DNS A;  4B14 A;  1IID A;  2R8V A;  2OZH A;  2YNC A;  3TFY A;  1I1D A;  3P2F A;  2Z10 A;  4CAF A;  4F0X A;  3F8K A;  4EVY A;  2VXK A;  2QIR A;  1M4I A;  1YR0 A;  2J8N A;  3R1K A;  5A28 A;  1Q2C A;  1P4N A;  2Q0Y A;  3CXP A;  3G8W A;  3R9E A;  4KSA A;  3SHP A;  5JQ4 A;  1YVO A;  1V0C A;  2Z3K A;  1PUA A;  4NF1 A;  4XNH C;  5IX3 A;  2K5T A;  1Z9U A;  2DPS A;  4R9M A;  2VZY A;  2WSA A;  3N7Z A;  4B5P B;  2FT0 A;  2J8R A;  4A30 A;  3VWD A;  3E0K A;  1QST A;  2PSW A;  4IF5 A;  1U6M A;  3D2M A;  4YRH A;  4XPD B;  2VEZ A;  4C68 A;  1S7F A;  3IU2 A;  2BSW A;  4JXQ A;  2EVN A;  2A4N A;  4M85 A;  4II9 A;  4CRZ B;  2FXF A;  4KOW A;  5G22 A;  3EY5 A;  3I3G A;  4MHD A;  3FYN A;  4KOX A;  4KVO E;  4XPL A;  5A27 A;  4PV6 A;  2OZU A;  3LOD A;  3PGP A;  4JXR A;  3CXS A;  4MFZ A;  4C7I A;  1WWZ A;  2R1I A;  4M3S A;  5J8F A;  1N71 A;  3FNC A;  3BJ8 A;  3GY9 A;  4AVB A;  4B10 A;  2WUU A;  4I49 A;  4RS2 A;  2Q4Y A;  4KUB A;  1MJ9 A;  4UCN A;  4CYP A;  4OAD A;  2GE3 A;  4L8A A;  4Y49 C;  1CM0 A;  3FBU A;  1IB1 E;  2YNC C;  1QSO A;  1KUY A;  1M4G A;  1KUV A;  4CGO A;  4BBH A;  2PR1 A;  5G20 A;  2O28 A;  4MJ8 A;  3S6K A;  4CAE A;  5E96 A;  4CAV A;  3TOA A;  2RC4 A;  5HMN A;  4KOV A;  4H89 A;  2BL1 A;  3KKW A;  4CGM A;  1KUX A;  2B58 A;  4F6A A;  2YND A;  4KVX A;  1YGH A;  2P0W A;  3TO9 A;  3IWE A;  4HNY B;  1M4D A;  5FVJ A;  3P2H A;  3TOB A;  1RXT A;  1UFH A;  1P0H A;  4CYO A;  2F5I A;  4KLV A;  3GKR A;  5KTA A;  1QSR A;  1S7N A;  4CRY B;  4AB7 A;  1MJA A;  4B13 A;  1K4J A;  4FD6 A;  1OZP A;  3W6X A;  4CGL A;  3FRM A;  3JVN A;  3TO7 A;  2JLM A;  2X7B A;  4CGN A;  4AVA A;  4L89 A;  3IGR A;  4XPK A;  2CY2 A;  4YGO A;  4JLY A;  2PC1 A;  4UBR A;  2OZG A;  2B4D A;  2FIA A;  4UCP A;  5GCN A;  5EBV A;  2D4O A;  2ATR A;  3C26 A;  4CAW A;  1S60 A;  2FCK A;  2R7H A;  2D4P A;  3VWE A;  4C2X A;  3A9L A;  5DWN A;  4R87 A;  1NMT A;  2B5G B;  1S5K A;  1TIQ A;  2QML A;  1YLE A;  2B3U A;  2Z3L A;  1YRE A;  3PZJ A;  2I00 A;  4GS4 A;  4UFV A;  2OH1 A;  4JD6 A;  1CJW A;  2G3T A;  1IYL A;  4IUS A;  2CNT A;  2Q44 A;  4FD5 A;  4QB9 A;  4R57 A;  1Z4R A;  3EXN A;  3TE4 A;  1M44 A;  1S7L A;  2P6F A;  2Z3N A;  4KOS A;  3QAH A;  2CNS A;  2ZPA A;  4X5K A;  3S6G A;  4NXY A;  1XIX A;  3GYA A;  3CXQ A;  1NSL A;  1VKC A;  4UFX A;  4Q36 A;  4F0Y A;  4MBU A;  5AGE A;  3V8I A;  2REE A;  1YK3 A;  1ON0 A;  1Y9W A;  1XEB A;  2Z3M A;  3DSB A;  2Q04 A;  3G3S A;  4KUA A;  3W6S A;  1S7K A;  5F48 A;  2YGW A;  2ZW6 A;  2CNM A;  3EC4 A;  2Z0Z A;  4AG7 A;  4PK2 A;  4KSF A;  4PSX A;  1QSM A;  5H86 A;  1IIC A;  1M1D A;  2VQY A;  4B5P A;  4HKF A;  5EC4 A;  4OLL A;  3K9U A;  4E8O A;  3ZJ0 A;  3IU1 A;  4B12 A;  5J8C A;  2VBQ A;  4MFJ A;  1PU9 A;  2I79 A;  3BLN A;  4ORF A;  3TTH A;  4C2Z A;  1VHS A;  5AG4 A;  1Y7R A;  4BMH A;  2B5G A;  4JWP A;  3FB3 A;  4LUA A;  4KOU A;  2HUZ A;  4RI1 A;  1RO5 A;  4KOY A;  1YVK A;  1IYK A;  2WPX A;  4Y49 B;  4LX9 A;  4A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...