2IQ6A

Crystal structure of the aminopeptidase from vibrio proteolyticus in complexation with leucyl-leucyl-leucine.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Experimental evidence for a metallohydrolase mechanism in which the nucleophile is not delivered by a metal ion: EPR spectrokinetic and structural studies of aminopeptidase from Vibrio proteolyticus
pubmed doi rcsb
total genus 109
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2iq6A00
4IHMA 5J1QA 4RUHA 1LFWA 1FT7A 2C6PA 3CT9A 4DJLA 4UIAA 2AFUA 2PVWA 3D67A 1CP7A 4P4FA 2IMOA 2DEAA 4NFRA 1DTDA 5HVHA 2V8HA 3B3SA 1PYTB 3WC5A 4NGMA 3WC6A 2Q4ZA 3KHZA 4NJQA 1VHEA 1XMBA 5K8OA 1QQ9A 2ZEEA 3B2YA 4P44A 2ZEDA 4MCQA 4OMEA 2GLFA 3KZWA 4ZY1A 4R6TA 3RAMA 2ZELA 4P4IA 1ZLHA 2ZEMA 3KHXA 3FH4A 2WZNA 2V8VA 2ZENA 7CPAA 1XFOA 1F2PA 2IQ6A 3FVLA 4EFDA 4P4JA 2PJ4A 3GB0A 2PRQA 2ZEHA 2BCOA 2AFZA 2ZEGA 4EWTA 3SI0A 3T8WA 4NGTA 4OIDA 2C1CA 4OIWA 5LRGA 2WYRA 1CBXA 2O4HA 5D8NA 1BAVA 3NA6A 4ZY2A 4A38A 4PPZA 1XRYA 2PIZA 3S9MA 2XEIA 3SI2A 3B3VA 3BXMA 1M4LA 3FX6A 4UIBA 3LWUA 1CPSA 1YW6A 3L2NA 1Y0RA 4CPAA 3FMCA 3K9TA 1BPNA 4OKOA 5K8PA 3N5FA 3FECA 4PXCA 2I3CA 4H2KA 1LAPA 5LYLA 1ELLP 2PJ6A 1ARLA 3PBEA 2QVPA 4OC0A 4LQGA 2IJZA 2CF4A 3VATA 2PJBA 3BI1A 3VARA 4TWEA 2BO9A 3V38A 3IEHA 3IO1A 2F8HA 3KGQA 4F9UA 4W9YA 5HVFA 1R3NA 4ZI6A 2O53A 3ISZA 1Q7LA 1HDQA 1AYEA 3TX8A 2Q51A 4MMOA 3B3CA 3SJEA 1CP6A 4MHYA 2PJ9A 4K3NA 5I4MA 4P45A 1Z5RA 3KQXA 2AFSA 3MRUA 4Z65A 4GM5A 3CDXA 3TC8A 3S9NA 3NFZA 3H8GA 4IK2A 1F57A 4A94A 2ZOFA 5HVGA 1ZG7A 1UWYA 1YSJA 3ISXA 1CPXA 4KSIA 2QJ8A 4OC5A 5LYFA 3VH9A 4R8FA 2EK9A 1VIXA 2ZEFA 3H8EA 2PJ5A 3V7ZA 3IJ3A 1LANA 8CPAA 3KI9A 3KL9A 2V8DA 2PJ7A 3RBUA 2V8GA 5HXDA 3D7FA 1DE4C 4IAVA 1BLLE 3H8FA 4NJRA 5JH9A 5IB9A 3RZAA 4ONWA 4A39A 1NSAA 3WABA 2J9AA 4TNUA 1PCAA 1HDUA 3SJGA 3D68A 2CTBA 1IY7A 2EWBA 4FWUA 5DS0A 3WC7A 1Z2LA 2ANPA 3BI0A 1XJOA 3BHXA 4G1PA 4F8ZA 3NH5A 1IGBA 4B6ZA 3K2KA 4MHPA 1CG2A 3PB8X 4MRIA 1VGYA 3CPXA 1R43A 2V77A 2JEWA 4MHNA 5THWA 1Z8LA 4UEZA 3DLJA 1YW4A 1TF8A 4MHZA 2AFXA 3KR5A 2G9DA 4PQAA 3SJXA 1YMEA 4ZY0A 1LAMA 2XEJA 4NGQA 1EE3P 3GLJA 1Y7EA 6CPAA 2PJ2A 2BOAA 5LYDA 3QNVA 4MXUA 1ARMA 1TXRA 4JYWA 1LCPA 3D7HA 5CBMA 2ABZA 4Q7AA 3NH8A 3DGVA 4P10A 2RB7A 5F09A 2HB6A 1VHOA 2XEGA 3D4UA 2VL1A 4F9VA 3I1UA 4OC4A 1HEEA 3FEEA 2PCUA 4ZYQA 1BPMA 4X8IA 3S9LA 1CX8A 3SI1A 4NGPA 4DUKA 1ELMP 4JZ0A 3B35A 4AXVA 5K8MA 4DYOA 1ZLIA 4P4DA 3PB6X 5D29A 4ZX8A 2CIJA 2PIYA 4UF4A 1TKFA 4O23A 5ELYA 2PJ1A 5LYIA 2C6CA 4P4BA 1QMUA 3WT4A 3PB7X 2PJ0A 2PJ3A 3KASA 2C6GA 2PJCA 3FF3A 4NGSA 4ZX9A 2QYVA 1ZG8A 1YLOA 3SJFA 1Y0YA 4R76A 4X3RA 2FVGA 2NYQA 4X2TA 3PBBA 2ZEOA 2PVVA 2F7VA 1LOKA 4R7MA 3PRTA 2GU2A 2ZEPA 4BD9A 3IC1A 1JQGA 4YWYA 3HLPA 2CTCA 3KR4A 2GREA 3CPAA 4NGNA 2OR4A 4UEEA 4OC3A 3JRUA 1OBRA 1XBUA 1H8LA 3FEDA 2GLJA 3PFOA 1AMPA 4WWVA 3D66A 3PFEA 1GYTA 4WJBA 5LRKA 1FNOA 4OC1A 3KQZA 2AFOA 3D7DA 4FBEA 2Q43A 4A37A 2JBJA 4EMEA 4UEFA 4FUUA 5LRJA 3PEIA 4P6YA 3MN8A 3D7GA 3IWWA 4PXBA 2ZOGA 2JBKA 1TKHA 3LMSA 4FAIA 5K8NA 4OP4A 2XEFA 2AFMA 3B7IA 3IFEA 4P4EA 4MCPA 2RFHA 3B3WA 3HUVA 4NGRA 1KWMA 2PJ8A 3NH4A 1TKJA 2EK8A 3GUXA 3PB9X 3IIBA 5JGFA 1ZG9A 4PXEA 2AFWA 2NSMA 2HC9A 4OC2A 1RTQA 2OOTA 4PXDA 5CPAA 4MCRA 1TF9A 2POKA 1F2OA 3PB4X 5JM6A 2PJAA 4YU9A 3FJUA 4MCSA 3B3TA 2PE3A
chains in the Genus database with same CATH superfamily
4IHMA 2VEZA 5J1QA 4RUHA 3GIUA 3TO9A 1LFWA 3NE8A 3H4QA 2I00A 4KUAA 1FT7A 5E96A 2Q04A 2Q7BA 5AG4A 3R9GA 1RXTA 2C6PA 2REEA 3CT9A 3I9SA 4DJLA 2Z3KA 5BWAB 2ZW6A 2BSWA 4ZBGA 4UIAA 2AFUA 1B6BA 2PVWA 3JTKA 3D67A 1CP7A 2PR8A 4KLVA 4P4FA 2IMOA 2DEAA 3D3SA 4NFRA 1DTDA 4MFQA 2WUUA 3SHPA 2V8HA 3EXNA 3TO7A 5HVHA 2EO8A 3B3SA 3B8GA 1PYTB 2R1IA 3PP9A 4MFJA 4U9ZA 4X5KA 2ATRA 1CM0A 4NGMA 3SXOA 2G3AA 3WC5A 3R9EA 3WC6A 4AG9A 2FT0A 2Q4ZA 4QB9A 3BJ8A 2DPTA 3CXQA 3KHZA 2R8VA 4NJQA 1YX0A 3FXTA 3D2PA 1VHEA 1XMBA 3BJ7A 2D4PA 4XPDC 5K8OA 1ON0A 4B14A 1QQ9A 1XE4A 3TT2A 2ZEEA 3B2YA 4P44A 4GS4A 2ZEDA 4MCQA 4HNWB 3DR8A 4OMEA 4GXHA 4QUSA 2GLFA 2JEVA 2YNCC 3KZWA 2FIWA 4A30A 4R6TA 3GY9A 4ZY1A 3RAMA 2ZELA 2GIVA 4P4IA 2OB0A 1ZLHA 2ZEMA 3KHXA 3FH4A 2WZNA 4XNHC 4BINA 2R7HA 2V8VA 3A9LA 2ZENA 4RN7A 2CNTA 3IU2A 1KUYA 3VWEA 2BL1A 7CPAA 1XFOA 1F2PA 4HNYB 2NMTA 2ODFA 3DSBA 3S6KA 3D2MA 3EFAA 4R3LA 2YNDA 5AG5A 2IQ6A 3FVLA 4EFDA 3R95A 2Z10A 1IYLA 1YVKA 2ZXVA 2FXFA 4IUSA 2PJ4A 4P4JA 3GB0A 2PRQA 3K9UA 2ZEHA 2B5GA 2BCOA 4A31A 2AFZA 2ZEGA 4EWTA 2CY2A 3SI0A 3T8WA 4H6ZA 3SXNA 2REFA 4NGTA 5EC4A 4H89A 2D4OA 4OIDA 2C1CA 4CS0B 4OIWA 4A2ZA 5LRGA 3D8PA 2WYRA 1CBXA 4Q38A 4B5PA 2O4HA 1ZO0A 4NSQA 4KOYA 5D8NA 1BAVA 1FY7A 3R1KA 3P2FA 4B5OA 1UFHA 3NA6A 4OLLA 1QSMA 4PPZA 1XF8A 4ZY2A 4A38A 1XRYA 2PIZA 4UWJA 3S9MA 2Y0MA 4C68A 2XEIA 5KTCA 5F47A 3SI2A 4U9YA 3B3VA 5ISVA 4H6UA 1JWQA 3TE4A 4FD7A 3F5BA 3BXMA 1M4LA 4KOUA 3FX6A 1GHEA 4PV6A 4UIBA 2VZZA 3LWUA 1CPSA 1YW6A 2PDOA 5G1ZA 3L2NA 4R3KA 4C7IA 1Y0RA 4CPAA 4CYPA 3FMCA 3K9TA 2HQYA 2QMLA 5AGEA 4B11A 4IF5A 1IOIA 1SQHA 1BPNA 4OKOA 5K8PA 3N5FA 3FECA 3P2HA 4PXCA 4CYQA 2I3CA 4H2KA 3G8WA 1LAPA 4Y49C 5LYLA 4R9MA 4NXYA 4UCPA 1TIQA 1ELLP 4XPDB 2PJ6A 2EBJA 1ARLA 4AVAA 3PBEA 4CAWA 2QVPA 4OC0A 4LQGA 2IJZA 2CF4A 3VATA 5AG7A 2CXAA 1S7NA 3MGDA 1YQEA 2PJBA 3BI1A 3VARA 4TWEA 4CYOA 2HUZA 2BO9A 3V38A 1CJWA 3IEHA 3IO1A 2F8HA 4HKFA 3KGQA 4F9UA 4MFZA 4M6IA 3FBUA 4UWIA 4I49A 4XNHB 4W9YA 5HVFA 4E2AA 1X12A 1R3NA 4ZI6A 2O53A 3ISZA 1MK4A 4CRYB 2DPSA 4CGOA 1Q7LA 3C26A 1HDQA 1AYEA 4BMHA 3JVNA 3TX8A 4AVCA 2Q51A 1XOVA 1M4IA 2J8RA 4MMOA 4EVYA 3OWCA 3B3CA 4L8AA 3SJEA 1CP6A 4Q36A 4MHYA 4CGMA 2PJ9A 5H84A 1NMTA 4K3NA 1P0HA 5I4MA 4P45A 3TOAA 1Z5RA 2CNSA 2JLMA 3KQXA 2AFSA 4U5YA 3MRUA 4Z65A 4GM5A 2O28A 1XIXA 3CDXA 4UBRA 2P6EA 1S60A 3TC8A 3S9NA 2P6GA 3NFZA 4KS9A 1NE9A 3H8GA 4JWPA 1YREA 3CXPA 4IK2A 3UY5A 4B12A 1PU9A 1Z4EA 1F57A 2VBQA 3F8KA 2IL4A 4A94A 2ZOFA 3CXSA 5HVGA 1QSOA 1ZG7A 5FVJA 1UWYA 4UA3A 1YSJA 1CPXA 3ISXA 4UFXA 4KSIA 4XPKA 2QJ8A 4OC5A 1YVOA 5LYFA 4B13A 2Z3PA 2WPWA 2PSWA 3VH9A 4R8FA 3TOBA 3W6XA 4CGNA 5IX3A 2ZW4A 2EK9A 4M3SA 1RO5A 2Z3LA 1Q2CA 1VIXA 5KTDA 2ZEFA 4JLYA 3H8EA 2PJ5A 5DWNA 3W6SA 1V0CA 2CNMA 3V7ZA 3IJ3A 5HH1A 3V8IA 1LANA 4M85A 8CPAA 3I3GA 1I1DA 3KI9A 5A27A 5JPHA 1R57A 4QVTA 3TFYA 3KL9A 4MI4A 2JDDA 4C7HA 5C82A 2V8DA 2PJ7A 5IV0A 3RBUA 2V8GA 2Q0YA 2PQ8A 2PRBA 5HXDA 3D7FA 2OU2A 1DE4C 4IAVA 1BLLE 3W91A 4C2XA 3H8FA 4NJRA 4QC6A 3JUWA 5JH9A 3RYOA 5IB9A 3N7ZA 4Y49B 3RZAA 3S6HA 4ONWA 4K30A 4R57A 4A39A 1IICA 1NSAA 3WABA 2J9AA 4TNUA 1PCAA 1HDUA 1Y9KA 3SJGA 5F46A 4KLWA 1P4NA 3D68A 2CTBA 1IY7A 4PSWA 5CNPA 5F49A 2EWBA 3R9FA 3LACA 4FWUA 5DS0A 3IGRA 2VXKA 2B4DB 3FNCA 3VWDA 5GCNA 3WC7A 4B10A 2F5IA 1Z2LA 2ANPA 3BI0A 3DNSA 4KSFA 1XJOA 1Z4RA 3BHXA 3IWGA 4G1PA 4RS2A 1VKCA 4CGLA 4F8ZA 3NH5A 1IGBA 5EBVA 4B6ZA 3K2KA 3DR6A 1CG2A 3PB8X 4MHPA 4MRIA 1VGYA 3CPXA 3LD2A 1R43A 2I79A 2Z3OA 1I21A 2V77A 2ARHA 2JEWA 1S3ZA 4MFKA 4MHNA 5THWA 1Z8LA 2X7BA 2BUEA 4LUAA 4UEZA 3DLJA 1YW4A 1U6MA 4YFJA 4C2ZA 5G22A 1TF8A 4F6AA 4MHZA 4UCMA 5F48A 3ZZIA 2AFXA 3KR5A 2PR1A 2G9DA 4PQAA 1KUXA 1KZFA 4AVBA 3SJXA 2VI7A 3QAHA 2DF5A 1YMEA 2OZGA 4ZY0A 2B4BA 2BEIA 1LAMA 4CGPA 4KVXA 2XEJA 4KOSA 4ORFA 4NGQA 1EE3P 5KTAA 2G0BA 2P0WA 3GLJA 2JDCA 1MJ9A 1Y7EA 4PK2A 3E0KA 4C2YA 6CPAA 3EC4A 2FSRA 4KOVA 2PJ2A 2AE6A 2BOAA 2B3UA 1KUVA 5LYDA 2FS5A 3QNVA 1WK4A 3FRMA 1ARMA 4MXUA 1TXRA 5DWMA 4JYWA 3R96A 4II9A 4KSAA 4CAFA 4CAEA 1MJAA 1LCPA 3D7HA 5CBMA 4KZTA 2ABZA 2Z3NA 4Q7AA 3NH8A 4QBJA 2B58A 2GANA 3DGVA 3RO0A 3PZJA 4P10A 1X10A 2RB7A 5F09A 2HB6A 3DDDA 1B87A 1VHOA 2XEGA 1IIDA 3D4UA 2VL1A 3LODA 3I1UA 4KVME 4MY3A 4F9VA 1Q2YA 2YNEA 1HEEA 3FEEA 4MJ8A 4OC4A 2PCUA 3ZJ0A 4M6HA 4JD6A 2B5GB 4ZYQA 1BPMA 4KORA 5JQ4A 4LX9A 1IB1E 1S7LA 2YGWA 2ZPAA 4X8IA 2OH1A 1Z8TA 3S9LA 3FB3A 2Z11A 1CX8A 2EVNA 2Q44A 3SI1A 1VHSA 2HV2A 2FCKA 2VQYA 4NGPA 2G3TA 4DUKA 1ELMP 4YGOA 3EO4A 4JZ0A 3B35A 2K5TA 4B5PB 4AXVA 1YK3A 1Z8XA 3TCVA 3T90A 5K8MA 4DYOA 1ZLIA 1L0CA 4P4DA 4MY0A 2WSAA 3PB6X 5D29A 4ZX8A 4J3GA 2Q4VA 2CIJA 2PIYA 4UF4A 1TKFA 2QIRA 1IYKA 4O23A 3NE7A 2H5MA 5ELYA 5G20A 2PJ1A 5LYIA 2C6CA 4P4BA 5EMIA 1M1DA 3KKWA 1QMUA 3WT4A 3PB7X 2PJ0A 2PJ3A 3KASA 2C6GA 2PJCA 1YLEA 3FF3A 3S6FA 4CRZB 3GKRA 4NGSA 5C88A 4ZX9A 2WPXA 3FYNA 1WWZA 2QYVA 2FIAA 1ZG8A 1YLOA 4M6GA 4MFPA 3SJFA 1Y0YA 1S7KA 2AJ6A 4R76A 4X3RA 2FVGA 2NYQA 4X2TA 2GFQA 3PBBA 1M44A 3S6GA 2ZEOA 1I12A 2F7VA 1LOKA 2KCWA 2PVVA 3H5ZA 4F0YA 4R7MA 4CAVA 1Z8WA 3PRTA 2GU2A 2ZEPA 3IWEA 4CAXA 4NEXA 4PK3A 3T9YA 3IC1A 4BD9A 4F0XA 1YR0A 1JQGA 4KVOE 3GYAA 3HLPA 4YWYA 2CTCA 2YNCA 3KR4A 2OZHA 1IU8A 2GREA 1QSRA 4MHDA 3CPAA 4MFLA 4NGNA 2OR4A 4UEEA 4OC3A 3G3SA 4A32A 3JRUA 1XEBA 1OBRA 1XBUA 1H8LA 3FEDA 2C27A 2Q4YA 4R87A 2GLJA 1BOBA 3PFOA 4AG7A 2GE3A 1AMPA 4WWVA 3IU1A 3D66A 4JXRA 3FIXA 1MJBA 3PFEA 4LQ6A 3QB8A 1GYTA 4WJBA 4ONUA 5HMNA 1FNOA 5IB0A 5LRKA 4UCNA 1N71A 4FD5A 2P6FA 2A4NA 4OC1A 2FL4A 3WR7A 3KQZA 4JXQA 2AFOA 2VZYA 3D7DA 1M4DA 5A28A 1J4JA 4FBEA 2Q43A 2B3VA 1K4JA 4A37A 2DXQA 5J8CA 2JBJA 4EMEA 4UEFA 4BBHA 4KOTA 4FUUA 1Y7RA 1LRZA 4MBUA 3RNZA 4FD6A 5LRJA 3PEIA 3PGPA 4P6YA 2J8NA 1QSNA 3MN8A 3D7GA 3IWWA 2R98A 1YGHA 4HPSA 2OZUA 4PXBA 3F0AA 2EUIA 2ZOGA 3QAYA 1Y9WA 2JBKA 1TKHA 3LMSA 4E8OA 4FAIA 4E0AA 5K8NA 1QSTA 4OP4A 2XEFA 2AFMA 3B7IA 3IFEA 4HNXB 4P4EA 5H86A 4A95A 4MCPA 2PC1A 1AUGA 2RFHA 4DNCA 3B3WA 1M4GA 3HUVA 4L89A 1S5KA 4NGRA 5AG6A 3EY5A 3CZXA 2Z3MA 1Z9UA 2Z0ZA 1KWMA 4XPLA 2FE7A 4KUBA 2PJ8A 3NH4A 1TKJA 1Q2DA 4OAEA 3TTHA 5J8FA 3TO6A 3BLNA 2RC4A 2EK8A 1IOFA 1OZPA 3GUXA 3PB9X 4OADA 3IIBA 5JGFA 1ZG9A 4PXEA 4AB7A 2AFWA 2NSMA 1XMTA 4FD4A 4UFVA 2ZW7A 4YRHA 4NCZA 1A2ZA 2HC9A 4OC2A 4ZGYB 1S7FA 1RTQA 2ZW5A 4JJXA 2OOTA 4KOWA 4UFWA 4PSXA 2QECA 4NF1A 4PXDA 5CPAA 4MCRA 1TF9A 1NSLA 2POKA 1F2OA 3PB4X 2J8MA 5JM6A 2PJAA 4YU9A 3FJUA 1BO4A 4CYNA 4MCSA 4RI1A 4A33A 3B3TA 1PUAA 2B4DA 4KOXA 2Q7SA 5G21A 2PE3A 5I0CA
chains in the Genus database with same CATH topology
4IHMA 5J1QA 4RUHA 1LFWA 1FT7A 2C6PA 3CT9A 4DJLA 4UIAA 2AFUA 2PVWA 3D67A 1CP7A 4P4FA 2IMOA 2DEAA 4NFRA 1DTDA 5HVHA 2V8HA 3B3SA 1PYTB 3WC5A 4NGMA 3WC6A 2Q4ZA 3KHZA 4NJQA 1VHEA 1XMBA 5K8OA 1QQ9A 2ZEEA 3B2YA 4P44A 2ZEDA 4MCQA 4OMEA 2GLFA 3KZWA 4ZY1A 4R6TA 3RAMA 2ZELA 4P4IA 1ZLHA 2ZEMA 3KHXA 3FH4A 2WZNA 2V8VA 2ZENA 7CPAA 1XFOA 1F2PA 2IQ6A 3FVLA 4EFDA 4P4JA 2PJ4A 3GB0A 2PRQA 2ZEHA 2BCOA 2AFZA 2ZEGA 4EWTA 3SI0A 3T8WA 4NGTA 4OIDA 2C1CA 4OIWA 5LRGA 2WYRA 1CBXA 2O4HA 5D8NA 1BAVA 3NA6A 4ZY2A 4A38A 4PPZA 1XRYA 2PIZA 3S9MA 2XEIA 3SI2A 3B3VA 3BXMA 1M4LA 3FX6A 4UIBA 3LWUA 1CPSA 1YW6A 3L2NA 1Y0RA 4CPAA 3FMCA 3K9TA 1BPNA 4OKOA 5K8PA 3N5FA 3FECA 4PXCA 2I3CA 4H2KA 1LAPA 5LYLA 1ELLP 2PJ6A 1ARLA 3PBEA 2QVPA 4OC0A 4LQGA 2IJZA 2CF4A 3VATA 2PJBA 3BI1A 3VARA 4TWEA 2BO9A 3V38A 3IEHA 3IO1A 2F8HA 3KGQA 4F9UA 4W9YA 5HVFA 1R3NA 4ZI6A 2O53A 3ISZA 1Q7LA 1HDQA 1AYEA 3TX8A 2Q51A 4MMOA 3B3CA 3SJEA 1CP6A 4MHYA 2PJ9A 4K3NA 5I4MA 4P45A 1Z5RA 3KQXA 2AFSA 3MRUA 4Z65A 4GM5A 3CDXA 3TC8A 3S9NA 3NFZA 3H8GA 4IK2A 1F57A 4A94A 2ZOFA 5HVGA 1ZG7A 1UWYA 1YSJA 3ISXA 1CPXA 4KSIA 2QJ8A 4OC5A 5LYFA 3VH9A 4R8FA 2EK9A 1VIXA 2ZEFA 3H8EA 2PJ5A 3V7ZA 3IJ3A 1LANA 8CPAA 3KI9A 3KL9A 2V8DA 2PJ7A 3RBUA 2V8GA 5HXDA 3D7FA 1DE4C 4IAVA 1BLLE 3H8FA 4NJRA 5JH9A 5IB9A 3RZAA 4ONWA 4A39A 1NSAA 3WABA 2J9AA 4TNUA 1PCAA 1HDUA 3SJGA 3D68A 2CTBA 1IY7A 2EWBA 4FWUA 5DS0A 3WC7A 1Z2LA 2ANPA 3BI0A 1XJOA 3BHXA 4G1PA 4F8ZA 3NH5A 1IGBA 4B6ZA 3K2KA 4MHPA 1CG2A 3PB8X 4MRIA 1VGYA 3CPXA 1R43A 2V77A 2JEWA 4MHNA 5THWA 1Z8LA 4UEZA 3DLJA 1YW4A 1TF8A 4MHZA 2AFXA 3KR5A 2G9DA 4PQAA 3SJXA 1YMEA 4ZY0A 1LAMA 2XEJA 4NGQA 1EE3P 3GLJA 1Y7EA 6CPAA 2PJ2A 2BOAA 5LYDA 3QNVA 4MXUA 1ARMA 1TXRA 4JYWA 1LCPA 3D7HA 5CBMA 2ABZA 4Q7AA 3NH8A 3DGVA 4P10A 2RB7A 5F09A 2HB6A 1VHOA 2XEGA 3D4UA 2VL1A 4F9VA 3I1UA 4OC4A 1HEEA 3FEEA 2PCUA 4ZYQA 1BPMA 4X8IA 3S9LA 1CX8A 3SI1A 4NGPA 4DUKA 1ELMP 4JZ0A 3B35A 4AXVA 5K8MA 4DYOA 1ZLIA 4P4DA 3PB6X 5D29A 4ZX8A 2CIJA 2PIYA 4UF4A 1TKFA 4O23A 5ELYA 2PJ1A 5LYIA 2C6CA 4P4BA 1QMUA 3WT4A 3PB7X 2PJ0A 2PJ3A 3KASA 2C6GA 2PJCA 3FF3A 4NGSA 4ZX9A 2QYVA 1ZG8A 1YLOA 3SJFA 1Y0YA 4R76A 4X3RA 2FVGA 2NYQA 4X2TA 3PBBA 2ZEOA 2PVVA 2F7VA 1LOKA 4R7MA 3PRTA 2GU2A 2ZEPA 4BD9A 3IC1A 1JQGA 4YWYA 3HLPA 2CTCA 3KR4A 2GREA 3CPAA 4NGNA 2OR4A 4UEEA 4OC3A 3JRUA 1OBRA 1XBUA 1H8LA 3FEDA 2GLJA 3PFOA 1AMPA 4WWVA 3D66A 3PFEA 1GYTA 4WJBA 5LRKA 1FNOA 4OC1A 3KQZA 2AFOA 3D7DA 4FBEA 2Q43A 4A37A 2JBJA 4EMEA 4UEFA 4FUUA 5LRJA 3PEIA 4P6YA 3MN8A 3D7GA 3IWWA 4PXBA 2ZOGA 2JBKA 1TKHA 3LMSA 4FAIA 5K8NA 4OP4A 2XEFA 2AFMA 3B7IA 3IFEA 4P4EA 4MCPA 2RFHA 3B3WA 3HUVA 4NGRA 1KWMA 2PJ8A 3NH4A 1TKJA 2EK8A 3GUXA 3PB9X 3IIBA 5JGFA 1ZG9A 4PXEA 2AFWA 2NSMA 2HC9A 4OC2A 1RTQA 2OOTA 4PXDA 5CPAA 4MCRA 1TF9A 2POKA 1F2OA 3PB4X 5JM6A 2PJAA 4YU9A 3FJUA 4MCSA 3B3TA 2PE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHM A;  5J1Q A;  4RUH A;  1LFW A;  1FT7 A;  2C6P A;  3CT9 A;  4DJL A;  4UIA A;  2AFU A;  2PVW A;  3D67 A;  1CP7 A;  4P4F A;  2IMO A;  2DEA A;  4NFR A;  1DTD A;  5HVH A;  2V8H A;  3B3S A;  1PYT B;  3WC5 A;  4NGM A;  3WC6 A;  2Q4Z A;  3KHZ A;  4NJQ A;  1VHE A;  1XMB A;  5K8O A;  1QQ9 A;  2ZEE A;  3B2Y A;  4P44 A;  2ZED A;  4MCQ A;  4OME A;  2GLF A;  3KZW A;  4ZY1 A;  4R6T A;  3RAM A;  2ZEL A;  4P4I A;  1ZLH A;  2ZEM A;  3KHX A;  3FH4 A;  2WZN A;  2V8V A;  2ZEN A;  7CPA A;  1XFO A;  1F2P A;  2IQ6 A;  3FVL A;  4EFD A;  4P4J A;  2PJ4 A;  3GB0 A;  2PRQ A;  2ZEH A;  2BCO A;  2AFZ A;  2ZEG A;  4EWT A;  3SI0 A;  3T8W A;  4NGT A;  4OID A;  2C1C A;  4OIW A;  5LRG A;  2WYR A;  1CBX A;  2O4H A;  5D8N A;  1BAV A;  3NA6 A;  4ZY2 A;  4A38 A;  4PPZ A;  1XRY A;  2PIZ A;  3S9M A;  2XEI A;  3SI2 A;  3B3V A;  3BXM A;  1M4L A;  3FX6 A;  4UIB A;  3LWU A;  1CPS A;  1YW6 A;  3L2N A;  1Y0R A;  4CPA A;  3FMC A;  3K9T A;  1BPN A;  4OKO A;  5K8P A;  3N5F A;  3FEC A;  4PXC A;  2I3C A;  4H2K A;  1LAP A;  5LYL A;  1ELL P;  2PJ6 A;  1ARL A;  3PBE A;  2QVP A;  4OC0 A;  4LQG A;  2IJZ A;  2CF4 A;  3VAT A;  2PJB A;  3BI1 A;  3VAR A;  4TWE A;  2BO9 A;  3V38 A;  3IEH A;  3IO1 A;  2F8H A;  3KGQ A;  4F9U A;  4W9Y A;  5HVF A;  1R3N A;  4ZI6 A;  2O53 A;  3ISZ A;  1Q7L A;  1HDQ A;  1AYE A;  3TX8 A;  2Q51 A;  4MMO A;  3B3C A;  3SJE A;  1CP6 A;  4MHY A;  2PJ9 A;  4K3N A;  5I4M A;  4P45 A;  1Z5R A;  3KQX A;  2AFS A;  3MRU A;  4Z65 A;  4GM5 A;  3CDX A;  3TC8 A;  3S9N A;  3NFZ A;  3H8G A;  4IK2 A;  1F57 A;  4A94 A;  2ZOF A;  5HVG A;  1ZG7 A;  1UWY A;  1YSJ A;  3ISX A;  1CPX A;  4KSI A;  2QJ8 A;  4OC5 A;  5LYF A;  3VH9 A;  4R8F A;  2EK9 A;  1VIX A;  2ZEF A;  3H8E A;  2PJ5 A;  3V7Z A;  3IJ3 A;  1LAN A;  8CPA A;  3KI9 A;  3KL9 A;  2V8D A;  2PJ7 A;  3RBU A;  2V8G A;  5HXD A;  3D7F A;  1DE4 C;  4IAV A;  1BLL E;  3H8F A;  4NJR A;  5JH9 A;  5IB9 A;  3RZA A;  4ONW A;  4A39 A;  1NSA A;  3WAB A;  2J9A A;  4TNU A;  1PCA A;  1HDU A;  3SJG A;  3D68 A;  2CTB A;  1IY7 A;  2EWB A;  4FWU A;  5DS0 A;  3WC7 A;  1Z2L A;  2ANP A;  3BI0 A;  1XJO A;  3BHX A;  4G1P A;  4F8Z A;  3NH5 A;  1IGB A;  4B6Z A;  3K2K A;  4MHP A;  1CG2 A;  3PB8 X;  4MRI A;  1VGY A;  3CPX A;  1R43 A;  2V77 A;  2JEW A;  4MHN A;  5THW A;  1Z8L A;  4UEZ A;  3DLJ A;  1YW4 A;  1TF8 A;  4MHZ A;  2AFX A;  3KR5 A;  2G9D A;  4PQA A;  3SJX A;  1YME A;  4ZY0 A;  1LAM A;  2XEJ A;  4NGQ A;  1EE3 P;  3GLJ A;  1Y7E A;  6CPA A;  2PJ2 A;  2BOA A;  5LYD A;  3QNV A;  4MXU A;  1ARM A;  1TXR A;  4JYW A;  1LCP A;  3D7H A;  5CBM A;  2ABZ A;  4Q7A A;  3NH8 A;  3DGV A;  4P10 A;  2RB7 A;  5F09 A;  2HB6 A;  1VHO A;  2XEG A;  3D4U A;  2VL1 A;  4F9V A;  3I1U A;  4OC4 A;  1HEE A;  3FEE A;  2PCU A;  4ZYQ A;  1BPM A;  4X8I A;  3S9L A;  1CX8 A;  3SI1 A;  4NGP A;  4DUK A;  1ELM P;  4JZ0 A;  3B35 A;  4AXV A;  5K8M A;  4DYO A;  1ZLI A;  4P4D A;  3PB6 X;  5D29 A;  4ZX8 A;  2CIJ A;  2PIY A;  4UF4 A;  1TKF A;  4O23 A;  5ELY A;  2PJ1 A;  5LYI A;  2C6C A;  4P4B A;  1QMU A;  3WT4 A;  3PB7 X;  2PJ0 A;  2PJ3 A;  3KAS A;  2C6G A;  2PJC A;  3FF3 A;  4NGS A;  4ZX9 A;  2QYV A;  1ZG8 A;  1YLO A;  3SJF A;  1Y0Y A;  4R76 A;  4X3R A;  2FVG A;  2NYQ A;  4X2T A;  3PBB A;  2ZEO A;  2PVV A;  2F7V A;  1LOK A;  4R7M A;  3PRT A;  2GU2 A;  2ZEP A;  4BD9 A;  3IC1 A;  1JQG A;  4YWY A;  3HLP A;  2CTC A;  3KR4 A;  2GRE A;  3CPA A;  4NGN A;  2OR4 A;  4UEE A;  4OC3 A;  3JRU A;  1OBR A;  1XBU A;  1H8L A;  3FED A;  2GLJ A;  3PFO A;  1AMP A;  4WWV A;  3D66 A;  3PFE A;  1GYT A;  4WJB A;  5LRK A;  1FNO A;  4OC1 A;  3KQZ A;  2AFO A;  3D7D A;  4FBE A;  2Q43 A;  4A37 A;  2JBJ A;  4EME A;  4UEF A;  4FUU A;  5LRJ A;  3PEI A;  4P6Y A;  3MN8 A;  3D7G A;  3IWW A;  4PXB A;  2ZOG A;  2JBK A;  1TKH A;  3LMS A;  4FAI A;  5K8N A;  4OP4 A;  2XEF A;  2AFM A;  3B7I A;  3IFE A;  4P4E A;  4MCP A;  2RFH A;  3B3W A;  3HUV A;  4NGR A;  1KWM A;  2PJ8 A;  3NH4 A;  1TKJ A;  2EK8 A;  3GUX A;  3PB9 X;  3IIB A;  5JGF A;  1ZG9 A;  4PXE A;  2AFW A;  2NSM A;  2HC9 A;  4OC2 A;  1RTQ A;  2OOT A;  4PXD A;  5CPA A;  4MCR A;  1TF9 A;  2POK A;  1F2O A;  3PB4 X;  5JM6 A;  2PJA A;  4YU9 A;  3FJU A;  4MCS A;  3B3T A;  2PE3 A; 
#chains in the Genus database with same CATH topology
 4IHM A;  2VEZ A;  5J1Q A;  4RUH A;  3GIU A;  3TO9 A;  1LFW A;  3NE8 A;  3H4Q A;  2I00 A;  4KUA A;  1FT7 A;  5E96 A;  2Q04 A;  2Q7B A;  5AG4 A;  3R9G A;  1RXT A;  2C6P A;  2REE A;  3CT9 A;  3I9S A;  4DJL A;  2Z3K A;  5BWA B;  2ZW6 A;  2BSW A;  4ZBG A;  4UIA A;  2AFU A;  1B6B A;  2PVW A;  3JTK A;  3D67 A;  1CP7 A;  2PR8 A;  4KLV A;  4P4F A;  2IMO A;  2DEA A;  3D3S A;  4NFR A;  1DTD A;  4MFQ A;  2WUU A;  3SHP A;  2V8H A;  3EXN A;  3TO7 A;  5HVH A;  2EO8 A;  3B3S A;  3B8G A;  1PYT B;  2R1I A;  3PP9 A;  4MFJ A;  4U9Z A;  4X5K A;  2ATR A;  1CM0 A;  4NGM A;  3SXO A;  2G3A A;  3WC5 A;  3R9E A;  3WC6 A;  4AG9 A;  2FT0 A;  2Q4Z A;  4QB9 A;  3BJ8 A;  2DPT A;  3CXQ A;  3KHZ A;  2R8V A;  4NJQ A;  1YX0 A;  3FXT A;  3D2P A;  1VHE A;  1XMB A;  3BJ7 A;  2D4P A;  4XPD C;  5K8O A;  1ON0 A;  4B14 A;  1QQ9 A;  1XE4 A;  3TT2 A;  2ZEE A;  3B2Y A;  4P44 A;  4GS4 A;  2ZED A;  4MCQ A;  4HNW B;  3DR8 A;  4OME A;  4GXH A;  4QUS A;  2GLF A;  2JEV A;  2YNC C;  3KZW A;  2FIW A;  4A30 A;  4R6T A;  3GY9 A;  4ZY1 A;  3RAM A;  2ZEL A;  2GIV A;  4P4I A;  2OB0 A;  1ZLH A;  2ZEM A;  3KHX A;  3FH4 A;  2WZN A;  4XNH C;  4BIN A;  2R7H A;  2V8V A;  3A9L A;  2ZEN A;  4RN7 A;  2CNT A;  3IU2 A;  1KUY A;  3VWE A;  2BL1 A;  7CPA A;  1XFO A;  1F2P A;  4HNY B;  2NMT A;  2ODF A;  3DSB A;  3S6K A;  3D2M A;  3EFA A;  4R3L A;  2YND A;  5AG5 A;  2IQ6 A;  3FVL A;  4EFD A;  3R95 A;  2Z10 A;  1IYL A;  1YVK A;  2ZXV A;  2FXF A;  4IUS A;  2PJ4 A;  4P4J A;  3GB0 A;  2PRQ A;  3K9U A;  2ZEH A;  2B5G A;  2BCO A;  4A31 A;  2AFZ A;  2ZEG A;  4EWT A;  2CY2 A;  3SI0 A;  3T8W A;  4H6Z A;  3SXN A;  2REF A;  4NGT A;  5EC4 A;  4H89 A;  2D4O A;  4OID A;  2C1C A;  4CS0 B;  4OIW A;  4A2Z A;  5LRG A;  3D8P A;  2WYR A;  1CBX A;  4Q38 A;  4B5P A;  2O4H A;  1ZO0 A;  4NSQ A;  4KOY A;  5D8N A;  1BAV A;  1FY7 A;  3R1K A;  3P2F A;  4B5O A;  1UFH A;  3NA6 A;  4OLL A;  1QSM A;  4PPZ A;  1XF8 A;  4ZY2 A;  4A38 A;  1XRY A;  2PIZ A;  4UWJ A;  3S9M A;  2Y0M A;  4C68 A;  2XEI A;  5KTC A;  5F47 A;  3SI2 A;  4U9Y A;  3B3V A;  5ISV A;  4H6U A;  1JWQ A;  3TE4 A;  4FD7 A;  3F5B A;  3BXM A;  1M4L A;  4KOU A;  3FX6 A;  1GHE A;  4PV6 A;  4UIB A;  2VZZ A;  3LWU A;  1CPS A;  1YW6 A;  2PDO A;  5G1Z A;  3L2N A;  4R3K A;  4C7I A;  1Y0R A;  4CPA A;  4CYP A;  3FMC A;  3K9T A;  2HQY A;  2QML A;  5AGE A;  4B11 A;  4IF5 A;  1IOI A;  1SQH A;  1BPN A;  4OKO A;  5K8P A;  3N5F A;  3FEC A;  3P2H A;  4PXC A;  4CYQ A;  2I3C A;  4H2K A;  3G8W A;  1LAP A;  4Y49 C;  5LYL A;  4R9M A;  4NXY A;  4UCP A;  1TIQ A;  1ELL P;  4XPD B;  2PJ6 A;  2EBJ A;  1ARL A;  4AVA A;  3PBE A;  4CAW A;  2QVP A;  4OC0 A;  4LQG A;  2IJZ A;  2CF4 A;  3VAT A;  5AG7 A;  2CXA A;  1S7N A;  3MGD A;  1YQE A;  2PJB A;  3BI1 A;  3VAR A;  4TWE A;  4CYO A;  2HUZ A;  2BO9 A;  3V38 A;  1CJW A;  3IEH A;  3IO1 A;  2F8H A;  4HKF A;  3KGQ A;  4F9U A;  4MFZ A;  4M6I A;  3FBU A;  4UWI A;  4I49 A;  4XNH B;  4W9Y A;  5HVF A;  4E2A A;  1X12 A;  1R3N A;  4ZI6 A;  2O53 A;  3ISZ A;  1MK4 A;  4CRY B;  2DPS A;  4CGO A;  1Q7L A;  3C26 A;  1HDQ A;  1AYE A;  4BMH A;  3JVN A;  3TX8 A;  4AVC A;  2Q51 A;  1XOV A;  1M4I A;  2J8R A;  4MMO A;  4EVY A;  3OWC A;  3B3C A;  4L8A A;  3SJE A;  1CP6 A;  4Q36 A;  4MHY A;  4CGM A;  2PJ9 A;  5H84 A;  1NMT A;  4K3N A;  1P0H A;  5I4M A;  4P45 A;  3TOA A;  1Z5R A;  2CNS A;  2JLM A;  3KQX A;  2AFS A;  4U5Y A;  3MRU A;  4Z65 A;  4GM5 A;  2O28 A;  1XIX A;  3CDX A;  4UBR A;  2P6E A;  1S60 A;  3TC8 A;  3S9N A;  2P6G A;  3NFZ A;  4KS9 A;  1NE9 A;  3H8G A;  4JWP A;  1YRE A;  3CXP A;  4IK2 A;  3UY5 A;  4B12 A;  1PU9 A;  1Z4E A;  1F57 A;  2VBQ A;  3F8K A;  2IL4 A;  4A94 A;  2ZOF A;  3CXS A;  5HVG A;  1QSO A;  1ZG7 A;  5FVJ A;  1UWY A;  4UA3 A;  1YSJ A;  1CPX A;  3ISX A;  4UFX A;  4KSI A;  4XPK A;  2QJ8 A;  4OC5 A;  1YVO A;  5LYF A;  4B13 A;  2Z3P A;  2WPW A;  2PSW A;  3VH9 A;  4R8F A;  3TOB A;  3W6X A;  4CGN A;  5IX3 A;  2ZW4 A;  2EK9 A;  4M3S A;  1RO5 A;  2Z3L A;  1Q2C A;  1VIX A;  5KTD A;  2ZEF A;  4JLY A;  3H8E A;  2PJ5 A;  5DWN A;  3W6S A;  1V0C A;  2CNM A;  3V7Z A;  3IJ3 A;  5HH1 A;  3V8I A;  1LAN A;  4M85 A;  8CPA A;  3I3G A;  1I1D A;  3KI9 A;  5A27 A;  5JPH A;  1R57 A;  4QVT A;  3TFY A;  3KL9 A;  4MI4 A;  2JDD A;  4C7H A;  5C82 A;  2V8D A;  2PJ7 A;  5IV0 A;  3RBU A;  2V8G A;  2Q0Y A;  2PQ8 A;  2PRB A;  5HXD A;  3D7F A;  2OU2 A;  1DE4 C;  4IAV A;  1BLL E;  3W91 A;  4C2X A;  3H8F A;  4NJR A;  4QC6 A;  3JUW A;  5JH9 A;  3RYO A;  5IB9 A;  3N7Z A;  4Y49 B;  3RZA A;  3S6H A;  4ONW A;  4K30 A;  4R57 A;  4A39 A;  1IIC A;  1NSA A;  3WAB A;  2J9A A;  4TNU A;  1PCA A;  1HDU A;  1Y9K A;  3SJG A;  5F46 A;  4KLW A;  1P4N A;  3D68 A;  2CTB A;  1IY7 A;  4PSW A;  5CNP A;  5F49 A;  2EWB A;  3R9F A;  3LAC A;  4FWU A;  5DS0 A;  3IGR A;  2VXK A;  2B4D B;  3FNC A;  3VWD A;  5GCN A;  3WC7 A;  4B10 A;  2F5I A;  1Z2L A;  2ANP A;  3BI0 A;  3DNS A;  4KSF A;  1XJO A;  1Z4R A;  3BHX A;  3IWG A;  4G1P A;  4RS2 A;  1VKC A;  4CGL A;  4F8Z A;  3NH5 A;  1IGB A;  5EBV A;  4B6Z A;  3K2K A;  3DR6 A;  1CG2 A;  3PB8 X;  4MHP A;  4MRI A;  1VGY A;  3CPX A;  3LD2 A;  1R43 A;  2I79 A;  2Z3O A;  1I21 A;  2V77 A;  2ARH A;  2JEW A;  1S3Z A;  4MFK A;  4MHN A;  5THW A;  1Z8L A;  2X7B A;  2BUE A;  4LUA A;  4UEZ A;  3DLJ A;  1YW4 A;  1U6M A;  4YFJ A;  4C2Z A;  5G22 A;  1TF8 A;  4F6A A;  4MHZ A;  4UCM A;  5F48 A;  3ZZI A;  2AFX A;  3KR5 A;  2PR1 A;  2G9D A;  4PQA A;  1KUX A;  1KZF A;  4AVB A;  3SJX A;  2VI7 A;  3QAH A;  2DF5 A;  1YME A;  2OZG A;  4ZY0 A;  2B4B A;  2BEI A;  1LAM A;  4CGP A;  4KVX A;  2XEJ A;  4KOS A;  4ORF A;  4NGQ A;  1EE3 P;  5KTA A;  2G0B A;  2P0W A;  3GLJ A;  2JDC A;  1MJ9 A;  1Y7E A;  4PK2 A;  3E0K A;  4C2Y A;  6CPA A;  3EC4 A;  2FSR A;  4KOV A;  2PJ2 A;  2AE6 A;  2BOA A;  2B3U A;  1KUV A;  5LYD A;  2FS5 A;  3QNV A;  1WK4 A;  3FRM A;  1ARM A;  4MXU A;  1TXR A;  5DWM A;  4JYW A;  3R96 A;  4II9 A;  4KSA A;  4CAF A;  4CAE A;  1MJA A;  1LCP A;  3D7H A;  5CBM A;  4KZT A;  2ABZ A;  2Z3N A;  4Q7A A;  3NH8 A;  4QBJ A;  2B58 A;  2GAN A;  3DGV A;  3RO0 A;  3PZJ A;  4P10 A;  1X10 A;  2RB7 A;  5F09 A;  2HB6 A;  3DDD A;  1B87 A;  1VHO A;  2XEG A;  1IID A;  3D4U A;  2VL1 A;  3LOD A;  3I1U A;  4KVM E;  4MY3 A;  4F9V A;  1Q2Y A;  2YNE A;  1HEE A;  3FEE A;  4MJ8 A;  4OC4 A;  2PCU A;  3ZJ0 A;  4M6H A;  4JD6 A;  2B5G B;  4ZYQ A;  1BPM A;  4KOR A;  5JQ4 A;  4LX9 A;  1IB1 E;  1S7L A;  2YGW A;  2ZPA A;  4X8I A;  2OH1 A;  1Z8T A;  3S9L A;  3FB3 A;  2Z11 A;  1CX8 A;  2EVN A;  2Q44 A;  3SI1 A;  1VHS A;  2HV2 A;  2FCK A;  2VQY A;  4NGP A;  2G3T A;  4DUK A;  1ELM P;  4YGO A;  3EO4 A;  4JZ0 A;  3B35 A;  2K5T A;  4B5P B;  4AXV A;  1YK3 A;  1Z8X A;  3TCV A;  3T90 A;  5K8M A;  4DYO A;  1ZLI A;  1L0C A;  4P4D A;  4MY0 A;  2WSA A;  3PB6 X;  5D29 A;  4ZX8 A;  4J3G A;  2Q4V A;  2CIJ A;  2PIY A;  4UF4 A;  1TKF A;  2QIR A;  1IYK A;  4O23 A;  3NE7 A;  2H5M A;  5ELY A;  5G20 A;  2PJ1 A;  5LYI A;  2C6C A;  4P4B A;  5EMI A;  1M1D A;  3KKW A;  1QMU A;  3WT4 A;  3PB7 X;  2PJ0 A;  2PJ3 A;  3KAS A;  2C6G A;  2PJC A;  1YLE A;  3FF3 A;  3S6F A;  4CRZ B;  3GKR A;  4NGS A;  5C88 A;  4ZX9 A;  2WPX A;  3FYN A;  1WWZ A;  2QYV A;  2FIA A;  1ZG8 A;  1YLO A;  4M6G A;  4MFP A;  3SJF A;  1Y0Y A;  1S7K A;  2AJ6 A;  4R76 A;  4X3R A;  2FVG A;  2NYQ A;  4X2T A;  2GFQ A;  3PBB A;  1M44 A;  3S6G A;  2ZEO A;  1I12 A;  2F7V A;  1LOK A;  2KCW A;  2PVV A;  3H5Z A;  4F0Y A;  4R7M A;  4CAV A;  1Z8W A;  3PRT A;  2GU2 A;  2ZEP A;  3IWE A;  4CAX A;  4NEX A;  4PK3 A;  3T9Y A;  3IC1 A;  4BD9 A;  4F0X A;  1YR0 A;  1JQG A;  4KVO E;  3GYA A;  3HLP A;  4YWY A;  2CTC A;  2YNC A;  3KR4 A;  2OZH A;  1IU8 A;  2GRE A;  1QSR A;  4MHD A;  3CPA A;  4MFL A;  4NGN A;  2OR4 A;  4UEE A;  4OC3 A;  3G3S A;  4A32 A;  3JRU A;  1XEB A;  1OBR A;  1XBU A;  1H8L A;  3FED A;  2C27 A;  2Q4Y A;  4R87 A;  2GLJ A;  1BOB A;  3PFO A;  4AG7 A;  2GE3 A;  1AMP A;  4WWV A;  3IU1 A;  3D66 A;  4JXR A;  3FIX A;  1MJB A;  3PFE A;  4LQ6 A;  3QB8 A;  1GYT A;  4WJB A;  4ONU A;  5HMN A;  1FNO A;  5IB0 A;  5LRK A;  4UCN A;  1N71 A;  4FD5 A;  2P6F A;  2A4N A;  4OC1 A;  2FL4 A;  3WR7 A;  3KQZ A;  4JXQ A;  2AFO A;  2VZY A;  3D7D A;  1M4D A;  5A28 A;  1J4J A;  4FBE A;  2Q43 A;  2B3V A;  1K4J A;  4A37 A;  2DXQ A;  5J8C A;  2JBJ A;  4EME A;  4UEF A;  4BBH A;  4KOT A;  4FUU A;  1Y7R A;  1LRZ A;  4MBU A;  3RNZ A;  4FD6 A;  5LRJ A;  3PEI A;  3PGP A;  4P6Y A;  2J8N A;  1QSN A;  3MN8 A;  3D7G A;  3IWW A;  2R98 A;  1YGH A;  4HPS A;  2OZU A;  4PXB A;  3F0A A;  2EUI A;  2ZOG A;  3QAY A;  1Y9W A;  2JBK A;  1TKH A;  3LMS A;  4E8O A;  4FAI A;  4E0A A;  5K8N A;  1QST A;  4OP4 A;  2XEF A;  2AFM A;  3B7I A;  3IFE A;  4HNX B;  4P4E A;  5H86 A;  4A95 A;  4MCP A;  2PC1 A;  1AUG A;  2RFH A;  4DNC A;  3B3W A;  1M4G A;  3HUV A;  4L89 A;  1S5K A;  4NGR A;  5AG6 A;  3EY5 A;  3CZX A;  2Z3M A;  1Z9U A;  2Z0Z A;  1KWM A;  4XPL A;  2FE7 A;  4KUB A;  2PJ8 A;  3NH4 A;  1TKJ A;  1Q2D A;  4OAE A;  3TTH A;  5J8F A;  3TO6 A;  3BLN A;  2RC4 A;  2EK8 A;  1IOF A;  1OZP A;  3GUX A;  3PB9 X;  4OAD A;  3IIB A;  5JGF A;  1ZG9 A;  4PXE A;  4AB7 A;  2AFW A;  2NSM A;  1XMT A;  4FD4 A;  4UFV A;  2ZW7 A;  4YRH A;  4NCZ A;  1A2Z A;  2HC9 A;  4OC2 A;  4ZGY B;  1S7F A;  1RTQ A;  2ZW5 A;  4JJX A;  2OOT A;  4KOW A;  4UFW A;  4PSX A;  2QEC A;  4NF1 A;  4PXD A;  5CPA A;  4MCR A;  1TF9 A;  1NSL A;  2POK A;  1F2O A;  3PB4 X;  2J8M A;  5JM6 A;  2PJA A;  4YU9 A;  3FJU A;  1BO4 A;  4CYN A;  4MCS A;  4RI1 A;  4A33 A;  3B3T A;  1PUA A;  2B4D A;  4KOX A;  2Q7S A;  5G21 A;  2PE3 A;  5I0C A; 
#chains in the Genus database with same CATH homology
 4IHM A;  5J1Q A;  4RUH A;  1LFW A;  1FT7 A;  2C6P A;  3CT9 A;  4DJL A;  4UIA A;  2AFU A;  2PVW A;  3D67 A;  1CP7 A;  4P4F A;  2IMO A;  2DEA A;  4NFR A;  1DTD A;  5HVH A;  2V8H A;  3B3S A;  1PYT B;  3WC5 A;  4NGM A;  3WC6 A;  2Q4Z A;  3KHZ A;  4NJQ A;  1VHE A;  1XMB A;  5K8O A;  1QQ9 A;  2ZEE A;  3B2Y A;  4P44 A;  2ZED A;  4MCQ A;  4OME A;  2GLF A;  3KZW A;  4ZY1 A;  4R6T A;  3RAM A;  2ZEL A;  4P4I A;  1ZLH A;  2ZEM A;  3KHX A;  3FH4 A;  2WZN A;  2V8V A;  2ZEN A;  7CPA A;  1XFO A;  1F2P A;  2IQ6 A;  3FVL A;  4EFD A;  4P4J A;  2PJ4 A;  3GB0 A;  2PRQ A;  2ZEH A;  2BCO A;  2AFZ A;  2ZEG A;  4EWT A;  3SI0 A;  3T8W A;  4NGT A;  4OID A;  2C1C A;  4OIW A;  5LRG A;  2WYR A;  1CBX A;  2O4H A;  5D8N A;  1BAV A;  3NA6 A;  4ZY2 A;  4A38 A;  4PPZ A;  1XRY A;  2PIZ A;  3S9M A;  2XEI A;  3SI2 A;  3B3V A;  3BXM A;  1M4L A;  3FX6 A;  4UIB A;  3LWU A;  1CPS A;  1YW6 A;  3L2N A;  1Y0R A;  4CPA A;  3FMC A;  3K9T A;  1BPN A;  4OKO A;  5K8P A;  3N5F A;  3FEC A;  4PXC A;  2I3C A;  4H2K A;  1LAP A;  5LYL A;  1ELL P;  2PJ6 A;  1ARL A;  3PBE A;  2QVP A;  4OC0 A;  4LQG A;  2IJZ A;  2CF4 A;  3VAT A;  2PJB A;  3BI1 A;  3VAR A;  4TWE A;  2BO9 A;  3V38 A;  3IEH A;  3IO1 A;  2F8H A;  3KGQ A;  4F9U A;  4W9Y A;  5HVF A;  1R3N A;  4ZI6 A;  2O53 A;  3ISZ A;  1Q7L A;  1HDQ A;  1AYE A;  3TX8 A;  2Q51 A;  4MMO A;  3B3C A;  3SJE A;  1CP6 A;  4MHY A;  2PJ9 A;  4K3N A;  5I4M A;  4P45 A;  1Z5R A;  3KQX A;  2AFS A;  3MRU A;  4Z65 A;  4GM5 A;  3CDX A;  3TC8 A;  3S9N A;  3NFZ A;  3H8G A;  4IK2 A;  1F57 A;  4A94 A;  2ZOF A;  5HVG A;  1ZG7 A;  1UWY A;  1YSJ A;  3ISX A;  1CPX A;  4KSI A;  2QJ8 A;  4OC5 A;  5LYF A;  3VH9 A;  4R8F A;  2EK9 A;  1VIX A;  2ZEF A;  3H8E A;  2PJ5 A;  3V7Z A;  3IJ3 A;  1LAN A;  8CPA A;  3KI9 A;  3KL9 A;  2V8D A;  2PJ7 A;  3RBU A;  2V8G A;  5HXD A;  3D7F A;  1DE4 C;  4IAV A;  1BLL E;  3H8F A;  4NJR A;  5JH9 A;  5IB9 A;  3RZA A;  4ONW A;  4A39 A;  1NSA A;  3WAB A;  2J9A A;  4TNU A;  1PCA A;  1HDU A;  3SJG A;  3D68 A;  2CTB A;  1IY7 A;  2EWB A;  4FWU A;  5DS0 A;  3WC7 A;  1Z2L A;  2ANP A;  3BI0 A;  1XJO A;  3BHX A;  4G1P A;  4F8Z A;  3NH5 A;  1IGB A;  4B6Z A;  3K2K A;  4MHP A;  1CG2 A;  3PB8 X;  4MRI A;  1VGY A;  3CPX A;  1R43 A;  2V77 A;  2JEW A;  4MHN A;  5THW A;  1Z8L A;  4UEZ A;  3DLJ A;  1YW4 A;  1TF8 A;  4MHZ A;  2AFX A;  3KR5 A;  2G9D A;  4PQA A;  3SJX A;  1YME A;  4ZY0 A;  1LAM A;  2XEJ A;  4NGQ A;  1EE3 P;  3GLJ A;  1Y7E A;  6CPA A;  2PJ2 A;  2BOA A;  5LYD A;  3QNV A;  4MXU A;  1ARM A;  1TXR A;  4JYW A;  1LCP A;  3D7H A;  5CBM A;  2ABZ A;  4Q7A A;  3NH8 A;  3DGV A;  4P10 A;  2RB7 A;  5F09 A;  2HB6 A;  1VHO A;  2XEG A;  3D4U A;  2VL1 A;  4F9V A;  3I1U A;  4OC4 A;  1HEE A;  3FEE A;  2PCU A;  4ZYQ A;  1BPM A;  4X8I A;  3S9L A;  1CX8 A;  3SI1 A;  4NGP A;  4DUK A;  1ELM P;  4JZ0 A;  3B35 A;  4AXV A;  5K8M A;  4DYO A;  1ZLI A;  4P4D A;  3PB6 X;  5D29 A;  4ZX8 A;  2CIJ A;  2PIY A;  4UF4 A;  1TKF A;  4O23 A;  5ELY A;  2PJ1 A;  5LYI A;  2C6C A;  4P4B A;  1QMU A;  3WT4 A;  3PB7 X;  2PJ0 A;  2PJ3 A;  3KAS A;  2C6G A;  2PJC A;  3FF3 A;  4NGS A;  4ZX9 A;  2QYV A;  1ZG8 A;  1YLO A;  3SJF A;  1Y0Y A;  4R76 A;  4X3R A;  2FVG A;  2NYQ A;  4X2T A;  3PBB A;  2ZEO A;  2PVV A;  2F7V A;  1LOK A;  4R7M A;  3PRT A;  2GU2 A;  2ZEP A;  4BD9 A;  3IC1 A;  1JQG A;  4YWY A;  3HLP A;  2CTC A;  3KR4 A;  2GRE A;  3CPA A;  4NGN A;  2OR4 A;  4UEE A;  4OC3 A;  3JRU A;  1OBR A;  1XBU A;  1H8L A;  3FED A;  2GLJ A;  3PFO A;  1AMP A;  4WWV A;  3D66 A;  3PFE A;  1GYT A;  4WJB A;  5LRK A;  1FNO A;  4OC1 A;  3KQZ A;  2AFO A;  3D7D A;  4FBE A;  2Q43 A;  4A37 A;  2JBJ A;  4EME A;  4UEF A;  4FUU A;  5LRJ A;  3PEI A;  4P6Y A;  3MN8 A;  3D7G A;  3IWW A;  4PXB A;  2ZOG A;  2JBK A;  1TKH A;  3LMS A;  4FAI A;  5K8N A;  4OP4 A;  2XEF A;  2AFM A;  3B7I A;  3IFE A;  4P4E A;  4MCP A;  2RFH A;  3B3W A;  3HUV A;  4NGR A;  1KWM A;  2PJ8 A;  3NH4 A;  1TKJ A;  2EK8 A;  3GUX A;  3PB9 X;  3IIB A;  5JGF A;  1ZG9 A;  4PXE A;  2AFW A;  2NSM A;  2HC9 A;  4OC2 A;  1RTQ A;  2OOT A;  4PXD A;  5CPA A;  4MCR A;  1TF9 A;  2POK A;  1F2O A;  3PB4 X;  5JM6 A;  2PJA A;  4YU9 A;  3FJU A;  4MCS A;  3B3T A;  2PE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...