2IQ6A

Crystal structure of the aminopeptidase from vibrio proteolyticus in complexation with leucyl-leucyl-leucine.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
molecule tags Hydrolase
publication title Experimental evidence for a metallohydrolase mechanism in which the nucleophile is not delivered by a metal ion: EPR spectrokinetic and structural studies of aminopeptidase from Vibrio proteolyticus
pubmed doi rcsb
total genus 109
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2iq6A00
3CT9A 2JBKA 3S9MA 3D4UA 4A37A 4GM5A 4OC3A 4P4DA 5ELYA 1KWMA 2PE3A 3KZWA 5D29A 4MMOA 2PJ2A 3IIBA 2V8GA 3WABA 3PFOA 3SJEA 3D7FA 2EWBA 1XBUA 1F2OA 3IEHA 4P4EA 1YW4A 2POKA 4Q7AA 2OOTA 2PJ4A 3FECA 1F57A 4MCRA 3D67A 2V8VA 4PXCA 2DEAA 1VIXA 2HC9A 1FNOA 3IFEA 1QQ9A 1GYTA 2GLJA 3D68A 3B3CA 3NFZA 3PB4X 5LRJA 3KR5A 1JQGA 4MHPA 5LRKA 2PJ7A 2WZNA 3SJFA 3GUXA 4OP4A 2QJ8A 4ZY0A 1DTDA 4P4JA 1CX8A 1Z5RA 4OC1A 3IC1A 2GREA 3KR4A 4B6ZA 2PCUA 1LANA 1ZG9A 1ZLIA 4JYWA 1ARMA 3K9TA 1BPMA 4X2TA 3PB8X 1AMPA 3FF3A 4R8FA 3T8WA 1TKFA 4O23A 4ZYQA 1TKHA 3WT4A 3B7IA 4P4FA 1YMEA 4EWTA 4OIDA 3KI9A 2XEFA 1BLLE 4ONWA 1Q7LA 4PXBA 4Z65A 2I3CA 3IWWA 1IGBA 3CDXA 3PB9X 3VH9A 3BXMA 3PBEA 3B3TA 1TKJA 2PJCA 2Q4ZA 2V8DA 4ZI6A 1VHOA 2PJ8A 3D7GA 1PYTB 1CPSA 1FT7A 4AXVA 4R76A 2CF4A 6CPAA 1TF9A 1TF8A 4MHYA 2PVWA 5HVFA 2RB7A 4PXDA 5LYIA 3S9NA 3MN8A 2PJ6A 1XJOA 5THWA 3B3SA 1LOKA 4EFDA 1VHEA 3PBBA 2GU2A 2ZOGA 3H8EA 2ZOFA 4A39A 1ELMP 2AFXA 5HVGA 3D7HA 3KHZA 5JM6A 3ISZA 3FEEA 5IB9A 4MHNA 4NGRA 4LQGA 2ZEFA 4NJRA 3RZAA 3B35A 2VL1A 4RUHA 2J9AA 2Q43A 2BOAA 2C6GA 2CIJA 1YLOA 3FVLA 5I4MA 3IO1A 1NSAA 1HDUA 4PXEA 1RTQA 3B3WA 3PB7X 4NGQA 4NGTA 3KGQA 3RBUA 2CTCA 4IAVA 4NGPA 3V38A 2PJ1A 3D66A 4MRIA 2XEIA 4P45A 3VATA 2RFHA 2PIYA 4KSIA 4X8IA 3SI0A 5K8OA 2V8HA 3NH8A 2PJ9A 4MCQA 3BHXA 2O53A 3JRUA 3KQZA 5D8NA 4ZX9A 1ELLP 3VARA 3D7DA 3L2NA 2IQ6A 1BAVA 4FUUA 5LYLA 1OBRA 1LFWA 1CP7A 4OMEA 7CPAA 5DS0A 3PEIA 4R6TA 5F09A 3GLJA 1R3NA 2AFSA 2QVPA 2ZENA 4P4IA 2PJBA 4G1PA 2NSMA 5J1QA 2PVVA 2XEGA 4P10A 1ARLA 4MXUA 2AFZA 1Y0RA 2ABZA 4UEZA 2JBJA 2V77A 4OC0A 3FH4A 4CPAA 2ZEDA 4ZX8A 1XFOA 2WYRA 2IJZA 3FMCA 4K3NA 1ZLHA 3QNVA 1F2PA 3MRUA 4DYOA 1LCPA 4WWVA 4UIAA 1UWYA 4NGNA 3H8FA 1CPXA 3CPAA 3V7ZA 4OC4A 1LAPA 1ZG7A 4NGSA 3RAMA 4EMEA 2PJAA 3HUVA 4TWEA 4W9YA 2JEWA 4FWUA 5JGFA 1QMUA 3SI2A 4NJQA 5LYDA 3CPXA 4IHMA 4TNUA 2IMOA 3PFEA 3H8GA 4FAIA 4OIWA 3NH4A 3DLJA 5JH9A 1Y7EA 1DE4C 2AFOA 4MCSA 4PPZA 3SJGA 3GB0A 4OKOA 3KASA 1TXRA 1CBXA 3BI1A 4NFRA 1Y0YA 1YW6A 2QYVA 3DGVA 4UEEA 3SJXA 4F9VA 1R43A 4YWYA 2AFUA 1HEEA 3NA6A 4ZY2A 3PB6X 1EE3P 1PCAA 3FX6A 4OC2A 2ZEEA 4BD9A 2PJ3A 3IJ3A 4H2KA 5K8MA 4OC5A 3SI1A 3LMSA 1YSJA 5HVHA 2ZELA 2PJ5A 3K2KA 5LYFA 4P4BA 3WC6A 5K8PA 1AYEA 2C6PA 3KL9A 4R7MA 4F9UA 5HXDA 2ZEOA 4A94A 2ZEGA 2ZEHA 5CPAA 1LAMA 2C1CA 3I1UA 1BPNA 1VGYA 2CTBA 1XMBA 3S9LA 4ZY1A 4MHZA 4DUKA 1ZG8A 4UEFA 4WJBA 4PQAA 2NYQA 2BO9A 1IY7A 3TC8A 4X3RA 4IK2A 2ANPA 3WC7A 2XEJA 4JZ0A 2ZEMA 1M4LA 3TX8A 2BCOA 1CG2A 2AFMA 4MCPA 4UIBA 2G9DA 3PRTA 3LWUA 3NH5A 2FVGA 2C6CA 2EK9A 4UF4A 5CBMA 3B3VA 1HDQA 2O4HA 5LRGA 4DJLA 3FEDA 2F7VA 1Z2LA 3BI0A 3N5FA 2PIZA 4P6YA 1CP6A 2GLFA 2PJ0A 4YU9A 2OR4A 4A38A 3ISXA 2ZEPA 2HB6A 2PRQA 4NGMA 3FJUA 1H8LA 4P44A 8CPAA 2F8HA 2Q51A 5K8NA 3WC5A 4FBEA 1XRYA 2AFWA 2EK8A 3B2YA 3HLPA 3KQXA 4F8ZA 1Z8LA 3KHXA
chains in the Genus database with same CATH superfamily
3CT9A 4CGPA 4CAXA 2JBKA 1IU8A 5GCNA 3D4UA 2OU2A 2O28A 2EUIA 2YNEA 4GM5A 4OC3A 4P4DA 4UBRA 5ELYA 3S6FA 5IB0A 1JWQA 4UFVA 1KWMA 2PE3A 3KZWA 3TOBA 5IX3A 4KOVA 2D4PA 5D29A 1YLEA 4GS4A 4MMOA 2PJ2A 3IIBA 2V8GA 2REFA 1M4DA 3WABA 1S60A 1YVKA 3PFOA 3SJEA 1XE4A 3D7FA 2EWBA 3QB8A 4UFXA 2J8NA 1Z8WA 1XBUA 4R3KA 3WR7A 4PV6A 1F2OA 4KVXA 3K9UA 3IEHA 4YGOA 4P4EA 1YW4A 2POKA 4Q7AA 3IWGA 4LUAA 2PJ4A 3FECA 5F49A 2OOTA 4MI4A 4R57A 3GYAA 1F57A 3G8WA 1N71A 4MCRA 3D67A 2V8VA 1I12A 2IL4A 4PXCA 2DEAA 1PUAA 4ZBGA 1VIXA 4B12A 2HC9A 1FNOA 2GANA 3NE7A 3IFEA 1QQ9A 1CJWA 1M4GA 2OZGA 3FIXA 3FYNA 3JUWA 1VKCA 1GYTA 2GLJA 3T9YA 2VI7A 4FD6A 3D68A 3IU2A 3B3CA 3NFZA 3PB4X 4XPKA 5LRJA 2Q4YA 4MY3A 3KR5A 4CGMA 3PGPA 1JQGA 4MHPA 5LRKA 2GE3A 3D3SA 4KSAA 4MFKA 5KTAA 1S7LA 4KZTA 2PJ7A 2WZNA 3C26A 3F0AA 3S6HA 5A28A 3SJFA 4C2ZA 3GUXA 4CRZB 4OP4A 1XMTA 2QJ8A 4ZY0A 1DTDA 4P4JA 1CX8A 1Z4RA 1Z5RA 4OC1A 3IC1A 2GREA 2PC1A 4HNYB 1BOBA 3KR4A 4B6ZA 2PCUA 3FNCA 4NEXA 2FSRA 3TCVA 1LANA 1M4IA 1ZG9A 2CNTA 2EVNA 3DSBA 4XPLA 2YGWA 3FXTA 5KTCA 2DPSA 2Q7SA 3KKWA 4UCPA 4BBHA 1ZLIA 2H5MA 1ARMA 3K9TA 4JYWA 1BPMA 3CXQA 1I21A 4X2TA 3PB8X 3TTHA 1AMPA 1S7FA 3FF3A 4Q38A 4R8FA 4MJ8A 4NXYA 1Z9UA 3T8WA 2GIVA 1TKFA 4U9ZA 1CM0A 1FY7A 4KLVA 4O23A 4ZYQA 1QSRA 2X7BA 1TKHA 3F8KA 2B5GA 2FL4A 4Y49B 3WT4A 3B7IA 4P4FA 4A33A 2B4DA 3W6SA 2F5IA 2I00A 3D2MA 1YMEA 3DNSA 4EWTA 4UCMA 4OIDA 3KI9A 5I0CA 2K5TA 2XEFA 1BLLE 4R3LA 1Y9WA 1UFHA 1Q7LA 2JLMA 4ONWA 3RYOA 3ZJ0A 1WK4A 2OB0A 3D8PA 2R1IA 1X10A 4PXBA 2J8MA 4B14A 4Z65A 1Z4EA 2I3CA 3IWWA 1IGBA 1QSNA 3CDXA 1Y9KA 2B3VA 4UWJA 3PB9X 5AG4A 2OH1A 1S5KA 3BXMA 4IUSA 3VH9A 3PBEA 2ZW5A 3B3TA 1TKJA 3QAYA 3P2HA 2PJCA 2Q4ZA 2V8DA 3N7ZA 4ZI6A 2QECA 4F0YA 1VHOA 2PJ8A 4KLWA 3D7GA 4C7HA 2Q0YA 4QUSA 2HQYA 2Q44A 4NCZA 1PYTB 1CPSA 1FT7A 1MJ9A 2PRBA 1QSOA 4AXVA 4R76A 4FD4A 2CF4A 6CPAA 1TF9A 4KVOE 1TF8A 3EC4A 3GIUA 2PVWA 4MHYA 2ARHA 5HVFA 5JQ4A 2RB7A 1OZPA 3EXNA 4PXDA 2WSAA 5LYIA 3S9NA 4CYOA 1YR0A 3MN8A 4GXHA 2EBJA 2PJ6A 1XJOA 4A95A 1IOFA 5THWA 2ZPAA 1J4JA 1LOKA 3B3SA 2HV2A 4EFDA 3BJ8A 1YQEA 1IYLA 1XOVA 1VHEA 3PBBA 2GU2A 2Z3KA 2ZOGA 3H8EA 5EC4A 4CRYB 2ZOFA 1YX0A 1ELMP 2AFXA 3BJ7A 4MFJA 5AG6A 3IU1A 2JDCA 4A39A 2QIRA 5HVGA 3D7HA 3KHZA 3R9FA 5BWAB 5JM6A 2CY2A 2REEA 3ISZA 4A2ZA 3FEEA 2Z3NA 5IB9A 3PP9A 4MHNA 4NGRA 4LQGA 3S6KA 2ZEFA 4NJRA 3RZAA 1B6BA 3B35A 3E0KA 2VL1A 4RUHA 4BMHA 2B5GB 2J9AA 2Q43A 4E2AA 1KUXA 4RI1A 2BOAA 2VXKA 2R8VA 2C6GA 2I79A 2CIJA 1YLOA 2CXAA 1AUGA 3FVLA 4XPDB 1MK4A 3GY9A 4UCNA 5AGEA 5I4MA 3IO1A 1NSAA 3G3SA 1HDUA 2VZYA 4PXEA 1Z8XA 1RTQA 3SXOA 4OLLA 4E0AA 2VZZA 2B58A 1Q2CA 2VBQA 4JXRA 2Q04A 4KOSA 3VWEA 3B3WA 3PB7X 4AVBA 2PR1A 4MHDA 4NGQA 5F47A 4NGTA 3KGQA 4JXQA 3RBUA 4DNCA 2CTCA 4IAVA 1QSMA 4NGPA 2P6FA 3V38A 2PJ1A 4J3GA 4M6GA 4AG7A 4XNHB 3CXPA 3D66A 2XEIA 4MRIA 4P45A 3VATA 4CAFA 1WWZA 2RFHA 2PIYA 2PSWA 3R1KA 4KSIA 4X8IA 5EBVA 4QVTA 3SI0A 5K8OA 2V8HA 5IV0A 3NH8A 5HMNA 2BEIA 4KS9A 2PJ9A 4MCQA 5F48A 3BHXA 4JJXA 2O53A 3JRUA 3KQZA 2BL1A 3MGDA 5D8NA 1ELLP 1KUYA 1Q2YA 4ZX9A 1PU9A 3D7DA 3L2NA 3VARA 1K4JA 2IQ6A 1BAVA 4FUUA 3BLNA 4H6UA 1YREA 5LYLA 1I1DA 1OBRA 1MJBA 2ZXVA 2FIAA 2FCKA 4II9A 3LODA 1LFWA 2B3UA 1CP7A 4CAWA 2AJ6A 4F6AA 1Q2DA 1A2ZA 2A4NA 4OMEA 4CYQA 7CPAA 4F0XA 3PZJA 5AG5A 5DS0A 2QMLA 3PEIA 4R6TA 5F09A 1YGHA 3SXNA 1NE9A 3GLJA 4JLYA 4PK2A 4EVYA 1R3NA 2AFSA 4ZGYB 3RNZA 2QVPA 4UWIA 2C27A 4QB9A 4HNXB 2ZENA 3P2FA 3I9SA 4P4IA 2FXFA 4B13A 4U9YA 2PJBA 4XNHC 4G1PA 1S7NA 2NSMA 2ZW6A 1RXTA 5J1QA 1U6MA 1TIQA 2PVVA 2XEGA 3A9LA 3DR8A 1ARLA 4P10A 3QAHA 4MXUA 1LRZA 2AFZA 4MFPA 5H86A 3R9EA 3TFYA 1Y0RA 2ABZA 4UEZA 2JBJA 4FD5A 1M44A 4PK3A 2OZHA 2V77A 4A32A 3H4QA 4NF1A 4OC0A 1MJAA 3FH4A 4CPAA 2ZEDA 1P0HA 1XFOA 2Z11A 2WYRA 4KVME 4PSXA 4ZX8A 2IJZA 3FMCA 4K3NA 4HNWB 1ZLHA 4MFQA 3QNVA 3OWCA 1F2PA 1XIXA 3MRUA 4DYOA 1NSLA 2Q4VA 1S7KA 1LCPA 4WWVA 4UIAA 4L8AA 1UWYA 2P6EA 1IICA 4NGNA 4C7IA 1B87A 2Z3OA 3H8FA 4AG9A 1CPXA 3CPAA 2Q7BA 3V7ZA 2R7HA 4OC4A 1LAPA 1ON0A 3FBUA 1ZG7A 4NGSA 3RAMA 3TO9A 4EMEA 2PJAA 3HUVA 3I3GA 4TWEA 4L89A 4W9YA 2JEWA 4FWUA 5EMIA 1IIDA 5JGFA 1QMUA 3H5ZA 3SI2A 4NJQA 4NSQA 3CPXA 4M6HA 5LYDA 3TO7A 4IHMA 2FE7A 4TNUA 1V0CA 2IMOA 3PFEA 3H8GA 4KUBA 4FD7A 3CXSA 3W91A 1Y7RA 4FAIA 4PSWA 4OIWA 5C88A 3NH4A 3DLJA 5J8FA 3R96A 2VEZA 2B4BA 5JH9A 1Y7EA 1DE4C 1Z8TA 2AFOA 4H6ZA 2Z0ZA 4MCSA 4PPZA 3R95A 3SJGA 4CGNA 3GB0A 4OKOA 4KUAA 2HUZA 1TXRA 1CBXA 3KASA 3BI1A 1KUVA 2ZW4A 2PDOA 3D2PA 3EFAA 1IOIA 4NFRA 5G21A 1RO5A 1Y0YA 1YW6A 2QYVA 3DGVA 4UEEA 5G20A 3SJXA 4F9VA 2Y0MA 2EO8A 1R43A 2RC4A 4M6IA 4YWYA 1SQHA 2AFUA 4JD6A 4MY0A 4U5YA 1HEEA 2P6GA 1P4NA 3NA6A 4OADA 3PB6X 1EE3P 4ZY2A 2OZUA 3JVNA 5KTDA 1PCAA 3FX6A 3B8GA 4KOUA 4OC2A 2ZEEA 5HH1A 4IF5A 3UY5A 4BD9A 2FIWA 2KCWA 2PJ3A 4C68A 2CNSA 3DR6A 2ATRA 3IJ3A 4H2KA 3TO6A 5K8MA 4QBJA 4OC5A 3R9GA 4UA3A 3SI1A 1YSJA 3LMSA 5C82A 5HVHA 2ZELA 5JPHA 2NMTA 3TOAA 2PJ5A 3K2KA 2WUUA 1BO4A 4CGLA 4KOYA 5LYFA 4QC6A 5DWMA 4P4BA 3WC6A 1M1DA 1AYEA 2C6PA 5K8PA 3KL9A 4R87A 4UFWA 4R7MA 4F9UA 4B11A 5HXDA 2ZEOA 4H89A 4Q36A 4A94A 2ZEGA 2ZEHA 5CPAA 2YNDA 2G3AA 1LAMA 1VHSA 4MFZA 1KZFA 3ZZIA 3NE8A 2C1CA 3I1UA 4B5PA 4ONUA 1BPNA 5G22A 2GFQA 1VGYA 1L0CA 4MFLA 4LX9A 3IGRA 4HPSA 4RN7A 4YRHA 4AVAA 2CTBA 2PQ8A 4B5OA 3S9MA 1XMBA 3S9LA 2ODFA 4ZY1A 2YNCC 4MBUA 2PR8A 4MHZA 4ORFA 4DUKA 3IWEA 4LQ6A 1ZG8A 4UEFA 4WJBA 4PQAA 2NYQA 4I49A 4CGOA 5A27A 1YK3A 1GHEA 2BO9A 1X12A 2BUEA 4R9MA 5G1ZA 1IY7A 3TC8A 2JEVA 4K30A 4YFJA 3F5BA 4X3RA 4IK2A 4CYPA 2ANPA 3EY5A 3WC7A 1ZO0A 3V8IA 2DPTA 1R57A 2XEJA 4JWPA 2FS5A 4JZ0A 2ZEMA 5FVJA 2BSWA 1IB1E 1M4LA 2BCOA 2ZW7A 3TX8A 3LD2A 1CG2A 1NMTA 1XEBA 2AFMA 4MCPA 4Y49C 4A30A 5AG7A 3TT2A 5F46A 4C2XA 2WPXA 4UIBA 2B4DB 2G9DA 2FT0A 3PRTA 5CNPA 2Z3LA 3LWUA 2FVGA 2C6CA 3NH5A 3LACA 1QSTA 4RS2A 2G3TA 5H84A 4X5KA 2EK9A 4KOXA 4KOTA 4UF4A 4OAEA 4AB7A 5CBMA 3VWDA 2DF5A 4B10A 4A37A 1XF8A 4E8OA 3B3VA 2R98A 1HDQA 4A31A 2O4HA 5LRGA 2AE6A 2G0BA 3FEDA 2CNMA 2F7VA 3W6XA 4DJLA 3TE4A 1Z2LA 3BI0A 3N5FA 4CAVA 2PIZA 4P6YA 1CP6A 4KSFA 4KORA 1IYKA 2PJ0A 2GLFA 4AVCA 2P0WA 2OR4A 4YU9A 4A38A 1YVOA 3ISXA 2ZEPA 4XPDC 2DXQA 3FB3A 3JTKA 2HB6A 2PRQA 4B5PB 5J8CA 4CYNA 4NGMA 5ISVA 2Z10A 3FJUA 1H8LA 4KOWA 3SHPA 2JDDA 2Z3MA 3T90A 4P44A 2D4OA 4M85A 4CS0B 4C2YA 8CPAA 2F8HA 4BINA 2Q51A 2Z3PA 5DWNA 4CAEA 5K8NA 3WC5A 2VQYA 2J8RA 4FBEA 3RO0A 2YNCA 1XRYA 2AFWA 2EK8A 3B2YA 3FRMA 3EO4A 3HLPA 3KQXA 2WPWA 4M3SA 5E96A 3S6GA 4F8ZA 1S3ZA 3CZXA 1Z8LA 3KHXA 4HKFA 3DDDA 3GKRA
chains in the Genus database with same CATH topology
3CT9A 2JBKA 3S9MA 3D4UA 4A37A 4GM5A 4OC3A 4P4DA 5ELYA 1KWMA 2PE3A 3KZWA 5D29A 4MMOA 2PJ2A 3IIBA 2V8GA 3WABA 3PFOA 3SJEA 3D7FA 2EWBA 1XBUA 1F2OA 3IEHA 4P4EA 1YW4A 2POKA 4Q7AA 2OOTA 2PJ4A 3FECA 1F57A 4MCRA 3D67A 2V8VA 4PXCA 2DEAA 1VIXA 2HC9A 1FNOA 3IFEA 1QQ9A 1GYTA 2GLJA 3D68A 3B3CA 3NFZA 3PB4X 5LRJA 3KR5A 1JQGA 4MHPA 5LRKA 2PJ7A 2WZNA 3SJFA 3GUXA 4OP4A 2QJ8A 4ZY0A 1DTDA 4P4JA 1CX8A 1Z5RA 4OC1A 3IC1A 2GREA 3KR4A 4B6ZA 2PCUA 1LANA 1ZG9A 1ZLIA 4JYWA 1ARMA 3K9TA 1BPMA 4X2TA 3PB8X 1AMPA 3FF3A 4R8FA 3T8WA 1TKFA 4O23A 4ZYQA 1TKHA 3WT4A 3B7IA 4P4FA 1YMEA 4EWTA 4OIDA 3KI9A 2XEFA 1BLLE 4ONWA 1Q7LA 4PXBA 4Z65A 2I3CA 3IWWA 1IGBA 3CDXA 3PB9X 3VH9A 3BXMA 3PBEA 3B3TA 1TKJA 2PJCA 2Q4ZA 2V8DA 4ZI6A 1VHOA 2PJ8A 3D7GA 1PYTB 1CPSA 1FT7A 4AXVA 4R76A 2CF4A 6CPAA 1TF9A 1TF8A 4MHYA 2PVWA 5HVFA 2RB7A 4PXDA 5LYIA 3S9NA 3MN8A 2PJ6A 1XJOA 5THWA 3B3SA 1LOKA 4EFDA 1VHEA 3PBBA 2GU2A 2ZOGA 3H8EA 2ZOFA 4A39A 1ELMP 2AFXA 5HVGA 3D7HA 3KHZA 5JM6A 3ISZA 3FEEA 5IB9A 4MHNA 4NGRA 4LQGA 2ZEFA 4NJRA 3RZAA 3B35A 2VL1A 4RUHA 2J9AA 2Q43A 2BOAA 2C6GA 2CIJA 1YLOA 3FVLA 5I4MA 3IO1A 1NSAA 1HDUA 4PXEA 1RTQA 3B3WA 3PB7X 4NGQA 4NGTA 3KGQA 3RBUA 2CTCA 4IAVA 4NGPA 3V38A 2PJ1A 3D66A 4MRIA 2XEIA 4P45A 3VATA 2RFHA 2PIYA 4KSIA 4X8IA 3SI0A 5K8OA 2V8HA 3NH8A 2PJ9A 4MCQA 3BHXA 2O53A 3JRUA 3KQZA 5D8NA 4ZX9A 1ELLP 3VARA 3D7DA 3L2NA 2IQ6A 1BAVA 4FUUA 5LYLA 1OBRA 1LFWA 1CP7A 4OMEA 7CPAA 5DS0A 3PEIA 4R6TA 5F09A 3GLJA 1R3NA 2AFSA 2QVPA 2ZENA 4P4IA 2PJBA 4G1PA 2NSMA 5J1QA 2PVVA 2XEGA 4P10A 1ARLA 4MXUA 2AFZA 1Y0RA 2ABZA 4UEZA 2JBJA 2V77A 4OC0A 3FH4A 4CPAA 2ZEDA 4ZX8A 1XFOA 2WYRA 2IJZA 3FMCA 4K3NA 1ZLHA 3QNVA 1F2PA 3MRUA 4DYOA 1LCPA 4WWVA 4UIAA 1UWYA 4NGNA 3H8FA 1CPXA 3CPAA 3V7ZA 4OC4A 1LAPA 1ZG7A 4NGSA 3RAMA 4EMEA 2PJAA 3HUVA 4TWEA 4W9YA 2JEWA 4FWUA 5JGFA 1QMUA 3SI2A 4NJQA 5LYDA 3CPXA 4IHMA 4TNUA 2IMOA 3PFEA 3H8GA 4FAIA 4OIWA 3NH4A 3DLJA 5JH9A 1Y7EA 1DE4C 2AFOA 4MCSA 4PPZA 3SJGA 3GB0A 4OKOA 3KASA 1TXRA 1CBXA 3BI1A 4NFRA 1Y0YA 1YW6A 2QYVA 3DGVA 4UEEA 3SJXA 4F9VA 1R43A 4YWYA 2AFUA 1HEEA 3NA6A 4ZY2A 3PB6X 1EE3P 1PCAA 3FX6A 4OC2A 2ZEEA 4BD9A 2PJ3A 3IJ3A 4H2KA 5K8MA 4OC5A 3SI1A 3LMSA 1YSJA 5HVHA 2ZELA 2PJ5A 3K2KA 5LYFA 4P4BA 3WC6A 5K8PA 1AYEA 2C6PA 3KL9A 4R7MA 4F9UA 5HXDA 2ZEOA 4A94A 2ZEGA 2ZEHA 5CPAA 1LAMA 2C1CA 3I1UA 1BPNA 1VGYA 2CTBA 1XMBA 3S9LA 4ZY1A 4MHZA 4DUKA 1ZG8A 4UEFA 4WJBA 4PQAA 2NYQA 2BO9A 1IY7A 3TC8A 4X3RA 4IK2A 2ANPA 3WC7A 2XEJA 4JZ0A 2ZEMA 1M4LA 3TX8A 2BCOA 1CG2A 2AFMA 4MCPA 4UIBA 2G9DA 3PRTA 3LWUA 3NH5A 2FVGA 2C6CA 2EK9A 4UF4A 5CBMA 3B3VA 1HDQA 2O4HA 5LRGA 4DJLA 3FEDA 2F7VA 1Z2LA 3BI0A 3N5FA 2PIZA 4P6YA 1CP6A 2GLFA 2PJ0A 4YU9A 2OR4A 4A38A 3ISXA 2ZEPA 2HB6A 2PRQA 4NGMA 3FJUA 1H8LA 4P44A 8CPAA 2F8HA 2Q51A 5K8NA 3WC5A 4FBEA 1XRYA 2AFWA 2EK8A 3B2YA 3HLPA 3KQXA 4F8ZA 1Z8LA 3KHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CT9 A;  2JBK A;  3S9M A;  3D4U A;  4A37 A;  4GM5 A;  4OC3 A;  4P4D A;  5ELY A;  1KWM A;  2PE3 A;  3KZW A;  5D29 A;  4MMO A;  2PJ2 A;  3IIB A;  2V8G A;  3WAB A;  3PFO A;  3SJE A;  3D7F A;  2EWB A;  1XBU A;  1F2O A;  3IEH A;  4P4E A;  1YW4 A;  2POK A;  4Q7A A;  2OOT A;  2PJ4 A;  3FEC A;  1F57 A;  4MCR A;  3D67 A;  2V8V A;  4PXC A;  2DEA A;  1VIX A;  2HC9 A;  1FNO A;  3IFE A;  1QQ9 A;  1GYT A;  2GLJ A;  3D68 A;  3B3C A;  3NFZ A;  3PB4 X;  5LRJ A;  3KR5 A;  1JQG A;  4MHP A;  5LRK A;  2PJ7 A;  2WZN A;  3SJF A;  3GUX A;  4OP4 A;  2QJ8 A;  4ZY0 A;  1DTD A;  4P4J A;  1CX8 A;  1Z5R A;  4OC1 A;  3IC1 A;  2GRE A;  3KR4 A;  4B6Z A;  2PCU A;  1LAN A;  1ZG9 A;  1ZLI A;  4JYW A;  1ARM A;  3K9T A;  1BPM A;  4X2T A;  3PB8 X;  1AMP A;  3FF3 A;  4R8F A;  3T8W A;  1TKF A;  4O23 A;  4ZYQ A;  1TKH A;  3WT4 A;  3B7I A;  4P4F A;  1YME A;  4EWT A;  4OID A;  3KI9 A;  2XEF A;  1BLL E;  4ONW A;  1Q7L A;  4PXB A;  4Z65 A;  2I3C A;  3IWW A;  1IGB A;  3CDX A;  3PB9 X;  3VH9 A;  3BXM A;  3PBE A;  3B3T A;  1TKJ A;  2PJC A;  2Q4Z A;  2V8D A;  4ZI6 A;  1VHO A;  2PJ8 A;  3D7G A;  1PYT B;  1CPS A;  1FT7 A;  4AXV A;  4R76 A;  2CF4 A;  6CPA A;  1TF9 A;  1TF8 A;  4MHY A;  2PVW A;  5HVF A;  2RB7 A;  4PXD A;  5LYI A;  3S9N A;  3MN8 A;  2PJ6 A;  1XJO A;  5THW A;  3B3S A;  1LOK A;  4EFD A;  1VHE A;  3PBB A;  2GU2 A;  2ZOG A;  3H8E A;  2ZOF A;  4A39 A;  1ELM P;  2AFX A;  5HVG A;  3D7H A;  3KHZ A;  5JM6 A;  3ISZ A;  3FEE A;  5IB9 A;  4MHN A;  4NGR A;  4LQG A;  2ZEF A;  4NJR A;  3RZA A;  3B35 A;  2VL1 A;  4RUH A;  2J9A A;  2Q43 A;  2BOA A;  2C6G A;  2CIJ A;  1YLO A;  3FVL A;  5I4M A;  3IO1 A;  1NSA A;  1HDU A;  4PXE A;  1RTQ A;  3B3W A;  3PB7 X;  4NGQ A;  4NGT A;  3KGQ A;  3RBU A;  2CTC A;  4IAV A;  4NGP A;  3V38 A;  2PJ1 A;  3D66 A;  4MRI A;  2XEI A;  4P45 A;  3VAT A;  2RFH A;  2PIY A;  4KSI A;  4X8I A;  3SI0 A;  5K8O A;  2V8H A;  3NH8 A;  2PJ9 A;  4MCQ A;  3BHX A;  2O53 A;  3JRU A;  3KQZ A;  5D8N A;  4ZX9 A;  1ELL P;  3VAR A;  3D7D A;  3L2N A;  2IQ6 A;  1BAV A;  4FUU A;  5LYL A;  1OBR A;  1LFW A;  1CP7 A;  4OME A;  7CPA A;  5DS0 A;  3PEI A;  4R6T A;  5F09 A;  3GLJ A;  1R3N A;  2AFS A;  2QVP A;  2ZEN A;  4P4I A;  2PJB A;  4G1P A;  2NSM A;  5J1Q A;  2PVV A;  2XEG A;  4P10 A;  1ARL A;  4MXU A;  2AFZ A;  1Y0R A;  2ABZ A;  4UEZ A;  2JBJ A;  2V77 A;  4OC0 A;  3FH4 A;  4CPA A;  2ZED A;  4ZX8 A;  1XFO A;  2WYR A;  2IJZ A;  3FMC A;  4K3N A;  1ZLH A;  3QNV A;  1F2P A;  3MRU A;  4DYO A;  1LCP A;  4WWV A;  4UIA A;  1UWY A;  4NGN A;  3H8F A;  1CPX A;  3CPA A;  3V7Z A;  4OC4 A;  1LAP A;  1ZG7 A;  4NGS A;  3RAM A;  4EME A;  2PJA A;  3HUV A;  4TWE A;  4W9Y A;  2JEW A;  4FWU A;  5JGF A;  1QMU A;  3SI2 A;  4NJQ A;  5LYD A;  3CPX A;  4IHM A;  4TNU A;  2IMO A;  3PFE A;  3H8G A;  4FAI A;  4OIW A;  3NH4 A;  3DLJ A;  5JH9 A;  1Y7E A;  1DE4 C;  2AFO A;  4MCS A;  4PPZ A;  3SJG A;  3GB0 A;  4OKO A;  3KAS A;  1TXR A;  1CBX A;  3BI1 A;  4NFR A;  1Y0Y A;  1YW6 A;  2QYV A;  3DGV A;  4UEE A;  3SJX A;  4F9V A;  1R43 A;  4YWY A;  2AFU A;  1HEE A;  3NA6 A;  4ZY2 A;  3PB6 X;  1EE3 P;  1PCA A;  3FX6 A;  4OC2 A;  2ZEE A;  4BD9 A;  2PJ3 A;  3IJ3 A;  4H2K A;  5K8M A;  4OC5 A;  3SI1 A;  3LMS A;  1YSJ A;  5HVH A;  2ZEL A;  2PJ5 A;  3K2K A;  5LYF A;  4P4B A;  3WC6 A;  5K8P A;  1AYE A;  2C6P A;  3KL9 A;  4R7M A;  4F9U A;  5HXD A;  2ZEO A;  4A94 A;  2ZEG A;  2ZEH A;  5CPA A;  1LAM A;  2C1C A;  3I1U A;  1BPN A;  1VGY A;  2CTB A;  1XMB A;  3S9L A;  4ZY1 A;  4MHZ A;  4DUK A;  1ZG8 A;  4UEF A;  4WJB A;  4PQA A;  2NYQ A;  2BO9 A;  1IY7 A;  3TC8 A;  4X3R A;  4IK2 A;  2ANP A;  3WC7 A;  2XEJ A;  4JZ0 A;  2ZEM A;  1M4L A;  3TX8 A;  2BCO A;  1CG2 A;  2AFM A;  4MCP A;  4UIB A;  2G9D A;  3PRT A;  3LWU A;  3NH5 A;  2FVG A;  2C6C A;  2EK9 A;  4UF4 A;  5CBM A;  3B3V A;  1HDQ A;  2O4H A;  5LRG A;  4DJL A;  3FED A;  2F7V A;  1Z2L A;  3BI0 A;  3N5F A;  2PIZ A;  4P6Y A;  1CP6 A;  2GLF A;  2PJ0 A;  4YU9 A;  2OR4 A;  4A38 A;  3ISX A;  2ZEP A;  2HB6 A;  2PRQ A;  4NGM A;  3FJU A;  1H8L A;  4P44 A;  8CPA A;  2F8H A;  2Q51 A;  5K8N A;  3WC5 A;  4FBE A;  1XRY A;  2AFW A;  2EK8 A;  3B2Y A;  3HLP A;  3KQX A;  4F8Z A;  1Z8L A;  3KHX A; 
#chains in the Genus database with same CATH topology
 3CT9 A;  4CGP A;  4CAX A;  2JBK A;  1IU8 A;  5GCN A;  3D4U A;  2OU2 A;  2O28 A;  2EUI A;  2YNE A;  4GM5 A;  4OC3 A;  4P4D A;  4UBR A;  5ELY A;  3S6F A;  5IB0 A;  1JWQ A;  4UFV A;  1KWM A;  2PE3 A;  3KZW A;  3TOB A;  5IX3 A;  4KOV A;  2D4P A;  5D29 A;  1YLE A;  4GS4 A;  4MMO A;  2PJ2 A;  3IIB A;  2V8G A;  2REF A;  1M4D A;  3WAB A;  1S60 A;  1YVK A;  3PFO A;  3SJE A;  1XE4 A;  3D7F A;  2EWB A;  3QB8 A;  4UFX A;  2J8N A;  1Z8W A;  1XBU A;  4R3K A;  3WR7 A;  4PV6 A;  1F2O A;  4KVX A;  3K9U A;  3IEH A;  4YGO A;  4P4E A;  1YW4 A;  2POK A;  4Q7A A;  3IWG A;  4LUA A;  2PJ4 A;  3FEC A;  5F49 A;  2OOT A;  4MI4 A;  4R57 A;  3GYA A;  1F57 A;  3G8W A;  1N71 A;  4MCR A;  3D67 A;  2V8V A;  1I12 A;  2IL4 A;  4PXC A;  2DEA A;  1PUA A;  4ZBG A;  1VIX A;  4B12 A;  2HC9 A;  1FNO A;  2GAN A;  3NE7 A;  3IFE A;  1QQ9 A;  1CJW A;  1M4G A;  2OZG A;  3FIX A;  3FYN A;  3JUW A;  1VKC A;  1GYT A;  2GLJ A;  3T9Y A;  2VI7 A;  4FD6 A;  3D68 A;  3IU2 A;  3B3C A;  3NFZ A;  3PB4 X;  4XPK A;  5LRJ A;  2Q4Y A;  4MY3 A;  3KR5 A;  4CGM A;  3PGP A;  1JQG A;  4MHP A;  5LRK A;  2GE3 A;  3D3S A;  4KSA A;  4MFK A;  5KTA A;  1S7L A;  4KZT A;  2PJ7 A;  2WZN A;  3C26 A;  3F0A A;  3S6H A;  5A28 A;  3SJF A;  4C2Z A;  3GUX A;  4CRZ B;  4OP4 A;  1XMT A;  2QJ8 A;  4ZY0 A;  1DTD A;  4P4J A;  1CX8 A;  1Z4R A;  1Z5R A;  4OC1 A;  3IC1 A;  2GRE A;  2PC1 A;  4HNY B;  1BOB A;  3KR4 A;  4B6Z A;  2PCU A;  3FNC A;  4NEX A;  2FSR A;  3TCV A;  1LAN A;  1M4I A;  1ZG9 A;  2CNT A;  2EVN A;  3DSB A;  4XPL A;  2YGW A;  3FXT A;  5KTC A;  2DPS A;  2Q7S A;  3KKW A;  4UCP A;  4BBH A;  1ZLI A;  2H5M A;  1ARM A;  3K9T A;  4JYW A;  1BPM A;  3CXQ A;  1I21 A;  4X2T A;  3PB8 X;  3TTH A;  1AMP A;  1S7F A;  3FF3 A;  4Q38 A;  4R8F A;  4MJ8 A;  4NXY A;  1Z9U A;  3T8W A;  2GIV A;  1TKF A;  4U9Z A;  1CM0 A;  1FY7 A;  4KLV A;  4O23 A;  4ZYQ A;  1QSR A;  2X7B A;  1TKH A;  3F8K A;  2B5G A;  2FL4 A;  4Y49 B;  3WT4 A;  3B7I A;  4P4F A;  4A33 A;  2B4D A;  3W6S A;  2F5I A;  2I00 A;  3D2M A;  1YME A;  3DNS A;  4EWT A;  4UCM A;  4OID A;  3KI9 A;  5I0C A;  2K5T A;  2XEF A;  1BLL E;  4R3L A;  1Y9W A;  1UFH A;  1Q7L A;  2JLM A;  4ONW A;  3RYO A;  3ZJ0 A;  1WK4 A;  2OB0 A;  3D8P A;  2R1I A;  1X10 A;  4PXB A;  2J8M A;  4B14 A;  4Z65 A;  1Z4E A;  2I3C A;  3IWW A;  1IGB A;  1QSN A;  3CDX A;  1Y9K A;  2B3V A;  4UWJ A;  3PB9 X;  5AG4 A;  2OH1 A;  1S5K A;  3BXM A;  4IUS A;  3VH9 A;  3PBE A;  2ZW5 A;  3B3T A;  1TKJ A;  3QAY A;  3P2H A;  2PJC A;  2Q4Z A;  2V8D A;  3N7Z A;  4ZI6 A;  2QEC A;  4F0Y A;  1VHO A;  2PJ8 A;  4KLW A;  3D7G A;  4C7H A;  2Q0Y A;  4QUS A;  2HQY A;  2Q44 A;  4NCZ A;  1PYT B;  1CPS A;  1FT7 A;  1MJ9 A;  2PRB A;  1QSO A;  4AXV A;  4R76 A;  4FD4 A;  2CF4 A;  6CPA A;  1TF9 A;  4KVO E;  1TF8 A;  3EC4 A;  3GIU A;  2PVW A;  4MHY A;  2ARH A;  5HVF A;  5JQ4 A;  2RB7 A;  1OZP A;  3EXN A;  4PXD A;  2WSA A;  5LYI A;  3S9N A;  4CYO A;  1YR0 A;  3MN8 A;  4GXH A;  2EBJ A;  2PJ6 A;  1XJO A;  4A95 A;  1IOF A;  5THW A;  2ZPA A;  1J4J A;  1LOK A;  3B3S A;  2HV2 A;  4EFD A;  3BJ8 A;  1YQE A;  1IYL A;  1XOV A;  1VHE A;  3PBB A;  2GU2 A;  2Z3K A;  2ZOG A;  3H8E A;  5EC4 A;  4CRY B;  2ZOF A;  1YX0 A;  1ELM P;  2AFX A;  3BJ7 A;  4MFJ A;  5AG6 A;  3IU1 A;  2JDC A;  4A39 A;  2QIR A;  5HVG A;  3D7H A;  3KHZ A;  3R9F A;  5BWA B;  5JM6 A;  2CY2 A;  2REE A;  3ISZ A;  4A2Z A;  3FEE A;  2Z3N A;  5IB9 A;  3PP9 A;  4MHN A;  4NGR A;  4LQG A;  3S6K A;  2ZEF A;  4NJR A;  3RZA A;  1B6B A;  3B35 A;  3E0K A;  2VL1 A;  4RUH A;  4BMH A;  2B5G B;  2J9A A;  2Q43 A;  4E2A A;  1KUX A;  4RI1 A;  2BOA A;  2VXK A;  2R8V A;  2C6G A;  2I79 A;  2CIJ A;  1YLO A;  2CXA A;  1AUG A;  3FVL A;  4XPD B;  1MK4 A;  3GY9 A;  4UCN A;  5AGE A;  5I4M A;  3IO1 A;  1NSA A;  3G3S A;  1HDU A;  2VZY A;  4PXE A;  1Z8X A;  1RTQ A;  3SXO A;  4OLL A;  4E0A A;  2VZZ A;  2B58 A;  1Q2C A;  2VBQ A;  4JXR A;  2Q04 A;  4KOS A;  3VWE A;  3B3W A;  3PB7 X;  4AVB A;  2PR1 A;  4MHD A;  4NGQ A;  5F47 A;  4NGT A;  3KGQ A;  4JXQ A;  3RBU A;  4DNC A;  2CTC A;  4IAV A;  1QSM A;  4NGP A;  2P6F A;  3V38 A;  2PJ1 A;  4J3G A;  4M6G A;  4AG7 A;  4XNH B;  3CXP A;  3D66 A;  2XEI A;  4MRI A;  4P45 A;  3VAT A;  4CAF A;  1WWZ A;  2RFH A;  2PIY A;  2PSW A;  3R1K A;  4KSI A;  4X8I A;  5EBV A;  4QVT A;  3SI0 A;  5K8O A;  2V8H A;  5IV0 A;  3NH8 A;  5HMN A;  2BEI A;  4KS9 A;  2PJ9 A;  4MCQ A;  5F48 A;  3BHX A;  4JJX A;  2O53 A;  3JRU A;  3KQZ A;  2BL1 A;  3MGD A;  5D8N A;  1ELL P;  1KUY A;  1Q2Y A;  4ZX9 A;  1PU9 A;  3D7D A;  3L2N A;  3VAR A;  1K4J A;  2IQ6 A;  1BAV A;  4FUU A;  3BLN A;  4H6U A;  1YRE A;  5LYL A;  1I1D A;  1OBR A;  1MJB A;  2ZXV A;  2FIA A;  2FCK A;  4II9 A;  3LOD A;  1LFW A;  2B3U A;  1CP7 A;  4CAW A;  2AJ6 A;  4F6A A;  1Q2D A;  1A2Z A;  2A4N A;  4OME A;  4CYQ A;  7CPA A;  4F0X A;  3PZJ A;  5AG5 A;  5DS0 A;  2QML A;  3PEI A;  4R6T A;  5F09 A;  1YGH A;  3SXN A;  1NE9 A;  3GLJ A;  4JLY A;  4PK2 A;  4EVY A;  1R3N A;  2AFS A;  4ZGY B;  3RNZ A;  2QVP A;  4UWI A;  2C27 A;  4QB9 A;  4HNX B;  2ZEN A;  3P2F A;  3I9S A;  4P4I A;  2FXF A;  4B13 A;  4U9Y A;  2PJB A;  4XNH C;  4G1P A;  1S7N A;  2NSM A;  2ZW6 A;  1RXT A;  5J1Q A;  1U6M A;  1TIQ A;  2PVV A;  2XEG A;  3A9L A;  3DR8 A;  1ARL A;  4P10 A;  3QAH A;  4MXU A;  1LRZ A;  2AFZ A;  4MFP A;  5H86 A;  3R9E A;  3TFY A;  1Y0R A;  2ABZ A;  4UEZ A;  2JBJ A;  4FD5 A;  1M44 A;  4PK3 A;  2OZH A;  2V77 A;  4A32 A;  3H4Q A;  4NF1 A;  4OC0 A;  1MJA A;  3FH4 A;  4CPA A;  2ZED A;  1P0H A;  1XFO A;  2Z11 A;  2WYR A;  4KVM E;  4PSX A;  4ZX8 A;  2IJZ A;  3FMC A;  4K3N A;  4HNW B;  1ZLH A;  4MFQ A;  3QNV A;  3OWC A;  1F2P A;  1XIX A;  3MRU A;  4DYO A;  1NSL A;  2Q4V A;  1S7K A;  1LCP A;  4WWV A;  4UIA A;  4L8A A;  1UWY A;  2P6E A;  1IIC A;  4NGN A;  4C7I A;  1B87 A;  2Z3O A;  3H8F A;  4AG9 A;  1CPX A;  3CPA A;  2Q7B A;  3V7Z A;  2R7H A;  4OC4 A;  1LAP A;  1ON0 A;  3FBU A;  1ZG7 A;  4NGS A;  3RAM A;  3TO9 A;  4EME A;  2PJA A;  3HUV A;  3I3G A;  4TWE A;  4L89 A;  4W9Y A;  2JEW A;  4FWU A;  5EMI A;  1IID A;  5JGF A;  1QMU A;  3H5Z A;  3SI2 A;  4NJQ A;  4NSQ A;  3CPX A;  4M6H A;  5LYD A;  3TO7 A;  4IHM A;  2FE7 A;  4TNU A;  1V0C A;  2IMO A;  3PFE A;  3H8G A;  4KUB A;  4FD7 A;  3CXS A;  3W91 A;  1Y7R A;  4FAI A;  4PSW A;  4OIW A;  5C88 A;  3NH4 A;  3DLJ A;  5J8F A;  3R96 A;  2VEZ A;  2B4B A;  5JH9 A;  1Y7E A;  1DE4 C;  1Z8T A;  2AFO A;  4H6Z A;  2Z0Z A;  4MCS A;  4PPZ A;  3R95 A;  3SJG A;  4CGN A;  3GB0 A;  4OKO A;  4KUA A;  2HUZ A;  1TXR A;  1CBX A;  3KAS A;  3BI1 A;  1KUV A;  2ZW4 A;  2PDO A;  3D2P A;  3EFA A;  1IOI A;  4NFR A;  5G21 A;  1RO5 A;  1Y0Y A;  1YW6 A;  2QYV A;  3DGV A;  4UEE A;  5G20 A;  3SJX A;  4F9V A;  2Y0M A;  2EO8 A;  1R43 A;  2RC4 A;  4M6I A;  4YWY A;  1SQH A;  2AFU A;  4JD6 A;  4MY0 A;  4U5Y A;  1HEE A;  2P6G A;  1P4N A;  3NA6 A;  4OAD A;  3PB6 X;  1EE3 P;  4ZY2 A;  2OZU A;  3JVN A;  5KTD A;  1PCA A;  3FX6 A;  3B8G A;  4KOU A;  4OC2 A;  2ZEE A;  5HH1 A;  4IF5 A;  3UY5 A;  4BD9 A;  2FIW A;  2KCW A;  2PJ3 A;  4C68 A;  2CNS A;  3DR6 A;  2ATR A;  3IJ3 A;  4H2K A;  3TO6 A;  5K8M A;  4QBJ A;  4OC5 A;  3R9G A;  4UA3 A;  3SI1 A;  1YSJ A;  3LMS A;  5C82 A;  5HVH A;  2ZEL A;  5JPH A;  2NMT A;  3TOA A;  2PJ5 A;  3K2K A;  2WUU A;  1BO4 A;  4CGL A;  4KOY A;  5LYF A;  4QC6 A;  5DWM A;  4P4B A;  3WC6 A;  1M1D A;  1AYE A;  2C6P A;  5K8P A;  3KL9 A;  4R87 A;  4UFW A;  4R7M A;  4F9U A;  4B11 A;  5HXD A;  2ZEO A;  4H89 A;  4Q36 A;  4A94 A;  2ZEG A;  2ZEH A;  5CPA A;  2YND A;  2G3A A;  1LAM A;  1VHS A;  4MFZ A;  1KZF A;  3ZZI A;  3NE8 A;  2C1C A;  3I1U A;  4B5P A;  4ONU A;  1BPN A;  5G22 A;  2GFQ A;  1VGY A;  1L0C A;  4MFL A;  4LX9 A;  3IGR A;  4HPS A;  4RN7 A;  4YRH A;  4AVA A;  2CTB A;  2PQ8 A;  4B5O A;  3S9M A;  1XMB A;  3S9L A;  2ODF A;  4ZY1 A;  2YNC C;  4MBU A;  2PR8 A;  4MHZ A;  4ORF A;  4DUK A;  3IWE A;  4LQ6 A;  1ZG8 A;  4UEF A;  4WJB A;  4PQA A;  2NYQ A;  4I49 A;  4CGO A;  5A27 A;  1YK3 A;  1GHE A;  2BO9 A;  1X12 A;  2BUE A;  4R9M A;  5G1Z A;  1IY7 A;  3TC8 A;  2JEV A;  4K30 A;  4YFJ A;  3F5B A;  4X3R A;  4IK2 A;  4CYP A;  2ANP A;  3EY5 A;  3WC7 A;  1ZO0 A;  3V8I A;  2DPT A;  1R57 A;  2XEJ A;  4JWP A;  2FS5 A;  4JZ0 A;  2ZEM A;  5FVJ A;  2BSW A;  1IB1 E;  1M4L A;  2BCO A;  2ZW7 A;  3TX8 A;  3LD2 A;  1CG2 A;  1NMT A;  1XEB A;  2AFM A;  4MCP A;  4Y49 C;  4A30 A;  5AG7 A;  3TT2 A;  5F46 A;  4C2X A;  2WPX A;  4UIB A;  2B4D B;  2G9D A;  2FT0 A;  3PRT A;  5CNP A;  2Z3L A;  3LWU A;  2FVG A;  2C6C A;  3NH5 A;  3LAC A;  1QST A;  4RS2 A;  2G3T A;  5H84 A;  4X5K A;  2EK9 A;  4KOX A;  4KOT A;  4UF4 A;  4OAE A;  4AB7 A;  5CBM A;  3VWD A;  2DF5 A;  4B10 A;  4A37 A;  1XF8 A;  4E8O A;  3B3V A;  2R98 A;  1HDQ A;  4A31 A;  2O4H A;  5LRG A;  2AE6 A;  2G0B A;  3FED A;  2CNM A;  2F7V A;  3W6X A;  4DJL A;  3TE4 A;  1Z2L A;  3BI0 A;  3N5F A;  4CAV A;  2PIZ A;  4P6Y A;  1CP6 A;  4KSF A;  4KOR A;  1IYK A;  2PJ0 A;  2GLF A;  4AVC A;  2P0W A;  2OR4 A;  4YU9 A;  4A38 A;  1YVO A;  3ISX A;  2ZEP A;  4XPD C;  2DXQ A;  3FB3 A;  3JTK A;  2HB6 A;  2PRQ A;  4B5P B;  5J8C A;  4CYN A;  4NGM A;  5ISV A;  2Z10 A;  3FJU A;  1H8L A;  4KOW A;  3SHP A;  2JDD A;  2Z3M A;  3T90 A;  4P44 A;  2D4O A;  4M85 A;  4CS0 B;  4C2Y A;  8CPA A;  2F8H A;  4BIN A;  2Q51 A;  2Z3P A;  5DWN A;  4CAE A;  5K8N A;  3WC5 A;  2VQY A;  2J8R A;  4FBE A;  3RO0 A;  2YNC A;  1XRY A;  2AFW A;  2EK8 A;  3B2Y A;  3FRM A;  3EO4 A;  3HLP A;  3KQX A;  2WPW A;  4M3S A;  5E96 A;  3S6G A;  4F8Z A;  1S3Z A;  3CZX A;  1Z8L A;  3KHX A;  4HKF A;  3DDD A;  3GKR A; 
#chains in the Genus database with same CATH homology
 3CT9 A;  2JBK A;  3S9M A;  3D4U A;  4A37 A;  4GM5 A;  4OC3 A;  4P4D A;  5ELY A;  1KWM A;  2PE3 A;  3KZW A;  5D29 A;  4MMO A;  2PJ2 A;  3IIB A;  2V8G A;  3WAB A;  3PFO A;  3SJE A;  3D7F A;  2EWB A;  1XBU A;  1F2O A;  3IEH A;  4P4E A;  1YW4 A;  2POK A;  4Q7A A;  2OOT A;  2PJ4 A;  3FEC A;  1F57 A;  4MCR A;  3D67 A;  2V8V A;  4PXC A;  2DEA A;  1VIX A;  2HC9 A;  1FNO A;  3IFE A;  1QQ9 A;  1GYT A;  2GLJ A;  3D68 A;  3B3C A;  3NFZ A;  3PB4 X;  5LRJ A;  3KR5 A;  1JQG A;  4MHP A;  5LRK A;  2PJ7 A;  2WZN A;  3SJF A;  3GUX A;  4OP4 A;  2QJ8 A;  4ZY0 A;  1DTD A;  4P4J A;  1CX8 A;  1Z5R A;  4OC1 A;  3IC1 A;  2GRE A;  3KR4 A;  4B6Z A;  2PCU A;  1LAN A;  1ZG9 A;  1ZLI A;  4JYW A;  1ARM A;  3K9T A;  1BPM A;  4X2T A;  3PB8 X;  1AMP A;  3FF3 A;  4R8F A;  3T8W A;  1TKF A;  4O23 A;  4ZYQ A;  1TKH A;  3WT4 A;  3B7I A;  4P4F A;  1YME A;  4EWT A;  4OID A;  3KI9 A;  2XEF A;  1BLL E;  4ONW A;  1Q7L A;  4PXB A;  4Z65 A;  2I3C A;  3IWW A;  1IGB A;  3CDX A;  3PB9 X;  3VH9 A;  3BXM A;  3PBE A;  3B3T A;  1TKJ A;  2PJC A;  2Q4Z A;  2V8D A;  4ZI6 A;  1VHO A;  2PJ8 A;  3D7G A;  1PYT B;  1CPS A;  1FT7 A;  4AXV A;  4R76 A;  2CF4 A;  6CPA A;  1TF9 A;  1TF8 A;  4MHY A;  2PVW A;  5HVF A;  2RB7 A;  4PXD A;  5LYI A;  3S9N A;  3MN8 A;  2PJ6 A;  1XJO A;  5THW A;  3B3S A;  1LOK A;  4EFD A;  1VHE A;  3PBB A;  2GU2 A;  2ZOG A;  3H8E A;  2ZOF A;  4A39 A;  1ELM P;  2AFX A;  5HVG A;  3D7H A;  3KHZ A;  5JM6 A;  3ISZ A;  3FEE A;  5IB9 A;  4MHN A;  4NGR A;  4LQG A;  2ZEF A;  4NJR A;  3RZA A;  3B35 A;  2VL1 A;  4RUH A;  2J9A A;  2Q43 A;  2BOA A;  2C6G A;  2CIJ A;  1YLO A;  3FVL A;  5I4M A;  3IO1 A;  1NSA A;  1HDU A;  4PXE A;  1RTQ A;  3B3W A;  3PB7 X;  4NGQ A;  4NGT A;  3KGQ A;  3RBU A;  2CTC A;  4IAV A;  4NGP A;  3V38 A;  2PJ1 A;  3D66 A;  4MRI A;  2XEI A;  4P45 A;  3VAT A;  2RFH A;  2PIY A;  4KSI A;  4X8I A;  3SI0 A;  5K8O A;  2V8H A;  3NH8 A;  2PJ9 A;  4MCQ A;  3BHX A;  2O53 A;  3JRU A;  3KQZ A;  5D8N A;  4ZX9 A;  1ELL P;  3VAR A;  3D7D A;  3L2N A;  2IQ6 A;  1BAV A;  4FUU A;  5LYL A;  1OBR A;  1LFW A;  1CP7 A;  4OME A;  7CPA A;  5DS0 A;  3PEI A;  4R6T A;  5F09 A;  3GLJ A;  1R3N A;  2AFS A;  2QVP A;  2ZEN A;  4P4I A;  2PJB A;  4G1P A;  2NSM A;  5J1Q A;  2PVV A;  2XEG A;  4P10 A;  1ARL A;  4MXU A;  2AFZ A;  1Y0R A;  2ABZ A;  4UEZ A;  2JBJ A;  2V77 A;  4OC0 A;  3FH4 A;  4CPA A;  2ZED A;  4ZX8 A;  1XFO A;  2WYR A;  2IJZ A;  3FMC A;  4K3N A;  1ZLH A;  3QNV A;  1F2P A;  3MRU A;  4DYO A;  1LCP A;  4WWV A;  4UIA A;  1UWY A;  4NGN A;  3H8F A;  1CPX A;  3CPA A;  3V7Z A;  4OC4 A;  1LAP A;  1ZG7 A;  4NGS A;  3RAM A;  4EME A;  2PJA A;  3HUV A;  4TWE A;  4W9Y A;  2JEW A;  4FWU A;  5JGF A;  1QMU A;  3SI2 A;  4NJQ A;  5LYD A;  3CPX A;  4IHM A;  4TNU A;  2IMO A;  3PFE A;  3H8G A;  4FAI A;  4OIW A;  3NH4 A;  3DLJ A;  5JH9 A;  1Y7E A;  1DE4 C;  2AFO A;  4MCS A;  4PPZ A;  3SJG A;  3GB0 A;  4OKO A;  3KAS A;  1TXR A;  1CBX A;  3BI1 A;  4NFR A;  1Y0Y A;  1YW6 A;  2QYV A;  3DGV A;  4UEE A;  3SJX A;  4F9V A;  1R43 A;  4YWY A;  2AFU A;  1HEE A;  3NA6 A;  4ZY2 A;  3PB6 X;  1EE3 P;  1PCA A;  3FX6 A;  4OC2 A;  2ZEE A;  4BD9 A;  2PJ3 A;  3IJ3 A;  4H2K A;  5K8M A;  4OC5 A;  3SI1 A;  3LMS A;  1YSJ A;  5HVH A;  2ZEL A;  2PJ5 A;  3K2K A;  5LYF A;  4P4B A;  3WC6 A;  5K8P A;  1AYE A;  2C6P A;  3KL9 A;  4R7M A;  4F9U A;  5HXD A;  2ZEO A;  4A94 A;  2ZEG A;  2ZEH A;  5CPA A;  1LAM A;  2C1C A;  3I1U A;  1BPN A;  1VGY A;  2CTB A;  1XMB A;  3S9L A;  4ZY1 A;  4MHZ A;  4DUK A;  1ZG8 A;  4UEF A;  4WJB A;  4PQA A;  2NYQ A;  2BO9 A;  1IY7 A;  3TC8 A;  4X3R A;  4IK2 A;  2ANP A;  3WC7 A;  2XEJ A;  4JZ0 A;  2ZEM A;  1M4L A;  3TX8 A;  2BCO A;  1CG2 A;  2AFM A;  4MCP A;  4UIB A;  2G9D A;  3PRT A;  3LWU A;  3NH5 A;  2FVG A;  2C6C A;  2EK9 A;  4UF4 A;  5CBM A;  3B3V A;  1HDQ A;  2O4H A;  5LRG A;  4DJL A;  3FED A;  2F7V A;  1Z2L A;  3BI0 A;  3N5F A;  2PIZ A;  4P6Y A;  1CP6 A;  2GLF A;  2PJ0 A;  4YU9 A;  2OR4 A;  4A38 A;  3ISX A;  2ZEP A;  2HB6 A;  2PRQ A;  4NGM A;  3FJU A;  1H8L A;  4P44 A;  8CPA A;  2F8H A;  2Q51 A;  5K8N A;  3WC5 A;  4FBE A;  1XRY A;  2AFW A;  2EK8 A;  3B2Y A;  3HLP A;  3KQX A;  4F8Z A;  1Z8L A;  3KHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...