3BLNA

Crystal structure of acetyltransferase gnat family (np_981174.1) from bacillus cereus atcc 10987 at 1.31 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
142
structure length
142
Chain Sequence
GMKNVTKASIDDLDSIVHIDIDVIGNDSRRNYIKHSIDEGRCVIVKEDNSISGFLTYDTNFFDCTFLSLIIVSPTKRRRGYASSLLSYMLSHSPTQKIFSSTNESNESMQKVFNANGFIRSGIVENLDEGDPEIIFYTKKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase GNAT family
publication title Crystal structure of acetyltransferase GNAT family (NP_981174.1) from Bacillus cereus ATCC 10987 at 1.31 A resolution
rcsb
source organism Bacillus cereus
total genus 40
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3blnA00
2PC1A 4CRZB 3P2HA 3ZZIA 4OAEA 2IL4A 4Y49C 3IWGA 1S7NA 2FE7A 4OLLA 2P6GA 1I21A 2J8MA 4R3LA 4KZTA 1NSLA 3S6KA 4MHDA 1R57A 1Z9UA 4OADA 1MJAA 1CJWA 4GS4A 2BL1A 4X5KA 3VWDA 1P4NA 5JQ4A 2ZW7A 2J8NA 5J8CA 1OZPA 4XNHB 2GE3A 1QSRA 4XPLA 3FRMA 2GANA 1BO4A 2ZW4A 4FD4A 3KKWA 1U6MA 4M3SA 4R87A 4AG7A 4MY0A 5EBVA 3I3GA 2HV2A 3TO9A 4AVCA 2Q4YA 2Q04A 3SXNA 3C26A 4M85A 5IX3A 4FD6A 3TO7A 4YRHA 3TOAA 4KVXA 1VHSA 4B5PA 2VBQA 4F0YA 3TO6A 4H6ZA 2B4DA 2OZGA 3FIXA 2ATRA 1K4JA 5C88A 2FIWA 2OB0A 3FYNA 4E8OA 1KUXA 3F0AA 3R96A 2JEVA 3I9SA 4KOVA 1B6BA 2ZXVA 2FCKA 3FB3A 4NXYA 4KOSA 2PDOA 2Q4VA 3CXPA 3K9UA 2QIRA 1MJ9A 2RC4A 2Y0MA 1RXTA 3BLNA 2OZHA 3DNSA 2VXKA 1VKCA 1LRZA 1SQHA 3V8IA 1XF8A 4H6UA 2Z11A 5F47A 2QMLA 1IIDA 3FBUA 4PK3A 3PP9A 1QSNA 1Q2YA 2AJ6A 2G3TA 2O28A 2B5GB 1M1DA 3EFAA 2CNMA 2FS5A 2AE6A 2PR1A 2VZZA 1WWZA 2P6EA 4MY3A 1YK3A 2REEA 3W6XA 4KOXA 4YFJA 5IV0A 3QB8A 4L89A 3MGDA 4JXRA 2ZPAA 2C27A 3TOBA 5KTAA 2X7BA 3UY5A 1YVKA 3F8KA 4CS0B 1Z4EA 4QB9A 1S7LA 1PUAA 3CXSA 1S7KA 3EY5A 1V0CA 2I79A 4KVOE 5HH1A 2FIAA 4Y49B 4IF5A 4JWPA 3ZJ0A 2PRBA 1KUVA 3W91A 2R8VA 4F6AA 2JDCA 1IYKA 4HNXB 3BJ8A 1Y7RA 1ON0A 4HNYB 3R95A 4UWJA 5I0CA 3S6GA 2VQYA 3G3SA 2DXQA 4R9MA 1I1DA 2WPXA 2R1IA 5E96A 4L8AA 2FT0A 4EVYA 4ZBGA 1BOBA 1Q2DA 1M4GA 3JUWA 1M4DA 3LD2A 1PU9A 4B5OA 1XEBA 2OZUA 2PR8A 3TCVA 1RO5A 3S6FA 3EO4A 4IUSA 4J3GA 2ZW5A 2FSRA 1YR0A 4XPDC 1S5KA 3FXTA 2F5IA 2Q0YA 2BEIA 4ONUA 3SXOA 1YLEA 2A4NA 1MK4A 1CM0A 4JLYA 5DWMA 4KLWA 4B5PB 3OWCA 3TTHA 3WR7A 2CNTA 4MJ8A 3F5BA 4KOUA 2B4DB 4QC6A 4CRYB 4KUBA 2HUZA 1Z4RA 2VEZA 4HKFA 3BJ7A 4NCZA 1YX0A 4KUAA 4PSXA 2OH1A 2Q44A 5FVJA 2ZW6A 1XE4A 4CAWA 2NMTA 3IGRA 4II9A 3P2FA 4UWIA 1FY7A 1J4JA 2KCWA 4AVBA 2G3AA 3TE4A 5KTDA 1Y9WA 2J8RA 5F49A 2R7HA 2JDDA 4KORA 1S3ZA 1N71A 2OU2A 3SHPA 4JXQA 4DNCA 3W6SA 1S60A 4LX9A 3D2MA 3PZJA 4BMHA 2VI7A 3EC4A 1YVOA 2Z10A 2B58A 3H4QA 4FD5A 4NEXA 3T90A 1IICA 2Z0ZA 1I12A 3B8GA 4MBUA 4NF1A 2BSWA 1L0CA 3GKRA 2VZYA 4R57A 4AB7A 4AG9A 5F48A 1MJBA 4XNHC 2FXFA 2P6FA 4HNWB 1KZFA 1B87A 4PV6A 3R9FA 1IB1E 3TFYA 3JVNA 5H86A 3R1KA 1QSTA 2ARHA 3GY9A 2B4BA 2GIVA 3DDDA 3CXQA 2K5TA 2EVNA 2CY2A 1IYLA 2Q7BA 1M4IA 4PK2A 4U9YA 3FNCA 2WPWA 4QVTA 4KOWA 3TT2A 2CNSA 4KOYA 4E0AA 1WK4A 5KTCA 4KVME 1XIXA 2G0BA 4QUSA 4U5YA 4R3KA 1QSOA 1UFHA 4PSWA 1NMTA 3D2PA 5CNPA 3GYAA 4CAVA 4NSQA 5EC4A 4I49A 2PSWA 2D4PA 3LODA 3D3SA 5J8FA 4XPDB 4RI1A 4QBJA 4K30A 4UBRA 1GHEA 1Q2CA 2PQ8A 5GCNA 3PGPA 2HQYA 4CAXA 2EUIA 3QAHA 3DR6A 1XMTA 3S6HA 5F46A 5HMNA 4E2AA 3T9YA 2P0WA 1KUYA 3E0KA 5C82A 4FD7A 4U9ZA 1YREA 2B5GA 1YGHA 4JJXA 2D4OA 3DSBA 3D8PA 4H89A 2JLMA 1NE9A 1QSMA 2BUEA 3R9EA 3VWEA 4KOTA 2QECA 4XPKA 2FL4A 4YGOA 1M44A 3RYOA 4MI4A 3N7ZA 3R9GA 4KLVA 5H84A 4AVAA 3DR8A 2I00A 3NE7A 4LUAA 2H5MA 5IB0A 4UA3A 3G8WA 1S7FA 3EXNA 4ORFA 1Y9KA 5JPHA 2B3UA 2REFA 5ISVA 2R98A 1TIQA 2B3VA 5DWNA 4JD6A 4RS2A 1P0HA
chains in the Genus database with same CATH superfamily
3GLJA 2PC1A 4CRZB 3P2HA 3ZZIA 4OAEA 2PVVA 2EK8A 2IL4A 1X10A 3HUVA 4Y49C 3IWGA 1S7NA 2FE7A 4OLLA 5THWA 2OOTA 2P6GA 4A30A 1I21A 2J8MA 4R3LA 4R6TA 3RBUA 4KZTA 1NSLA 3S6KA 3PB9X 3KR4A 2V8VA 4MHDA 1R57A 1Z9UA 2PJ6A 1MJAA 3BHXA 4OADA 2AFXA 1CJWA 1Q7LA 2PRQA 4GS4A 2BL1A 4X5KA 3VWDA 2PIZA 4OC3A 4ZX9A 3VH9A 1P4NA 4YWYA 5JQ4A 4JZ0A 4A2ZA 2ZW7A 4K3NA 2J8NA 1IGBA 5J8CA 1OZPA 1F2PA 1LCPA 2GLFA 2IMOA 4NGTA 2GE3A 1YSJA 4PPZA 1QSRA 2DPSA 4XNHB 1XFOA 3FX6A 4P44A 2ODFA 5F09A 4XPLA 5D8NA 3FRMA 2GANA 1BO4A 2ZW4A 5HVFA 4FD4A 3KKWA 1OBRA 1U6MA 1BLLE 1HEEA 4M3SA 4R87A 4AG7A 4A39A 4CYQA 4MY0A 4MFQA 4KSIA 5EBVA 5G1ZA 3I3GA 1CP6A 2HV2A 1JWQA 3TO9A 1LAMA 2EWBA 1AYEA 1R3NA 4AVCA 2AFSA 2PJ7A 2Q4YA 3VATA 2Q04A 5LRJA 1QQ9A 2I3CA 3C26A 3SXNA 5JM6A 4CGPA 4M85A 5IX3A 2IJZA 3SI0A 2AFOA 4FD6A 3TO7A 6CPAA 3KZWA 4YRHA 4OC5A 3TOAA 4KVXA 4M6HA 1VHSA 4B5PA 2VBQA 4AXVA 3FF3A 2NYQA 4MCRA 4F0YA 3TO6A 2EO8A 1GYTA 2ZEEA 4TNUA 4H6ZA 4UCPA 3MRUA 3RO0A 4P4DA 2B4DA 2OZGA 2PVWA 1QMUA 3FIXA 3SJEA 2ATRA 1K4JA 4A94A 5C88A 1ELMP 1XJOA 2FIWA 2OB0A 3FYNA 4E8OA 3D7DA 1KUXA 3F0AA 3R96A 3DGVA 2JEVA 2GREA 3D67A 4F9UA 3I9SA 4KOVA 1B6BA 2ZXVA 1LAPA 2FCKA 3FB3A 4NXYA 4CYPA 5CBMA 2BOAA 4KOSA 2PDOA 3D7FA 1ZLIA 5K8OA 2PJAA 2HC9A 2Q4VA 2QIRA 3CXPA 3K9UA 1MJ9A 3ISZA 2PJ4A 3CPAA 2RC4A 2Y0MA 4C2XA 4DYOA 5D29A 1RXTA 3BLNA 4ZY2A 2OZHA 4MCSA 3D4UA 3DNSA 2VXKA 1VKCA 1LRZA 1SQHA 4P4BA 3V8IA 4MRIA 1XF8A 2BO9A 4H6UA 2Z11A 5F47A 3IWWA 2QMLA 4A37A 4ZGYB 1IIDA 3FBUA 2V77A 2CTCA 4PK3A 2CXAA 1BPMA 3PEIA 3PP9A 3QAYA 1VIXA 1Z2LA 2POKA 1QSNA 1Q2YA 1Y7EA 2AJ6A 2G3TA 2O28A 2B5GB 1M1DA 2ZOGA 3D7HA 2ZEDA 3EFAA 4Z65A 2YGWA 2CNMA 2FS5A 2AE6A 4C2ZA 2PR1A 1YMEA 4ONWA 2VZZA 1WWZA 2P6EA 2ANPA 4MMOA 1YK3A 4MY3A 3HLPA 2REEA 3W6XA 4KOXA 4YFJA 4NGNA 5IV0A 3WC5A 3QB8A 1X12A 4L89A 3NH4A 1XBUA 4OC0A 2O53A 3MGDA 3IIBA 1PCAA 4JXRA 5HVGA 4UEZA 2WUUA 2ZPAA 4UFXA 1YLOA 2C27A 4CPAA 3B35A 3TOBA 3V38A 5KTAA 2X7BA 1Z5RA 3UY5A 2G9DA 4UFWA 3B3VA 1YVKA 4NFRA 3F8KA 4ZY0A 4PXCA 4CS0B 4WWVA 4BD9A 2PJ3A 4NJQA 5CPAA 1Z8XA 1Z4EA 5G21A 4QB9A 3IC1A 1S7LA 4IAVA 1PUAA 1DE4C 2Z3PA 1Z8LA 1Y0RA 3CXSA 1S7KA 3EY5A 1IOIA 3S9NA 1V0CA 2I79A 4KVOE 5HH1A 2CTBA 2FIAA 4O23A 1NSAA 2Q7SA 4MHNA 4IF5A 4JWPA 4Y49B 3ZJ0A 4CGOA 2PRBA 1KUVA 1ZG8A 2PJ1A 4R76A 4NGRA 2R8VA 3NH5A 3W91A 5G22A 2RB7A 4P6YA 4F6AA 2JDCA 2GLJA 1IYKA 4HNXB 2F7VA 2VL1A 2FVGA 3ISXA 3BJ8A 1Y7RA 2V8HA 1ON0A 1CBXA 4HNYB 4UEEA 4ZX8A 4UWJA 3R95A 2Q51A 3H8EA 5I0CA 5A27A 4P4EA 1TKFA 3S6GA 1IU8A 2VQYA 3G3SA 2DXQA 4OC2A 4B6ZA 4CGNA 4R9MA 1I1DA 1ZG7A 2R1IA 2WPXA 1TKJA 5E96A 2ABZA 4L8AA 4NGSA 2FT0A 4B14A 4JYWA 3PBBA 4H2KA 4EVYA 1AMPA 1BOBA 4ZBGA 3LMSA 1Q2DA 2PE3A 1M4GA 2IQ6A 3JUWA 8CPAA 2AFZA 1M4DA 3LD2A 4P4IA 1PU9A 1TF9A 4PQAA 4B5OA 2DEAA 4CYNA 1XEBA 3RNZA 2ZOFA 3FECA 2OZUA 1YW4A 2PR8A 2NSMA 2WZNA 3TCVA 1RO5A 3S6FA 3EO4A 3NA6A 3IWEA 3CZXA 4IUSA 3B3TA 2YNCA 4J3GA 4KS9A 4OC4A 2ZW5A 2FSRA 2QYVA 4FBEA 1YR0A 2AFMA 4XPDC 5LYLA 1S5KA 2Z3NA 4EFDA 3FXTA 1XOVA 2F5IA 2O4HA 2Q0YA 3D66A 2BEIA 4EMEA 3FEDA 5I4MA 3KL9A 4ONUA 3SXOA 4Q38A 1YLEA 2WYRA 1LANA 2A4NA 1MK4A 2PJ9A 3K9TA 4HPSA 4EWTA 2Z3MA 1CM0A 4JLYA 4P4JA 4UFVA 4CGLA 5DWMA 2V8GA 3IU1A 4KLWA 4MHZA 4B5PB 4CGMA 3IU2A 2ZEMA 2C6CA 3PB8X 1Y0YA 3OWCA 3PB4X 3TTHA 4KSAA 3NH8A 1LFWA 4BBHA 2Z3OA 3WR7A 4F9VA 1EE3P 2CNTA 1CG2A 4MJ8A 3F5BA 1XMBA 2AFWA 4KOUA 1CPXA 2B4DB 3FEEA 4TWEA 4A33A 5K8PA 2ZEFA 2Z3LA 1VGYA 4QC6A 4CRYB 2Q43A 2V8DA 3SJFA 4ZYQA 4P4FA 2RFHA 4KUBA 2HUZA 1Z4RA 1M4LA 4B11A 2VEZA 4HKFA 3BJ7A 1LOKA 3NE8A 4M6GA 4OC1A 4NGPA 3VARA 4OKOA 3PB6X 4P45A 5AG6A 4CAEA 4NCZA 1YX0A 3B2YA 4KUAA 4PSXA 2OH1A 5LYFA 2Q44A 5FVJA 2ZW6A 1HDQA 1XE4A 2XEFA 4MFLA 3K2KA 3S9LA 4CAWA 4MFPA 1ARMA 2NMTA 3PFOA 4LQ6A 4NGQA 3IGRA 1CP7A 4UF4A 4II9A 3P2FA 2PJCA 4MFKA 4UWIA 1FY7A 5LRKA 4C68A 1J4JA 2KCWA 4Q7AA 4AVBA 1CPSA 2G3AA 3H8FA 3MN8A 7CPAA 4X3RA 3TE4A 5KTDA 2YNEA 2JBJA 1Y9WA 2J8RA 1DTDA 5AG4A 5F49A 2R7HA 2JDDA 4KORA 4G1PA 1S3ZA 3D7GA 1N71A 1IY7A 2OU2A 3SHPA 2C6GA 3B3SA 4A95A 5HXDA 3BI1A 4JXQA 3RZAA 4DNCA 3W6SA 3FVLA 1S60A 4LX9A 4R7MA 1BAVA 3D2MA 3IO1A 3PZJA 4FUUA 3DLJA 4BMHA 2VI7A 1FT7A 3EC4A 4MFZA 1YVOA 2Z10A 2QJ8A 1JQGA 1KWMA 1XRYA 2B58A 3JRUA 4B10A 3H4QA 4FD5A 4BINA 1ZG9A 5A28A 4UIAA 5K8NA 4PXBA 4NEXA 5JH9A 1YW6A 3T90A 1IICA 2Z0ZA 1I12A 3B8GA 4MBUA 4NF1A 2BSWA 2XEIA 4GXHA 4A31A 1L0CA 4PXEA 3H5ZA 3KHZA 4OP4A 3GKRA 2VZYA 4R57A 4AB7A 4AG9A 2C6PA 2ZEGA 1PYTB 5LRGA 2JEWA 5F48A 1MJBA 4XNHC 2FXFA 3PBEA 1AUGA 3GIUA 2P6FA 4HNWB 1KZFA 1B87A 4MCQA 3L2NA 4MXUA 5AG7A 4PV6A 3WC7A 3R9FA 5K8MA 1IB1E 3TFYA 3SI1A 3PFEA 3JVNA 5H86A 4FWUA 1H8LA 3R1KA 2PJ5A 1QSTA 2ARHA 5LYDA 2QVPA 2EK9A 2B4BA 3GY9A 3KQXA 1VHEA 2GIVA 3IEHA 3DDDA 2EBJA 3LACA 4C7IA 3I1UA 1TF8A 4MHYA 2XEJA 3CXQA 1TKHA 2K5TA 2EVNA 2CY2A 4ZY1A 2CF4A 1IYLA 1HDUA 4KSFA 5AGEA 2Q7BA 5BWAB 1M4IA 4PK2A 3H8GA 3FJUA 3FNCA 1VHOA 2GU2A 2WPWA 4QVTA 4KOWA 4RN7A 3JTKA 4U9YA 3CPXA 4UIBA 3B3WA 2Q4ZA 3TT2A 2CNSA 3BI0A 4KOYA 3WABA 3S9MA 1A2ZA 3PB7X 4E0AA 2OR4A 3KHXA 5J1QA 1WK4A 5KTCA 4KVME 3WC6A 3KGQA 1YQEA 1XIXA 2G0BA 4QUSA 4U5YA 2YNCC 1F57A 4R3KA 2BCOA 4A32A 1ZO0A 1QSOA 5IB9A 1BPNA 1UFHA 1NMTA 2PIYA 3D2PA 4PSWA 3KI9A 5CNPA 3V7ZA 2ZEHA 4LQGA 3GYAA 4CAVA 4B13A 4NSQA 5EC4A 4I49A 2PSWA 4UCNA 3QNVA 5EMIA 2D4PA 3LODA 3D3SA 5J8FA 4XPDB 4W9YA 4MCPA 3T8WA 4RI1A 4B12A 4DUKA 2ZELA 2C1CA 3GUXA 2PJ8A 1FNOA 2PCUA 4QBJA 3SJXA 1UWYA 4K30A 2ZEPA 1GHEA 4UBRA 1Q2CA 2PQ8A 2YNDA 5GCNA 3PGPA 2HQYA 4CAXA 4A38A 1IOFA 2EUIA 2JBKA 3QAHA 4OIWA 4WJBA 3DR6A 1XMTA 3S6HA 3TC8A 2DF5A 5F46A 5HMNA 2PJ0A 2ZEOA 4E2AA 4YU9A 3SI2A 2P0WA 3T9YA 1KUYA 2J9AA 3E0KA 3LWUA 2XEGA 3WT4A 5C82A 3KASA 3IJ3A 4FD7A 4U9ZA 2WSAA 4C7HA 2PJ2A 1YREA 2B5GA 2CIJA 1YGHA 4IK2A 4JJXA 3KR5A 3TX8A 4MFJA 2D4OA 3DSBA 3BXMA 2GFQA 4NJRA 4PXDA 1TXRA 3D8PA 4H89A 3D68A 2JLMA 1ELLP 1NE9A 3B3CA 5HVHA 1QSMA 1RTQA 4P10A 3A9LA 1ZLHA 2BUEA 3R9EA 3VWEA 4KOTA 2QECA 4UCMA 3CDXA 4XPKA 1Z8WA 5DS0A 3KQZA 4GM5A 4OMEA 4CYOA 4ZI6A 2FL4A 4YGOA 1M44A 3RYOA 4F8ZA 5LYIA 4UEFA 2Z3KA 4OIDA 4MI4A 4X8IA 3N7ZA 1R43A 4M6IA 3R9GA 3FH4A 4CAFA 4KLVA 4NGMA 5H84A 4RUHA 4AVAA 2PJBA 2I00A 3DR8A 3GB0A 4MHPA 4F0XA 3NE7A 4LUAA 4X2TA 5G20A 4R8FA 2H5MA 3IFEA 5IB0A 1Z8TA 3SJGA 4UA3A 3G8WA 3NFZA 4Q36A 1S7FA 1CX8A 3EXNA 4ORFA 2AFUA 3RAMA 5JGFA 3FMCA 1Y9KA 5JPHA 2B3UA 4IHMA 2REFA 5ISVA 4FAIA 2R98A 1TIQA 5AG5A 2B3VA 5ELYA 5DWNA 2DPTA 3B7IA 3PRTA 2ZENA 2HB6A 3CT9A 2F8HA 4DJLA 1F2OA 4JD6A 4C2YA 1ARLA 3N5FA 4RS2A 1P0HA
chains in the Genus database with same CATH topology
2PC1A 4CRZB 3P2HA 3ZZIA 4OAEA 2IL4A 4Y49C 3IWGA 1S7NA 2FE7A 4OLLA 2P6GA 4A30A 1I21A 2J8MA 4R3LA 4KZTA 1NSLA 3S6KA 4MHDA 1R57A 1Z9UA 4OADA 1MJAA 1CJWA 4GS4A 2BL1A 4X5KA 3VWDA 1P4NA 5JQ4A 4A2ZA 2ZW7A 2J8NA 5J8CA 1OZPA 4XNHB 4BBHA 2GE3A 1QSRA 2DPSA 4XPLA 3FRMA 2GANA 1BO4A 2ZW4A 4FD4A 3KKWA 1U6MA 4M3SA 4R87A 4AG7A 4CYQA 4MY0A 4MFQA 5EBVA 5G1ZA 3I3GA 2HV2A 3TO9A 4AVCA 2Q4YA 2Q04A 3SXNA 3C26A 4CGPA 4M85A 5IX3A 4FD6A 3TO7A 4YRHA 3TOAA 4KVXA 1VHSA 4B5PA 2VBQA 4F0YA 3TO6A 4H6ZA 4UCPA 2B4DA 2OZGA 3FIXA 2ATRA 1K4JA 5C88A 2FIWA 2OB0A 3FYNA 4E8OA 1KUXA 3F0AA 3R96A 2JEVA 3I9SA 4KOVA 1B6BA 2ZXVA 2FCKA 3FB3A 4NXYA 4CYPA 4KOSA 2PDOA 2Q4VA 3CXPA 3K9UA 2QIRA 1MJ9A 4C2XA 2RC4A 2Y0MA 1RXTA 3BLNA 2OZHA 3DNSA 2VXKA 1VKCA 1LRZA 1SQHA 3V8IA 1XF8A 4H6UA 2Z11A 5F47A 4ZGYB 2QMLA 1IIDA 3FBUA 4PK3A 2CXAA 3PP9A 1QSNA 1Q2YA 2AJ6A 2G3TA 2O28A 2B5GB 1M1DA 3EFAA 2YGWA 2CNMA 2FS5A 2AE6A 4C2ZA 2PR1A 2VZZA 1WWZA 2P6EA 4MY3A 1YK3A 2REEA 3W6XA 4KOXA 4YFJA 5IV0A 3QB8A 4L89A 3MGDA 4JXRA 2WUUA 2ZPAA 4UFXA 2C27A 3TOBA 5KTAA 2X7BA 3UY5A 4UFWA 1YVKA 3F8KA 4CS0B 1Z4EA 5G21A 4QB9A 1S7LA 1PUAA 2Z3PA 3CXSA 1S7KA 3EY5A 1V0CA 2I79A 4KVOE 5HH1A 2FIAA 4Y49B 4IF5A 4JWPA 3ZJ0A 4CGOA 2PRBA 1KUVA 3W91A 2R8VA 5G22A 4F6AA 2JDCA 1IYKA 4HNXB 3BJ8A 1Y7RA 1ON0A 4HNYB 3R95A 4UWJA 5I0CA 5A27A 3S6GA 2VQYA 3G3SA 2DXQA 4CGNA 4R9MA 1I1DA 2WPXA 2R1IA 5E96A 4L8AA 2FT0A 4B14A 4EVYA 4ZBGA 1BOBA 1Q2DA 1M4GA 3JUWA 1M4DA 3LD2A 1PU9A 4B5OA 4CYNA 1XEBA 2OZUA 2PR8A 3TCVA 1RO5A 3S6FA 3EO4A 3IWEA 4IUSA 2YNCA 4J3GA 4KS9A 2ZW5A 2FSRA 1YR0A 4XPDC 1S5KA 2Z3NA 3FXTA 2F5IA 2Q0YA 2BEIA 4ONUA 3SXOA 4Q38A 1YLEA 2A4NA 1MK4A 2Z3MA 1CM0A 4JLYA 4UFVA 4CGLA 5DWMA 3IU1A 4KLWA 4B5PB 4CGMA 3IU2A 3OWCA 3TTHA 4KSAA 2Z3OA 3WR7A 2CNTA 4MJ8A 3F5BA 4KOUA 4A33A 2B4DB 2Z3LA 4QC6A 4CRYB 4KUBA 2HUZA 1Z4RA 4B11A 2VEZA 4HKFA 3BJ7A 5AG6A 4CAEA 4NCZA 1YX0A 4KUAA 4PSXA 2OH1A 2Q44A 5FVJA 2ZW6A 1XE4A 4MFLA 4CAWA 4MFPA 2NMTA 3IGRA 4II9A 3P2FA 4MFKA 4UWIA 1FY7A 4C68A 1J4JA 2KCWA 4AVBA 2G3AA 3TE4A 5KTDA 2YNEA 1Y9WA 2J8RA 5AG4A 5F49A 2R7HA 2JDDA 4KORA 1S3ZA 1N71A 2OU2A 3SHPA 4A95A 4JXQA 4DNCA 3W6SA 1S60A 4LX9A 3D2MA 3PZJA 4BMHA 2VI7A 3EC4A 4MFZA 1YVOA 2Z10A 4B10A 2B58A 3H4QA 4FD5A 5A28A 4NEXA 3T90A 1IICA 2Z0ZA 1I12A 3B8GA 4MBUA 4NF1A 2BSWA 4A31A 1L0CA 3H5ZA 3GKRA 2VZYA 4R57A 4AB7A 4AG9A 5F48A 1MJBA 4XNHC 2FXFA 2P6FA 4HNWB 1KZFA 1B87A 5AG7A 4PV6A 3R9FA 1IB1E 3TFYA 3JVNA 5H86A 3R1KA 1QSTA 2ARHA 3GY9A 2B4BA 2GIVA 3DDDA 4C7IA 3CXQA 2K5TA 2EVNA 2CY2A 1IYLA 4KSFA 5AGEA 2Q7BA 5BWAB 1M4IA 4PK2A 4U9YA 3FNCA 2WPWA 4QVTA 4KOWA 3JTKA 3TT2A 2CNSA 4KOYA 4E0AA 1WK4A 5KTCA 4KVME 1XIXA 2G0BA 4QUSA 4U5YA 2YNCC 4R3KA 4A32A 1ZO0A 1QSOA 1UFHA 4PSWA 1NMTA 3D2PA 5CNPA 3GYAA 4CAVA 4B13A 4NSQA 5EC4A 4I49A 2PSWA 4UCNA 2D4PA 3LODA 3D3SA 5J8FA 4XPDB 4RI1A 4B12A 4QBJA 4K30A 4UBRA 1GHEA 1Q2CA 2PQ8A 2YNDA 5GCNA 3PGPA 2HQYA 4CAXA 2EUIA 3QAHA 3DR6A 1XMTA 3S6HA 5F46A 5HMNA 4E2AA 3T9YA 2P0WA 1KUYA 3E0KA 5C82A 4FD7A 4U9ZA 2WSAA 4C7HA 1YREA 2B5GA 1YGHA 4JJXA 4MFJA 2D4OA 3DSBA 3D8PA 4H89A 2JLMA 1NE9A 1QSMA 3A9LA 2BUEA 3R9EA 3VWEA 4KOTA 2QECA 4UCMA 4XPKA 4CYOA 2FL4A 4YGOA 1M44A 3RYOA 2Z3KA 4MI4A 3N7ZA 3R9GA 4CAFA 4KLVA 5H84A 4AVAA 3DR8A 2I00A 4F0XA 3NE7A 4LUAA 5G20A 2H5MA 5IB0A 4UA3A 3G8WA 4Q36A 1S7FA 3EXNA 4ORFA 1Y9KA 5JPHA 2B3UA 2REFA 5ISVA 2R98A 1TIQA 5AG5A 2B3VA 5DWNA 2DPTA 4JD6A 4C2YA 4RS2A 1P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PC1 A;  4CRZ B;  3P2H A;  3ZZI A;  4OAE A;  2IL4 A;  4Y49 C;  3IWG A;  1S7N A;  2FE7 A;  4OLL A;  2P6G A;  1I21 A;  2J8M A;  4R3L A;  4KZT A;  1NSL A;  3S6K A;  4MHD A;  1R57 A;  1Z9U A;  4OAD A;  1MJA A;  1CJW A;  4GS4 A;  2BL1 A;  4X5K A;  3VWD A;  1P4N A;  5JQ4 A;  2ZW7 A;  2J8N A;  5J8C A;  1OZP A;  4XNH B;  2GE3 A;  1QSR A;  4XPL A;  3FRM A;  2GAN A;  1BO4 A;  2ZW4 A;  4FD4 A;  3KKW A;  1U6M A;  4M3S A;  4R87 A;  4AG7 A;  4MY0 A;  5EBV A;  3I3G A;  2HV2 A;  3TO9 A;  4AVC A;  2Q4Y A;  2Q04 A;  3SXN A;  3C26 A;  4M85 A;  5IX3 A;  4FD6 A;  3TO7 A;  4YRH A;  3TOA A;  4KVX A;  1VHS A;  4B5P A;  2VBQ A;  4F0Y A;  3TO6 A;  4H6Z A;  2B4D A;  2OZG A;  3FIX A;  2ATR A;  1K4J A;  5C88 A;  2FIW A;  2OB0 A;  3FYN A;  4E8O A;  1KUX A;  3F0A A;  3R96 A;  2JEV A;  3I9S A;  4KOV A;  1B6B A;  2ZXV A;  2FCK A;  3FB3 A;  4NXY A;  4KOS A;  2PDO A;  2Q4V A;  3CXP A;  3K9U A;  2QIR A;  1MJ9 A;  2RC4 A;  2Y0M A;  1RXT A;  3BLN A;  2OZH A;  3DNS A;  2VXK A;  1VKC A;  1LRZ A;  1SQH A;  3V8I A;  1XF8 A;  4H6U A;  2Z11 A;  5F47 A;  2QML A;  1IID A;  3FBU A;  4PK3 A;  3PP9 A;  1QSN A;  1Q2Y A;  2AJ6 A;  2G3T A;  2O28 A;  2B5G B;  1M1D A;  3EFA A;  2CNM A;  2FS5 A;  2AE6 A;  2PR1 A;  2VZZ A;  1WWZ A;  2P6E A;  4MY3 A;  1YK3 A;  2REE A;  3W6X A;  4KOX A;  4YFJ A;  5IV0 A;  3QB8 A;  4L89 A;  3MGD A;  4JXR A;  2ZPA A;  2C27 A;  3TOB A;  5KTA A;  2X7B A;  3UY5 A;  1YVK A;  3F8K A;  4CS0 B;  1Z4E A;  4QB9 A;  1S7L A;  1PUA A;  3CXS A;  1S7K A;  3EY5 A;  1V0C A;  2I79 A;  4KVO E;  5HH1 A;  2FIA A;  4Y49 B;  4IF5 A;  4JWP A;  3ZJ0 A;  2PRB A;  1KUV A;  3W91 A;  2R8V A;  4F6A A;  2JDC A;  1IYK A;  4HNX B;  3BJ8 A;  1Y7R A;  1ON0 A;  4HNY B;  3R95 A;  4UWJ A;  5I0C A;  3S6G A;  2VQY A;  3G3S A;  2DXQ A;  4R9M A;  1I1D A;  2WPX A;  2R1I A;  5E96 A;  4L8A A;  2FT0 A;  4EVY A;  4ZBG A;  1BOB A;  1Q2D A;  1M4G A;  3JUW A;  1M4D A;  3LD2 A;  1PU9 A;  4B5O A;  1XEB A;  2OZU A;  2PR8 A;  3TCV A;  1RO5 A;  3S6F A;  3EO4 A;  4IUS A;  4J3G A;  2ZW5 A;  2FSR A;  1YR0 A;  4XPD C;  1S5K A;  3FXT A;  2F5I A;  2Q0Y A;  2BEI A;  4ONU A;  3SXO A;  1YLE A;  2A4N A;  1MK4 A;  1CM0 A;  4JLY A;  5DWM A;  4KLW A;  4B5P B;  3OWC A;  3TTH A;  3WR7 A;  2CNT A;  4MJ8 A;  3F5B A;  4KOU A;  2B4D B;  4QC6 A;  4CRY B;  4KUB A;  2HUZ A;  1Z4R A;  2VEZ A;  4HKF A;  3BJ7 A;  4NCZ A;  1YX0 A;  4KUA A;  4PSX A;  2OH1 A;  2Q44 A;  5FVJ A;  2ZW6 A;  1XE4 A;  4CAW A;  2NMT A;  3IGR A;  4II9 A;  3P2F A;  4UWI A;  1FY7 A;  1J4J A;  2KCW A;  4AVB A;  2G3A A;  3TE4 A;  5KTD A;  1Y9W A;  2J8R A;  5F49 A;  2R7H A;  2JDD A;  4KOR A;  1S3Z A;  1N71 A;  2OU2 A;  3SHP A;  4JXQ A;  4DNC A;  3W6S A;  1S60 A;  4LX9 A;  3D2M A;  3PZJ A;  4BMH A;  2VI7 A;  3EC4 A;  1YVO A;  2Z10 A;  2B58 A;  3H4Q A;  4FD5 A;  4NEX A;  3T90 A;  1IIC A;  2Z0Z A;  1I12 A;  3B8G A;  4MBU A;  4NF1 A;  2BSW A;  1L0C A;  3GKR A;  2VZY A;  4R57 A;  4AB7 A;  4AG9 A;  5F48 A;  1MJB A;  4XNH C;  2FXF A;  2P6F A;  4HNW B;  1KZF A;  1B87 A;  4PV6 A;  3R9F A;  1IB1 E;  3TFY A;  3JVN A;  5H86 A;  3R1K A;  1QST A;  2ARH A;  3GY9 A;  2B4B A;  2GIV A;  3DDD A;  3CXQ A;  2K5T A;  2EVN A;  2CY2 A;  1IYL A;  2Q7B A;  1M4I A;  4PK2 A;  4U9Y A;  3FNC A;  2WPW A;  4QVT A;  4KOW A;  3TT2 A;  2CNS A;  4KOY A;  4E0A A;  1WK4 A;  5KTC A;  4KVM E;  1XIX A;  2G0B A;  4QUS A;  4U5Y A;  4R3K A;  1QSO A;  1UFH A;  4PSW A;  1NMT A;  3D2P A;  5CNP A;  3GYA A;  4CAV A;  4NSQ A;  5EC4 A;  4I49 A;  2PSW A;  2D4P A;  3LOD A;  3D3S A;  5J8F A;  4XPD B;  4RI1 A;  4QBJ A;  4K30 A;  4UBR A;  1GHE A;  1Q2C A;  2PQ8 A;  5GCN A;  3PGP A;  2HQY A;  4CAX A;  2EUI A;  3QAH A;  3DR6 A;  1XMT A;  3S6H A;  5F46 A;  5HMN A;  4E2A A;  3T9Y A;  2P0W A;  1KUY A;  3E0K A;  5C82 A;  4FD7 A;  4U9Z A;  1YRE A;  2B5G A;  1YGH A;  4JJX A;  2D4O A;  3DSB A;  3D8P A;  4H89 A;  2JLM A;  1NE9 A;  1QSM A;  2BUE A;  3R9E A;  3VWE A;  4KOT A;  2QEC A;  4XPK A;  2FL4 A;  4YGO A;  1M44 A;  3RYO A;  4MI4 A;  3N7Z A;  3R9G A;  4KLV A;  5H84 A;  4AVA A;  3DR8 A;  2I00 A;  3NE7 A;  4LUA A;  2H5M A;  5IB0 A;  4UA3 A;  3G8W A;  1S7F A;  3EXN A;  4ORF A;  1Y9K A;  5JPH A;  2B3U A;  2REF A;  5ISV A;  2R98 A;  1TIQ A;  2B3V A;  5DWN A;  4JD6 A;  4RS2 A;  1P0H A; 
#chains in the Genus database with same CATH topology
 3GLJ A;  2PC1 A;  4CRZ B;  3P2H A;  3ZZI A;  4OAE A;  2PVV A;  2EK8 A;  2IL4 A;  1X10 A;  3HUV A;  4Y49 C;  3IWG A;  1S7N A;  2FE7 A;  4OLL A;  5THW A;  2OOT A;  2P6G A;  4A30 A;  1I21 A;  2J8M A;  4R3L A;  4R6T A;  3RBU A;  4KZT A;  1NSL A;  3S6K A;  3PB9 X;  3KR4 A;  2V8V A;  4MHD A;  1R57 A;  1Z9U A;  2PJ6 A;  1MJA A;  3BHX A;  4OAD A;  2AFX A;  1CJW A;  1Q7L A;  2PRQ A;  4GS4 A;  2BL1 A;  4X5K A;  3VWD A;  2PIZ A;  4OC3 A;  4ZX9 A;  3VH9 A;  1P4N A;  4YWY A;  5JQ4 A;  4JZ0 A;  4A2Z A;  2ZW7 A;  4K3N A;  2J8N A;  1IGB A;  5J8C A;  1OZP A;  1F2P A;  1LCP A;  2GLF A;  2IMO A;  4NGT A;  2GE3 A;  1YSJ A;  4PPZ A;  1QSR A;  2DPS A;  4XNH B;  1XFO A;  3FX6 A;  4P44 A;  2ODF A;  5F09 A;  4XPL A;  5D8N A;  3FRM A;  2GAN A;  1BO4 A;  2ZW4 A;  5HVF A;  4FD4 A;  3KKW A;  1OBR A;  1U6M A;  1BLL E;  1HEE A;  4M3S A;  4R87 A;  4AG7 A;  4A39 A;  4CYQ A;  4MY0 A;  4MFQ A;  4KSI A;  5EBV A;  5G1Z A;  3I3G A;  1CP6 A;  2HV2 A;  1JWQ A;  3TO9 A;  1LAM A;  2EWB A;  1AYE A;  1R3N A;  4AVC A;  2AFS A;  2PJ7 A;  2Q4Y A;  3VAT A;  2Q04 A;  5LRJ A;  1QQ9 A;  2I3C A;  3C26 A;  3SXN A;  5JM6 A;  4CGP A;  4M85 A;  5IX3 A;  2IJZ A;  3SI0 A;  2AFO A;  4FD6 A;  3TO7 A;  6CPA A;  3KZW A;  4YRH A;  4OC5 A;  3TOA A;  4KVX A;  4M6H A;  1VHS A;  4B5P A;  2VBQ A;  4AXV A;  3FF3 A;  2NYQ A;  4MCR A;  4F0Y A;  3TO6 A;  2EO8 A;  1GYT A;  2ZEE A;  4TNU A;  4H6Z A;  4UCP A;  3MRU A;  3RO0 A;  4P4D A;  2B4D A;  2OZG A;  2PVW A;  1QMU A;  3FIX A;  3SJE A;  2ATR A;  1K4J A;  4A94 A;  5C88 A;  1ELM P;  1XJO A;  2FIW A;  2OB0 A;  3FYN A;  4E8O A;  3D7D A;  1KUX A;  3F0A A;  3R96 A;  3DGV A;  2JEV A;  2GRE A;  3D67 A;  4F9U A;  3I9S A;  4KOV A;  1B6B A;  2ZXV A;  1LAP A;  2FCK A;  3FB3 A;  4NXY A;  4CYP A;  5CBM A;  2BOA A;  4KOS A;  2PDO A;  3D7F A;  1ZLI A;  5K8O A;  2PJA A;  2HC9 A;  2Q4V A;  2QIR A;  3CXP A;  3K9U A;  1MJ9 A;  3ISZ A;  2PJ4 A;  3CPA A;  2RC4 A;  2Y0M A;  4C2X A;  4DYO A;  5D29 A;  1RXT A;  3BLN A;  4ZY2 A;  2OZH A;  4MCS A;  3D4U A;  3DNS A;  2VXK A;  1VKC A;  1LRZ A;  1SQH A;  4P4B A;  3V8I A;  4MRI A;  1XF8 A;  2BO9 A;  4H6U A;  2Z11 A;  5F47 A;  3IWW A;  2QML A;  4A37 A;  4ZGY B;  1IID A;  3FBU A;  2V77 A;  2CTC A;  4PK3 A;  2CXA A;  1BPM A;  3PEI A;  3PP9 A;  3QAY A;  1VIX A;  1Z2L A;  2POK A;  1QSN A;  1Q2Y A;  1Y7E A;  2AJ6 A;  2G3T A;  2O28 A;  2B5G B;  1M1D A;  2ZOG A;  3D7H A;  2ZED A;  3EFA A;  4Z65 A;  2YGW A;  2CNM A;  2FS5 A;  2AE6 A;  4C2Z A;  2PR1 A;  1YME A;  4ONW A;  2VZZ A;  1WWZ A;  2P6E A;  2ANP A;  4MMO A;  1YK3 A;  4MY3 A;  3HLP A;  2REE A;  3W6X A;  4KOX A;  4YFJ A;  4NGN A;  5IV0 A;  3WC5 A;  3QB8 A;  1X12 A;  4L89 A;  3NH4 A;  1XBU A;  4OC0 A;  2O53 A;  3MGD A;  3IIB A;  1PCA A;  4JXR A;  5HVG A;  4UEZ A;  2WUU A;  2ZPA A;  4UFX A;  1YLO A;  2C27 A;  4CPA A;  3B35 A;  3TOB A;  3V38 A;  5KTA A;  2X7B A;  1Z5R A;  3UY5 A;  2G9D A;  4UFW A;  3B3V A;  1YVK A;  4NFR A;  3F8K A;  4ZY0 A;  4PXC A;  4CS0 B;  4WWV A;  4BD9 A;  2PJ3 A;  4NJQ A;  5CPA A;  1Z8X A;  1Z4E A;  5G21 A;  4QB9 A;  3IC1 A;  1S7L A;  4IAV A;  1PUA A;  1DE4 C;  2Z3P A;  1Z8L A;  1Y0R A;  3CXS A;  1S7K A;  3EY5 A;  1IOI A;  3S9N A;  1V0C A;  2I79 A;  4KVO E;  5HH1 A;  2CTB A;  2FIA A;  4O23 A;  1NSA A;  2Q7S A;  4MHN A;  4IF5 A;  4JWP A;  4Y49 B;  3ZJ0 A;  4CGO A;  2PRB A;  1KUV A;  1ZG8 A;  2PJ1 A;  4R76 A;  4NGR A;  2R8V A;  3NH5 A;  3W91 A;  5G22 A;  2RB7 A;  4P6Y A;  4F6A A;  2JDC A;  2GLJ A;  1IYK A;  4HNX B;  2F7V A;  2VL1 A;  2FVG A;  3ISX A;  3BJ8 A;  1Y7R A;  2V8H A;  1ON0 A;  1CBX A;  4HNY B;  4UEE A;  4ZX8 A;  4UWJ A;  3R95 A;  2Q51 A;  3H8E A;  5I0C A;  5A27 A;  4P4E A;  1TKF A;  3S6G A;  1IU8 A;  2VQY A;  3G3S A;  2DXQ A;  4OC2 A;  4B6Z A;  4CGN A;  4R9M A;  1I1D A;  1ZG7 A;  2R1I A;  2WPX A;  1TKJ A;  5E96 A;  2ABZ A;  4L8A A;  4NGS A;  2FT0 A;  4B14 A;  4JYW A;  3PBB A;  4H2K A;  4EVY A;  1AMP A;  1BOB A;  4ZBG A;  3LMS A;  1Q2D A;  2PE3 A;  1M4G A;  2IQ6 A;  3JUW A;  8CPA A;  2AFZ A;  1M4D A;  3LD2 A;  4P4I A;  1PU9 A;  1TF9 A;  4PQA A;  4B5O A;  2DEA A;  4CYN A;  1XEB A;  3RNZ A;  2ZOF A;  3FEC A;  2OZU A;  1YW4 A;  2PR8 A;  2NSM A;  2WZN A;  3TCV A;  1RO5 A;  3S6F A;  3EO4 A;  3NA6 A;  3IWE A;  3CZX A;  4IUS A;  3B3T A;  2YNC A;  4J3G A;  4KS9 A;  4OC4 A;  2ZW5 A;  2FSR A;  2QYV A;  4FBE A;  1YR0 A;  2AFM A;  4XPD C;  5LYL A;  1S5K A;  2Z3N A;  4EFD A;  3FXT A;  1XOV A;  2F5I A;  2O4H A;  2Q0Y A;  3D66 A;  2BEI A;  4EME A;  3FED A;  5I4M A;  3KL9 A;  4ONU A;  3SXO A;  4Q38 A;  1YLE A;  2WYR A;  1LAN A;  2A4N A;  1MK4 A;  2PJ9 A;  3K9T A;  4HPS A;  4EWT A;  2Z3M A;  1CM0 A;  4JLY A;  4P4J A;  4UFV A;  4CGL A;  5DWM A;  2V8G A;  3IU1 A;  4KLW A;  4MHZ A;  4B5P B;  4CGM A;  3IU2 A;  2ZEM A;  2C6C A;  3PB8 X;  1Y0Y A;  3OWC A;  3PB4 X;  3TTH A;  4KSA A;  3NH8 A;  1LFW A;  4BBH A;  2Z3O A;  3WR7 A;  4F9V A;  1EE3 P;  2CNT A;  1CG2 A;  4MJ8 A;  3F5B A;  1XMB A;  2AFW A;  4KOU A;  1CPX A;  2B4D B;  3FEE A;  4TWE A;  4A33 A;  5K8P A;  2ZEF A;  2Z3L A;  1VGY A;  4QC6 A;  4CRY B;  2Q43 A;  2V8D A;  3SJF A;  4ZYQ A;  4P4F A;  2RFH A;  4KUB A;  2HUZ A;  1Z4R A;  1M4L A;  4B11 A;  2VEZ A;  4HKF A;  3BJ7 A;  1LOK A;  3NE8 A;  4M6G A;  4OC1 A;  4NGP A;  3VAR A;  4OKO A;  3PB6 X;  4P45 A;  5AG6 A;  4CAE A;  4NCZ A;  1YX0 A;  3B2Y A;  4KUA A;  4PSX A;  2OH1 A;  5LYF A;  2Q44 A;  5FVJ A;  2ZW6 A;  1HDQ A;  1XE4 A;  2XEF A;  4MFL A;  3K2K A;  3S9L A;  4CAW A;  4MFP A;  1ARM A;  2NMT A;  3PFO A;  4LQ6 A;  4NGQ A;  3IGR A;  1CP7 A;  4UF4 A;  4II9 A;  3P2F A;  2PJC A;  4MFK A;  4UWI A;  1FY7 A;  5LRK A;  4C68 A;  1J4J A;  2KCW A;  4Q7A A;  4AVB A;  1CPS A;  2G3A A;  3H8F A;  3MN8 A;  7CPA A;  4X3R A;  3TE4 A;  5KTD A;  2YNE A;  2JBJ A;  1Y9W A;  2J8R A;  1DTD A;  5AG4 A;  5F49 A;  2R7H A;  2JDD A;  4KOR A;  4G1P A;  1S3Z A;  3D7G A;  1N71 A;  1IY7 A;  2OU2 A;  3SHP A;  2C6G A;  3B3S A;  4A95 A;  5HXD A;  3BI1 A;  4JXQ A;  3RZA A;  4DNC A;  3W6S A;  3FVL A;  1S60 A;  4LX9 A;  4R7M A;  1BAV A;  3D2M A;  3IO1 A;  3PZJ A;  4FUU A;  3DLJ A;  4BMH A;  2VI7 A;  1FT7 A;  3EC4 A;  4MFZ A;  1YVO A;  2Z10 A;  2QJ8 A;  1JQG A;  1KWM A;  1XRY A;  2B58 A;  3JRU A;  4B10 A;  3H4Q A;  4FD5 A;  4BIN A;  1ZG9 A;  5A28 A;  4UIA A;  5K8N A;  4PXB A;  4NEX A;  5JH9 A;  1YW6 A;  3T90 A;  1IIC A;  2Z0Z A;  1I12 A;  3B8G A;  4MBU A;  4NF1 A;  2BSW A;  2XEI A;  4GXH A;  4A31 A;  1L0C A;  4PXE A;  3H5Z A;  3KHZ A;  4OP4 A;  3GKR A;  2VZY A;  4R57 A;  4AB7 A;  4AG9 A;  2C6P A;  2ZEG A;  1PYT B;  5LRG A;  2JEW A;  5F48 A;  1MJB A;  4XNH C;  2FXF A;  3PBE A;  1AUG A;  3GIU A;  2P6F A;  4HNW B;  1KZF A;  1B87 A;  4MCQ A;  3L2N A;  4MXU A;  5AG7 A;  4PV6 A;  3WC7 A;  3R9F A;  5K8M A;  1IB1 E;  3TFY A;  3SI1 A;  3PFE A;  3JVN A;  5H86 A;  4FWU A;  1H8L A;  3R1K A;  2PJ5 A;  1QST A;  2ARH A;  5LYD A;  2QVP A;  2EK9 A;  2B4B A;  3GY9 A;  3KQX A;  1VHE A;  2GIV A;  3IEH A;  3DDD A;  2EBJ A;  3LAC A;  4C7I A;  3I1U A;  1TF8 A;  4MHY A;  2XEJ A;  3CXQ A;  1TKH A;  2K5T A;  2EVN A;  2CY2 A;  4ZY1 A;  2CF4 A;  1IYL A;  1HDU A;  4KSF A;  5AGE A;  2Q7B A;  5BWA B;  1M4I A;  4PK2 A;  3H8G A;  3FJU A;  3FNC A;  1VHO A;  2GU2 A;  2WPW A;  4QVT A;  4KOW A;  4RN7 A;  3JTK A;  4U9Y A;  3CPX A;  4UIB A;  3B3W A;  2Q4Z A;  3TT2 A;  2CNS A;  3BI0 A;  4KOY A;  3WAB A;  3S9M A;  1A2Z A;  3PB7 X;  4E0A A;  2OR4 A;  3KHX A;  5J1Q A;  1WK4 A;  5KTC A;  4KVM E;  3WC6 A;  3KGQ A;  1YQE A;  1XIX A;  2G0B A;  4QUS A;  4U5Y A;  2YNC C;  1F57 A;  4R3K A;  2BCO A;  4A32 A;  1ZO0 A;  1QSO A;  5IB9 A;  1BPN A;  1UFH A;  1NMT A;  2PIY A;  3D2P A;  4PSW A;  3KI9 A;  5CNP A;  3V7Z A;  2ZEH A;  4LQG A;  3GYA A;  4CAV A;  4B13 A;  4NSQ A;  5EC4 A;  4I49 A;  2PSW A;  4UCN A;  3QNV A;  5EMI A;  2D4P A;  3LOD A;  3D3S A;  5J8F A;  4XPD B;  4W9Y A;  4MCP A;  3T8W A;  4RI1 A;  4B12 A;  4DUK A;  2ZEL A;  2C1C A;  3GUX A;  2PJ8 A;  1FNO A;  2PCU A;  4QBJ A;  3SJX A;  1UWY A;  4K30 A;  2ZEP A;  1GHE A;  4UBR A;  1Q2C A;  2PQ8 A;  2YND A;  5GCN A;  3PGP A;  2HQY A;  4CAX A;  4A38 A;  1IOF A;  2EUI A;  2JBK A;  3QAH A;  4OIW A;  4WJB A;  3DR6 A;  1XMT A;  3S6H A;  3TC8 A;  2DF5 A;  5F46 A;  5HMN A;  2PJ0 A;  2ZEO A;  4E2A A;  4YU9 A;  3SI2 A;  2P0W A;  3T9Y A;  1KUY A;  2J9A A;  3E0K A;  3LWU A;  2XEG A;  3WT4 A;  5C82 A;  3KAS A;  3IJ3 A;  4FD7 A;  4U9Z A;  2WSA A;  4C7H A;  2PJ2 A;  1YRE A;  2B5G A;  2CIJ A;  1YGH A;  4IK2 A;  4JJX A;  3KR5 A;  3TX8 A;  4MFJ A;  2D4O A;  3DSB A;  3BXM A;  2GFQ A;  4NJR A;  4PXD A;  1TXR A;  3D8P A;  4H89 A;  3D68 A;  2JLM A;  1ELL P;  1NE9 A;  3B3C A;  5HVH A;  1QSM A;  1RTQ A;  4P10 A;  3A9L A;  1ZLH A;  2BUE A;  3R9E A;  3VWE A;  4KOT A;  2QEC A;  4UCM A;  3CDX A;  4XPK A;  1Z8W A;  5DS0 A;  3KQZ A;  4GM5 A;  4OME A;  4CYO A;  4ZI6 A;  2FL4 A;  4YGO A;  1M44 A;  3RYO A;  4F8Z A;  5LYI A;  4UEF A;  2Z3K A;  4OID A;  4MI4 A;  4X8I A;  3N7Z A;  1R43 A;  4M6I A;  3R9G A;  3FH4 A;  4CAF A;  4KLV A;  4NGM A;  5H84 A;  4RUH A;  4AVA A;  2PJB A;  2I00 A;  3DR8 A;  3GB0 A;  4MHP A;  4F0X A;  3NE7 A;  4LUA A;  4X2T A;  5G20 A;  4R8F A;  2H5M A;  3IFE A;  5IB0 A;  1Z8T A;  3SJG A;  4UA3 A;  3G8W A;  3NFZ A;  4Q36 A;  1S7F A;  1CX8 A;  3EXN A;  4ORF A;  2AFU A;  3RAM A;  5JGF A;  3FMC A;  1Y9K A;  5JPH A;  2B3U A;  4IHM A;  2REF A;  5ISV A;  4FAI A;  2R98 A;  1TIQ A;  5AG5 A;  2B3V A;  5ELY A;  5DWN A;  2DPT A;  3B7I A;  3PRT A;  2ZEN A;  2HB6 A;  3CT9 A;  2F8H A;  4DJL A;  1F2O A;  4JD6 A;  4C2Y A;  1ARL A;  3N5F A;  4RS2 A;  1P0H A; 
#chains in the Genus database with same CATH homology
 2PC1 A;  4CRZ B;  3P2H A;  3ZZI A;  4OAE A;  2IL4 A;  4Y49 C;  3IWG A;  1S7N A;  2FE7 A;  4OLL A;  2P6G A;  4A30 A;  1I21 A;  2J8M A;  4R3L A;  4KZT A;  1NSL A;  3S6K A;  4MHD A;  1R57 A;  1Z9U A;  4OAD A;  1MJA A;  1CJW A;  4GS4 A;  2BL1 A;  4X5K A;  3VWD A;  1P4N A;  5JQ4 A;  4A2Z A;  2ZW7 A;  2J8N A;  5J8C A;  1OZP A;  4XNH B;  4BBH A;  2GE3 A;  1QSR A;  2DPS A;  4XPL A;  3FRM A;  2GAN A;  1BO4 A;  2ZW4 A;  4FD4 A;  3KKW A;  1U6M A;  4M3S A;  4R87 A;  4AG7 A;  4CYQ A;  4MY0 A;  4MFQ A;  5EBV A;  5G1Z A;  3I3G A;  2HV2 A;  3TO9 A;  4AVC A;  2Q4Y A;  2Q04 A;  3SXN A;  3C26 A;  4CGP A;  4M85 A;  5IX3 A;  4FD6 A;  3TO7 A;  4YRH A;  3TOA A;  4KVX A;  1VHS A;  4B5P A;  2VBQ A;  4F0Y A;  3TO6 A;  4H6Z A;  4UCP A;  2B4D A;  2OZG A;  3FIX A;  2ATR A;  1K4J A;  5C88 A;  2FIW A;  2OB0 A;  3FYN A;  4E8O A;  1KUX A;  3F0A A;  3R96 A;  2JEV A;  3I9S A;  4KOV A;  1B6B A;  2ZXV A;  2FCK A;  3FB3 A;  4NXY A;  4CYP A;  4KOS A;  2PDO A;  2Q4V A;  3CXP A;  3K9U A;  2QIR A;  1MJ9 A;  4C2X A;  2RC4 A;  2Y0M A;  1RXT A;  3BLN A;  2OZH A;  3DNS A;  2VXK A;  1VKC A;  1LRZ A;  1SQH A;  3V8I A;  1XF8 A;  4H6U A;  2Z11 A;  5F47 A;  4ZGY B;  2QML A;  1IID A;  3FBU A;  4PK3 A;  2CXA A;  3PP9 A;  1QSN A;  1Q2Y A;  2AJ6 A;  2G3T A;  2O28 A;  2B5G B;  1M1D A;  3EFA A;  2YGW A;  2CNM A;  2FS5 A;  2AE6 A;  4C2Z A;  2PR1 A;  2VZZ A;  1WWZ A;  2P6E A;  4MY3 A;  1YK3 A;  2REE A;  3W6X A;  4KOX A;  4YFJ A;  5IV0 A;  3QB8 A;  4L89 A;  3MGD A;  4JXR A;  2WUU A;  2ZPA A;  4UFX A;  2C27 A;  3TOB A;  5KTA A;  2X7B A;  3UY5 A;  4UFW A;  1YVK A;  3F8K A;  4CS0 B;  1Z4E A;  5G21 A;  4QB9 A;  1S7L A;  1PUA A;  2Z3P A;  3CXS A;  1S7K A;  3EY5 A;  1V0C A;  2I79 A;  4KVO E;  5HH1 A;  2FIA A;  4Y49 B;  4IF5 A;  4JWP A;  3ZJ0 A;  4CGO A;  2PRB A;  1KUV A;  3W91 A;  2R8V A;  5G22 A;  4F6A A;  2JDC A;  1IYK A;  4HNX B;  3BJ8 A;  1Y7R A;  1ON0 A;  4HNY B;  3R95 A;  4UWJ A;  5I0C A;  5A27 A;  3S6G A;  2VQY A;  3G3S A;  2DXQ A;  4CGN A;  4R9M A;  1I1D A;  2WPX A;  2R1I A;  5E96 A;  4L8A A;  2FT0 A;  4B14 A;  4EVY A;  4ZBG A;  1BOB A;  1Q2D A;  1M4G A;  3JUW A;  1M4D A;  3LD2 A;  1PU9 A;  4B5O A;  4CYN A;  1XEB A;  2OZU A;  2PR8 A;  3TCV A;  1RO5 A;  3S6F A;  3EO4 A;  3IWE A;  4IUS A;  2YNC A;  4J3G A;  4KS9 A;  2ZW5 A;  2FSR A;  1YR0 A;  4XPD C;  1S5K A;  2Z3N A;  3FXT A;  2F5I A;  2Q0Y A;  2BEI A;  4ONU A;  3SXO A;  4Q38 A;  1YLE A;  2A4N A;  1MK4 A;  2Z3M A;  1CM0 A;  4JLY A;  4UFV A;  4CGL A;  5DWM A;  3IU1 A;  4KLW A;  4B5P B;  4CGM A;  3IU2 A;  3OWC A;  3TTH A;  4KSA A;  2Z3O A;  3WR7 A;  2CNT A;  4MJ8 A;  3F5B A;  4KOU A;  4A33 A;  2B4D B;  2Z3L A;  4QC6 A;  4CRY B;  4KUB A;  2HUZ A;  1Z4R A;  4B11 A;  2VEZ A;  4HKF A;  3BJ7 A;  5AG6 A;  4CAE A;  4NCZ A;  1YX0 A;  4KUA A;  4PSX A;  2OH1 A;  2Q44 A;  5FVJ A;  2ZW6 A;  1XE4 A;  4MFL A;  4CAW A;  4MFP A;  2NMT A;  3IGR A;  4II9 A;  3P2F A;  4MFK A;  4UWI A;  1FY7 A;  4C68 A;  1J4J A;  2KCW A;  4AVB A;  2G3A A;  3TE4 A;  5KTD A;  2YNE A;  1Y9W A;  2J8R A;  5AG4 A;  5F49 A;  2R7H A;  2JDD A;  4KOR A;  1S3Z A;  1N71 A;  2OU2 A;  3SHP A;  4A95 A;  4JXQ A;  4DNC A;  3W6S A;  1S60 A;  4LX9 A;  3D2M A;  3PZJ A;  4BMH A;  2VI7 A;  3EC4 A;  4MFZ A;  1YVO A;  2Z10 A;  4B10 A;  2B58 A;  3H4Q A;  4FD5 A;  5A28 A;  4NEX A;  3T90 A;  1IIC A;  2Z0Z A;  1I12 A;  3B8G A;  4MBU A;  4NF1 A;  2BSW A;  4A31 A;  1L0C A;  3H5Z A;  3GKR A;  2VZY A;  4R57 A;  4AB7 A;  4AG9 A;  5F48 A;  1MJB A;  4XNH C;  2FXF A;  2P6F A;  4HNW B;  1KZF A;  1B87 A;  5AG7 A;  4PV6 A;  3R9F A;  1IB1 E;  3TFY A;  3JVN A;  5H86 A;  3R1K A;  1QST A;  2ARH A;  3GY9 A;  2B4B A;  2GIV A;  3DDD A;  4C7I A;  3CXQ A;  2K5T A;  2EVN A;  2CY2 A;  1IYL A;  4KSF A;  5AGE A;  2Q7B A;  5BWA B;  1M4I A;  4PK2 A;  4U9Y A;  3FNC A;  2WPW A;  4QVT A;  4KOW A;  3JTK A;  3TT2 A;  2CNS A;  4KOY A;  4E0A A;  1WK4 A;  5KTC A;  4KVM E;  1XIX A;  2G0B A;  4QUS A;  4U5Y A;  2YNC C;  4R3K A;  4A32 A;  1ZO0 A;  1QSO A;  1UFH A;  4PSW A;  1NMT A;  3D2P A;  5CNP A;  3GYA A;  4CAV A;  4B13 A;  4NSQ A;  5EC4 A;  4I49 A;  2PSW A;  4UCN A;  2D4P A;  3LOD A;  3D3S A;  5J8F A;  4XPD B;  4RI1 A;  4B12 A;  4QBJ A;  4K30 A;  4UBR A;  1GHE A;  1Q2C A;  2PQ8 A;  2YND A;  5GCN A;  3PGP A;  2HQY A;  4CAX A;  2EUI A;  3QAH A;  3DR6 A;  1XMT A;  3S6H A;  5F46 A;  5HMN A;  4E2A A;  3T9Y A;  2P0W A;  1KUY A;  3E0K A;  5C82 A;  4FD7 A;  4U9Z A;  2WSA A;  4C7H A;  1YRE A;  2B5G A;  1YGH A;  4JJX A;  4MFJ A;  2D4O A;  3DSB A;  3D8P A;  4H89 A;  2JLM A;  1NE9 A;  1QSM A;  3A9L A;  2BUE A;  3R9E A;  3VWE A;  4KOT A;  2QEC A;  4UCM A;  4XPK A;  4CYO A;  2FL4 A;  4YGO A;  1M44 A;  3RYO A;  2Z3K A;  4MI4 A;  3N7Z A;  3R9G A;  4CAF A;  4KLV A;  5H84 A;  4AVA A;  3DR8 A;  2I00 A;  4F0X A;  3NE7 A;  4LUA A;  5G20 A;  2H5M A;  5IB0 A;  4UA3 A;  3G8W A;  4Q36 A;  1S7F A;  3EXN A;  4ORF A;  1Y9K A;  5JPH A;  2B3U A;  2REF A;  5ISV A;  2R98 A;  1TIQ A;  5AG5 A;  2B3V A;  5DWN A;  2DPT A;  4JD6 A;  4C2Y A;  4RS2 A;  1P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...