3BLNA

Crystal structure of acetyltransferase gnat family (np_981174.1) from bacillus cereus atcc 10987 at 1.31 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
142
structure length
142
Chain Sequence
GMKNVTKASIDDLDSIVHIDIDVIGNDSRRNYIKHSIDEGRCVIVKEDNSISGFLTYDTNFFDCTFLSLIIVSPTKRRRGYASSLLSYMLSHSPTQKIFSSTNESNESMQKVFNANGFIRSGIVENLDEGDPEIIFYTKKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase GNAT family
publication title Crystal structure of acetyltransferase GNAT family (NP_981174.1) from Bacillus cereus ATCC 10987 at 1.31 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 40
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3blnA00
2FXFA 4KOXA 3CXQA 4E8OA 2B58A 3N7ZA 4B5PA 4KLWA 1S7LA 4XPKA 4R3KA 4NXYA 3FNCA 2K5TA 2Q7BA 2Q4VA 3TO6A 1QSRA 1KUVA 4KUBA 3W6XA 2X7BA 1S60A 5I0CA 2WPXA 5H86A 1YGHA 1J4JA 3KKWA 3S6KA 1QSTA 1RO5A 2DXQA 2JDDA 2ZPAA 4KOTA 4KUAA 3SXOA 3P2HA 4JXRA 5HMNA 3DR8A 2D4OA 4MJ8A 1QSMA 3WR7A 5KTCA 4MHDA 4L89A 1XMTA 5J8FA 4JWPA 3TE4A 2ZW4A 2C27A 2Q4YA 3LD2A 4MY0A 4KOVA 5H84A 4PK3A 2GIVA 3DSBA 1PUAA 1MK4A 3BLNA 4CS0B 4BMHA 4DNCA 3PP9A 1IIDA 3ZJ0A 4AG7A 4CAXA 3FXTA 1YLEA 4PK2A 4HNYB 2B3UA 1WWZA 2O28A 3T9YA 2JEVA 1WK4A 2B3VA 4E2AA 2FT0A 4YFJA 1L0CA 4KOWA 5EC4A 2NMTA 3PZJA 1Q2YA 3CXSA 1XE4A 4KVME 3G8WA 1YX0A 4AVAA 2I00A 1BO4A 2B4BA 3VWEA 1I21A 2HV2A 3EY5A 3GYAA 4XPDB 4JXQA 2ZW7A 5GCNA 2GANA 5DWNA 2R8VA 4F6AA 3QB8A 3S6HA 3FYNA 4RS2A 2PQ8A 1B6BA 1Q2CA 1S5KA 4KOUA 1IYLA 2ATRA 4FD6A 2OU2A 4NF1A 1S3ZA 4KOSA 1MJBA 3R9FA 3OWCA 4KVOE 1PU9A 1S7KA 3QAHA 3TO7A 3MGDA 2Y0MA 5DWMA 1N71A 1YREA 4JD6A 4QC6A 2ARHA 2H5MA 2CNMA 4R9MA 2BUEA 1VKCA 5KTDA 2JLMA 2CY2A 4H6UA 3GKRA 3T90A 3D2MA 2J8NA 3BJ7A 3RYOA 2CNTA 2R98A 3IGRA 3B8GA 2ZW6A 1M4IA 2VZZA 5F49A 3CXPA 3I3GA 4HKFA 2I79A 5EBVA 1QSNA 2FIWA 4OLLA 3P2FA 1Y9KA 3FIXA 4F0YA 2WPWA 2HQYA 4R87A 3NE7A 1GHEA 2B5GB 2Q04A 1FY7A 2R7HA 3S6GA 3F0AA 3GY9A 2P6GA 4M85A 2J8RA 3TFYA 4ZBGA 5JPHA 1CJWA 1SQHA 2FIAA 3W91A 4KZTA 4H89A 1TIQA 1IICA 4KLVA 4HNXB 1V0CA 3IWGA 3D3SA 4NEXA 2REFA 4K30A 2HUZA 3DNSA 2CNSA 3VWDA 2PSWA 2RC4A 1S7NA 4MI4A 3DDDA 4Y49B 4QBJA 4HNWB 1U6MA 1YK3A 5HH1A 5E96A 1VHSA 1UFHA 1OZPA 4EVYA 4NSQA 2QIRA 1YVKA 3R1KA 4PSWA 3FRMA 4AVBA 2OZGA 5F47A 2Z11A 5IV0A 4FD4A 3W6SA 1MJAA 4KOYA 4U9YA 2VXKA 3EFAA 2PDOA 4Y49C 1Y9WA 1M44A 2EVNA 3C26A 4IF5A 4B5PB 2FS5A 1M4GA 4NCZA 1BOBA 3EC4A 4UWIA 4X5KA 4CAWA 2B4DB 5FVJA 1ON0A 3PGPA 3EXNA 2KCWA 2J8MA 1QSOA 4CRYB 4M3SA 1NSLA 5C88A 3SXNA 3S6FA 2IL4A 1XEBA 2D4PA 3TCVA 1IB1E 4IUSA 4MBUA 4J3GA 2P0WA 4AB7A 4OADA 4JLYA 1R57A 2ZW5A 4R57A 3FB3A 5F48A 4CRZB 1Z4EA 4FD7A 3JVNA 2G3TA 1B87A 4UBRA 1M1DA 2Q0YA 3R9EA 5IX3A 4UWJA 2OH1A 4MY3A 3R9GA 4H6ZA 5ISVA 4L8AA 3SHPA 2R1IA 2PRBA 2F5IA 3K9UA 5F46A 3JUWA 4KORA 2EUIA 1IYKA 1M4DA 2B4DA 2BSWA 1YVOA 4PV6A 1Z9UA 2VQYA 5J8CA 3D8PA 3F8KA 4AVCA 1KUXA 2VI7A 1YR0A 3D2PA 3E0KA 3ZZIA 1NE9A 3FBUA 2QMLA 3H4QA 1KUYA 3V8IA 4U9ZA 2AE6A 2G0BA 2VZYA 1KZFA 1P4NA 3F5BA 3I9SA 2Q44A 4YRHA 2OZHA 5IB0A 5JQ4A 2Z0ZA 4LUAA 4R3LA 4XNHB 3DR6A 4E0AA 2OB0A 4RI1A 2BL1A 3R95A 3R96A 1MJ9A 4U5YA 2PR1A 3TOAA 2P6FA 1Q2DA 2VBQA 4LX9A 2REEA 1K4JA 2P6EA 4CAVA 1CM0A 5C82A 2BEIA 5KTAA 4QUSA 1I1DA 3TOBA 4XNHC 2B5GA 2Z10A 2FE7A 2GE3A 1XF8A 4FD5A 1XIXA 3LODA 2FSRA 1LRZA 1P0HA 4I49A 2PC1A 3UY5A 1Y7RA 2OZUA 4OAEA 4QVTA 3TO9A 5CNPA 1I12A 1S7FA 2QECA 2PR8A 4ORFA 4YGOA 2ZXVA 1Z4RA 2VEZA 4AG9A 3TTHA 4GS4A 3G3SA 2FL4A 4PSXA 3BJ8A 4B5OA 2JDCA 2G3AA 1NMTA 2AJ6A 4KVXA 4XPDC 4II9A 4XPLA 3TT2A 4UA3A 4ONUA 1RXTA 3EO4A 4QB9A 2FCKA 2A4NA 4JJXA
chains in the Genus database with same CATH superfamily
4NGMA 2FXFA 4KOXA 3CXQA 4E8OA 4PXEA 2B58A 3FH4A 3N7ZA 2PVWA 4TNUA 4MHYA 4B5PA 5F09A 1XOVA 4KLWA 3V7ZA 1S7LA 1VGYA 2EWBA 1IU8A 5IB9A 3MRUA 4XPKA 3FECA 4R3KA 4NXYA 3FNCA 2K5TA 2Q7BA 2Q51A 1JQGA 4OC1A 5LYIA 5HVHA 3FMCA 2Q4VA 4MXUA 1QSRA 2ZEDA 3TO6A 1HDQA 1KUVA 4KUBA 3W6XA 2X7BA 1S60A 3B3CA 4F9UA 4OC3A 2C6GA 3CPXA 2WPXA 3IWWA 5H86A 3D7GA 4B13A 5JGFA 1YGHA 4MCQA 1J4JA 3CZXA 1PYTB 4CGPA 4A31A 4A95A 3KKWA 2PJCA 4ZY2A 3S6KA 1QSTA 1RO5A 2DXQA 2Z3NA 4EMEA 4B14A 4A39A 2JDDA 2ZPAA 2AFZA 4KOTA 4KUAA 3SXOA 3P2HA 4C7HA 4JXRA 4RUHA 5HMNA 2PJAA 3DR8A 3I1UA 2D4OA 5JM6A 4MJ8A 1QSMA 2XEJA 2PJ7A 2Z3KA 3WR7A 5KTCA 3JRUA 4P4DA 4MHDA 2RB7A 4L89A 1XMTA 5J8FA 4JWPA 4GM5A 4KSAA 3KHZA 2ZW4A 3TE4A 2C27A 2Q4YA 2JBKA 1YQEA 2O53A 2PJ4A 3KR4A 2PJ5A 3LD2A 4MY0A 4ZY0A 3GLJA 4MMOA 4NJQA 4K3NA 5J1QA 1TF9A 4KOVA 5H84A 5LRKA 3RNZA 4PK3A 2GIVA 2PJ0A 5G20A 1JWQA 3DSBA 4X2TA 2J9AA 1PUAA 1MK4A 3BLNA 4Q38A 3KGQA 4CS0B 4P44A 3IO1A 1Z2LA 2GLJA 2IQ6A 5K8OA 4OP4A 2GLFA 4BMHA 4DNCA 3PP9A 1IIDA 3VATA 3ZJ0A 4AG7A 4CAXA 2V77A 3FXTA 5K8PA 2NSMA 1YLEA 3H5ZA 3RBUA 1Z8XA 4CAFA 4IK2A 2DPSA 4PK2A 4HNYB 2PJ3A 3PBEA 3B2YA 4EFDA 2PVVA 3PFEA 2ZEHA 3T8WA 3S9MA 2B3UA 4OC4A 5I0CA 1WWZA 2O28A 8CPAA 3T9YA 2JEVA 1OBRA 1Z8WA 1WK4A 1XRYA 4KSFA 2DPTA 2B3VA 4CAEA 4E2AA 2FT0A 3GUXA 4P4IA 4F0XA 4YFJA 3KHXA 3SJEA 1L0CA 1YMEA 4KOWA 3LWUA 1YSJA 2PJ1A 2NMTA 2ZEMA 3PZJA 3B7IA 4X8IA 4BINA 4CYNA 1Q2YA 3CXSA 4NGPA 1XE4A 3LMSA 2IJZA 4KVME 2V8VA 3G8WA 1IOFA 1YX0A 3CT9A 2I00A 4JZ0A 4AVAA 1DE4C 1BO4A 2B4BA 3VWEA 2XEGA 4WWVA 1I21A 2HV2A 3EY5A 3GYAA 4XPDB 5AG6A 4JXQA 4MHPA 2YNDA 2ZW7A 5AG4A 5GCNA 2GANA 4OC0A 2ZEGA 5DWNA 4DYOA 2R8VA 4F6AA 1F57A 1RTQA 2AFXA 3QB8A 5THWA 3S6HA 1F2OA 4B6ZA 3FYNA 3NFZA 4OC5A 4RS2A 3B3TA 3JTKA 1Z5RA 4R76A 2PQ8A 1B6BA 1Q2CA 1S5KA 2GU2A 4KOUA 4BD9A 4C2ZA 3RZAA 4NGTA 1IYLA 2ATRA 4PXCA 2F8HA 4FD6A 2OU2A 1PCAA 3WC6A 3WC5A 5DS0A 2ANPA 4NF1A 1S3ZA 4KOSA 5BWAB 4PXBA 2PIZA 1MJBA 3FEDA 4UFVA 2YGWA 3R9FA 3VARA 4F9VA 2Q4ZA 3OWCA 1FNOA 4KVOE 1PU9A 1S7KA 3IWEA 3QAHA 3TO7A 3MGDA 2Y0MA 5DWMA 2ZEPA 3A9LA 1N71A 1YREA 5G21A 4JD6A 4QC6A 2ARHA 5CBMA 1ZO0A 3IC1A 2H5MA 4AXVA 2F7VA 1VHEA 4NGNA 2WZNA 1TKHA 2CNMA 4BBHA 4R9MA 2BUEA 1LFWA 1VKCA 3KR5A 2JLMA 4WJBA 5KTDA 3WABA 2CY2A 2QYVA 4P45A 3RAMA 4H6UA 3GKRA 2POKA 3D2MA 3T90A 4F8ZA 2QVPA 3GIUA 2YNCA 2ZEFA 2AFUA 2ZOGA 3GB0A 2J8NA 3BJ7A 3RYOA 5JH9A 1ARLA 1TKJA 2CNTA 2HC9A 2R98A 4UCPA 2GREA 3D7FA 3IGRA 3B8GA 2ZW6A 1M4IA 1CG2A 2VZZA 3KZWA 4G1PA 5F49A 5I4MA 1LCPA 3CXPA 3I3GA 4HKFA 2V8GA 2I79A 4KSIA 5EBVA 1AMPA 4FBEA 4JYWA 1QSNA 3B3VA 2FIWA 2XEIA 3PBBA 3D67A 5LRJA 4C2YA 1KWMA 4OLLA 3P2FA 1Y9KA 3FIXA 4ZX9A 4F0YA 1Q7LA 1LAMA 2WPWA 1FT7A 1HEEA 2HQYA 1A2ZA 1VIXA 3S9NA 4R87A 3NE7A 3HLPA 1XBUA 2XEFA 1GHEA 2B5GB 5HVFA 4P4FA 1IY7A 2Q04A 3IU1A 3DGVA 1BPMA 2EK8A 1DTDA 1FY7A 2ZEOA 2ZELA 2R7HA 3RO0A 4HPSA 3S6GA 3F0AA 1CP7A 3GY9A 4NGSA 4TWEA 5LRGA 4CGMA 2P6GA 4IAVA 4H2KA 4M85A 1BPNA 1ZG7A 1BAVA 1TF8A 2J8RA 3K2KA 4B10A 4ZBGA 5JPHA 1CJWA 3TFYA 1SQHA 2FIAA 3VH9A 1Z8LA 3D68A 3W91A 3MN8A 4KZTA 3KL9A 4H89A 1TIQA 1IICA 4KLVA 4HNXB 1V0CA 2GFQA 3IWGA 3D3SA 3QAYA 3TX8A 4CYPA 4NEXA 2REFA 4K30A 2EO8A 3PB6X 2Z3MA 2HUZA 3DNSA 1XFOA 2CNSA 3SI0A 3NH8A 3VWDA 4ZI6A 2PSWA 3H8EA 2RC4A 3NH4A 1S7NA 4MFPA 4MI4A 3DDDA 5HXDA 4Y49B 4QBJA 3B3WA 1CP6A 3FVLA 4Q7AA 4PQAA 4Q36A 4HNWB 1U6MA 2WSAA 1YK3A 5HH1A 5E96A 1VHSA 1UFHA 2PE3A 4DJLA 1CPXA 1OZPA 3D66A 1YLOA 2BO9A 4EVYA 4NSQA 2QIRA 1YVKA 3FEEA 3WT4A 3R1KA 4UIAA 3SJGA 4PSWA 3FRMA 4AVBA 4C68A 2OZGA 5F47A 2Z11A 5IV0A 3PB8X 4FD4A 3B35A 3W6SA 1TKFA 1CX8A 1MJAA 4Z65A 4KOYA 1ELMP 2PJBA 2WYRA 3PB7X 4U9YA 2VXKA 3EFAA 1VHOA 2PDOA 1Y9WA 4Y49C 1M44A 2EVNA 3C26A 4IF5A 4B5PB 2CIJA 2FS5A 2PJ9A 1M4GA 2AFOA 4NCZA 1BOBA 3EC4A 4UWIA 4X5KA 4CAWA 2DEAA 4M6GA 2B4DB 5FVJA 1NSAA 1ON0A 3PGPA 3EXNA 2OOTA 1H8LA 3H8GA 2KCWA 3IFEA 2J8MA 1QSOA 4MCRA 4NGQA 4FUUA 4CRYB 2Q7SA 3IEHA 4YU9A 2C6PA 3KQZA 4A94A 4M3SA 4O23A 2ZEEA 5LYLA 1NSLA 3L2NA 5C88A 3SXNA 5CPAA 5EMIA 4A37A 3S6FA 4UEFA 2IL4A 1XEBA 2D4PA 3HUVA 3TCVA 1IB1E 4IUSA 4ZY1A 4MBUA 4J3GA 1R3NA 2P0WA 3CPAA 4MCSA 4JLYA 4OADA 1R57A 1R43A 3FJUA 4AB7A 4CYOA 4UFXA 4A32A 2ZW5A 1F2PA 5LYFA 4R57A 3FB3A 3PB9X 5F48A 3NH5A 4CRZB 2BOAA 1Z4EA 4FD7A 4FAIA 7CPAA 3JVNA 4OC2A 2G3TA 4KS9A 1B87A 4UBRA 3BHXA 4YWYA 1TXRA 1M1DA 2Q0YA 4M6HA 4MFQA 3R9EA 5HVGA 1CPSA 3IJ3A 4P4EA 2EK9A 5IX3A 2O4HA 4UWJA 2OH1A 4MCPA 4MY3A 3R9GA 4H6ZA 1LAPA 2Q43A 5ISVA 4L8AA 3SHPA 4OIWA 1Y0YA 5K8MA 5AGEA 4M6IA 2R1IA 2PRBA 4UFWA 1QMUA 2F5IA 1BLLE 3K9UA 5F46A 3JUWA 3FF3A 4P6YA 4R6TA 4KORA 4PXDA 2EUIA 1GYTA 3IU2A 1IYKA 1M4DA 2B4DA 4FWUA 2BSWA 1YVOA 4PV6A 1Z9UA 2EBJA 2PJ6A 2VQYA 4UEEA 5J8CA 3D8PA 3D7HA 3PEIA 3F8KA 2BCOA 2Z3OA 4MHZA 5K8NA 2AFSA 4AVCA 4MFKA 1KUXA 2C1CA 2VI7A 4OIDA 1YR0A 3D2PA 2YNEA 2PRQA 3E0KA 4LQ6A 1NE9A 4UCMA 3ZZIA 1HDUA 3LACA 2ODFA 2WUUA 4C7IA 3FBUA 1ZLHA 2QMLA 3H8FA 1QQ9A 3H4QA 3PRTA 2IMOA 1KUYA 4MHNA 2RFHA 3V8IA 4U9ZA 2AE6A 2PIYA 4MFLA 2G0BA 4CGNA 1IGBA 1ZLIA 6CPAA 1EE3P 4W9YA 2VL1A 5A27A 5D8NA 4UIBA 2VZYA 1CBXA 4B12A 4LQGA 3FX6A 3QNVA 3ISXA 1KZFA 1P4NA 4B11A 1XMBA 3F5BA 3I9SA 2Q44A 2Z3LA 2OZHA 4YRHA 5IB0A 5JQ4A 5G1ZA 3SJFA 4CPAA 2Z0ZA 4LUAA 4R7MA 4R3LA 1UWYA 4EWTA 4XNHB 2CF4A 3DR6A 2OB0A 3IIBA 2ZOFA 3NA6A 4E0AA 4RI1A 2V8HA 2BL1A 4NJRA 3B3SA 2NYQA 4P10A 3R95A 4R8FA 4MRIA 3R96A 4MFJA 1MJ9A 4U5YA 4A2ZA 2PR1A 3TOAA 2G9DA 1ZG8A 2P6FA 1Q2DA 2VBQA 4LX9A 1YW6A 4NGRA 5AG5A 2REEA 3K9TA 1K4JA 2P6EA 1X10A 4CAVA 3SI1A 1CM0A 5A28A 5C82A 2AFMA 3DLJA 4ZX8A 1ARMA 2BEIA 4OKOA 5KTAA 3KASA 4QUSA 1I1DA 4P4BA 3ISZA 4UEZA 3TOBA 4P4JA 1Y0RA 4XNHC 3WC7A 2B5GA 1LOKA 2Z10A 3TC8A 1Z8TA 4DUKA 2JEWA 2DF5A 2FE7A 1XF8A 2GE3A 1XIXA 4FD5A 2CTBA 2CTCA 4RN7A 3LODA 2JBJA 4MFZA 2FSRA 3S9LA 2PJ2A 1LRZA 4UCNA 1P0HA 4I49A 3NE8A 1AYEA 1YW4A 1Y7RA 1ELLP 2PC1A 2ZENA 3UY5A 2OZUA 4OAEA 4QVTA 3TO9A 2PCUA 5CNPA 4CGLA 2V8DA 3SI2A 1I12A 5ELYA 4OMEA 1S7FA 5LYDA 2QECA 4X3RA 1XJOA 4ZYQA 3BI0A 3BXMA 2PR8A 2HB6A 4ORFA 4YGOA 2ZXVA 3PB4X 1Z4RA 2VEZA 4AG9A 4ONWA 1IOIA 3TTHA 2CXAA 4IHMA 2AFWA 4A38A 3N5FA 4UF4A 2ABZA 2Z3PA 4GS4A 5D29A 3BI1A 4ZGYB 3G3SA 3KQXA 2C6CA 4PPZA 4A33A 1ZG9A 2FL4A 4PSXA 2PJ8A 3BJ8A 2YNCC 3V38A 4B5OA 4NFRA 2JDCA 2G3AA 1M4LA 1Y7EA 3PFOA 4GXHA 1NMTA 2AJ6A 3KI9A 4KVXA 4XPDC 4II9A 3CDXA 4XPLA 1X12A 2FVGA 3SJXA 4UA3A 3TT2A 5G22A 4ONUA 3D7DA 1RXTA 3D4UA 2QJ8A 1AUGA 3EO4A 4QB9A 2FCKA 4A30A 4CGOA 2A4NA 5EC4A 2OR4A 5AG7A 4C2XA 4JJXA 1LANA 2I3CA 4CYQA
chains in the Genus database with same CATH topology
2FXFA 4KOXA 3CXQA 4E8OA 2B58A 3N7ZA 4B5PA 4KLWA 1S7LA 4XPKA 4R3KA 4NXYA 3FNCA 2K5TA 2Q7BA 2Q4VA 3TO6A 1QSRA 1KUVA 4KUBA 3W6XA 2X7BA 1S60A 5I0CA 2WPXA 5H86A 4B13A 1YGHA 1J4JA 4CGPA 4A31A 4A95A 3KKWA 3S6KA 1QSTA 1RO5A 2DXQA 2Z3NA 4B14A 2JDDA 2ZPAA 4KOTA 4KUAA 3SXOA 3P2HA 4C7HA 4JXRA 5HMNA 3DR8A 2D4OA 4MJ8A 1QSMA 2Z3KA 3WR7A 5KTCA 4MHDA 4L89A 1XMTA 5J8FA 4JWPA 4KSAA 3TE4A 2ZW4A 2C27A 2Q4YA 3LD2A 4MY0A 4KOVA 5H84A 4PK3A 2GIVA 5G20A 3DSBA 1PUAA 1MK4A 3BLNA 4Q38A 4CS0B 4BMHA 4DNCA 3PP9A 1IIDA 3ZJ0A 4AG7A 4CAXA 3FXTA 1YLEA 3H5ZA 4CAFA 2DPSA 4PK2A 4HNYB 2B3UA 1WWZA 2O28A 3T9YA 2JEVA 1WK4A 4KSFA 2DPTA 2B3VA 4CAEA 4E2AA 2FT0A 4F0XA 4YFJA 1L0CA 4KOWA 5EC4A 2NMTA 3PZJA 4CYNA 1Q2YA 3CXSA 1XE4A 4KVME 3G8WA 1YX0A 4AVAA 2I00A 1BO4A 2B4BA 3VWEA 1I21A 2HV2A 3EY5A 3GYAA 4XPDB 5AG6A 4JXQA 2YNDA 2ZW7A 5AG4A 5GCNA 2GANA 5DWNA 2R8VA 4F6AA 3QB8A 3S6HA 3FYNA 4RS2A 3JTKA 2PQ8A 1B6BA 1Q2CA 1S5KA 4KOUA 4C2ZA 1IYLA 2ATRA 4FD6A 2OU2A 4NF1A 1S3ZA 4KOSA 5BWAB 1MJBA 4UFVA 2YGWA 3R9FA 3OWCA 4KVOE 1PU9A 1S7KA 3IWEA 3QAHA 3TO7A 3MGDA 2Y0MA 5DWMA 3A9LA 1N71A 1YREA 5G21A 4JD6A 4QC6A 2ARHA 1ZO0A 2H5MA 2CNMA 4BBHA 4R9MA 2BUEA 1VKCA 5KTDA 2JLMA 2CY2A 4H6UA 3GKRA 3T90A 3D2MA 2YNCA 2J8NA 3BJ7A 3RYOA 2CNTA 4UCPA 2R98A 3IGRA 3B8GA 2ZW6A 1M4IA 2VZZA 5F49A 3CXPA 3I3GA 4HKFA 2I79A 5EBVA 1QSNA 2FIWA 4C2YA 4OLLA 3P2FA 1Y9KA 3FIXA 4F0YA 2WPWA 2HQYA 4R87A 3NE7A 1GHEA 2B5GB 2Q04A 3IU1A 1FY7A 2R7HA 3S6GA 4CGMA 3F0AA 3GY9A 2P6GA 4M85A 2J8RA 4B10A 3TFYA 4ZBGA 5JPHA 1CJWA 1SQHA 2FIAA 3W91A 4KZTA 4H89A 1TIQA 1IICA 4KLVA 4HNXB 1V0CA 3IWGA 3D3SA 4CYPA 4NEXA 2REFA 4K30A 2Z3MA 2HUZA 3DNSA 2CNSA 3VWDA 2PSWA 2RC4A 1S7NA 4MFPA 4MI4A 3DDDA 4Y49B 4QBJA 4Q36A 4HNWB 1U6MA 2WSAA 1YK3A 5HH1A 5E96A 1VHSA 1UFHA 1OZPA 4EVYA 4NSQA 2QIRA 1YVKA 3R1KA 4PSWA 3FRMA 4AVBA 4C68A 2OZGA 5F47A 2Z11A 5IV0A 4FD4A 3W6SA 1MJAA 4KOYA 4U9YA 2VXKA 3EFAA 2PDOA 4Y49C 1Y9WA 1M44A 2EVNA 3C26A 4IF5A 4B5PB 2FS5A 1M4GA 4NCZA 1BOBA 3EC4A 4UWIA 4X5KA 4CAWA 2B4DB 5FVJA 1ON0A 3PGPA 3EXNA 2KCWA 2J8MA 1QSOA 4CRYB 4M3SA 1NSLA 5C88A 3SXNA 3S6FA 2IL4A 1XEBA 2D4PA 3TCVA 1IB1E 4IUSA 4MBUA 4J3GA 2P0WA 4AB7A 4OADA 4JLYA 1R57A 4CYOA 4UFXA 4A32A 2ZW5A 4R57A 3FB3A 5F48A 4CRZB 1Z4EA 4FD7A 3JVNA 2G3TA 4KS9A 1B87A 4UBRA 1M1DA 2Q0YA 4MFQA 3R9EA 5IX3A 4UWJA 2OH1A 4MY3A 3R9GA 4H6ZA 5ISVA 4L8AA 3SHPA 5AGEA 2R1IA 2PRBA 4UFWA 2F5IA 3K9UA 5F46A 3JUWA 4KORA 2EUIA 3IU2A 1IYKA 1M4DA 2B4DA 2BSWA 1YVOA 4PV6A 1Z9UA 2VQYA 5J8CA 3D8PA 3F8KA 2Z3OA 4AVCA 4MFKA 1KUXA 2VI7A 1YR0A 3D2PA 2YNEA 3E0KA 3ZZIA 1NE9A 4UCMA 4C7IA 2WUUA 3FBUA 2QMLA 3H4QA 1KUYA 3V8IA 4U9ZA 2AE6A 4MFLA 2G0BA 4CGNA 5A27A 4B12A 2VZYA 1KZFA 1P4NA 4B11A 3F5BA 3I9SA 2Q44A 2Z3LA 2OZHA 4YRHA 5IB0A 5JQ4A 5G1ZA 2Z0ZA 4LUAA 4R3LA 4XNHB 3DR6A 4E0AA 2OB0A 4RI1A 2BL1A 3R95A 3R96A 4MFJA 1MJ9A 4U5YA 4A2ZA 2PR1A 3TOAA 2P6FA 1Q2DA 2VBQA 4LX9A 5AG5A 2REEA 1K4JA 2P6EA 4CAVA 1CM0A 5A28A 5C82A 2BEIA 5KTAA 4QUSA 1I1DA 3TOBA 4XNHC 2B5GA 2Z10A 2FE7A 2GE3A 1XF8A 4FD5A 1XIXA 3LODA 4MFZA 2FSRA 1LRZA 4UCNA 1P0HA 4I49A 2PC1A 3UY5A 1Y7RA 2OZUA 4OAEA 4QVTA 3TO9A 5CNPA 4CGLA 1I12A 1S7FA 2QECA 2PR8A 4ORFA 4YGOA 2ZXVA 1Z4RA 2VEZA 4AG9A 3TTHA 2CXAA 2Z3PA 4GS4A 4ZGYB 3G3SA 4A33A 2FL4A 4PSXA 3BJ8A 2YNCC 4B5OA 2JDCA 2G3AA 1NMTA 2AJ6A 4KVXA 4XPDC 4II9A 4XPLA 3TT2A 4UA3A 5G22A 4ONUA 1RXTA 3EO4A 4QB9A 2FCKA 4A30A 4CGOA 2A4NA 4C2XA 5AG7A 4JJXA 4CYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXF A;  4KOX A;  3CXQ A;  4E8O A;  2B58 A;  3N7Z A;  4B5P A;  4KLW A;  1S7L A;  4XPK A;  4R3K A;  4NXY A;  3FNC A;  2K5T A;  2Q7B A;  2Q4V A;  3TO6 A;  1QSR A;  1KUV A;  4KUB A;  3W6X A;  2X7B A;  1S60 A;  5I0C A;  2WPX A;  5H86 A;  1YGH A;  1J4J A;  3KKW A;  3S6K A;  1QST A;  1RO5 A;  2DXQ A;  2JDD A;  2ZPA A;  4KOT A;  4KUA A;  3SXO A;  3P2H A;  4JXR A;  5HMN A;  3DR8 A;  2D4O A;  4MJ8 A;  1QSM A;  3WR7 A;  5KTC A;  4MHD A;  4L89 A;  1XMT A;  5J8F A;  4JWP A;  3TE4 A;  2ZW4 A;  2C27 A;  2Q4Y A;  3LD2 A;  4MY0 A;  4KOV A;  5H84 A;  4PK3 A;  2GIV A;  3DSB A;  1PUA A;  1MK4 A;  3BLN A;  4CS0 B;  4BMH A;  4DNC A;  3PP9 A;  1IID A;  3ZJ0 A;  4AG7 A;  4CAX A;  3FXT A;  1YLE A;  4PK2 A;  4HNY B;  2B3U A;  1WWZ A;  2O28 A;  3T9Y A;  2JEV A;  1WK4 A;  2B3V A;  4E2A A;  2FT0 A;  4YFJ A;  1L0C A;  4KOW A;  5EC4 A;  2NMT A;  3PZJ A;  1Q2Y A;  3CXS A;  1XE4 A;  4KVM E;  3G8W A;  1YX0 A;  4AVA A;  2I00 A;  1BO4 A;  2B4B A;  3VWE A;  1I21 A;  2HV2 A;  3EY5 A;  3GYA A;  4XPD B;  4JXQ A;  2ZW7 A;  5GCN A;  2GAN A;  5DWN A;  2R8V A;  4F6A A;  3QB8 A;  3S6H A;  3FYN A;  4RS2 A;  2PQ8 A;  1B6B A;  1Q2C A;  1S5K A;  4KOU A;  1IYL A;  2ATR A;  4FD6 A;  2OU2 A;  4NF1 A;  1S3Z A;  4KOS A;  1MJB A;  3R9F A;  3OWC A;  4KVO E;  1PU9 A;  1S7K A;  3QAH A;  3TO7 A;  3MGD A;  2Y0M A;  5DWM A;  1N71 A;  1YRE A;  4JD6 A;  4QC6 A;  2ARH A;  2H5M A;  2CNM A;  4R9M A;  2BUE A;  1VKC A;  5KTD A;  2JLM A;  2CY2 A;  4H6U A;  3GKR A;  3T90 A;  3D2M A;  2J8N A;  3BJ7 A;  3RYO A;  2CNT A;  2R98 A;  3IGR A;  3B8G A;  2ZW6 A;  1M4I A;  2VZZ A;  5F49 A;  3CXP A;  3I3G A;  4HKF A;  2I79 A;  5EBV A;  1QSN A;  2FIW A;  4OLL A;  3P2F A;  1Y9K A;  3FIX A;  4F0Y A;  2WPW A;  2HQY A;  4R87 A;  3NE7 A;  1GHE A;  2B5G B;  2Q04 A;  1FY7 A;  2R7H A;  3S6G A;  3F0A A;  3GY9 A;  2P6G A;  4M85 A;  2J8R A;  3TFY A;  4ZBG A;  5JPH A;  1CJW A;  1SQH A;  2FIA A;  3W91 A;  4KZT A;  4H89 A;  1TIQ A;  1IIC A;  4KLV A;  4HNX B;  1V0C A;  3IWG A;  3D3S A;  4NEX A;  2REF A;  4K30 A;  2HUZ A;  3DNS A;  2CNS A;  3VWD A;  2PSW A;  2RC4 A;  1S7N A;  4MI4 A;  3DDD A;  4Y49 B;  4QBJ A;  4HNW B;  1U6M A;  1YK3 A;  5HH1 A;  5E96 A;  1VHS A;  1UFH A;  1OZP A;  4EVY A;  4NSQ A;  2QIR A;  1YVK A;  3R1K A;  4PSW A;  3FRM A;  4AVB A;  2OZG A;  5F47 A;  2Z11 A;  5IV0 A;  4FD4 A;  3W6S A;  1MJA A;  4KOY A;  4U9Y A;  2VXK A;  3EFA A;  2PDO A;  4Y49 C;  1Y9W A;  1M44 A;  2EVN A;  3C26 A;  4IF5 A;  4B5P B;  2FS5 A;  1M4G A;  4NCZ A;  1BOB A;  3EC4 A;  4UWI A;  4X5K A;  4CAW A;  2B4D B;  5FVJ A;  1ON0 A;  3PGP A;  3EXN A;  2KCW A;  2J8M A;  1QSO A;  4CRY B;  4M3S A;  1NSL A;  5C88 A;  3SXN A;  3S6F A;  2IL4 A;  1XEB A;  2D4P A;  3TCV A;  1IB1 E;  4IUS A;  4MBU A;  4J3G A;  2P0W A;  4AB7 A;  4OAD A;  4JLY A;  1R57 A;  2ZW5 A;  4R57 A;  3FB3 A;  5F48 A;  4CRZ B;  1Z4E A;  4FD7 A;  3JVN A;  2G3T A;  1B87 A;  4UBR A;  1M1D A;  2Q0Y A;  3R9E A;  5IX3 A;  4UWJ A;  2OH1 A;  4MY3 A;  3R9G A;  4H6Z A;  5ISV A;  4L8A A;  3SHP A;  2R1I A;  2PRB A;  2F5I A;  3K9U A;  5F46 A;  3JUW A;  4KOR A;  2EUI A;  1IYK A;  1M4D A;  2B4D A;  2BSW A;  1YVO A;  4PV6 A;  1Z9U A;  2VQY A;  5J8C A;  3D8P A;  3F8K A;  4AVC A;  1KUX A;  2VI7 A;  1YR0 A;  3D2P A;  3E0K A;  3ZZI A;  1NE9 A;  3FBU A;  2QML A;  3H4Q A;  1KUY A;  3V8I A;  4U9Z A;  2AE6 A;  2G0B A;  2VZY A;  1KZF A;  1P4N A;  3F5B A;  3I9S A;  2Q44 A;  4YRH A;  2OZH A;  5IB0 A;  5JQ4 A;  2Z0Z A;  4LUA A;  4R3L A;  4XNH B;  3DR6 A;  4E0A A;  2OB0 A;  4RI1 A;  2BL1 A;  3R95 A;  3R96 A;  1MJ9 A;  4U5Y A;  2PR1 A;  3TOA A;  2P6F A;  1Q2D A;  2VBQ A;  4LX9 A;  2REE A;  1K4J A;  2P6E A;  4CAV A;  1CM0 A;  5C82 A;  2BEI A;  5KTA A;  4QUS A;  1I1D A;  3TOB A;  4XNH C;  2B5G A;  2Z10 A;  2FE7 A;  2GE3 A;  1XF8 A;  4FD5 A;  1XIX A;  3LOD A;  2FSR A;  1LRZ A;  1P0H A;  4I49 A;  2PC1 A;  3UY5 A;  1Y7R A;  2OZU A;  4OAE A;  4QVT A;  3TO9 A;  5CNP A;  1I12 A;  1S7F A;  2QEC A;  2PR8 A;  4ORF A;  4YGO A;  2ZXV A;  1Z4R A;  2VEZ A;  4AG9 A;  3TTH A;  4GS4 A;  3G3S A;  2FL4 A;  4PSX A;  3BJ8 A;  4B5O A;  2JDC A;  2G3A A;  1NMT A;  2AJ6 A;  4KVX A;  4XPD C;  4II9 A;  4XPL A;  3TT2 A;  4UA3 A;  4ONU A;  1RXT A;  3EO4 A;  4QB9 A;  2FCK A;  2A4N A;  4JJX A; 
#chains in the Genus database with same CATH topology
 4NGM A;  2FXF A;  4KOX A;  3CXQ A;  4E8O A;  4PXE A;  2B58 A;  3FH4 A;  3N7Z A;  2PVW A;  4TNU A;  4MHY A;  4B5P A;  5F09 A;  1XOV A;  4KLW A;  3V7Z A;  1S7L A;  1VGY A;  2EWB A;  1IU8 A;  5IB9 A;  3MRU A;  4XPK A;  3FEC A;  4R3K A;  4NXY A;  3FNC A;  2K5T A;  2Q7B A;  2Q51 A;  1JQG A;  4OC1 A;  5LYI A;  5HVH A;  3FMC A;  2Q4V A;  4MXU A;  1QSR A;  2ZED A;  3TO6 A;  1HDQ A;  1KUV A;  4KUB A;  3W6X A;  2X7B A;  1S60 A;  3B3C A;  4F9U A;  4OC3 A;  2C6G A;  3CPX A;  2WPX A;  3IWW A;  5H86 A;  3D7G A;  4B13 A;  5JGF A;  1YGH A;  4MCQ A;  1J4J A;  3CZX A;  1PYT B;  4CGP A;  4A31 A;  4A95 A;  3KKW A;  2PJC A;  4ZY2 A;  3S6K A;  1QST A;  1RO5 A;  2DXQ A;  2Z3N A;  4EME A;  4B14 A;  4A39 A;  2JDD A;  2ZPA A;  2AFZ A;  4KOT A;  4KUA A;  3SXO A;  3P2H A;  4C7H A;  4JXR A;  4RUH A;  5HMN A;  2PJA A;  3DR8 A;  3I1U A;  2D4O A;  5JM6 A;  4MJ8 A;  1QSM A;  2XEJ A;  2PJ7 A;  2Z3K A;  3WR7 A;  5KTC A;  3JRU A;  4P4D A;  4MHD A;  2RB7 A;  4L89 A;  1XMT A;  5J8F A;  4JWP A;  4GM5 A;  4KSA A;  3KHZ A;  2ZW4 A;  3TE4 A;  2C27 A;  2Q4Y A;  2JBK A;  1YQE A;  2O53 A;  2PJ4 A;  3KR4 A;  2PJ5 A;  3LD2 A;  4MY0 A;  4ZY0 A;  3GLJ A;  4MMO A;  4NJQ A;  4K3N A;  5J1Q A;  1TF9 A;  4KOV A;  5H84 A;  5LRK A;  3RNZ A;  4PK3 A;  2GIV A;  2PJ0 A;  5G20 A;  1JWQ A;  3DSB A;  4X2T A;  2J9A A;  1PUA A;  1MK4 A;  3BLN A;  4Q38 A;  3KGQ A;  4CS0 B;  4P44 A;  3IO1 A;  1Z2L A;  2GLJ A;  2IQ6 A;  5K8O A;  4OP4 A;  2GLF A;  4BMH A;  4DNC A;  3PP9 A;  1IID A;  3VAT A;  3ZJ0 A;  4AG7 A;  4CAX A;  2V77 A;  3FXT A;  5K8P A;  2NSM A;  1YLE A;  3H5Z A;  3RBU A;  1Z8X A;  4CAF A;  4IK2 A;  2DPS A;  4PK2 A;  4HNY B;  2PJ3 A;  3PBE A;  3B2Y A;  4EFD A;  2PVV A;  3PFE A;  2ZEH A;  3T8W A;  3S9M A;  2B3U A;  4OC4 A;  5I0C A;  1WWZ A;  2O28 A;  8CPA A;  3T9Y A;  2JEV A;  1OBR A;  1Z8W A;  1WK4 A;  1XRY A;  4KSF A;  2DPT A;  2B3V A;  4CAE A;  4E2A A;  2FT0 A;  3GUX A;  4P4I A;  4F0X A;  4YFJ A;  3KHX A;  3SJE A;  1L0C A;  1YME A;  4KOW A;  3LWU A;  1YSJ A;  2PJ1 A;  2NMT A;  2ZEM A;  3PZJ A;  3B7I A;  4X8I A;  4BIN A;  4CYN A;  1Q2Y A;  3CXS A;  4NGP A;  1XE4 A;  3LMS A;  2IJZ A;  4KVM E;  2V8V A;  3G8W A;  1IOF A;  1YX0 A;  3CT9 A;  2I00 A;  4JZ0 A;  4AVA A;  1DE4 C;  1BO4 A;  2B4B A;  3VWE A;  2XEG A;  4WWV A;  1I21 A;  2HV2 A;  3EY5 A;  3GYA A;  4XPD B;  5AG6 A;  4JXQ A;  4MHP A;  2YND A;  2ZW7 A;  5AG4 A;  5GCN A;  2GAN A;  4OC0 A;  2ZEG A;  5DWN A;  4DYO A;  2R8V A;  4F6A A;  1F57 A;  1RTQ A;  2AFX A;  3QB8 A;  5THW A;  3S6H A;  1F2O A;  4B6Z A;  3FYN A;  3NFZ A;  4OC5 A;  4RS2 A;  3B3T A;  3JTK A;  1Z5R A;  4R76 A;  2PQ8 A;  1B6B A;  1Q2C A;  1S5K A;  2GU2 A;  4KOU A;  4BD9 A;  4C2Z A;  3RZA A;  4NGT A;  1IYL A;  2ATR A;  4PXC A;  2F8H A;  4FD6 A;  2OU2 A;  1PCA A;  3WC6 A;  3WC5 A;  5DS0 A;  2ANP A;  4NF1 A;  1S3Z A;  4KOS A;  5BWA B;  4PXB A;  2PIZ A;  1MJB A;  3FED A;  4UFV A;  2YGW A;  3R9F A;  3VAR A;  4F9V A;  2Q4Z A;  3OWC A;  1FNO A;  4KVO E;  1PU9 A;  1S7K A;  3IWE A;  3QAH A;  3TO7 A;  3MGD A;  2Y0M A;  5DWM A;  2ZEP A;  3A9L A;  1N71 A;  1YRE A;  5G21 A;  4JD6 A;  4QC6 A;  2ARH A;  5CBM A;  1ZO0 A;  3IC1 A;  2H5M A;  4AXV A;  2F7V A;  1VHE A;  4NGN A;  2WZN A;  1TKH A;  2CNM A;  4BBH A;  4R9M A;  2BUE A;  1LFW A;  1VKC A;  3KR5 A;  2JLM A;  4WJB A;  5KTD A;  3WAB A;  2CY2 A;  2QYV A;  4P45 A;  3RAM A;  4H6U A;  3GKR A;  2POK A;  3D2M A;  3T90 A;  4F8Z A;  2QVP A;  3GIU A;  2YNC A;  2ZEF A;  2AFU A;  2ZOG A;  3GB0 A;  2J8N A;  3BJ7 A;  3RYO A;  5JH9 A;  1ARL A;  1TKJ A;  2CNT A;  2HC9 A;  2R98 A;  4UCP A;  2GRE A;  3D7F A;  3IGR A;  3B8G A;  2ZW6 A;  1M4I A;  1CG2 A;  2VZZ A;  3KZW A;  4G1P A;  5F49 A;  5I4M A;  1LCP A;  3CXP A;  3I3G A;  4HKF A;  2V8G A;  2I79 A;  4KSI A;  5EBV A;  1AMP A;  4FBE A;  4JYW A;  1QSN A;  3B3V A;  2FIW A;  2XEI A;  3PBB A;  3D67 A;  5LRJ A;  4C2Y A;  1KWM A;  4OLL A;  3P2F A;  1Y9K A;  3FIX A;  4ZX9 A;  4F0Y A;  1Q7L A;  1LAM A;  2WPW A;  1FT7 A;  1HEE A;  2HQY A;  1A2Z A;  1VIX A;  3S9N A;  4R87 A;  3NE7 A;  3HLP A;  1XBU A;  2XEF A;  1GHE A;  2B5G B;  5HVF A;  4P4F A;  1IY7 A;  2Q04 A;  3IU1 A;  3DGV A;  1BPM A;  2EK8 A;  1DTD A;  1FY7 A;  2ZEO A;  2ZEL A;  2R7H A;  3RO0 A;  4HPS A;  3S6G A;  3F0A A;  1CP7 A;  3GY9 A;  4NGS A;  4TWE A;  5LRG A;  4CGM A;  2P6G A;  4IAV A;  4H2K A;  4M85 A;  1BPN A;  1ZG7 A;  1BAV A;  1TF8 A;  2J8R A;  3K2K A;  4B10 A;  4ZBG A;  5JPH A;  1CJW A;  3TFY A;  1SQH A;  2FIA A;  3VH9 A;  1Z8L A;  3D68 A;  3W91 A;  3MN8 A;  4KZT A;  3KL9 A;  4H89 A;  1TIQ A;  1IIC A;  4KLV A;  4HNX B;  1V0C A;  2GFQ A;  3IWG A;  3D3S A;  3QAY A;  3TX8 A;  4CYP A;  4NEX A;  2REF A;  4K30 A;  2EO8 A;  3PB6 X;  2Z3M A;  2HUZ A;  3DNS A;  1XFO A;  2CNS A;  3SI0 A;  3NH8 A;  3VWD A;  4ZI6 A;  2PSW A;  3H8E A;  2RC4 A;  3NH4 A;  1S7N A;  4MFP A;  4MI4 A;  3DDD A;  5HXD A;  4Y49 B;  4QBJ A;  3B3W A;  1CP6 A;  3FVL A;  4Q7A A;  4PQA A;  4Q36 A;  4HNW B;  1U6M A;  2WSA A;  1YK3 A;  5HH1 A;  5E96 A;  1VHS A;  1UFH A;  2PE3 A;  4DJL A;  1CPX A;  1OZP A;  3D66 A;  1YLO A;  2BO9 A;  4EVY A;  4NSQ A;  2QIR A;  1YVK A;  3FEE A;  3WT4 A;  3R1K A;  4UIA A;  3SJG A;  4PSW A;  3FRM A;  4AVB A;  4C68 A;  2OZG A;  5F47 A;  2Z11 A;  5IV0 A;  3PB8 X;  4FD4 A;  3B35 A;  3W6S A;  1TKF A;  1CX8 A;  1MJA A;  4Z65 A;  4KOY A;  1ELM P;  2PJB A;  2WYR A;  3PB7 X;  4U9Y A;  2VXK A;  3EFA A;  1VHO A;  2PDO A;  1Y9W A;  4Y49 C;  1M44 A;  2EVN A;  3C26 A;  4IF5 A;  4B5P B;  2CIJ A;  2FS5 A;  2PJ9 A;  1M4G A;  2AFO A;  4NCZ A;  1BOB A;  3EC4 A;  4UWI A;  4X5K A;  4CAW A;  2DEA A;  4M6G A;  2B4D B;  5FVJ A;  1NSA A;  1ON0 A;  3PGP A;  3EXN A;  2OOT A;  1H8L A;  3H8G A;  2KCW A;  3IFE A;  2J8M A;  1QSO A;  4MCR A;  4NGQ A;  4FUU A;  4CRY B;  2Q7S A;  3IEH A;  4YU9 A;  2C6P A;  3KQZ A;  4A94 A;  4M3S A;  4O23 A;  2ZEE A;  5LYL A;  1NSL A;  3L2N A;  5C88 A;  3SXN A;  5CPA A;  5EMI A;  4A37 A;  3S6F A;  4UEF A;  2IL4 A;  1XEB A;  2D4P A;  3HUV A;  3TCV A;  1IB1 E;  4IUS A;  4ZY1 A;  4MBU A;  4J3G A;  1R3N A;  2P0W A;  3CPA A;  4MCS A;  4JLY A;  4OAD A;  1R57 A;  1R43 A;  3FJU A;  4AB7 A;  4CYO A;  4UFX A;  4A32 A;  2ZW5 A;  1F2P A;  5LYF A;  4R57 A;  3FB3 A;  3PB9 X;  5F48 A;  3NH5 A;  4CRZ B;  2BOA A;  1Z4E A;  4FD7 A;  4FAI A;  7CPA A;  3JVN A;  4OC2 A;  2G3T A;  4KS9 A;  1B87 A;  4UBR A;  3BHX A;  4YWY A;  1TXR A;  1M1D A;  2Q0Y A;  4M6H A;  4MFQ A;  3R9E A;  5HVG A;  1CPS A;  3IJ3 A;  4P4E A;  2EK9 A;  5IX3 A;  2O4H A;  4UWJ A;  2OH1 A;  4MCP A;  4MY3 A;  3R9G A;  4H6Z A;  1LAP A;  2Q43 A;  5ISV A;  4L8A A;  3SHP A;  4OIW A;  1Y0Y A;  5K8M A;  5AGE A;  4M6I A;  2R1I A;  2PRB A;  4UFW A;  1QMU A;  2F5I A;  1BLL E;  3K9U A;  5F46 A;  3JUW A;  3FF3 A;  4P6Y A;  4R6T A;  4KOR A;  4PXD A;  2EUI A;  1GYT A;  3IU2 A;  1IYK A;  1M4D A;  2B4D A;  4FWU A;  2BSW A;  1YVO A;  4PV6 A;  1Z9U A;  2EBJ A;  2PJ6 A;  2VQY A;  4UEE A;  5J8C A;  3D8P A;  3D7H A;  3PEI A;  3F8K A;  2BCO A;  2Z3O A;  4MHZ A;  5K8N A;  2AFS A;  4AVC A;  4MFK A;  1KUX A;  2C1C A;  2VI7 A;  4OID A;  1YR0 A;  3D2P A;  2YNE A;  2PRQ A;  3E0K A;  4LQ6 A;  1NE9 A;  4UCM A;  3ZZI A;  1HDU A;  3LAC A;  2ODF A;  2WUU A;  4C7I A;  3FBU A;  1ZLH A;  2QML A;  3H8F A;  1QQ9 A;  3H4Q A;  3PRT A;  2IMO A;  1KUY A;  4MHN A;  2RFH A;  3V8I A;  4U9Z A;  2AE6 A;  2PIY A;  4MFL A;  2G0B A;  4CGN A;  1IGB A;  1ZLI A;  6CPA A;  1EE3 P;  4W9Y A;  2VL1 A;  5A27 A;  5D8N A;  4UIB A;  2VZY A;  1CBX A;  4B12 A;  4LQG A;  3FX6 A;  3QNV A;  3ISX A;  1KZF A;  1P4N A;  4B11 A;  1XMB A;  3F5B A;  3I9S A;  2Q44 A;  2Z3L A;  2OZH A;  4YRH A;  5IB0 A;  5JQ4 A;  5G1Z A;  3SJF A;  4CPA A;  2Z0Z A;  4LUA A;  4R7M A;  4R3L A;  1UWY A;  4EWT A;  4XNH B;  2CF4 A;  3DR6 A;  2OB0 A;  3IIB A;  2ZOF A;  3NA6 A;  4E0A A;  4RI1 A;  2V8H A;  2BL1 A;  4NJR A;  3B3S A;  2NYQ A;  4P10 A;  3R95 A;  4R8F A;  4MRI A;  3R96 A;  4MFJ A;  1MJ9 A;  4U5Y A;  4A2Z A;  2PR1 A;  3TOA A;  2G9D A;  1ZG8 A;  2P6F A;  1Q2D A;  2VBQ A;  4LX9 A;  1YW6 A;  4NGR A;  5AG5 A;  2REE A;  3K9T A;  1K4J A;  2P6E A;  1X10 A;  4CAV A;  3SI1 A;  1CM0 A;  5A28 A;  5C82 A;  2AFM A;  3DLJ A;  4ZX8 A;  1ARM A;  2BEI A;  4OKO A;  5KTA A;  3KAS A;  4QUS A;  1I1D A;  4P4B A;  3ISZ A;  4UEZ A;  3TOB A;  4P4J A;  1Y0R A;  4XNH C;  3WC7 A;  2B5G A;  1LOK A;  2Z10 A;  3TC8 A;  1Z8T A;  4DUK A;  2JEW A;  2DF5 A;  2FE7 A;  1XF8 A;  2GE3 A;  1XIX A;  4FD5 A;  2CTB A;  2CTC A;  4RN7 A;  3LOD A;  2JBJ A;  4MFZ A;  2FSR A;  3S9L A;  2PJ2 A;  1LRZ A;  4UCN A;  1P0H A;  4I49 A;  3NE8 A;  1AYE A;  1YW4 A;  1Y7R A;  1ELL P;  2PC1 A;  2ZEN A;  3UY5 A;  2OZU A;  4OAE A;  4QVT A;  3TO9 A;  2PCU A;  5CNP A;  4CGL A;  2V8D A;  3SI2 A;  1I12 A;  5ELY A;  4OME A;  1S7F A;  5LYD A;  2QEC A;  4X3R A;  1XJO A;  4ZYQ A;  3BI0 A;  3BXM A;  2PR8 A;  2HB6 A;  4ORF A;  4YGO A;  2ZXV A;  3PB4 X;  1Z4R A;  2VEZ A;  4AG9 A;  4ONW A;  1IOI A;  3TTH A;  2CXA A;  4IHM A;  2AFW A;  4A38 A;  3N5F A;  4UF4 A;  2ABZ A;  2Z3P A;  4GS4 A;  5D29 A;  3BI1 A;  4ZGY B;  3G3S A;  3KQX A;  2C6C A;  4PPZ A;  4A33 A;  1ZG9 A;  2FL4 A;  4PSX A;  2PJ8 A;  3BJ8 A;  2YNC C;  3V38 A;  4B5O A;  4NFR A;  2JDC A;  2G3A A;  1M4L A;  1Y7E A;  3PFO A;  4GXH A;  1NMT A;  2AJ6 A;  3KI9 A;  4KVX A;  4XPD C;  4II9 A;  3CDX A;  4XPL A;  1X12 A;  2FVG A;  3SJX A;  4UA3 A;  3TT2 A;  5G22 A;  4ONU A;  3D7D A;  1RXT A;  3D4U A;  2QJ8 A;  1AUG A;  3EO4 A;  4QB9 A;  2FCK A;  4A30 A;  4CGO A;  2A4N A;  5EC4 A;  2OR4 A;  5AG7 A;  4C2X A;  4JJX A;  1LAN A;  2I3C A;  4CYQ A; 
#chains in the Genus database with same CATH homology
 2FXF A;  4KOX A;  3CXQ A;  4E8O A;  2B58 A;  3N7Z A;  4B5P A;  4KLW A;  1S7L A;  4XPK A;  4R3K A;  4NXY A;  3FNC A;  2K5T A;  2Q7B A;  2Q4V A;  3TO6 A;  1QSR A;  1KUV A;  4KUB A;  3W6X A;  2X7B A;  1S60 A;  5I0C A;  2WPX A;  5H86 A;  4B13 A;  1YGH A;  1J4J A;  4CGP A;  4A31 A;  4A95 A;  3KKW A;  3S6K A;  1QST A;  1RO5 A;  2DXQ A;  2Z3N A;  4B14 A;  2JDD A;  2ZPA A;  4KOT A;  4KUA A;  3SXO A;  3P2H A;  4C7H A;  4JXR A;  5HMN A;  3DR8 A;  2D4O A;  4MJ8 A;  1QSM A;  2Z3K A;  3WR7 A;  5KTC A;  4MHD A;  4L89 A;  1XMT A;  5J8F A;  4JWP A;  4KSA A;  3TE4 A;  2ZW4 A;  2C27 A;  2Q4Y A;  3LD2 A;  4MY0 A;  4KOV A;  5H84 A;  4PK3 A;  2GIV A;  5G20 A;  3DSB A;  1PUA A;  1MK4 A;  3BLN A;  4Q38 A;  4CS0 B;  4BMH A;  4DNC A;  3PP9 A;  1IID A;  3ZJ0 A;  4AG7 A;  4CAX A;  3FXT A;  1YLE A;  3H5Z A;  4CAF A;  2DPS A;  4PK2 A;  4HNY B;  2B3U A;  1WWZ A;  2O28 A;  3T9Y A;  2JEV A;  1WK4 A;  4KSF A;  2DPT A;  2B3V A;  4CAE A;  4E2A A;  2FT0 A;  4F0X A;  4YFJ A;  1L0C A;  4KOW A;  5EC4 A;  2NMT A;  3PZJ A;  4CYN A;  1Q2Y A;  3CXS A;  1XE4 A;  4KVM E;  3G8W A;  1YX0 A;  4AVA A;  2I00 A;  1BO4 A;  2B4B A;  3VWE A;  1I21 A;  2HV2 A;  3EY5 A;  3GYA A;  4XPD B;  5AG6 A;  4JXQ A;  2YND A;  2ZW7 A;  5AG4 A;  5GCN A;  2GAN A;  5DWN A;  2R8V A;  4F6A A;  3QB8 A;  3S6H A;  3FYN A;  4RS2 A;  3JTK A;  2PQ8 A;  1B6B A;  1Q2C A;  1S5K A;  4KOU A;  4C2Z A;  1IYL A;  2ATR A;  4FD6 A;  2OU2 A;  4NF1 A;  1S3Z A;  4KOS A;  5BWA B;  1MJB A;  4UFV A;  2YGW A;  3R9F A;  3OWC A;  4KVO E;  1PU9 A;  1S7K A;  3IWE A;  3QAH A;  3TO7 A;  3MGD A;  2Y0M A;  5DWM A;  3A9L A;  1N71 A;  1YRE A;  5G21 A;  4JD6 A;  4QC6 A;  2ARH A;  1ZO0 A;  2H5M A;  2CNM A;  4BBH A;  4R9M A;  2BUE A;  1VKC A;  5KTD A;  2JLM A;  2CY2 A;  4H6U A;  3GKR A;  3T90 A;  3D2M A;  2YNC A;  2J8N A;  3BJ7 A;  3RYO A;  2CNT A;  4UCP A;  2R98 A;  3IGR A;  3B8G A;  2ZW6 A;  1M4I A;  2VZZ A;  5F49 A;  3CXP A;  3I3G A;  4HKF A;  2I79 A;  5EBV A;  1QSN A;  2FIW A;  4C2Y A;  4OLL A;  3P2F A;  1Y9K A;  3FIX A;  4F0Y A;  2WPW A;  2HQY A;  4R87 A;  3NE7 A;  1GHE A;  2B5G B;  2Q04 A;  3IU1 A;  1FY7 A;  2R7H A;  3S6G A;  4CGM A;  3F0A A;  3GY9 A;  2P6G A;  4M85 A;  2J8R A;  4B10 A;  3TFY A;  4ZBG A;  5JPH A;  1CJW A;  1SQH A;  2FIA A;  3W91 A;  4KZT A;  4H89 A;  1TIQ A;  1IIC A;  4KLV A;  4HNX B;  1V0C A;  3IWG A;  3D3S A;  4CYP A;  4NEX A;  2REF A;  4K30 A;  2Z3M A;  2HUZ A;  3DNS A;  2CNS A;  3VWD A;  2PSW A;  2RC4 A;  1S7N A;  4MFP A;  4MI4 A;  3DDD A;  4Y49 B;  4QBJ A;  4Q36 A;  4HNW B;  1U6M A;  2WSA A;  1YK3 A;  5HH1 A;  5E96 A;  1VHS A;  1UFH A;  1OZP A;  4EVY A;  4NSQ A;  2QIR A;  1YVK A;  3R1K A;  4PSW A;  3FRM A;  4AVB A;  4C68 A;  2OZG A;  5F47 A;  2Z11 A;  5IV0 A;  4FD4 A;  3W6S A;  1MJA A;  4KOY A;  4U9Y A;  2VXK A;  3EFA A;  2PDO A;  4Y49 C;  1Y9W A;  1M44 A;  2EVN A;  3C26 A;  4IF5 A;  4B5P B;  2FS5 A;  1M4G A;  4NCZ A;  1BOB A;  3EC4 A;  4UWI A;  4X5K A;  4CAW A;  2B4D B;  5FVJ A;  1ON0 A;  3PGP A;  3EXN A;  2KCW A;  2J8M A;  1QSO A;  4CRY B;  4M3S A;  1NSL A;  5C88 A;  3SXN A;  3S6F A;  2IL4 A;  1XEB A;  2D4P A;  3TCV A;  1IB1 E;  4IUS A;  4MBU A;  4J3G A;  2P0W A;  4AB7 A;  4OAD A;  4JLY A;  1R57 A;  4CYO A;  4UFX A;  4A32 A;  2ZW5 A;  4R57 A;  3FB3 A;  5F48 A;  4CRZ B;  1Z4E A;  4FD7 A;  3JVN A;  2G3T A;  4KS9 A;  1B87 A;  4UBR A;  1M1D A;  2Q0Y A;  4MFQ A;  3R9E A;  5IX3 A;  4UWJ A;  2OH1 A;  4MY3 A;  3R9G A;  4H6Z A;  5ISV A;  4L8A A;  3SHP A;  5AGE A;  2R1I A;  2PRB A;  4UFW A;  2F5I A;  3K9U A;  5F46 A;  3JUW A;  4KOR A;  2EUI A;  3IU2 A;  1IYK A;  1M4D A;  2B4D A;  2BSW A;  1YVO A;  4PV6 A;  1Z9U A;  2VQY A;  5J8C A;  3D8P A;  3F8K A;  2Z3O A;  4AVC A;  4MFK A;  1KUX A;  2VI7 A;  1YR0 A;  3D2P A;  2YNE A;  3E0K A;  3ZZI A;  1NE9 A;  4UCM A;  4C7I A;  2WUU A;  3FBU A;  2QML A;  3H4Q A;  1KUY A;  3V8I A;  4U9Z A;  2AE6 A;  4MFL A;  2G0B A;  4CGN A;  5A27 A;  4B12 A;  2VZY A;  1KZF A;  1P4N A;  4B11 A;  3F5B A;  3I9S A;  2Q44 A;  2Z3L A;  2OZH A;  4YRH A;  5IB0 A;  5JQ4 A;  5G1Z A;  2Z0Z A;  4LUA A;  4R3L A;  4XNH B;  3DR6 A;  4E0A A;  2OB0 A;  4RI1 A;  2BL1 A;  3R95 A;  3R96 A;  4MFJ A;  1MJ9 A;  4U5Y A;  4A2Z A;  2PR1 A;  3TOA A;  2P6F A;  1Q2D A;  2VBQ A;  4LX9 A;  5AG5 A;  2REE A;  1K4J A;  2P6E A;  4CAV A;  1CM0 A;  5A28 A;  5C82 A;  2BEI A;  5KTA A;  4QUS A;  1I1D A;  3TOB A;  4XNH C;  2B5G A;  2Z10 A;  2FE7 A;  2GE3 A;  1XF8 A;  4FD5 A;  1XIX A;  3LOD A;  4MFZ A;  2FSR A;  1LRZ A;  4UCN A;  1P0H A;  4I49 A;  2PC1 A;  3UY5 A;  1Y7R A;  2OZU A;  4OAE A;  4QVT A;  3TO9 A;  5CNP A;  4CGL A;  1I12 A;  1S7F A;  2QEC A;  2PR8 A;  4ORF A;  4YGO A;  2ZXV A;  1Z4R A;  2VEZ A;  4AG9 A;  3TTH A;  2CXA A;  2Z3P A;  4GS4 A;  4ZGY B;  3G3S A;  4A33 A;  2FL4 A;  4PSX A;  3BJ8 A;  2YNC C;  4B5O A;  2JDC A;  2G3A A;  1NMT A;  2AJ6 A;  4KVX A;  4XPD C;  4II9 A;  4XPL A;  3TT2 A;  4UA3 A;  5G22 A;  4ONU A;  1RXT A;  3EO4 A;  4QB9 A;  2FCK A;  4A30 A;  4CGO A;  2A4N A;  4C2X A;  5AG7 A;  4JJX A;  4CYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...