2J8MA

Structure of p. aeruginosa acetyltransferase pa4866
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
SASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title L-Methionine Sulfoximine, But not Phosphinothricin, is a Substrate for an Acetyltransferase (Gene Pa4866) from Pseudomonas Aeruginosa: Structural and Functional Studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 51
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8mA00
5C82A 1Q2DA 4XPDB 3BLNA 3BJ7A 4HNXB 1OZPA 3TFYA 4MY3A 3W6XA 2Q4YA 1XE4A 5C88A 2VEZA 1NSLA 1NE9A 3H4QA 5J8FA 3FBUA 5GCNA 2FL4A 3D2PA 1VHSA 5IX3A 3T9YA 4MJ8A 3V8IA 4QVTA 2P6FA 4MBUA 4Y49B 2BUEA 1CJWA 3R9FA 4I49A 2B5GA 2KCWA 2HUZA 2VZYA 3DR6A 1V0CA 2WPWA 3D8PA 1KUVA 2QIRA 4NSQA 5DWMA 4YFJA 4KOTA 4NEXA 2PRBA 4R3KA 2J8NA 2PC1A 3CXSA 1WK4A 2BSWA 2Z0ZA 1K4JA 3SXOA 3TCVA 2CNMA 1S5KA 2P6GA 1QSRA 3FXTA 4KLVA 3GKRA 4XPLA 4JXRA 4F0YA 4OAEA 2B4DA 1R57A 4Y49C 5EBVA 4HNYB 4XPKA 4ORFA 2B3UA 4CS0B 5KTAA 3TO7A 4AG9A 2Z10A 4R9MA 4KLWA 3T90A 2ZPAA 4JJXA 3N7ZA 3JVNA 4L89A 1S60A 2FCKA 2EUIA 3QB8A 4UA3A 5F47A 2JEVA 1U6MA 5EC4A 2ZW5A 3DR8A 1J4JA 5E96A 2D4PA 4CAVA 2VBQA 3C26A 1M4DA 4R87A 4E2AA 2PR8A 2R7HA 4UWIA 3FB3A 4NF1A 3P2FA 4MY0A 1XMTA 4OLLA 2OZHA 3EY5A 4HKFA 2Q7BA 2B4BA 1XEBA 4LUAA 3VWEA 2FS5A 2ZW7A 2HV2A 3TE4A 4XNHC 1BO4A 3PP9A 3PZJA 2OZGA 1PU9A 4U9ZA 4NXYA 3D2MA 5FVJA 2OB0A 4E0AA 2B3VA 3G8WA 4E8OA 1QSOA 2I79A 2FE7A 2R1IA 4AVAA 2A4NA 1P4NA 3IWGA 2FXFA 2AJ6A 3I3GA 1YK3A 4H6UA 4QBJA 1I21A 3FNCA 1S7LA 2VXKA 4L8AA 1S7KA 2P0WA 3R9GA 2Q4VA 4KORA 2FSRA 4MHDA 4X5KA 3ZJ0A 3TT2A 2B58A 3B8GA 2I00A 1KUYA 1Y9KA 2CNTA 1SQHA 1Y9WA 2HQYA 1YLEA 5IV0A 4FD6A 2BEIA 4XPDC 1L0CA 4CRYB 4LX9A 4PK3A 4PV6A 3W6SA 4JLYA 4F6AA 3QAHA 3GY9A 2X7BA 1ON0A 1Q2CA 3FIXA 2G3AA 2ZW6A 4YRHA 4HNWB 4JWPA 2VZZA 4R57A 3TO6A 3D3SA 2CY2A 1B6BA 4KOWA 1YVKA 4KOUA 3S6FA 3TO9A 1Z9UA 2NMTA 4FD4A 5HMNA 3LODA 4M3SA 1FY7A 1MK4A 4EVYA 2C27A 4UBRA 3SXNA 5H84A 2JLMA 3F0AA 4MI4A 4UWJA 2F5IA 3EO4A 2IL4A 2REFA 4II9A 2WPXA 5KTCA 4ZBGA 1RO5A 2GE3A 3DSBA 3TTHA 1YREA 5IB0A 1S7FA 4PSWA 2OH1A 1I12A 1UFHA 3S6GA 3OWCA 4IF5A 1QSNA 2GANA 3R9EA 2FT0A 1M44A 4AVCA 4B5PB 1XF8A 4J3GA 4PSXA 4QB9A 1M1DA 3GYAA 5I0CA 4KZTA 2VI7A 1IYLA 5JPHA 3R95A 2ZXVA 2K5TA 4GS4A 3RYOA 2Q0YA 2R98A 1YR0A 3I9SA 3W91A 3E0KA 4FD7A 4NCZA 1CM0A 1M4GA 1VKCA 2QECA 2ATRA 2B5GB 2PR1A 2EVNA 5F46A 3P2HA 1Q2YA 2Q44A 3BJ8A 4KOSA 3TOBA 4KOXA 5DWNA 3EFAA 1LRZA 3FRMA 4AVBA 3WR7A 5JQ4A 3IGRA 4BMHA 3FYNA 5J8CA 4K30A 1XIXA 5CNPA 4CRZB 3UY5A 3DDDA 1TIQA 4RI1A 4B5PA 1QSMA 2B4DB 3PGPA 3DNSA 4R3LA 2PDOA 3TOAA 3S6KA 1WWZA 2FIWA 3KKWA 3NE7A 1RXTA 3MGDA 1MJ9A 3EXNA 2QMLA 4U9YA 1KZFA 1Z4EA 4FD5A 4KOYA 1QSTA 2ARHA 4CAWA 1KUXA 3SHPA 1YX0A 2REEA 3ZZIA 1YVOA 1IB1E 4KVXA 2PSWA 3CXQA 1N71A 3R96A 4PK2A 1BOBA 3VWDA 2O28A 4CAXA 1S3ZA 1I1DA 4U5YA 3F5BA 2VQYA 3R1KA 5KTDA 4M85A 2DXQA 2G0BA 3LD2A 4H89A 1IIDA 2CNSA 1M4IA 2J8RA 1Z4RA 2AE6A 2G3TA 2FIAA 3EC4A 4IUSA 4JXQA 2JDDA 1S7NA 5ISVA 5F49A 2P6EA 3F8KA 2ZW4A 2BL1A 2D4OA 1IICA 4XNHB 3CXPA 4YGOA 2J8MA 1IYKA 1NMTA 3S6HA 2PQ8A 4ONUA 2RC4A 4DNCA 5H86A 2OZUA 1B87A 4AB7A 1Y7RA 4KVME 4KOVA 3JUWA 4KUBA 2OU2A 2Y0MA 1MJBA 2H5MA 3K9UA 5HH1A 1YGHA 4RS2A 4KUAA 4B5OA 2GIVA 1GHEA 4H6ZA 1MJAA 2Z11A 4JD6A 3G3SA 2Q04A 4AG7A 2R8VA 2JDCA 4QC6A 1PUAA 5F48A 4QUSA 4KVOE 4OADA 1P0HA
chains in the Genus database with same CATH superfamily
5C82A 1Q2DA 3WC6A 2V8GA 2AFWA 3I1UA 4XPDB 1R3NA 3BLNA 4A37A 1QMUA 3BJ7A 1F2OA 4HNXB 1NSAA 1OZPA 4FBEA 3TFYA 4H2KA 5LYIA 2CTBA 4BBHA 3S9MA 4MY3A 1Y7EA 1CPSA 3W6XA 3ISXA 1XFOA 3PB7X 2Q4YA 4ONWA 1XE4A 4P44A 5THWA 4DUKA 5C88A 5I4MA 2VEZA 1XRYA 1NSLA 4PXCA 3SI1A 1NE9A 4NGRA 3IWEA 3H4QA 5J8FA 3FBUA 5GCNA 2FL4A 3D2PA 4Q7AA 1VHSA 5IX3A 3T9YA 4MJ8A 2ZEEA 1M4LA 2PJ7A 3VATA 1TF8A 4ZY1A 3V8IA 3S9LA 1RTQA 4QVTA 2P6FA 3DLJA 4MBUA 4Y49B 2BUEA 3HLPA 3PB9X 2V8VA 1CJWA 3R9FA 4I49A 2B5GA 2KCWA 2HUZA 2VZYA 3DR6A 2OOTA 3FVLA 1V0CA 2WPWA 4KSFA 4AXVA 2C6PA 2YNEA 1BPMA 3D8PA 2Z3NA 2F8HA 2PVVA 1KUVA 2PRQA 4OMEA 4TNUA 4UF4A 4NJRA 5LYLA 2QIRA 4NSQA 4A38A 5DWMA 3DGVA 2DF5A 4YFJA 4KOTA 1X10A 4NEXA 2PRBA 4R3KA 2J8NA 2PC1A 3CXSA 1WK4A 3KI9A 2BSWA 4P45A 2Z0ZA 3KL9A 4NGTA 1K4JA 4UFVA 3SXOA 3K2KA 1IY7A 4A33A 3NH8A 2V8HA 1IOIA 2CNMA 2QJ8A 5DS0A 1S5KA 4PQAA 2P6GA 3TCVA 1QSRA 4IHMA 1Z8LA 2AFSA 1LOKA 3FXTA 4KLVA 4WWVA 5D29A 3GKRA 5HVHA 4XPLA 4JXRA 3N5FA 3MN8A 3D7FA 3IIBA 2XEIA 4F0YA 4OAEA 1F2PA 4P6YA 2B4DA 1R57A 4Y49C 5EBVA 4LQGA 1HDUA 4GM5A 4HNYB 4XPKA 4ORFA 1TKFA 2B3UA 2PJ8A 4CS0B 1AYEA 5KTAA 3TO7A 2RB7A 4AG9A 3S9NA 4X8IA 2BOAA 3WABA 2Z10A 4R9MA 5A27A 4KLWA 3T90A 2ZPAA 4UCNA 4JJXA 3N7ZA 3D7HA 3FF3A 2O4HA 3JVNA 4L89A 5CPAA 4EWTA 1S60A 1ZG9A 2FCKA 5G21A 5CBMA 1VGYA 3NA6A 4OKOA 2EUIA 3QB8A 4UA3A 5F47A 4PPZA 2JEVA 1U6MA 5EC4A 2PIZA 2ZW5A 3DR8A 1J4JA 5E96A 2D4PA 4CAVA 3A9LA 2EK9A 2VBQA 3C26A 1M4DA 3IFEA 4R87A 4C7HA 4E2AA 2PR8A 2R7HA 4UWIA 1BLLE 3FB3A 2C6GA 1Z2LA 3P2FA 4MY0A 4NF1A 1XMTA 2V77A 3B3VA 4MHNA 2OZHA 4OLLA 3EY5A 2C1CA 4HKFA 4B11A 3FX6A 2NSMA 2C6CA 4MXUA 4ZY2A 2HB6A 2B4BA 2CXAA 1YSJA 2Q7BA 3SI0A 5K8OA 1XEBA 2J9AA 4UIAA 4MFZA 4LUAA 3VWEA 3PBBA 2FS5A 2ZW7A 2HV2A 3TE4A 4P4BA 1IGBA 2JBJA 4XNHC 4ZYQA 1BO4A 4GXHA 3PP9A 3PZJA 2OZGA 4MHPA 1PU9A 2ZEGA 4A2ZA 1F57A 4NXYA 4U9ZA 3D2MA 2DPTA 5FVJA 4UIBA 1ELLP 1Z8XA 2JBKA 3VH9A 1TF9A 2XEJA 2ZELA 2OB0A 4E0AA 2ZOGA 1ARMA 3FMCA 2B3VA 3G8WA 4NGPA 4P4EA 5ELYA 1QSOA 2I79A 5G1ZA 4E8OA 2EBJA 4CYNA 2FE7A 1KWMA 2R1IA 5D8NA 4AVAA 2A4NA 2GREA 5LRGA 1P4NA 3IWGA 3KR5A 2FXFA 1OBRA 1PYTB 2IJZA 2AFOA 2AJ6A 2PJ9A 3I3GA 5HXDA 1YK3A 4H6UA 4QBJA 3PEIA 4O23A 3WC7A 1I21A 4MFKA 5JGFA 3FNCA 2PJBA 1JWQA 2IMOA 4MFLA 2IQ6A 2ZEMA 2PIYA 1S7LA 3LWUA 5G22A 2VXKA 3SJFA 4L8AA 1S7KA 2P0WA 3R9GA 2Q4VA 1QQ9A 5JM6A 3PBEA 4KORA 2FSRA 3PB4X 4MHDA 4X5KA 5LRJA 3ZJ0A 3TT2A 2B58A 3B8GA 2I00A 1BAVA 3ISZA 4JYWA 1KUYA 4MFQA 4X3RA 1Y9KA 2CNTA 3KR4A 1SQHA 1Y9WA 2HQYA 4B10A 1ELMP 1YLEA 3B7IA 2PJ0A 5IV0A 4MRIA 4FD6A 2BEIA 4R76A 4NGSA 3IU2A 4XPDC 1L0CA 4CRYB 4OC3A 4MCQA 1Z5RA 2RFHA 4LX9A 4PK3A 2YNDA 4PV6A 2ZEOA 2GFQA 3KHZA 3W6SA 4FWUA 2PJCA 4JLYA 2PE3A 3H5ZA 4F6AA 3QAHA 2Z3OA 3GY9A 4K3NA 3SI2A 2CF4A 2X7BA 4HPSA 1ZG7A 4C2YA 1ON0A 2VL1A 2WYRA 4DYOA 1Q2CA 3FIXA 3GB0A 2G3AA 3BI0A 2ZW6A 4YRHA 4HNWB 4JWPA 3KHXA 2ABZA 2CIJA 4BD9A 4F0XA 2VZZA 3GIUA 4R57A 3TO6A 3D3SA 2CY2A 1B6BA 4KOWA 4CGNA 4A39A 1YVKA 4KOUA 3BXMA 3BI1A 3S6FA 4UEEA 5K8NA 1YW4A 3TO9A 3GLJA 1Z9UA 2O53A 4CAEA 2QVPA 3PFEA 4NGMA 2NMTA 4FD4A 5HMNA 3LODA 4M3SA 1FY7A 3NH5A 3CT9A 3JTKA 1MK4A 1YMEA 3D66A 4UEZA 4EVYA 2C27A 4MFPA 4UBRA 3SXNA 1XOVA 1IU8A 4P4IA 4P4FA 1LAPA 4W9YA 5H84A 4YWYA 4A94A 4CYQA 2JLMA 3F0AA 4MI4A 4UWJA 2F5IA 5BWAB 3EO4A 2WUUA 2IL4A 2REFA 4II9A 2WPXA 1H8LA 4Z65A 5KTCA 3IO1A 4ZBGA 1RO5A 2GE3A 1LANA 3DSBA 3TTHA 4EFDA 4PXDA 2AFMA 1YREA 3IWWA 5IB0A 3H8GA 1S7FA 1CP7A 4PSWA 2G9DA 2OH1A 1FT7A 3KZWA 1I12A 1UFHA 3S6GA 3OWCA 4IF5A 1QSNA 2GANA 2Q4ZA 3R9EA 2FT0A 3RNZA 3H8FA 1M44A 1IOFA 4AVCA 4B5PB 1XF8A 4PXEA 4J3GA 1CG2A 4CGMA 4JZ0A 4PSXA 2NYQA 4QB9A 1TXRA 2POKA 1YQEA 1X12A 1M1DA 2Z3PA 3B2YA 3GYAA 5I0CA 4KZTA 2VI7A 1IYLA 5AG7A 5JPHA 1DE4C 1CX8A 2PJ1A 3R95A 4WJBA 3FECA 2ZXVA 1ZG8A 2V8DA 4CGPA 4KS9A 2K5TA 2OR4A 4GS4A 3RYOA 3SJGA 2Q0YA 2R98A 4OC1A 2QYVA 4NGNA 4RN7A 3B35A 3FJUA 1YR0A 4CAFA 4EMEA 5F09A 2Z3MA 2DPSA 3I9SA 4TWEA 1TKJA 3W91A 4M6HA 3RBUA 1EE3P 3E0KA 4FD7A 4NCZA 3LMSA 1CM0A 3H8EA 1M4GA 3LACA 4ZX9A 3B3TA 1VKCA 3CDXA 2QECA 3V7ZA 3D7DA 4IAVA 2ATRA 2B5GB 2PR1A 2EVNA 2AFZA 1LCPA 4C68A 2ZENA 5AGEA 1Y0RA 1BPNA 5F46A 3BHXA 5HVGA 5J1QA 1AUGA 3P2HA 1Q2YA 7CPAA 4MFJA 1PCAA 2Q44A 3BJ8A 4KOSA 3TOBA 2Q7SA 2Q43A 2PJ6A 4KOXA 5DWNA 3EFAA 4P4DA 3B3SA 1TKHA 1LRZA 3FRMA 4AVBA 4F9UA 1DTDA 3NE8A 3WR7A 1VHOA 5JQ4A 3IGRA 1Y0YA 1CP6A 2WZNA 2XEFA 2ZOFA 4BMHA 1YLOA 5AG4A 1Z8WA 3FYNA 5J8CA 4K30A 3K9TA 3B3WA 1XIXA 5CNPA 4OIDA 5G20A 3UY5A 4CRZB 2WSAA 3DDDA 5K8PA 1TIQA 4KSIA 4NGQA 3TX8A 4RI1A 2GU2A 3FH4A 4B5PA 1QSMA 4OC0A 3CZXA 2B4DB 5IB9A 4F9VA 4BINA 3PGPA 2PCUA 3CPXA 3IC1A 2ZEDA 2HC9A 1R43A 3DNSA 4MCSA 4R3LA 4C2ZA 3VARA 2PDOA 3TOAA 3NFZA 5AG6A 4P10A 3B3CA 3IU1A 4MCRA 3GUXA 3S6KA 4DJLA 1WWZA 2FIWA 3KKWA 3NE7A 5LYFA 1RXTA 3MGDA 1ARLA 1MJ9A 3EXNA 4IK2A 2JEWA 2YGWA 4FUUA 1Z8TA 2QMLA 4U9YA 4R6TA 1KZFA 1Z4EA 2ZEFA 4MHYA 1VHEA 5K8MA 4FD5A 4KOYA 1QSTA 2ARHA 1ZLIA 4CAWA 3L2NA 2BCOA 5AG5A 3IJ3A 1CBXA 1KUXA 4M6IA 3SHPA 4ZY0A 5JH9A 1YX0A 2ZEHA 3FEDA 3PB6X 2REEA 3WT4A 3ZZIA 3HUVA 1YVOA 2EWBA 1IB1E 4KVXA 4KSAA 4A32A 1LFWA 2PSWA 3JRUA 3D68A 2BO9A 3CXQA 1N71A 4OC4A 2YNCC 4PK2A 3R96A 1BOBA 3VWDA 1XMBA 2O28A 4CAXA 3SJEA 1S3ZA 2ANPA 3KQXA 3RZAA 3RO0A 4OP4A 4OIWA 5HVFA 2DEAA 3KQZA 1I1DA 4CYPA 3IEHA 4U5YA 3F5BA 2VQYA 3R1KA 5KTDA 4M85A 1LAMA 2DXQA 3RAMA 2GLFA 2G0BA 4R7MA 5LYDA 4A30A 4CGOA 3LD2A 1Q7LA 4H89A 1IIDA 2ZEPA 4OC5A 4UCPA 4B14A 2CNSA 4CGLA 1M4IA 2J8RA 2AFXA 1Z4RA 4C7IA 2AE6A 2G3TA 2FIAA 3EC4A 4IUSA 4JXQA 2JDDA 2YNCA 4OC2A 4ZI6A 4CYOA 4MHZA 1S7NA 2Z3LA 4Q38A 5F49A 5ISVA 2P6EA 2PJ3A 3F8KA 2ZW4A 2AFUA 2BL1A 8CPAA 4UEFA 2F7VA 2D4OA 2PVWA 1UWYA 2Q51A 4MMOA 5EMIA 1HDQA 1IICA 1A2ZA 3KASA 4XNHB 4PXBA 3CXPA 3PRTA 3D67A 2PJAA 1AMPA 3CPAA 4YGOA 4M6GA 3WC5A 6CPAA 4FAIA 4Q36A 3SJXA 1ZO0A 4G1PA 2J8MA 1XBUA 1IYKA 1NMTA 3S6HA 1YW6A 2PQ8A 4ONUA 2I3CA 4RUHA 2RC4A 1FNOA 4DNCA 2XEGA 5H86A 2OZUA 1B87A 4F8ZA 4AB7A 1ZLHA 3D7GA 4UCMA 4UFXA 1Y7RA 4KVME 4KOVA 2PJ5A 2GLJA 4CPAA 4A95A 3JUWA 4KUBA 2OU2A 2Y0MA 1MJBA 2EK8A 2EO8A 2H5MA 1CPXA 3K9UA 1VIXA 3D4UA 3PB8X 1YGHA 2PJ2A 4KUAA 4LQ6A 4RS2A 5HH1A 4A31A 4B12A 2CTCA 3PFOA 1GYTA 2ODFA 4B5OA 5A28A 2GIVA 4NFRA 1GHEA 4H6ZA 4B13A 2FVGA 1MJAA 2Z11A 4P4JA 3KGQA 1XJOA 4JD6A 3G3SA 5LRKA 2PJ4A 3FEEA 2Q04A 4ZX8A 4AG7A 2R8VA 2JDCA 4QC6A 3T8WA 4C2XA 2Z3KA 3QAYA 4YU9A 1JQGA 1PUAA 3MRUA 4B6ZA 3QNVA 4NJQA 4ZGYB 3NH4A 1HEEA 3TC8A 4MCPA 4X2TA 5F48A 4QUSA 4KVOE 4OADA 4UFWA 3V38A 4R8FA 1P0HA
chains in the Genus database with same CATH topology
5C82A 1Q2DA 4XPDB 3BLNA 3BJ7A 4HNXB 1OZPA 3TFYA 4BBHA 4MY3A 3W6XA 2Q4YA 1XE4A 5C88A 2VEZA 1NSLA 1NE9A 3IWEA 3H4QA 5J8FA 3FBUA 5GCNA 2FL4A 3D2PA 1VHSA 5IX3A 3T9YA 4MJ8A 3V8IA 4QVTA 2P6FA 4MBUA 4Y49B 2BUEA 1CJWA 3R9FA 4I49A 2B5GA 2KCWA 2HUZA 2VZYA 3DR6A 1V0CA 2WPWA 4KSFA 2YNEA 3D8PA 2Z3NA 1KUVA 2QIRA 4NSQA 5DWMA 4YFJA 4KOTA 4NEXA 2PRBA 4R3KA 2J8NA 2PC1A 3CXSA 1WK4A 2BSWA 2Z0ZA 1K4JA 4UFVA 3SXOA 4A33A 3TCVA 2CNMA 1S5KA 2P6GA 1QSRA 3FXTA 4KLVA 3GKRA 4XPLA 4JXRA 4F0YA 4OAEA 2B4DA 1R57A 4Y49C 5EBVA 4HNYB 4XPKA 4ORFA 2B3UA 4CS0B 5KTAA 3TO7A 4AG9A 2Z10A 4R9MA 5A27A 4KLWA 3T90A 2ZPAA 4UCNA 4JJXA 3N7ZA 3JVNA 4L89A 1S60A 2FCKA 5G21A 2EUIA 3QB8A 4UA3A 5F47A 2JEVA 1U6MA 5EC4A 2ZW5A 3DR8A 1J4JA 5E96A 2D4PA 4CAVA 3A9LA 2VBQA 3C26A 1M4DA 4C7HA 4R87A 4E2AA 2PR8A 2R7HA 4UWIA 3FB3A 4NF1A 3P2FA 4MY0A 1XMTA 4OLLA 2OZHA 3EY5A 4HKFA 4B11A 2Q7BA 2B4BA 2CXAA 1XEBA 4MFZA 4LUAA 3VWEA 2FS5A 2ZW7A 2HV2A 3TE4A 4XNHC 1BO4A 3PP9A 3PZJA 2OZGA 1PU9A 4A2ZA 4U9ZA 4NXYA 3D2MA 2DPTA 5FVJA 2OB0A 4E0AA 2B3VA 3G8WA 4E8OA 1QSOA 2I79A 5G1ZA 4CYNA 2FE7A 2R1IA 4AVAA 2A4NA 1P4NA 3IWGA 2FXFA 2AJ6A 3I3GA 1YK3A 4H6UA 4QBJA 1I21A 4MFKA 3FNCA 4MFLA 1S7LA 5G22A 2VXKA 4L8AA 1S7KA 2P0WA 3R9GA 2Q4VA 4KORA 2FSRA 4MHDA 4X5KA 3ZJ0A 3TT2A 2B58A 3B8GA 2I00A 1KUYA 4MFQA 1Y9KA 2CNTA 1SQHA 1Y9WA 2HQYA 4B10A 1YLEA 5IV0A 4FD6A 2BEIA 3IU2A 4XPDC 1L0CA 4CRYB 4LX9A 4PK3A 2YNDA 4PV6A 3W6SA 4JLYA 3H5ZA 4F6AA 3QAHA 2Z3OA 3GY9A 2X7BA 4C2YA 1ON0A 1Q2CA 3FIXA 2G3AA 2ZW6A 4YRHA 4HNWB 4JWPA 4F0XA 2VZZA 4R57A 3TO6A 3D3SA 2CY2A 1B6BA 4KOWA 4CGNA 1YVKA 4KOUA 3S6FA 3TO9A 1Z9UA 4CAEA 2NMTA 4FD4A 5HMNA 3LODA 4M3SA 1FY7A 3JTKA 1MK4A 4EVYA 2C27A 4MFPA 4UBRA 3SXNA 5H84A 4CYQA 2JLMA 3F0AA 4MI4A 4UWJA 2F5IA 5BWAB 3EO4A 2WUUA 2IL4A 2REFA 4II9A 2WPXA 5KTCA 4ZBGA 1RO5A 2GE3A 3DSBA 3TTHA 1YREA 5IB0A 1S7FA 4PSWA 2OH1A 1I12A 1UFHA 3S6GA 3OWCA 4IF5A 1QSNA 2GANA 3R9EA 2FT0A 1M44A 4AVCA 4B5PB 1XF8A 4J3GA 4CGMA 4PSXA 4QB9A 2Z3PA 1M1DA 3GYAA 5I0CA 4KZTA 2VI7A 1IYLA 5AG7A 5JPHA 3R95A 2ZXVA 4CGPA 4KS9A 2K5TA 4GS4A 3RYOA 2Q0YA 2R98A 1YR0A 4CAFA 2Z3MA 2DPSA 3I9SA 3W91A 3E0KA 4FD7A 4NCZA 1CM0A 1M4GA 1VKCA 2QECA 2ATRA 2B5GB 2PR1A 2EVNA 4C68A 5AGEA 5F46A 3P2HA 1Q2YA 4MFJA 2Q44A 3BJ8A 4KOSA 3TOBA 4KOXA 5DWNA 3EFAA 1LRZA 3FRMA 4AVBA 3WR7A 5JQ4A 3IGRA 5AG4A 4BMHA 3FYNA 5J8CA 4K30A 1XIXA 5CNPA 5G20A 3UY5A 4CRZB 2WSAA 3DDDA 1TIQA 4RI1A 4B5PA 1QSMA 2B4DB 3PGPA 3DNSA 4R3LA 4C2ZA 2PDOA 3TOAA 5AG6A 3IU1A 3S6KA 1WWZA 2FIWA 3KKWA 3NE7A 1RXTA 3MGDA 1MJ9A 3EXNA 2YGWA 2QMLA 4U9YA 1KZFA 1Z4EA 4FD5A 4KOYA 1QSTA 2ARHA 4CAWA 5AG5A 1KUXA 3SHPA 1YX0A 2REEA 3ZZIA 1YVOA 1IB1E 4KVXA 4KSAA 4A32A 2PSWA 3CXQA 1N71A 3R96A 2YNCC 4PK2A 1BOBA 3VWDA 2O28A 4CAXA 1S3ZA 1I1DA 4CYPA 4U5YA 3F5BA 2VQYA 3R1KA 5KTDA 4M85A 2DXQA 2G0BA 4A30A 4CGOA 3LD2A 4H89A 1IIDA 4UCPA 4B14A 2CNSA 4CGLA 1M4IA 2J8RA 1Z4RA 4C7IA 2AE6A 2G3TA 2FIAA 3EC4A 4IUSA 4JXQA 2JDDA 2YNCA 4CYOA 1S7NA 2Z3LA 4Q38A 5F49A 5ISVA 2P6EA 3F8KA 2ZW4A 2BL1A 2D4OA 1IICA 4XNHB 3CXPA 4YGOA 4Q36A 1ZO0A 2J8MA 1IYKA 1NMTA 3S6HA 2PQ8A 4ONUA 2RC4A 4DNCA 5H86A 2OZUA 1B87A 4AB7A 4UCMA 4UFXA 1Y7RA 4KVME 4KOVA 4A95A 3JUWA 4KUBA 2OU2A 2Y0MA 1MJBA 2H5MA 3K9UA 5HH1A 1YGHA 4RS2A 4KUAA 4A31A 4B12A 5A28A 4B5OA 2GIVA 1GHEA 4H6ZA 4B13A 1MJAA 2Z11A 4JD6A 3G3SA 2Q04A 4AG7A 2R8VA 2JDCA 4QC6A 4C2XA 2Z3KA 1PUAA 4ZGYB 5F48A 4QUSA 4KVOE 4OADA 4UFWA 1P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C82 A;  1Q2D A;  4XPD B;  3BLN A;  3BJ7 A;  4HNX B;  1OZP A;  3TFY A;  4MY3 A;  3W6X A;  2Q4Y A;  1XE4 A;  5C88 A;  2VEZ A;  1NSL A;  1NE9 A;  3H4Q A;  5J8F A;  3FBU A;  5GCN A;  2FL4 A;  3D2P A;  1VHS A;  5IX3 A;  3T9Y A;  4MJ8 A;  3V8I A;  4QVT A;  2P6F A;  4MBU A;  4Y49 B;  2BUE A;  1CJW A;  3R9F A;  4I49 A;  2B5G A;  2KCW A;  2HUZ A;  2VZY A;  3DR6 A;  1V0C A;  2WPW A;  3D8P A;  1KUV A;  2QIR A;  4NSQ A;  5DWM A;  4YFJ A;  4KOT A;  4NEX A;  2PRB A;  4R3K A;  2J8N A;  2PC1 A;  3CXS A;  1WK4 A;  2BSW A;  2Z0Z A;  1K4J A;  3SXO A;  3TCV A;  2CNM A;  1S5K A;  2P6G A;  1QSR A;  3FXT A;  4KLV A;  3GKR A;  4XPL A;  4JXR A;  4F0Y A;  4OAE A;  2B4D A;  1R57 A;  4Y49 C;  5EBV A;  4HNY B;  4XPK A;  4ORF A;  2B3U A;  4CS0 B;  5KTA A;  3TO7 A;  4AG9 A;  2Z10 A;  4R9M A;  4KLW A;  3T90 A;  2ZPA A;  4JJX A;  3N7Z A;  3JVN A;  4L89 A;  1S60 A;  2FCK A;  2EUI A;  3QB8 A;  4UA3 A;  5F47 A;  2JEV A;  1U6M A;  5EC4 A;  2ZW5 A;  3DR8 A;  1J4J A;  5E96 A;  2D4P A;  4CAV A;  2VBQ A;  3C26 A;  1M4D A;  4R87 A;  4E2A A;  2PR8 A;  2R7H A;  4UWI A;  3FB3 A;  4NF1 A;  3P2F A;  4MY0 A;  1XMT A;  4OLL A;  2OZH A;  3EY5 A;  4HKF A;  2Q7B A;  2B4B A;  1XEB A;  4LUA A;  3VWE A;  2FS5 A;  2ZW7 A;  2HV2 A;  3TE4 A;  4XNH C;  1BO4 A;  3PP9 A;  3PZJ A;  2OZG A;  1PU9 A;  4U9Z A;  4NXY A;  3D2M A;  5FVJ A;  2OB0 A;  4E0A A;  2B3V A;  3G8W A;  4E8O A;  1QSO A;  2I79 A;  2FE7 A;  2R1I A;  4AVA A;  2A4N A;  1P4N A;  3IWG A;  2FXF A;  2AJ6 A;  3I3G A;  1YK3 A;  4H6U A;  4QBJ A;  1I21 A;  3FNC A;  1S7L A;  2VXK A;  4L8A A;  1S7K A;  2P0W A;  3R9G A;  2Q4V A;  4KOR A;  2FSR A;  4MHD A;  4X5K A;  3ZJ0 A;  3TT2 A;  2B58 A;  3B8G A;  2I00 A;  1KUY A;  1Y9K A;  2CNT A;  1SQH A;  1Y9W A;  2HQY A;  1YLE A;  5IV0 A;  4FD6 A;  2BEI A;  4XPD C;  1L0C A;  4CRY B;  4LX9 A;  4PK3 A;  4PV6 A;  3W6S A;  4JLY A;  4F6A A;  3QAH A;  3GY9 A;  2X7B A;  1ON0 A;  1Q2C A;  3FIX A;  2G3A A;  2ZW6 A;  4YRH A;  4HNW B;  4JWP A;  2VZZ A;  4R57 A;  3TO6 A;  3D3S A;  2CY2 A;  1B6B A;  4KOW A;  1YVK A;  4KOU A;  3S6F A;  3TO9 A;  1Z9U A;  2NMT A;  4FD4 A;  5HMN A;  3LOD A;  4M3S A;  1FY7 A;  1MK4 A;  4EVY A;  2C27 A;  4UBR A;  3SXN A;  5H84 A;  2JLM A;  3F0A A;  4MI4 A;  4UWJ A;  2F5I A;  3EO4 A;  2IL4 A;  2REF A;  4II9 A;  2WPX A;  5KTC A;  4ZBG A;  1RO5 A;  2GE3 A;  3DSB A;  3TTH A;  1YRE A;  5IB0 A;  1S7F A;  4PSW A;  2OH1 A;  1I12 A;  1UFH A;  3S6G A;  3OWC A;  4IF5 A;  1QSN A;  2GAN A;  3R9E A;  2FT0 A;  1M44 A;  4AVC A;  4B5P B;  1XF8 A;  4J3G A;  4PSX A;  4QB9 A;  1M1D A;  3GYA A;  5I0C A;  4KZT A;  2VI7 A;  1IYL A;  5JPH A;  3R95 A;  2ZXV A;  2K5T A;  4GS4 A;  3RYO A;  2Q0Y A;  2R98 A;  1YR0 A;  3I9S A;  3W91 A;  3E0K A;  4FD7 A;  4NCZ A;  1CM0 A;  1M4G A;  1VKC A;  2QEC A;  2ATR A;  2B5G B;  2PR1 A;  2EVN A;  5F46 A;  3P2H A;  1Q2Y A;  2Q44 A;  3BJ8 A;  4KOS A;  3TOB A;  4KOX A;  5DWN A;  3EFA A;  1LRZ A;  3FRM A;  4AVB A;  3WR7 A;  5JQ4 A;  3IGR A;  4BMH A;  3FYN A;  5J8C A;  4K30 A;  1XIX A;  5CNP A;  4CRZ B;  3UY5 A;  3DDD A;  1TIQ A;  4RI1 A;  4B5P A;  1QSM A;  2B4D B;  3PGP A;  3DNS A;  4R3L A;  2PDO A;  3TOA A;  3S6K A;  1WWZ A;  2FIW A;  3KKW A;  3NE7 A;  1RXT A;  3MGD A;  1MJ9 A;  3EXN A;  2QML A;  4U9Y A;  1KZF A;  1Z4E A;  4FD5 A;  4KOY A;  1QST A;  2ARH A;  4CAW A;  1KUX A;  3SHP A;  1YX0 A;  2REE A;  3ZZI A;  1YVO A;  1IB1 E;  4KVX A;  2PSW A;  3CXQ A;  1N71 A;  3R96 A;  4PK2 A;  1BOB A;  3VWD A;  2O28 A;  4CAX A;  1S3Z A;  1I1D A;  4U5Y A;  3F5B A;  2VQY A;  3R1K A;  5KTD A;  4M85 A;  2DXQ A;  2G0B A;  3LD2 A;  4H89 A;  1IID A;  2CNS A;  1M4I A;  2J8R A;  1Z4R A;  2AE6 A;  2G3T A;  2FIA A;  3EC4 A;  4IUS A;  4JXQ A;  2JDD A;  1S7N A;  5ISV A;  5F49 A;  2P6E A;  3F8K A;  2ZW4 A;  2BL1 A;  2D4O A;  1IIC A;  4XNH B;  3CXP A;  4YGO A;  2J8M A;  1IYK A;  1NMT A;  3S6H A;  2PQ8 A;  4ONU A;  2RC4 A;  4DNC A;  5H86 A;  2OZU A;  1B87 A;  4AB7 A;  1Y7R A;  4KVM E;  4KOV A;  3JUW A;  4KUB A;  2OU2 A;  2Y0M A;  1MJB A;  2H5M A;  3K9U A;  5HH1 A;  1YGH A;  4RS2 A;  4KUA A;  4B5O A;  2GIV A;  1GHE A;  4H6Z A;  1MJA A;  2Z11 A;  4JD6 A;  3G3S A;  2Q04 A;  4AG7 A;  2R8V A;  2JDC A;  4QC6 A;  1PUA A;  5F48 A;  4QUS A;  4KVO E;  4OAD A;  1P0H A; 
#chains in the Genus database with same CATH topology
 5C82 A;  1Q2D A;  3WC6 A;  2V8G A;  2AFW A;  3I1U A;  4XPD B;  1R3N A;  3BLN A;  4A37 A;  1QMU A;  3BJ7 A;  1F2O A;  4HNX B;  1NSA A;  1OZP A;  4FBE A;  3TFY A;  4H2K A;  5LYI A;  2CTB A;  4BBH A;  3S9M A;  4MY3 A;  1Y7E A;  1CPS A;  3W6X A;  3ISX A;  1XFO A;  3PB7 X;  2Q4Y A;  4ONW A;  1XE4 A;  4P44 A;  5THW A;  4DUK A;  5C88 A;  5I4M A;  2VEZ A;  1XRY A;  1NSL A;  4PXC A;  3SI1 A;  1NE9 A;  4NGR A;  3IWE A;  3H4Q A;  5J8F A;  3FBU A;  5GCN A;  2FL4 A;  3D2P A;  4Q7A A;  1VHS A;  5IX3 A;  3T9Y A;  4MJ8 A;  2ZEE A;  1M4L A;  2PJ7 A;  3VAT A;  1TF8 A;  4ZY1 A;  3V8I A;  3S9L A;  1RTQ A;  4QVT A;  2P6F A;  3DLJ A;  4MBU A;  4Y49 B;  2BUE A;  3HLP A;  3PB9 X;  2V8V A;  1CJW A;  3R9F A;  4I49 A;  2B5G A;  2KCW A;  2HUZ A;  2VZY A;  3DR6 A;  2OOT A;  3FVL A;  1V0C A;  2WPW A;  4KSF A;  4AXV A;  2C6P A;  2YNE A;  1BPM A;  3D8P A;  2Z3N A;  2F8H A;  2PVV A;  1KUV A;  2PRQ A;  4OME A;  4TNU A;  4UF4 A;  4NJR A;  5LYL A;  2QIR A;  4NSQ A;  4A38 A;  5DWM A;  3DGV A;  2DF5 A;  4YFJ A;  4KOT A;  1X10 A;  4NEX A;  2PRB A;  4R3K A;  2J8N A;  2PC1 A;  3CXS A;  1WK4 A;  3KI9 A;  2BSW A;  4P45 A;  2Z0Z A;  3KL9 A;  4NGT A;  1K4J A;  4UFV A;  3SXO A;  3K2K A;  1IY7 A;  4A33 A;  3NH8 A;  2V8H A;  1IOI A;  2CNM A;  2QJ8 A;  5DS0 A;  1S5K A;  4PQA A;  2P6G A;  3TCV A;  1QSR A;  4IHM A;  1Z8L A;  2AFS A;  1LOK A;  3FXT A;  4KLV A;  4WWV A;  5D29 A;  3GKR A;  5HVH A;  4XPL A;  4JXR A;  3N5F A;  3MN8 A;  3D7F A;  3IIB A;  2XEI A;  4F0Y A;  4OAE A;  1F2P A;  4P6Y A;  2B4D A;  1R57 A;  4Y49 C;  5EBV A;  4LQG A;  1HDU A;  4GM5 A;  4HNY B;  4XPK A;  4ORF A;  1TKF A;  2B3U A;  2PJ8 A;  4CS0 B;  1AYE A;  5KTA A;  3TO7 A;  2RB7 A;  4AG9 A;  3S9N A;  4X8I A;  2BOA A;  3WAB A;  2Z10 A;  4R9M A;  5A27 A;  4KLW A;  3T90 A;  2ZPA A;  4UCN A;  4JJX A;  3N7Z A;  3D7H A;  3FF3 A;  2O4H A;  3JVN A;  4L89 A;  5CPA A;  4EWT A;  1S60 A;  1ZG9 A;  2FCK A;  5G21 A;  5CBM A;  1VGY A;  3NA6 A;  4OKO A;  2EUI A;  3QB8 A;  4UA3 A;  5F47 A;  4PPZ A;  2JEV A;  1U6M A;  5EC4 A;  2PIZ A;  2ZW5 A;  3DR8 A;  1J4J A;  5E96 A;  2D4P A;  4CAV A;  3A9L A;  2EK9 A;  2VBQ A;  3C26 A;  1M4D A;  3IFE A;  4R87 A;  4C7H A;  4E2A A;  2PR8 A;  2R7H A;  4UWI A;  1BLL E;  3FB3 A;  2C6G A;  1Z2L A;  3P2F A;  4MY0 A;  4NF1 A;  1XMT A;  2V77 A;  3B3V A;  4MHN A;  2OZH A;  4OLL A;  3EY5 A;  2C1C A;  4HKF A;  4B11 A;  3FX6 A;  2NSM A;  2C6C A;  4MXU A;  4ZY2 A;  2HB6 A;  2B4B A;  2CXA A;  1YSJ A;  2Q7B A;  3SI0 A;  5K8O A;  1XEB A;  2J9A A;  4UIA A;  4MFZ A;  4LUA A;  3VWE A;  3PBB A;  2FS5 A;  2ZW7 A;  2HV2 A;  3TE4 A;  4P4B A;  1IGB A;  2JBJ A;  4XNH C;  4ZYQ A;  1BO4 A;  4GXH A;  3PP9 A;  3PZJ A;  2OZG A;  4MHP A;  1PU9 A;  2ZEG A;  4A2Z A;  1F57 A;  4NXY A;  4U9Z A;  3D2M A;  2DPT A;  5FVJ A;  4UIB A;  1ELL P;  1Z8X A;  2JBK A;  3VH9 A;  1TF9 A;  2XEJ A;  2ZEL A;  2OB0 A;  4E0A A;  2ZOG A;  1ARM A;  3FMC A;  2B3V A;  3G8W A;  4NGP A;  4P4E A;  5ELY A;  1QSO A;  2I79 A;  5G1Z A;  4E8O A;  2EBJ A;  4CYN A;  2FE7 A;  1KWM A;  2R1I A;  5D8N A;  4AVA A;  2A4N A;  2GRE A;  5LRG A;  1P4N A;  3IWG A;  3KR5 A;  2FXF A;  1OBR A;  1PYT B;  2IJZ A;  2AFO A;  2AJ6 A;  2PJ9 A;  3I3G A;  5HXD A;  1YK3 A;  4H6U A;  4QBJ A;  3PEI A;  4O23 A;  3WC7 A;  1I21 A;  4MFK A;  5JGF A;  3FNC A;  2PJB A;  1JWQ A;  2IMO A;  4MFL A;  2IQ6 A;  2ZEM A;  2PIY A;  1S7L A;  3LWU A;  5G22 A;  2VXK A;  3SJF A;  4L8A A;  1S7K A;  2P0W A;  3R9G A;  2Q4V A;  1QQ9 A;  5JM6 A;  3PBE A;  4KOR A;  2FSR A;  3PB4 X;  4MHD A;  4X5K A;  5LRJ A;  3ZJ0 A;  3TT2 A;  2B58 A;  3B8G A;  2I00 A;  1BAV A;  3ISZ A;  4JYW A;  1KUY A;  4MFQ A;  4X3R A;  1Y9K A;  2CNT A;  3KR4 A;  1SQH A;  1Y9W A;  2HQY A;  4B10 A;  1ELM P;  1YLE A;  3B7I A;  2PJ0 A;  5IV0 A;  4MRI A;  4FD6 A;  2BEI A;  4R76 A;  4NGS A;  3IU2 A;  4XPD C;  1L0C A;  4CRY B;  4OC3 A;  4MCQ A;  1Z5R A;  2RFH A;  4LX9 A;  4PK3 A;  2YND A;  4PV6 A;  2ZEO A;  2GFQ A;  3KHZ A;  3W6S A;  4FWU A;  2PJC A;  4JLY A;  2PE3 A;  3H5Z A;  4F6A A;  3QAH A;  2Z3O A;  3GY9 A;  4K3N A;  3SI2 A;  2CF4 A;  2X7B A;  4HPS A;  1ZG7 A;  4C2Y A;  1ON0 A;  2VL1 A;  2WYR A;  4DYO A;  1Q2C A;  3FIX A;  3GB0 A;  2G3A A;  3BI0 A;  2ZW6 A;  4YRH A;  4HNW B;  4JWP A;  3KHX A;  2ABZ A;  2CIJ A;  4BD9 A;  4F0X A;  2VZZ A;  3GIU A;  4R57 A;  3TO6 A;  3D3S A;  2CY2 A;  1B6B A;  4KOW A;  4CGN A;  4A39 A;  1YVK A;  4KOU A;  3BXM A;  3BI1 A;  3S6F A;  4UEE A;  5K8N A;  1YW4 A;  3TO9 A;  3GLJ A;  1Z9U A;  2O53 A;  4CAE A;  2QVP A;  3PFE A;  4NGM A;  2NMT A;  4FD4 A;  5HMN A;  3LOD A;  4M3S A;  1FY7 A;  3NH5 A;  3CT9 A;  3JTK A;  1MK4 A;  1YME A;  3D66 A;  4UEZ A;  4EVY A;  2C27 A;  4MFP A;  4UBR A;  3SXN A;  1XOV A;  1IU8 A;  4P4I A;  4P4F A;  1LAP A;  4W9Y A;  5H84 A;  4YWY A;  4A94 A;  4CYQ A;  2JLM A;  3F0A A;  4MI4 A;  4UWJ A;  2F5I A;  5BWA B;  3EO4 A;  2WUU A;  2IL4 A;  2REF A;  4II9 A;  2WPX A;  1H8L A;  4Z65 A;  5KTC A;  3IO1 A;  4ZBG A;  1RO5 A;  2GE3 A;  1LAN A;  3DSB A;  3TTH A;  4EFD A;  4PXD A;  2AFM A;  1YRE A;  3IWW A;  5IB0 A;  3H8G A;  1S7F A;  1CP7 A;  4PSW A;  2G9D A;  2OH1 A;  1FT7 A;  3KZW A;  1I12 A;  1UFH A;  3S6G A;  3OWC A;  4IF5 A;  1QSN A;  2GAN A;  2Q4Z A;  3R9E A;  2FT0 A;  3RNZ A;  3H8F A;  1M44 A;  1IOF A;  4AVC A;  4B5P B;  1XF8 A;  4PXE A;  4J3G A;  1CG2 A;  4CGM A;  4JZ0 A;  4PSX A;  2NYQ A;  4QB9 A;  1TXR A;  2POK A;  1YQE A;  1X12 A;  1M1D A;  2Z3P A;  3B2Y A;  3GYA A;  5I0C A;  4KZT A;  2VI7 A;  1IYL A;  5AG7 A;  5JPH A;  1DE4 C;  1CX8 A;  2PJ1 A;  3R95 A;  4WJB A;  3FEC A;  2ZXV A;  1ZG8 A;  2V8D A;  4CGP A;  4KS9 A;  2K5T A;  2OR4 A;  4GS4 A;  3RYO A;  3SJG A;  2Q0Y A;  2R98 A;  4OC1 A;  2QYV A;  4NGN A;  4RN7 A;  3B35 A;  3FJU A;  1YR0 A;  4CAF A;  4EME A;  5F09 A;  2Z3M A;  2DPS A;  3I9S A;  4TWE A;  1TKJ A;  3W91 A;  4M6H A;  3RBU A;  1EE3 P;  3E0K A;  4FD7 A;  4NCZ A;  3LMS A;  1CM0 A;  3H8E A;  1M4G A;  3LAC A;  4ZX9 A;  3B3T A;  1VKC A;  3CDX A;  2QEC A;  3V7Z A;  3D7D A;  4IAV A;  2ATR A;  2B5G B;  2PR1 A;  2EVN A;  2AFZ A;  1LCP A;  4C68 A;  2ZEN A;  5AGE A;  1Y0R A;  1BPN A;  5F46 A;  3BHX A;  5HVG A;  5J1Q A;  1AUG A;  3P2H A;  1Q2Y A;  7CPA A;  4MFJ A;  1PCA A;  2Q44 A;  3BJ8 A;  4KOS A;  3TOB A;  2Q7S A;  2Q43 A;  2PJ6 A;  4KOX A;  5DWN A;  3EFA A;  4P4D A;  3B3S A;  1TKH A;  1LRZ A;  3FRM A;  4AVB A;  4F9U A;  1DTD A;  3NE8 A;  3WR7 A;  1VHO A;  5JQ4 A;  3IGR A;  1Y0Y A;  1CP6 A;  2WZN A;  2XEF A;  2ZOF A;  4BMH A;  1YLO A;  5AG4 A;  1Z8W A;  3FYN A;  5J8C A;  4K30 A;  3K9T A;  3B3W A;  1XIX A;  5CNP A;  4OID A;  5G20 A;  3UY5 A;  4CRZ B;  2WSA A;  3DDD A;  5K8P A;  1TIQ A;  4KSI A;  4NGQ A;  3TX8 A;  4RI1 A;  2GU2 A;  3FH4 A;  4B5P A;  1QSM A;  4OC0 A;  3CZX A;  2B4D B;  5IB9 A;  4F9V A;  4BIN A;  3PGP A;  2PCU A;  3CPX A;  3IC1 A;  2ZED A;  2HC9 A;  1R43 A;  3DNS A;  4MCS A;  4R3L A;  4C2Z A;  3VAR A;  2PDO A;  3TOA A;  3NFZ A;  5AG6 A;  4P10 A;  3B3C A;  3IU1 A;  4MCR A;  3GUX A;  3S6K A;  4DJL A;  1WWZ A;  2FIW A;  3KKW A;  3NE7 A;  5LYF A;  1RXT A;  3MGD A;  1ARL A;  1MJ9 A;  3EXN A;  4IK2 A;  2JEW A;  2YGW A;  4FUU A;  1Z8T A;  2QML A;  4U9Y A;  4R6T A;  1KZF A;  1Z4E A;  2ZEF A;  4MHY A;  1VHE A;  5K8M A;  4FD5 A;  4KOY A;  1QST A;  2ARH A;  1ZLI A;  4CAW A;  3L2N A;  2BCO A;  5AG5 A;  3IJ3 A;  1CBX A;  1KUX A;  4M6I A;  3SHP A;  4ZY0 A;  5JH9 A;  1YX0 A;  2ZEH A;  3FED A;  3PB6 X;  2REE A;  3WT4 A;  3ZZI A;  3HUV A;  1YVO A;  2EWB A;  1IB1 E;  4KVX A;  4KSA A;  4A32 A;  1LFW A;  2PSW A;  3JRU A;  3D68 A;  2BO9 A;  3CXQ A;  1N71 A;  4OC4 A;  2YNC C;  4PK2 A;  3R96 A;  1BOB A;  3VWD A;  1XMB A;  2O28 A;  4CAX A;  3SJE A;  1S3Z A;  2ANP A;  3KQX A;  3RZA A;  3RO0 A;  4OP4 A;  4OIW A;  5HVF A;  2DEA A;  3KQZ A;  1I1D A;  4CYP A;  3IEH A;  4U5Y A;  3F5B A;  2VQY A;  3R1K A;  5KTD A;  4M85 A;  1LAM A;  2DXQ A;  3RAM A;  2GLF A;  2G0B A;  4R7M A;  5LYD A;  4A30 A;  4CGO A;  3LD2 A;  1Q7L A;  4H89 A;  1IID A;  2ZEP A;  4OC5 A;  4UCP A;  4B14 A;  2CNS A;  4CGL A;  1M4I A;  2J8R A;  2AFX A;  1Z4R A;  4C7I A;  2AE6 A;  2G3T A;  2FIA A;  3EC4 A;  4IUS A;  4JXQ A;  2JDD A;  2YNC A;  4OC2 A;  4ZI6 A;  4CYO A;  4MHZ A;  1S7N A;  2Z3L A;  4Q38 A;  5F49 A;  5ISV A;  2P6E A;  2PJ3 A;  3F8K A;  2ZW4 A;  2AFU A;  2BL1 A;  8CPA A;  4UEF A;  2F7V A;  2D4O A;  2PVW A;  1UWY A;  2Q51 A;  4MMO A;  5EMI A;  1HDQ A;  1IIC A;  1A2Z A;  3KAS A;  4XNH B;  4PXB A;  3CXP A;  3PRT A;  3D67 A;  2PJA A;  1AMP A;  3CPA A;  4YGO A;  4M6G A;  3WC5 A;  6CPA A;  4FAI A;  4Q36 A;  3SJX A;  1ZO0 A;  4G1P A;  2J8M A;  1XBU A;  1IYK A;  1NMT A;  3S6H A;  1YW6 A;  2PQ8 A;  4ONU A;  2I3C A;  4RUH A;  2RC4 A;  1FNO A;  4DNC A;  2XEG A;  5H86 A;  2OZU A;  1B87 A;  4F8Z A;  4AB7 A;  1ZLH A;  3D7G A;  4UCM A;  4UFX A;  1Y7R A;  4KVM E;  4KOV A;  2PJ5 A;  2GLJ A;  4CPA A;  4A95 A;  3JUW A;  4KUB A;  2OU2 A;  2Y0M A;  1MJB A;  2EK8 A;  2EO8 A;  2H5M A;  1CPX A;  3K9U A;  1VIX A;  3D4U A;  3PB8 X;  1YGH A;  2PJ2 A;  4KUA A;  4LQ6 A;  4RS2 A;  5HH1 A;  4A31 A;  4B12 A;  2CTC A;  3PFO A;  1GYT A;  2ODF A;  4B5O A;  5A28 A;  2GIV A;  4NFR A;  1GHE A;  4H6Z A;  4B13 A;  2FVG A;  1MJA A;  2Z11 A;  4P4J A;  3KGQ A;  1XJO A;  4JD6 A;  3G3S A;  5LRK A;  2PJ4 A;  3FEE A;  2Q04 A;  4ZX8 A;  4AG7 A;  2R8V A;  2JDC A;  4QC6 A;  3T8W A;  4C2X A;  2Z3K A;  3QAY A;  4YU9 A;  1JQG A;  1PUA A;  3MRU A;  4B6Z A;  3QNV A;  4NJQ A;  4ZGY B;  3NH4 A;  1HEE A;  3TC8 A;  4MCP A;  4X2T A;  5F48 A;  4QUS A;  4KVO E;  4OAD A;  4UFW A;  3V38 A;  4R8F A;  1P0H A; 
#chains in the Genus database with same CATH homology
 5C82 A;  1Q2D A;  4XPD B;  3BLN A;  3BJ7 A;  4HNX B;  1OZP A;  3TFY A;  4BBH A;  4MY3 A;  3W6X A;  2Q4Y A;  1XE4 A;  5C88 A;  2VEZ A;  1NSL A;  1NE9 A;  3IWE A;  3H4Q A;  5J8F A;  3FBU A;  5GCN A;  2FL4 A;  3D2P A;  1VHS A;  5IX3 A;  3T9Y A;  4MJ8 A;  3V8I A;  4QVT A;  2P6F A;  4MBU A;  4Y49 B;  2BUE A;  1CJW A;  3R9F A;  4I49 A;  2B5G A;  2KCW A;  2HUZ A;  2VZY A;  3DR6 A;  1V0C A;  2WPW A;  4KSF A;  2YNE A;  3D8P A;  2Z3N A;  1KUV A;  2QIR A;  4NSQ A;  5DWM A;  4YFJ A;  4KOT A;  4NEX A;  2PRB A;  4R3K A;  2J8N A;  2PC1 A;  3CXS A;  1WK4 A;  2BSW A;  2Z0Z A;  1K4J A;  4UFV A;  3SXO A;  4A33 A;  3TCV A;  2CNM A;  1S5K A;  2P6G A;  1QSR A;  3FXT A;  4KLV A;  3GKR A;  4XPL A;  4JXR A;  4F0Y A;  4OAE A;  2B4D A;  1R57 A;  4Y49 C;  5EBV A;  4HNY B;  4XPK A;  4ORF A;  2B3U A;  4CS0 B;  5KTA A;  3TO7 A;  4AG9 A;  2Z10 A;  4R9M A;  5A27 A;  4KLW A;  3T90 A;  2ZPA A;  4UCN A;  4JJX A;  3N7Z A;  3JVN A;  4L89 A;  1S60 A;  2FCK A;  5G21 A;  2EUI A;  3QB8 A;  4UA3 A;  5F47 A;  2JEV A;  1U6M A;  5EC4 A;  2ZW5 A;  3DR8 A;  1J4J A;  5E96 A;  2D4P A;  4CAV A;  3A9L A;  2VBQ A;  3C26 A;  1M4D A;  4C7H A;  4R87 A;  4E2A A;  2PR8 A;  2R7H A;  4UWI A;  3FB3 A;  4NF1 A;  3P2F A;  4MY0 A;  1XMT A;  4OLL A;  2OZH A;  3EY5 A;  4HKF A;  4B11 A;  2Q7B A;  2B4B A;  2CXA A;  1XEB A;  4MFZ A;  4LUA A;  3VWE A;  2FS5 A;  2ZW7 A;  2HV2 A;  3TE4 A;  4XNH C;  1BO4 A;  3PP9 A;  3PZJ A;  2OZG A;  1PU9 A;  4A2Z A;  4U9Z A;  4NXY A;  3D2M A;  2DPT A;  5FVJ A;  2OB0 A;  4E0A A;  2B3V A;  3G8W A;  4E8O A;  1QSO A;  2I79 A;  5G1Z A;  4CYN A;  2FE7 A;  2R1I A;  4AVA A;  2A4N A;  1P4N A;  3IWG A;  2FXF A;  2AJ6 A;  3I3G A;  1YK3 A;  4H6U A;  4QBJ A;  1I21 A;  4MFK A;  3FNC A;  4MFL A;  1S7L A;  5G22 A;  2VXK A;  4L8A A;  1S7K A;  2P0W A;  3R9G A;  2Q4V A;  4KOR A;  2FSR A;  4MHD A;  4X5K A;  3ZJ0 A;  3TT2 A;  2B58 A;  3B8G A;  2I00 A;  1KUY A;  4MFQ A;  1Y9K A;  2CNT A;  1SQH A;  1Y9W A;  2HQY A;  4B10 A;  1YLE A;  5IV0 A;  4FD6 A;  2BEI A;  3IU2 A;  4XPD C;  1L0C A;  4CRY B;  4LX9 A;  4PK3 A;  2YND A;  4PV6 A;  3W6S A;  4JLY A;  3H5Z A;  4F6A A;  3QAH A;  2Z3O A;  3GY9 A;  2X7B A;  4C2Y A;  1ON0 A;  1Q2C A;  3FIX A;  2G3A A;  2ZW6 A;  4YRH A;  4HNW B;  4JWP A;  4F0X A;  2VZZ A;  4R57 A;  3TO6 A;  3D3S A;  2CY2 A;  1B6B A;  4KOW A;  4CGN A;  1YVK A;  4KOU A;  3S6F A;  3TO9 A;  1Z9U A;  4CAE A;  2NMT A;  4FD4 A;  5HMN A;  3LOD A;  4M3S A;  1FY7 A;  3JTK A;  1MK4 A;  4EVY A;  2C27 A;  4MFP A;  4UBR A;  3SXN A;  5H84 A;  4CYQ A;  2JLM A;  3F0A A;  4MI4 A;  4UWJ A;  2F5I A;  5BWA B;  3EO4 A;  2WUU A;  2IL4 A;  2REF A;  4II9 A;  2WPX A;  5KTC A;  4ZBG A;  1RO5 A;  2GE3 A;  3DSB A;  3TTH A;  1YRE A;  5IB0 A;  1S7F A;  4PSW A;  2OH1 A;  1I12 A;  1UFH A;  3S6G A;  3OWC A;  4IF5 A;  1QSN A;  2GAN A;  3R9E A;  2FT0 A;  1M44 A;  4AVC A;  4B5P B;  1XF8 A;  4J3G A;  4CGM A;  4PSX A;  4QB9 A;  2Z3P A;  1M1D A;  3GYA A;  5I0C A;  4KZT A;  2VI7 A;  1IYL A;  5AG7 A;  5JPH A;  3R95 A;  2ZXV A;  4CGP A;  4KS9 A;  2K5T A;  4GS4 A;  3RYO A;  2Q0Y A;  2R98 A;  1YR0 A;  4CAF A;  2Z3M A;  2DPS A;  3I9S A;  3W91 A;  3E0K A;  4FD7 A;  4NCZ A;  1CM0 A;  1M4G A;  1VKC A;  2QEC A;  2ATR A;  2B5G B;  2PR1 A;  2EVN A;  4C68 A;  5AGE A;  5F46 A;  3P2H A;  1Q2Y A;  4MFJ A;  2Q44 A;  3BJ8 A;  4KOS A;  3TOB A;  4KOX A;  5DWN A;  3EFA A;  1LRZ A;  3FRM A;  4AVB A;  3WR7 A;  5JQ4 A;  3IGR A;  5AG4 A;  4BMH A;  3FYN A;  5J8C A;  4K30 A;  1XIX A;  5CNP A;  5G20 A;  3UY5 A;  4CRZ B;  2WSA A;  3DDD A;  1TIQ A;  4RI1 A;  4B5P A;  1QSM A;  2B4D B;  3PGP A;  3DNS A;  4R3L A;  4C2Z A;  2PDO A;  3TOA A;  5AG6 A;  3IU1 A;  3S6K A;  1WWZ A;  2FIW A;  3KKW A;  3NE7 A;  1RXT A;  3MGD A;  1MJ9 A;  3EXN A;  2YGW A;  2QML A;  4U9Y A;  1KZF A;  1Z4E A;  4FD5 A;  4KOY A;  1QST A;  2ARH A;  4CAW A;  5AG5 A;  1KUX A;  3SHP A;  1YX0 A;  2REE A;  3ZZI A;  1YVO A;  1IB1 E;  4KVX A;  4KSA A;  4A32 A;  2PSW A;  3CXQ A;  1N71 A;  3R96 A;  2YNC C;  4PK2 A;  1BOB A;  3VWD A;  2O28 A;  4CAX A;  1S3Z A;  1I1D A;  4CYP A;  4U5Y A;  3F5B A;  2VQY A;  3R1K A;  5KTD A;  4M85 A;  2DXQ A;  2G0B A;  4A30 A;  4CGO A;  3LD2 A;  4H89 A;  1IID A;  4UCP A;  4B14 A;  2CNS A;  4CGL A;  1M4I A;  2J8R A;  1Z4R A;  4C7I A;  2AE6 A;  2G3T A;  2FIA A;  3EC4 A;  4IUS A;  4JXQ A;  2JDD A;  2YNC A;  4CYO A;  1S7N A;  2Z3L A;  4Q38 A;  5F49 A;  5ISV A;  2P6E A;  3F8K A;  2ZW4 A;  2BL1 A;  2D4O A;  1IIC A;  4XNH B;  3CXP A;  4YGO A;  4Q36 A;  1ZO0 A;  2J8M A;  1IYK A;  1NMT A;  3S6H A;  2PQ8 A;  4ONU A;  2RC4 A;  4DNC A;  5H86 A;  2OZU A;  1B87 A;  4AB7 A;  4UCM A;  4UFX A;  1Y7R A;  4KVM E;  4KOV A;  4A95 A;  3JUW A;  4KUB A;  2OU2 A;  2Y0M A;  1MJB A;  2H5M A;  3K9U A;  5HH1 A;  1YGH A;  4RS2 A;  4KUA A;  4A31 A;  4B12 A;  5A28 A;  4B5O A;  2GIV A;  1GHE A;  4H6Z A;  4B13 A;  1MJA A;  2Z11 A;  4JD6 A;  3G3S A;  2Q04 A;  4AG7 A;  2R8V A;  2JDC A;  4QC6 A;  4C2X A;  2Z3K A;  1PUA A;  4ZGY B;  5F48 A;  4QUS A;  4KVO E;  4OAD A;  4UFW A;  1P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...