2J8MA

Structure of p. aeruginosa acetyltransferase pa4866
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
SASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title L-Methionine Sulfoximine, But not Phosphinothricin, is a Substrate for an Acetyltransferase (Gene Pa4866) from Pseudomonas Aeruginosa: Structural and Functional Studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 51
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8mA00
2P0WA 5IX3A 3H4QA 4PV6A 1YLEA 4MY0A 1IICA 3I9SA 1UFHA 2R8VA 3SXNA 2JLMA 1M4GA 4HNWB 2FIAA 1XEBA 1K4JA 4MJ8A 3S6GA 1L0CA 2K5TA 3S6HA 4HNYB 4JLYA 1S7NA 1Y9KA 2QECA 4JJXA 4QVTA 2J8RA 5F49A 2R7HA 4LUAA 2RC4A 4MHDA 3C26A 2VEZA 2R1IA 4XPDB 1CM0A 3SXOA 1KZFA 2VZZA 4QB9A 4PSWA 1XF8A 2BSWA 5E96A 4RS2A 2PQ8A 5H86A 5C88A 2VQYA 3WR7A 1P0HA 5I0CA 3DDDA 1WK4A 4CAXA 4HNXB 2FE7A 1Q2CA 3FRMA 2F5IA 4IUSA 4RI1A 1XE4A 1Z4EA 1N71A 1QSRA 1BO4A 5JPHA 2J8NA 1RXTA 3TTHA 3ZJ0A 4JD6A 1PU9A 3FBUA 4E8OA 3W6SA 2REEA 3R95A 4KOTA 2I00A 4AVBA 2OZUA 4XPLA 4B5OA 3T9YA 4R3LA 5F46A 1J4JA 1Z4RA 4KZTA 1Z9UA 3ZZIA 4OAEA 3TFYA 5F47A 2B4BA 2EVNA 2Q0YA 2R98A 3D2PA 4H89A 3W91A 2Z10A 3FIXA 1S7FA 4B5PB 3MGDA 3CXSA 3I3GA 1Q2DA 1KUYA 4L89A 4NF1A 2B5GB 4J3GA 3VWDA 4F0YA 2VZYA 4FD5A 4QBJA 2KCWA 3V8IA 4X5KA 5H84A 5KTAA 4EVYA 1B6BA 4PK3A 1XIXA 1WWZA 5IB0A 4KUAA 3K9UA 4XNHC 3CXQA 2ATRA 3PZJA 4H6UA 2I79A 2Y0MA 2ZW5A 4PK2A 3FXTA 3TOAA 4FD4A 3OWCA 4M3SA 3FNCA 2FCKA 4E2AA 1BOBA 5KTDA 4KOXA 2ZPAA 3R9EA 4LX9A 1MJ9A 1IB1E 2OZHA 4YRHA 4OLLA 1I1DA 2GANA 3TCVA 3B8GA 3EO4A 4KOSA 3F0AA 1NE9A 4AB7A 4KVXA 2HV2A 2CNMA 3R9FA 1Q2YA 4Y49B 3PP9A 4UWIA 2P6EA 1NSLA 3D2MA 3R9GA 4R3KA 3D8PA 4OADA 1S7LA 2PR8A 2BL1A 2ZXVA 3PGPA 4MY3A 2AE6A 3R96A 3E0KA 1YVOA 5HMNA 4U9YA 2PDOA 3TE4A 1CJWA 1ON0A 1Y9WA 4L8AA 2Q4VA 3TT2A 1IYLA 3FYNA 3QB8A 2VXKA 2P6FA 3GKRA 4CAVA 3DSBA 2X7BA 4KVME 4KLWA 5C82A 4II9A 4FD7A 2JDDA 2FIWA 2OH1A 4DNCA 2FT0A 4CRYB 4PSXA 3UY5A 1V0CA 4KVOE 2Q7BA 1S7KA 4IF5A 2B4DB 2WPWA 5J8CA 2G3AA 1MK4A 3DNSA 3P2HA 1TIQA 2O28A 3F8KA 3NE7A 2B4DA 4E0AA 2PRBA 1P4NA 2FSRA 5JQ4A 1S5KA 5F48A 4KOYA 5J8FA 3EXNA 4JXQA 4UWJA 1U6MA 4JXRA 2JEVA 3DR6A 4KOUA 1MJBA 3IWGA 1FY7A 2J8MA 3JUWA 2Z11A 3VWEA 4CRZB 3S6FA 1YVKA 2PC1A 4YFJA 2HUZA 3TOBA 3TO6A 1M4DA 3RYOA 1NMTA 2Q04A 4R9MA 1YGHA 4XPKA 1QSOA 3JVNA 1OZPA 2ZW4A 4AG9A 3D3SA 2FL4A 1R57A 1IIDA 4KLVA 4R57A 1SQHA 2PR1A 5IV0A 3GY9A 2B3UA 2A4NA 3S6KA 2OZGA 4XPDC 4AG7A 2Q4YA 4ONUA 4XNHB 1XMTA 2Z0ZA 2G0BA 1KUVA 1M1DA 2NMTA 2BUEA 3W6XA 4U9ZA 5HH1A 4KORA 3TO9A 5ISVA 4KOVA 4K30A 1Y7RA 2H5MA 3IGRA 1MJAA 3P2FA 4NEXA 2IL4A 2D4OA 2ZW6A 5EBVA 2GE3A 4H6ZA 3N7ZA 2D4PA 3G3SA 2QIRA 5GCNA 2P6GA 2VBQA 2DXQA 4GS4A 2CY2A 1VKCA 2REFA 1I12A 4NSQA 4QUSA 4AVAA 4KOWA 2Q44A 4NXYA 2FS5A 1LRZA 1GHEA 3BJ8A 2BEIA 2B3VA 3T90A 4NCZA 4CS0B 1M44A 1I21A 3DR8A 4MI4A 4M85A 1QSNA 1YX0A 1S60A 4UBRA 2OB0A 4JWPA 4QC6A 3SHPA 4ZBGA 3QAHA 4UA3A 4U5YA 2AJ6A 3BLNA 4F6AA 3R1KA 1YK3A 2C27A 2B58A 1YREA 2G3TA 2WPXA 1S3ZA 3EFAA 1IYKA 2PSWA 2GIVA 1QSMA 1RO5A 3TO7A 4CAWA 1QSTA 3EC4A 3LD2A 2OU2A 4B5PA 2QMLA 3BJ7A 4MBUA 3G8WA 3LODA 2ZW7A 1PUAA 3FB3A 2B5GA 4R87A 3EY5A 3KKWA 5DWNA 4ORFA 4YGOA 1YR0A 4BMHA 4HKFA 1VHSA 2CNTA 4I49A 2VI7A 1M4IA 2EUIA 3F5BA 2ARHA 2FXFA 2JDCA 5CNPA 1KUXA 4AVCA 2HQYA 3GYAA 4Y49C 5FVJA 4FD6A 2CNSA 3CXPA 5DWMA 5KTCA 1B87A 4KUBA 5EC4A
chains in the Genus database with same CATH superfamily
4PXDA 2P0WA 5AG4A 5IX3A 3H4QA 4IK2A 4PV6A 1YLEA 4MY0A 1AYEA 4KSAA 3SJXA 1IICA 3I9SA 1UFHA 4CGLA 2R8VA 1Z2LA 2JLMA 1M4GA 4HNWB 3SXNA 2FIAA 4DYOA 5JM6A 4A32A 1XEBA 1K4JA 4MJ8A 3S6GA 1L0CA 4F0XA 2K5TA 3S6HA 4ZYQA 3FVLA 1OBRA 4HNYB 3SI2A 4JLYA 3BI1A 1S7NA 1Y9KA 2XEGA 3BI0A 2QECA 3FECA 4P4BA 4JJXA 2GREA 4QVTA 5LRJA 2J8RA 4FWUA 3K2KA 3D7HA 1ZLIA 2J9AA 5F49A 2BOAA 2R7HA 3B3TA 4C2YA 4JZ0A 2RC4A 4LUAA 4A2ZA 4CYQA 3KR5A 4F9UA 3RBUA 4MHDA 1QMUA 5K8NA 2I3CA 3SJEA 2C6PA 4EFDA 3C26A 4NJRA 3CPAA 2VEZA 3MN8A 2R1IA 4XPDB 1ELMP 1YW6A 1CM0A 2WYRA 2PJ4A 3SXOA 1KZFA 1ZG8A 2VZZA 4QB9A 2PJ0A 4PSWA 3D7DA 1XF8A 2BSWA 2CXAA 3KHZA 4RN7A 5E96A 4RS2A 4NGRA 4CGNA 2V8GA 2PQ8A 5H86A 5C88A 2VQYA 3WC6A 4PXBA 4M6HA 3WR7A 1P0HA 5I0CA 3DDDA 1WK4A 1RTQA 4CAXA 4HNXB 1TF9A 1PYTB 2FE7A 1Q2CA 3FRMA 2F5IA 4IUSA 4RI1A 1XE4A 4O23A 4PXEA 2DPTA 1Z4EA 1N71A 1IY7A 2V8DA 4NGNA 1QSRA 1BO4A 2WZNA 2ZOGA 2AFZA 2J8NA 5JPHA 1ZO0A 5I4MA 1RXTA 3TTHA 3ZJ0A 5A27A 4JD6A 5LYFA 5K8MA 1PU9A 3D67A 3FBUA 4DJLA 4MHYA 3LMSA 1TKHA 4E8OA 3W6SA 1Z8XA 5F09A 2REEA 4KSFA 2CTBA 3B3CA 1NSAA 3R95A 2IMOA 4OMEA 1QQ9A 4KOTA 2I00A 4AVBA 2OZUA 1JQGA 2YNCA 4XPLA 5AGEA 5EMIA 5HVFA 3T9YA 2OOTA 4R3LA 4B5OA 5F46A 1J4JA 1Z4RA 3B3WA 4KZTA 1Z9UA 4IAVA 4OAEA 3ZZIA 3TFYA 5F47A 3QAYA 2B4BA 2EVNA 4PXCA 2Q0YA 3NE8A 2R98A 3D2PA 4H89A 3DGVA 1CPXA 2PJ5A 3W91A 1HDQA 2Z10A 2NYQA 1IGBA 4WJBA 3FIXA 1S7FA 2ODFA 4A38A 4B5PB 4R76A 1CBXA 4GM5A 3IU1A 3MGDA 5IB9A 3CXSA 3I3GA 3PB8X 1Q2DA 1KUYA 2V77A 3KQXA 3NH4A 4L89A 4P4FA 3GUXA 2YGWA 4NF1A 2B5GB 2GFQA 4J3GA 3VWDA 3CDXA 3S9NA 2ZEDA 4F0YA 5J1QA 2VZYA 4C2ZA 4FD5A 4QBJA 3D4UA 2KCWA 2AFOA 3V8IA 4CGOA 3VATA 3MRUA 3PB7X 4X5KA 5H84A 4P45A 5KTAA 4R7MA 4EVYA 5LRGA 4ZY0A 3D7FA 4CYNA 3B2YA 5G22A 5DS0A 1B6BA 3FEDA 4PK3A 1XIXA 1LAMA 1WWZA 3IJ3A 7CPAA 5IB0A 2JBKA 4R8FA 4KUAA 1XJOA 1LOKA 3D66A 2Z3LA 3K9UA 4EMEA 4ZY1A 1BAVA 4XNHC 2ZOFA 3CXQA 1XOVA 2ATRA 3PZJA 5CBMA 1GYTA 4UEZA 4H6UA 2I79A 2Y0MA 2ZW5A 4A30A 4PK2A 2PJ9A 3FEEA 3FXTA 2PJ3A 4OIDA 3TOAA 4FD4A 3OWCA 4M3SA 5HXDA 3FNCA 2FCKA 4FUUA 2PIZA 5CPAA 2ZEEA 2HC9A 2YNEA 4NGTA 4B6ZA 4E2AA 2ANPA 4YU9A 3TC8A 1BOBA 2PIYA 2Z3KA 4C68A 5KTDA 4KOXA 2PJ7A 4MFJA 2ZPAA 3R9EA 3I1UA 5G20A 1BLLE 4LX9A 1A2ZA 1F57A 1MJ9A 1IB1E 1TF8A 2OZHA 4YRHA 4OLLA 3RNZA 3S9LA 1I1DA 3PB9X 1F2PA 5LRKA 2GANA 3TCVA 4OP4A 2PVWA 4X2TA 3B8GA 4MFZA 4KSIA 5AG6A 3EO4A 4KOSA 5D29A 3F0AA 1NE9A 3DLJA 4AB7A 1DTDA 4KVXA 2HV2A 2CNMA 2G9DA 4NGQA 4NGPA 3SI0A 3R9FA 1Q2YA 4Y49B 2PJAA 3PP9A 4IHMA 4UWIA 2P6EA 1NSLA 3D2MA 3R9GA 4R3KA 4UEFA 2QYVA 3D8PA 4NJQA 4OADA 1S7LA 2PR8A 4UF4A 3VH9A 4BD9A 2GU2A 2BL1A 2ZXVA 4OC0A 5AG7A 2PJBA 2NSMA 3N5FA 2C6GA 3PGPA 4WWVA 4MY3A 2AE6A 3FX6A 3R96A 4FAIA 3E0KA 1YVOA 5HMNA 2Q51A 2DPSA 4U9YA 2EK8A 2PDOA 3TE4A 1X12A 1XBUA 1CJWA 1ON0A 1Y9WA 5LYLA 4L8AA 4OKOA 3IC1A 4MCQA 4ZX9A 4M6GA 4HPSA 1LCPA 1LFWA 2Q4VA 2F7VA 4UIAA 4A31A 4MCPA 4ONWA 3TT2A 1IYLA 3NFZA 3FYNA 3QB8A 6CPAA 2VXKA 2P6FA 3GKRA 2EBJA 2CF4A 4MFLA 8CPAA 4X8IA 2Z3OA 3RO0A 2QJ8A 4CAVA 1XMBA 3DSBA 2X7BA 4KVME 4KLWA 2JBJA 5C82A 4II9A 4FD7A 3LWUA 2JDDA 4P4DA 2FIWA 5LYDA 3SI1A 4BBHA 4OC1A 2AFSA 2OH1A 1KWMA 3IO1A 4DNCA 1CX8A 2FT0A 3D68A 4UEEA 4CRYB 4PSXA 3HUVA 2EK9A 3UY5A 4P10A 1V0CA 4KVOE 2Q7BA 1M4LA 1S7KA 3IWEA 4IF5A 4K3NA 2B4DB 3FH4A 2JEWA 2WPWA 4F8ZA 5J8CA 2Q7SA 4MHZA 1Y7EA 1FNOA 3TX8A 3NH5A 2Z3NA 1EE3P 1PCAA 2G3AA 1MK4A 2V8HA 3CZXA 4MHNA 4ZY2A 1ELLP 3DNSA 3P2HA 1TIQA 1UWYA 3JTKA 3SJGA 2O28A 1HEEA 3F8KA 2ZEHA 3NE7A 4F9VA 2B4DA 4E0AA 4CYPA 3PBBA 2HB6A 1P4NA 2PRBA 2FSRA 3IIBA 4JYWA 4CAFA 1IOIA 1S5KA 2AFUA 2WUUA 5F48A 5JQ4A 4KOYA 5J8FA 5K8OA 3EXNA 3PB6X 4JXQA 4UWJA 3WC7A 1TKFA 1R3NA 4ZX8A 1U6MA 3ISZA 3SJFA 2O53A 4JXRA 2JEVA 3DR6A 4M6IA 4KOUA 1MJBA 2PRQA 4FBEA 3H8FA 3IWGA 1FY7A 2J8MA 4OC3A 5ELYA 2PJ6A 4UFWA 2QVPA 4MHPA 4Q7AA 1CP7A 1R43A 5HVGA 4A33A 3JUWA 4C7IA 2Z11A 2DEAA 3D7GA 3S9MA 4C7HA 3VWEA 4CRZB 3S6FA 2ZEGA 3ISXA 1YVKA 2PC1A 4YFJA 3KR4A 2ZEOA 4NGSA 2HUZA 3KZWA 1HDUA 2GLFA 4P6YA 3TOBA 2PJ1A 4UCMA 2XEIA 1M4DA 3IU2A 1NMTA 3RYOA 3TO6A 3IFEA 2C1CA 3RAMA 3K9TA 2Z3MA 4B12A 3B35A 2Q04A 2PJ8A 3FF3A 4R9MA 3PBEA 1CPSA 1YGHA 4XPKA 4DUKA 1QSOA 4Z65A 3JVNA 4AXVA 4CAEA 1ZLHA 1OZPA 4P44A 3KHXA 2ZW4A 4AG9A 3D3SA 2CIJA 2ZELA 4P4IA 2FL4A 1R57A 1IIDA 4KLVA 4P4JA 4R57A 1SQHA 1IU8A 2PR1A 2AFMA 2POKA 4OC2A 5IV0A 3GY9A 2B3UA 3T8WA 2A4NA 3FJUA 3S6KA 5JGFA 2OZGA 3FMCA 4XPDC 4AG7A 2Q4YA 3PFEA 4MMOA 4ONUA 4XNHB 1XMTA 1DE4C 2Z0ZA 2FVGA 2G0BA 4A39A 4CGMA 1KUVA 1M1DA 2NMTA 2BUEA 2O4HA 4U9ZA 3W6XA 5HH1A 1AMPA 3PEIA 2OR4A 4KORA 4PQAA 1VIXA 4UCNA 3A9LA 3TO9A 5ISVA 4KOVA 3GIUA 4K30A 1ZG7A 1Y7RA 4B13A 3KGQA 2H5MA 4UFVA 1VGYA 1MJAA 3IGRA 2ABZA 2XEFA 1LAPA 3PFOA 1Z8TA 3P2FA 3BHXA 2IL4A 2D4OA 2ZW6A 4NEXA 5EBVA 4UIBA 4A37A 4MFPA 5A28A 2GE3A 4H6ZA 4Q36A 3N7ZA 3B7IA 1FT7A 4X3RA 1YSJA 3KL9A 4Q38A 2D4PA 4MFKA 3WABA 3G3SA 2QIRA 5D8NA 3L2NA 5GCNA 2P6GA 3PB4X 2Q43A 2DXQA 2VBQA 4GS4A 3RZAA 2CY2A 1ARLA 2YNCC 1VKCA 2REFA 1I12A 4G1PA 2V8VA 4MFQA 4NSQA 3NH8A 4QUSA 4AVAA 4PPZA 2DF5A 1IOFA 4KOWA 2Q44A 1VHOA 4NXYA 2FS5A 1JWQA 5THWA 5HVHA 1LRZA 1BPMA 1CP6A 1GHEA 3BJ8A 2BEIA 3LACA 2B3VA 3GB0A 4B11A 5AG5A 3T90A 3B3SA 2RFHA 4LQ6A 2IQ6A 1AUGA 4NCZA 4ZI6A 4KS9A 4CS0B 3PRTA 1M44A 5LYIA 1I21A 3JRUA 3DR8A 4MI4A 2AFWA 5BWAB 1H8LA 4M85A 4MRIA 1QSNA 4B10A 1YX0A 1S60A 1Y0RA 3VARA 4UBRA 1Z5RA 4TWEA 2OB0A 4JWPA 3CT9A 4QC6A 1CG2A 2GLJA 3BXMA 1XRYA 3SHPA 4ZBGA 1X10A 3QAHA 4UA3A 4A94A 1YW4A 4CPAA 1VHEA 4TNUA 2AFXA 4U5YA 1BPNA 4OIWA 2AJ6A 1YMEA 2PCUA 2PJ2A 3BLNA 1Y0YA 4F6AA 3R1KA 1YK3A 5JH9A 5G1ZA 2Z3PA 2C27A 1TKJA 2B58A 1YREA 2G3TA 4MCRA 2F8HA 3WC5A 3H5ZA 2WPXA 4OC4A 4R6TA 4MCSA 2PE3A 2YNDA 3HLPA 4C2XA 2EWBA 2PJCA 3KQZA 2ZEMA 1S3ZA 3EFAA 4OC5A 1IYKA 1YQEA 2PSWA 3IEHA 2GIVA 1YLOA 1QSMA 1RO5A 2ZENA 3GLJA 3TO7A 4CAWA 3KI9A 3KASA 4YWYA 2RB7A 1TXRA 1QSTA 3EC4A 4CGPA 3LD2A 2OU2A 2CTCA 3V7ZA 4B5PA 2QMLA 5K8PA 3BJ7A 4MBUA 3H8EA 3G8WA 1Q7LA 3V38A 3LODA 4B14A 1F2OA 2ZW7A 4P4EA 1PUAA 3B3VA 1ZG9A 3FB3A 4NFRA 2B5GA 3IWWA 3CPXA 4MXUA 4R87A 2IJZA 1XFOA 3EY5A 3KKWA 4LQGA 5DWNA 4ORFA 2Q4ZA 4YGOA 3NA6A 1YR0A 4H2KA 1Z8WA 4HKFA 4BMHA 1VHSA 2BO9A 2CNTA 4ZGYB 3QNVA 2XEJA 2ZEPA 4NGMA 4I49A 4BINA 2VI7A 1M4IA 4CYOA 1ARMA 4UFXA 2EUIA 3H8GA 4UCPA 4W9YA 2ZEFA 2C6CA 4GXHA 2VL1A 3F5BA 2ARHA 2FXFA 4A95A 2PVVA 2EO8A 2JDCA 4EWTA 5CNPA 1KUXA 4RUHA 4AVCA 2HQYA 3GYAA 1Z8LA 4Y49C 5FVJA 4FD6A 5G21A 2WSAA 2CNSA 3CXPA 1LANA 5DWMA 3WT4A 2BCOA 5KTCA 1B87A 4KUBA 5EC4A
chains in the Genus database with same CATH topology
2P0WA 5AG4A 5IX3A 3H4QA 4PV6A 1YLEA 4MY0A 4KSAA 1IICA 3I9SA 1UFHA 4CGLA 2R8VA 3SXNA 2JLMA 1M4GA 4HNWB 2FIAA 4A32A 1XEBA 1K4JA 4MJ8A 3S6GA 1L0CA 4F0XA 2K5TA 3S6HA 4HNYB 4JLYA 1S7NA 1Y9KA 2QECA 4JJXA 4QVTA 2J8RA 5F49A 2R7HA 4C2YA 4LUAA 2RC4A 4A2ZA 4CYQA 4MHDA 3C26A 2VEZA 2R1IA 4XPDB 1CM0A 3SXOA 1KZFA 2VZZA 4QB9A 4PSWA 1XF8A 2BSWA 2CXAA 5E96A 4CGNA 4RS2A 2PQ8A 5H86A 5C88A 2VQYA 3WR7A 1P0HA 5I0CA 3DDDA 1WK4A 4CAXA 4HNXB 2FE7A 1Q2CA 3FRMA 2F5IA 4IUSA 4RI1A 1XE4A 2DPTA 1Z4EA 1N71A 1QSRA 1BO4A 5JPHA 2J8NA 1ZO0A 1RXTA 3TTHA 3ZJ0A 5A27A 4JD6A 1PU9A 3FBUA 4E8OA 3W6SA 2REEA 4KSFA 3R95A 4KOTA 2I00A 4AVBA 2OZUA 4XPLA 2YNCA 4B5OA 5AGEA 3T9YA 4R3LA 5F46A 1J4JA 1Z4RA 4KZTA 1Z9UA 3ZZIA 4OAEA 3TFYA 5F47A 2B4BA 2EVNA 2Q0YA 2R98A 3D2PA 4H89A 3W91A 2Z10A 3FIXA 1S7FA 4B5PB 3IU1A 3MGDA 3CXSA 3I3GA 1Q2DA 1KUYA 4L89A 2YGWA 4NF1A 2B5GB 4J3GA 3VWDA 4F0YA 2VZYA 4C2ZA 4FD5A 4QBJA 2KCWA 3V8IA 4CGOA 4X5KA 5H84A 5KTAA 4EVYA 4CYNA 5G22A 1B6BA 4PK3A 1XIXA 1WWZA 5IB0A 4KUAA 2Z3LA 3K9UA 4XNHC 3CXQA 2ATRA 3PZJA 4A30A 4H6UA 2I79A 2Y0MA 2ZW5A 4PK2A 3FXTA 3TOAA 4FD4A 3OWCA 4M3SA 3FNCA 2FCKA 4E2AA 2YNEA 1BOBA 2Z3KA 4C68A 5KTDA 4KOXA 4MFJA 2ZPAA 3R9EA 5G20A 4LX9A 1MJ9A 1IB1E 2OZHA 4YRHA 4OLLA 1I1DA 2GANA 3TCVA 3B8GA 4MFZA 5AG6A 3EO4A 4KOSA 3F0AA 1NE9A 4AB7A 4KVXA 2HV2A 2CNMA 4BBHA 3R9FA 1Q2YA 4Y49B 3PP9A 4UWIA 2P6EA 1NSLA 3D2MA 3R9GA 4R3KA 3D8PA 4OADA 1S7LA 2PR8A 2BL1A 2ZXVA 5AG7A 3PGPA 4MY3A 2AE6A 3R96A 3E0KA 1YVOA 5HMNA 2DPSA 4U9YA 2PDOA 3TE4A 1CJWA 1ON0A 1Y9WA 4L8AA 2Q4VA 4A31A 3TT2A 1IYLA 3FYNA 3QB8A 2VXKA 2P6FA 3GKRA 4MFLA 2Z3OA 4CAVA 3DSBA 2X7BA 4KVME 4KLWA 5C82A 4II9A 4FD7A 2JDDA 2FIWA 2OH1A 4DNCA 2FT0A 4CRYB 4PSXA 3UY5A 1V0CA 4KVOE 2Q7BA 1S7KA 3IWEA 4IF5A 2B4DB 2WPWA 5J8CA 2Z3NA 2G3AA 1MK4A 3DNSA 3P2HA 1TIQA 3JTKA 2O28A 3F8KA 3NE7A 2B4DA 4E0AA 4CYPA 2PRBA 1P4NA 2FSRA 4CAFA 5JQ4A 1S5KA 2WUUA 5F48A 4KOYA 5J8FA 3EXNA 4JXQA 4UWJA 1U6MA 4JXRA 2JEVA 3DR6A 4KOUA 1MJBA 3IWGA 1FY7A 2J8MA 4UFWA 4A33A 3JUWA 4C7IA 2Z11A 4C7HA 3VWEA 4CRZB 3S6FA 1YVKA 2PC1A 4YFJA 2HUZA 3TOBA 3TO6A 4UCMA 3IU2A 1M4DA 3RYOA 1NMTA 2Z3MA 4B12A 2Q04A 4R9MA 1YGHA 4XPKA 1QSOA 3JVNA 4CAEA 1OZPA 2ZW4A 4AG9A 3D3SA 2FL4A 1R57A 1IIDA 4KLVA 4R57A 1SQHA 2PR1A 5IV0A 3GY9A 2B3UA 2A4NA 3S6KA 2OZGA 4XPDC 4AG7A 2Q4YA 4ONUA 4XNHB 1XMTA 2Z0ZA 2G0BA 4CGMA 1KUVA 1M1DA 2NMTA 2BUEA 3W6XA 4U9ZA 5HH1A 4KORA 4UCNA 3TO9A 3A9LA 5ISVA 4KOVA 4K30A 1Y7RA 4B13A 2H5MA 4UFVA 3IGRA 1MJAA 3P2FA 4NEXA 2IL4A 2D4OA 2ZW6A 5EBVA 4MFPA 5A28A 2GE3A 4H6ZA 4Q36A 3N7ZA 4Q38A 2D4PA 4MFKA 3G3SA 2QIRA 5GCNA 2P6GA 2VBQA 2DXQA 4GS4A 2CY2A 2YNCC 1VKCA 2REFA 1I12A 4NSQA 4MFQA 4QUSA 4AVAA 4KOWA 2Q44A 4NXYA 2FS5A 1LRZA 1GHEA 3BJ8A 2BEIA 2B3VA 4B11A 5AG5A 3T90A 4NCZA 4KS9A 4CS0B 1M44A 1I21A 3DR8A 4MI4A 5BWAB 4B10A 4M85A 1QSNA 1YX0A 1S60A 4UBRA 2OB0A 4JWPA 4QC6A 3SHPA 4ZBGA 3QAHA 4UA3A 4U5YA 2AJ6A 3BLNA 4F6AA 3R1KA 1YK3A 5G1ZA 2Z3PA 2C27A 2B58A 1YREA 2G3TA 3H5ZA 2WPXA 2YNDA 4C2XA 1S3ZA 3EFAA 1IYKA 2PSWA 2GIVA 1QSMA 1RO5A 3TO7A 4CAWA 4CGPA 1QSTA 3EC4A 3LD2A 2OU2A 4B5PA 2QMLA 3BJ7A 4MBUA 3G8WA 3LODA 4B14A 2ZW7A 1PUAA 3FB3A 2B5GA 4R87A 3EY5A 3KKWA 5DWNA 4ORFA 4YGOA 1YR0A 4BMHA 4HKFA 1VHSA 2CNTA 4ZGYB 4I49A 2VI7A 1M4IA 4CYOA 4UFXA 2EUIA 4UCPA 3F5BA 2ARHA 2FXFA 4A95A 2JDCA 5CNPA 1KUXA 4AVCA 2HQYA 3GYAA 4Y49C 5FVJA 4FD6A 5G21A 2WSAA 2CNSA 3CXPA 5DWMA 5KTCA 1B87A 4KUBA 5EC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0W A;  5IX3 A;  3H4Q A;  4PV6 A;  1YLE A;  4MY0 A;  1IIC A;  3I9S A;  1UFH A;  2R8V A;  3SXN A;  2JLM A;  1M4G A;  4HNW B;  2FIA A;  1XEB A;  1K4J A;  4MJ8 A;  3S6G A;  1L0C A;  2K5T A;  3S6H A;  4HNY B;  4JLY A;  1S7N A;  1Y9K A;  2QEC A;  4JJX A;  4QVT A;  2J8R A;  5F49 A;  2R7H A;  4LUA A;  2RC4 A;  4MHD A;  3C26 A;  2VEZ A;  2R1I A;  4XPD B;  1CM0 A;  3SXO A;  1KZF A;  2VZZ A;  4QB9 A;  4PSW A;  1XF8 A;  2BSW A;  5E96 A;  4RS2 A;  2PQ8 A;  5H86 A;  5C88 A;  2VQY A;  3WR7 A;  1P0H A;  5I0C A;  3DDD A;  1WK4 A;  4CAX A;  4HNX B;  2FE7 A;  1Q2C A;  3FRM A;  2F5I A;  4IUS A;  4RI1 A;  1XE4 A;  1Z4E A;  1N71 A;  1QSR A;  1BO4 A;  5JPH A;  2J8N A;  1RXT A;  3TTH A;  3ZJ0 A;  4JD6 A;  1PU9 A;  3FBU A;  4E8O A;  3W6S A;  2REE A;  3R95 A;  4KOT A;  2I00 A;  4AVB A;  2OZU A;  4XPL A;  4B5O A;  3T9Y A;  4R3L A;  5F46 A;  1J4J A;  1Z4R A;  4KZT A;  1Z9U A;  3ZZI A;  4OAE A;  3TFY A;  5F47 A;  2B4B A;  2EVN A;  2Q0Y A;  2R98 A;  3D2P A;  4H89 A;  3W91 A;  2Z10 A;  3FIX A;  1S7F A;  4B5P B;  3MGD A;  3CXS A;  3I3G A;  1Q2D A;  1KUY A;  4L89 A;  4NF1 A;  2B5G B;  4J3G A;  3VWD A;  4F0Y A;  2VZY A;  4FD5 A;  4QBJ A;  2KCW A;  3V8I A;  4X5K A;  5H84 A;  5KTA A;  4EVY A;  1B6B A;  4PK3 A;  1XIX A;  1WWZ A;  5IB0 A;  4KUA A;  3K9U A;  4XNH C;  3CXQ A;  2ATR A;  3PZJ A;  4H6U A;  2I79 A;  2Y0M A;  2ZW5 A;  4PK2 A;  3FXT A;  3TOA A;  4FD4 A;  3OWC A;  4M3S A;  3FNC A;  2FCK A;  4E2A A;  1BOB A;  5KTD A;  4KOX A;  2ZPA A;  3R9E A;  4LX9 A;  1MJ9 A;  1IB1 E;  2OZH A;  4YRH A;  4OLL A;  1I1D A;  2GAN A;  3TCV A;  3B8G A;  3EO4 A;  4KOS A;  3F0A A;  1NE9 A;  4AB7 A;  4KVX A;  2HV2 A;  2CNM A;  3R9F A;  1Q2Y A;  4Y49 B;  3PP9 A;  4UWI A;  2P6E A;  1NSL A;  3D2M A;  3R9G A;  4R3K A;  3D8P A;  4OAD A;  1S7L A;  2PR8 A;  2BL1 A;  2ZXV A;  3PGP A;  4MY3 A;  2AE6 A;  3R96 A;  3E0K A;  1YVO A;  5HMN A;  4U9Y A;  2PDO A;  3TE4 A;  1CJW A;  1ON0 A;  1Y9W A;  4L8A A;  2Q4V A;  3TT2 A;  1IYL A;  3FYN A;  3QB8 A;  2VXK A;  2P6F A;  3GKR A;  4CAV A;  3DSB A;  2X7B A;  4KVM E;  4KLW A;  5C82 A;  4II9 A;  4FD7 A;  2JDD A;  2FIW A;  2OH1 A;  4DNC A;  2FT0 A;  4CRY B;  4PSX A;  3UY5 A;  1V0C A;  4KVO E;  2Q7B A;  1S7K A;  4IF5 A;  2B4D B;  2WPW A;  5J8C A;  2G3A A;  1MK4 A;  3DNS A;  3P2H A;  1TIQ A;  2O28 A;  3F8K A;  3NE7 A;  2B4D A;  4E0A A;  2PRB A;  1P4N A;  2FSR A;  5JQ4 A;  1S5K A;  5F48 A;  4KOY A;  5J8F A;  3EXN A;  4JXQ A;  4UWJ A;  1U6M A;  4JXR A;  2JEV A;  3DR6 A;  4KOU A;  1MJB A;  3IWG A;  1FY7 A;  2J8M A;  3JUW A;  2Z11 A;  3VWE A;  4CRZ B;  3S6F A;  1YVK A;  2PC1 A;  4YFJ A;  2HUZ A;  3TOB A;  3TO6 A;  1M4D A;  3RYO A;  1NMT A;  2Q04 A;  4R9M A;  1YGH A;  4XPK A;  1QSO A;  3JVN A;  1OZP A;  2ZW4 A;  4AG9 A;  3D3S A;  2FL4 A;  1R57 A;  1IID A;  4KLV A;  4R57 A;  1SQH A;  2PR1 A;  5IV0 A;  3GY9 A;  2B3U A;  2A4N A;  3S6K A;  2OZG A;  4XPD C;  4AG7 A;  2Q4Y A;  4ONU A;  4XNH B;  1XMT A;  2Z0Z A;  2G0B A;  1KUV A;  1M1D A;  2NMT A;  2BUE A;  3W6X A;  4U9Z A;  5HH1 A;  4KOR A;  3TO9 A;  5ISV A;  4KOV A;  4K30 A;  1Y7R A;  2H5M A;  3IGR A;  1MJA A;  3P2F A;  4NEX A;  2IL4 A;  2D4O A;  2ZW6 A;  5EBV A;  2GE3 A;  4H6Z A;  3N7Z A;  2D4P A;  3G3S A;  2QIR A;  5GCN A;  2P6G A;  2VBQ A;  2DXQ A;  4GS4 A;  2CY2 A;  1VKC A;  2REF A;  1I12 A;  4NSQ A;  4QUS A;  4AVA A;  4KOW A;  2Q44 A;  4NXY A;  2FS5 A;  1LRZ A;  1GHE A;  3BJ8 A;  2BEI A;  2B3V A;  3T90 A;  4NCZ A;  4CS0 B;  1M44 A;  1I21 A;  3DR8 A;  4MI4 A;  4M85 A;  1QSN A;  1YX0 A;  1S60 A;  4UBR A;  2OB0 A;  4JWP A;  4QC6 A;  3SHP A;  4ZBG A;  3QAH A;  4UA3 A;  4U5Y A;  2AJ6 A;  3BLN A;  4F6A A;  3R1K A;  1YK3 A;  2C27 A;  2B58 A;  1YRE A;  2G3T A;  2WPX A;  1S3Z A;  3EFA A;  1IYK A;  2PSW A;  2GIV A;  1QSM A;  1RO5 A;  3TO7 A;  4CAW A;  1QST A;  3EC4 A;  3LD2 A;  2OU2 A;  4B5P A;  2QML A;  3BJ7 A;  4MBU A;  3G8W A;  3LOD A;  2ZW7 A;  1PUA A;  3FB3 A;  2B5G A;  4R87 A;  3EY5 A;  3KKW A;  5DWN A;  4ORF A;  4YGO A;  1YR0 A;  4BMH A;  4HKF A;  1VHS A;  2CNT A;  4I49 A;  2VI7 A;  1M4I A;  2EUI A;  3F5B A;  2ARH A;  2FXF A;  2JDC A;  5CNP A;  1KUX A;  4AVC A;  2HQY A;  3GYA A;  4Y49 C;  5FVJ A;  4FD6 A;  2CNS A;  3CXP A;  5DWM A;  5KTC A;  1B87 A;  4KUB A;  5EC4 A; 
#chains in the Genus database with same CATH topology
 4PXD A;  2P0W A;  5AG4 A;  5IX3 A;  3H4Q A;  4IK2 A;  4PV6 A;  1YLE A;  4MY0 A;  1AYE A;  4KSA A;  3SJX A;  1IIC A;  3I9S A;  1UFH A;  4CGL A;  2R8V A;  1Z2L A;  2JLM A;  1M4G A;  4HNW B;  3SXN A;  2FIA A;  4DYO A;  5JM6 A;  4A32 A;  1XEB A;  1K4J A;  4MJ8 A;  3S6G A;  1L0C A;  4F0X A;  2K5T A;  3S6H A;  4ZYQ A;  3FVL A;  1OBR A;  4HNY B;  3SI2 A;  4JLY A;  3BI1 A;  1S7N A;  1Y9K A;  2XEG A;  3BI0 A;  2QEC A;  3FEC A;  4P4B A;  4JJX A;  2GRE A;  4QVT A;  5LRJ A;  2J8R A;  4FWU A;  3K2K A;  3D7H A;  1ZLI A;  2J9A A;  5F49 A;  2BOA A;  2R7H A;  3B3T A;  4C2Y A;  4JZ0 A;  2RC4 A;  4LUA A;  4A2Z A;  4CYQ A;  3KR5 A;  4F9U A;  3RBU A;  4MHD A;  1QMU A;  5K8N A;  2I3C A;  3SJE A;  2C6P A;  4EFD A;  3C26 A;  4NJR A;  3CPA A;  2VEZ A;  3MN8 A;  2R1I A;  4XPD B;  1ELM P;  1YW6 A;  1CM0 A;  2WYR A;  2PJ4 A;  3SXO A;  1KZF A;  1ZG8 A;  2VZZ A;  4QB9 A;  2PJ0 A;  4PSW A;  3D7D A;  1XF8 A;  2BSW A;  2CXA A;  3KHZ A;  4RN7 A;  5E96 A;  4RS2 A;  4NGR A;  4CGN A;  2V8G A;  2PQ8 A;  5H86 A;  5C88 A;  2VQY A;  3WC6 A;  4PXB A;  4M6H A;  3WR7 A;  1P0H A;  5I0C A;  3DDD A;  1WK4 A;  1RTQ A;  4CAX A;  4HNX B;  1TF9 A;  1PYT B;  2FE7 A;  1Q2C A;  3FRM A;  2F5I A;  4IUS A;  4RI1 A;  1XE4 A;  4O23 A;  4PXE A;  2DPT A;  1Z4E A;  1N71 A;  1IY7 A;  2V8D A;  4NGN A;  1QSR A;  1BO4 A;  2WZN A;  2ZOG A;  2AFZ A;  2J8N A;  5JPH A;  1ZO0 A;  5I4M A;  1RXT A;  3TTH A;  3ZJ0 A;  5A27 A;  4JD6 A;  5LYF A;  5K8M A;  1PU9 A;  3D67 A;  3FBU A;  4DJL A;  4MHY A;  3LMS A;  1TKH A;  4E8O A;  3W6S A;  1Z8X A;  5F09 A;  2REE A;  4KSF A;  2CTB A;  3B3C A;  1NSA A;  3R95 A;  2IMO A;  4OME A;  1QQ9 A;  4KOT A;  2I00 A;  4AVB A;  2OZU A;  1JQG A;  2YNC A;  4XPL A;  5AGE A;  5EMI A;  5HVF A;  3T9Y A;  2OOT A;  4R3L A;  4B5O A;  5F46 A;  1J4J A;  1Z4R A;  3B3W A;  4KZT A;  1Z9U A;  4IAV A;  4OAE A;  3ZZI A;  3TFY A;  5F47 A;  3QAY A;  2B4B A;  2EVN A;  4PXC A;  2Q0Y A;  3NE8 A;  2R98 A;  3D2P A;  4H89 A;  3DGV A;  1CPX A;  2PJ5 A;  3W91 A;  1HDQ A;  2Z10 A;  2NYQ A;  1IGB A;  4WJB A;  3FIX A;  1S7F A;  2ODF A;  4A38 A;  4B5P B;  4R76 A;  1CBX A;  4GM5 A;  3IU1 A;  3MGD A;  5IB9 A;  3CXS A;  3I3G A;  3PB8 X;  1Q2D A;  1KUY A;  2V77 A;  3KQX A;  3NH4 A;  4L89 A;  4P4F A;  3GUX A;  2YGW A;  4NF1 A;  2B5G B;  2GFQ A;  4J3G A;  3VWD A;  3CDX A;  3S9N A;  2ZED A;  4F0Y A;  5J1Q A;  2VZY A;  4C2Z A;  4FD5 A;  4QBJ A;  3D4U A;  2KCW A;  2AFO A;  3V8I A;  4CGO A;  3VAT A;  3MRU A;  3PB7 X;  4X5K A;  5H84 A;  4P45 A;  5KTA A;  4R7M A;  4EVY A;  5LRG A;  4ZY0 A;  3D7F A;  4CYN A;  3B2Y A;  5G22 A;  5DS0 A;  1B6B A;  3FED A;  4PK3 A;  1XIX A;  1LAM A;  1WWZ A;  3IJ3 A;  7CPA A;  5IB0 A;  2JBK A;  4R8F A;  4KUA A;  1XJO A;  1LOK A;  3D66 A;  2Z3L A;  3K9U A;  4EME A;  4ZY1 A;  1BAV A;  4XNH C;  2ZOF A;  3CXQ A;  1XOV A;  2ATR A;  3PZJ A;  5CBM A;  1GYT A;  4UEZ A;  4H6U A;  2I79 A;  2Y0M A;  2ZW5 A;  4A30 A;  4PK2 A;  2PJ9 A;  3FEE A;  3FXT A;  2PJ3 A;  4OID A;  3TOA A;  4FD4 A;  3OWC A;  4M3S A;  5HXD A;  3FNC A;  2FCK A;  4FUU A;  2PIZ A;  5CPA A;  2ZEE A;  2HC9 A;  2YNE A;  4NGT A;  4B6Z A;  4E2A A;  2ANP A;  4YU9 A;  3TC8 A;  1BOB A;  2PIY A;  2Z3K A;  4C68 A;  5KTD A;  4KOX A;  2PJ7 A;  4MFJ A;  2ZPA A;  3R9E A;  3I1U A;  5G20 A;  1BLL E;  4LX9 A;  1A2Z A;  1F57 A;  1MJ9 A;  1IB1 E;  1TF8 A;  2OZH A;  4YRH A;  4OLL A;  3RNZ A;  3S9L A;  1I1D A;  3PB9 X;  1F2P A;  5LRK A;  2GAN A;  3TCV A;  4OP4 A;  2PVW A;  4X2T A;  3B8G A;  4MFZ A;  4KSI A;  5AG6 A;  3EO4 A;  4KOS A;  5D29 A;  3F0A A;  1NE9 A;  3DLJ A;  4AB7 A;  1DTD A;  4KVX A;  2HV2 A;  2CNM A;  2G9D A;  4NGQ A;  4NGP A;  3SI0 A;  3R9F A;  1Q2Y A;  4Y49 B;  2PJA A;  3PP9 A;  4IHM A;  4UWI A;  2P6E A;  1NSL A;  3D2M A;  3R9G A;  4R3K A;  4UEF A;  2QYV A;  3D8P A;  4NJQ A;  4OAD A;  1S7L A;  2PR8 A;  4UF4 A;  3VH9 A;  4BD9 A;  2GU2 A;  2BL1 A;  2ZXV A;  4OC0 A;  5AG7 A;  2PJB A;  2NSM A;  3N5F A;  2C6G A;  3PGP A;  4WWV A;  4MY3 A;  2AE6 A;  3FX6 A;  3R96 A;  4FAI A;  3E0K A;  1YVO A;  5HMN A;  2Q51 A;  2DPS A;  4U9Y A;  2EK8 A;  2PDO A;  3TE4 A;  1X12 A;  1XBU A;  1CJW A;  1ON0 A;  1Y9W A;  5LYL A;  4L8A A;  4OKO A;  3IC1 A;  4MCQ A;  4ZX9 A;  4M6G A;  4HPS A;  1LCP A;  1LFW A;  2Q4V A;  2F7V A;  4UIA A;  4A31 A;  4MCP A;  4ONW A;  3TT2 A;  1IYL A;  3NFZ A;  3FYN A;  3QB8 A;  6CPA A;  2VXK A;  2P6F A;  3GKR A;  2EBJ A;  2CF4 A;  4MFL A;  8CPA A;  4X8I A;  2Z3O A;  3RO0 A;  2QJ8 A;  4CAV A;  1XMB A;  3DSB A;  2X7B A;  4KVM E;  4KLW A;  2JBJ A;  5C82 A;  4II9 A;  4FD7 A;  3LWU A;  2JDD A;  4P4D A;  2FIW A;  5LYD A;  3SI1 A;  4BBH A;  4OC1 A;  2AFS A;  2OH1 A;  1KWM A;  3IO1 A;  4DNC A;  1CX8 A;  2FT0 A;  3D68 A;  4UEE A;  4CRY B;  4PSX A;  3HUV A;  2EK9 A;  3UY5 A;  4P10 A;  1V0C A;  4KVO E;  2Q7B A;  1M4L A;  1S7K A;  3IWE A;  4IF5 A;  4K3N A;  2B4D B;  3FH4 A;  2JEW A;  2WPW A;  4F8Z A;  5J8C A;  2Q7S A;  4MHZ A;  1Y7E A;  1FNO A;  3TX8 A;  3NH5 A;  2Z3N A;  1EE3 P;  1PCA A;  2G3A A;  1MK4 A;  2V8H A;  3CZX A;  4MHN A;  4ZY2 A;  1ELL P;  3DNS A;  3P2H A;  1TIQ A;  1UWY A;  3JTK A;  3SJG A;  2O28 A;  1HEE A;  3F8K A;  2ZEH A;  3NE7 A;  4F9V A;  2B4D A;  4E0A A;  4CYP A;  3PBB A;  2HB6 A;  1P4N A;  2PRB A;  2FSR A;  3IIB A;  4JYW A;  4CAF A;  1IOI A;  1S5K A;  2AFU A;  2WUU A;  5F48 A;  5JQ4 A;  4KOY A;  5J8F A;  5K8O A;  3EXN A;  3PB6 X;  4JXQ A;  4UWJ A;  3WC7 A;  1TKF A;  1R3N A;  4ZX8 A;  1U6M A;  3ISZ A;  3SJF A;  2O53 A;  4JXR A;  2JEV A;  3DR6 A;  4M6I A;  4KOU A;  1MJB A;  2PRQ A;  4FBE A;  3H8F A;  3IWG A;  1FY7 A;  2J8M A;  4OC3 A;  5ELY A;  2PJ6 A;  4UFW A;  2QVP A;  4MHP A;  4Q7A A;  1CP7 A;  1R43 A;  5HVG A;  4A33 A;  3JUW A;  4C7I A;  2Z11 A;  2DEA A;  3D7G A;  3S9M A;  4C7H A;  3VWE A;  4CRZ B;  3S6F A;  2ZEG A;  3ISX A;  1YVK A;  2PC1 A;  4YFJ A;  3KR4 A;  2ZEO A;  4NGS A;  2HUZ A;  3KZW A;  1HDU A;  2GLF A;  4P6Y A;  3TOB A;  2PJ1 A;  4UCM A;  2XEI A;  1M4D A;  3IU2 A;  1NMT A;  3RYO A;  3TO6 A;  3IFE A;  2C1C A;  3RAM A;  3K9T A;  2Z3M A;  4B12 A;  3B35 A;  2Q04 A;  2PJ8 A;  3FF3 A;  4R9M A;  3PBE A;  1CPS A;  1YGH A;  4XPK A;  4DUK A;  1QSO A;  4Z65 A;  3JVN A;  4AXV A;  4CAE A;  1ZLH A;  1OZP A;  4P44 A;  3KHX A;  2ZW4 A;  4AG9 A;  3D3S A;  2CIJ A;  2ZEL A;  4P4I A;  2FL4 A;  1R57 A;  1IID A;  4KLV A;  4P4J A;  4R57 A;  1SQH A;  1IU8 A;  2PR1 A;  2AFM A;  2POK A;  4OC2 A;  5IV0 A;  3GY9 A;  2B3U A;  3T8W A;  2A4N A;  3FJU A;  3S6K A;  5JGF A;  2OZG A;  3FMC A;  4XPD C;  4AG7 A;  2Q4Y A;  3PFE A;  4MMO A;  4ONU A;  4XNH B;  1XMT A;  1DE4 C;  2Z0Z A;  2FVG A;  2G0B A;  4A39 A;  4CGM A;  1KUV A;  1M1D A;  2NMT A;  2BUE A;  2O4H A;  4U9Z A;  3W6X A;  5HH1 A;  1AMP A;  3PEI A;  2OR4 A;  4KOR A;  4PQA A;  1VIX A;  4UCN A;  3A9L A;  3TO9 A;  5ISV A;  4KOV A;  3GIU A;  4K30 A;  1ZG7 A;  1Y7R A;  4B13 A;  3KGQ A;  2H5M A;  4UFV A;  1VGY A;  1MJA A;  3IGR A;  2ABZ A;  2XEF A;  1LAP A;  3PFO A;  1Z8T A;  3P2F A;  3BHX A;  2IL4 A;  2D4O A;  2ZW6 A;  4NEX A;  5EBV A;  4UIB A;  4A37 A;  4MFP A;  5A28 A;  2GE3 A;  4H6Z A;  4Q36 A;  3N7Z A;  3B7I A;  1FT7 A;  4X3R A;  1YSJ A;  3KL9 A;  4Q38 A;  2D4P A;  4MFK A;  3WAB A;  3G3S A;  2QIR A;  5D8N A;  3L2N A;  5GCN A;  2P6G A;  3PB4 X;  2Q43 A;  2DXQ A;  2VBQ A;  4GS4 A;  3RZA A;  2CY2 A;  1ARL A;  2YNC C;  1VKC A;  2REF A;  1I12 A;  4G1P A;  2V8V A;  4MFQ A;  4NSQ A;  3NH8 A;  4QUS A;  4AVA A;  4PPZ A;  2DF5 A;  1IOF A;  4KOW A;  2Q44 A;  1VHO A;  4NXY A;  2FS5 A;  1JWQ A;  5THW A;  5HVH A;  1LRZ A;  1BPM A;  1CP6 A;  1GHE A;  3BJ8 A;  2BEI A;  3LAC A;  2B3V A;  3GB0 A;  4B11 A;  5AG5 A;  3T90 A;  3B3S A;  2RFH A;  4LQ6 A;  2IQ6 A;  1AUG A;  4NCZ A;  4ZI6 A;  4KS9 A;  4CS0 B;  3PRT A;  1M44 A;  5LYI A;  1I21 A;  3JRU A;  3DR8 A;  4MI4 A;  2AFW A;  5BWA B;  1H8L A;  4M85 A;  4MRI A;  1QSN A;  4B10 A;  1YX0 A;  1S60 A;  1Y0R A;  3VAR A;  4UBR A;  1Z5R A;  4TWE A;  2OB0 A;  4JWP A;  3CT9 A;  4QC6 A;  1CG2 A;  2GLJ A;  3BXM A;  1XRY A;  3SHP A;  4ZBG A;  1X10 A;  3QAH A;  4UA3 A;  4A94 A;  1YW4 A;  4CPA A;  1VHE A;  4TNU A;  2AFX A;  4U5Y A;  1BPN A;  4OIW A;  2AJ6 A;  1YME A;  2PCU A;  2PJ2 A;  3BLN A;  1Y0Y A;  4F6A A;  3R1K A;  1YK3 A;  5JH9 A;  5G1Z A;  2Z3P A;  2C27 A;  1TKJ A;  2B58 A;  1YRE A;  2G3T A;  4MCR A;  2F8H A;  3WC5 A;  3H5Z A;  2WPX A;  4OC4 A;  4R6T A;  4MCS A;  2PE3 A;  2YND A;  3HLP A;  4C2X A;  2EWB A;  2PJC A;  3KQZ A;  2ZEM A;  1S3Z A;  3EFA A;  4OC5 A;  1IYK A;  1YQE A;  2PSW A;  3IEH A;  2GIV A;  1YLO A;  1QSM A;  1RO5 A;  2ZEN A;  3GLJ A;  3TO7 A;  4CAW A;  3KI9 A;  3KAS A;  4YWY A;  2RB7 A;  1TXR A;  1QST A;  3EC4 A;  4CGP A;  3LD2 A;  2OU2 A;  2CTC A;  3V7Z A;  4B5P A;  2QML A;  5K8P A;  3BJ7 A;  4MBU A;  3H8E A;  3G8W A;  1Q7L A;  3V38 A;  3LOD A;  4B14 A;  1F2O A;  2ZW7 A;  4P4E A;  1PUA A;  3B3V A;  1ZG9 A;  3FB3 A;  4NFR A;  2B5G A;  3IWW A;  3CPX A;  4MXU A;  4R87 A;  2IJZ A;  1XFO A;  3EY5 A;  3KKW A;  4LQG A;  5DWN A;  4ORF A;  2Q4Z A;  4YGO A;  3NA6 A;  1YR0 A;  4H2K A;  1Z8W A;  4HKF A;  4BMH A;  1VHS A;  2BO9 A;  2CNT A;  4ZGY B;  3QNV A;  2XEJ A;  2ZEP A;  4NGM A;  4I49 A;  4BIN A;  2VI7 A;  1M4I A;  4CYO A;  1ARM A;  4UFX A;  2EUI A;  3H8G A;  4UCP A;  4W9Y A;  2ZEF A;  2C6C A;  4GXH A;  2VL1 A;  3F5B A;  2ARH A;  2FXF A;  4A95 A;  2PVV A;  2EO8 A;  2JDC A;  4EWT A;  5CNP A;  1KUX A;  4RUH A;  4AVC A;  2HQY A;  3GYA A;  1Z8L A;  4Y49 C;  5FVJ A;  4FD6 A;  5G21 A;  2WSA A;  2CNS A;  3CXP A;  1LAN A;  5DWM A;  3WT4 A;  2BCO A;  5KTC A;  1B87 A;  4KUB A;  5EC4 A; 
#chains in the Genus database with same CATH homology
 2P0W A;  5AG4 A;  5IX3 A;  3H4Q A;  4PV6 A;  1YLE A;  4MY0 A;  4KSA A;  1IIC A;  3I9S A;  1UFH A;  4CGL A;  2R8V A;  3SXN A;  2JLM A;  1M4G A;  4HNW B;  2FIA A;  4A32 A;  1XEB A;  1K4J A;  4MJ8 A;  3S6G A;  1L0C A;  4F0X A;  2K5T A;  3S6H A;  4HNY B;  4JLY A;  1S7N A;  1Y9K A;  2QEC A;  4JJX A;  4QVT A;  2J8R A;  5F49 A;  2R7H A;  4C2Y A;  4LUA A;  2RC4 A;  4A2Z A;  4CYQ A;  4MHD A;  3C26 A;  2VEZ A;  2R1I A;  4XPD B;  1CM0 A;  3SXO A;  1KZF A;  2VZZ A;  4QB9 A;  4PSW A;  1XF8 A;  2BSW A;  2CXA A;  5E96 A;  4CGN A;  4RS2 A;  2PQ8 A;  5H86 A;  5C88 A;  2VQY A;  3WR7 A;  1P0H A;  5I0C A;  3DDD A;  1WK4 A;  4CAX A;  4HNX B;  2FE7 A;  1Q2C A;  3FRM A;  2F5I A;  4IUS A;  4RI1 A;  1XE4 A;  2DPT A;  1Z4E A;  1N71 A;  1QSR A;  1BO4 A;  5JPH A;  2J8N A;  1ZO0 A;  1RXT A;  3TTH A;  3ZJ0 A;  5A27 A;  4JD6 A;  1PU9 A;  3FBU A;  4E8O A;  3W6S A;  2REE A;  4KSF A;  3R95 A;  4KOT A;  2I00 A;  4AVB A;  2OZU A;  4XPL A;  2YNC A;  4B5O A;  5AGE A;  3T9Y A;  4R3L A;  5F46 A;  1J4J A;  1Z4R A;  4KZT A;  1Z9U A;  3ZZI A;  4OAE A;  3TFY A;  5F47 A;  2B4B A;  2EVN A;  2Q0Y A;  2R98 A;  3D2P A;  4H89 A;  3W91 A;  2Z10 A;  3FIX A;  1S7F A;  4B5P B;  3IU1 A;  3MGD A;  3CXS A;  3I3G A;  1Q2D A;  1KUY A;  4L89 A;  2YGW A;  4NF1 A;  2B5G B;  4J3G A;  3VWD A;  4F0Y A;  2VZY A;  4C2Z A;  4FD5 A;  4QBJ A;  2KCW A;  3V8I A;  4CGO A;  4X5K A;  5H84 A;  5KTA A;  4EVY A;  4CYN A;  5G22 A;  1B6B A;  4PK3 A;  1XIX A;  1WWZ A;  5IB0 A;  4KUA A;  2Z3L A;  3K9U A;  4XNH C;  3CXQ A;  2ATR A;  3PZJ A;  4A30 A;  4H6U A;  2I79 A;  2Y0M A;  2ZW5 A;  4PK2 A;  3FXT A;  3TOA A;  4FD4 A;  3OWC A;  4M3S A;  3FNC A;  2FCK A;  4E2A A;  2YNE A;  1BOB A;  2Z3K A;  4C68 A;  5KTD A;  4KOX A;  4MFJ A;  2ZPA A;  3R9E A;  5G20 A;  4LX9 A;  1MJ9 A;  1IB1 E;  2OZH A;  4YRH A;  4OLL A;  1I1D A;  2GAN A;  3TCV A;  3B8G A;  4MFZ A;  5AG6 A;  3EO4 A;  4KOS A;  3F0A A;  1NE9 A;  4AB7 A;  4KVX A;  2HV2 A;  2CNM A;  4BBH A;  3R9F A;  1Q2Y A;  4Y49 B;  3PP9 A;  4UWI A;  2P6E A;  1NSL A;  3D2M A;  3R9G A;  4R3K A;  3D8P A;  4OAD A;  1S7L A;  2PR8 A;  2BL1 A;  2ZXV A;  5AG7 A;  3PGP A;  4MY3 A;  2AE6 A;  3R96 A;  3E0K A;  1YVO A;  5HMN A;  2DPS A;  4U9Y A;  2PDO A;  3TE4 A;  1CJW A;  1ON0 A;  1Y9W A;  4L8A A;  2Q4V A;  4A31 A;  3TT2 A;  1IYL A;  3FYN A;  3QB8 A;  2VXK A;  2P6F A;  3GKR A;  4MFL A;  2Z3O A;  4CAV A;  3DSB A;  2X7B A;  4KVM E;  4KLW A;  5C82 A;  4II9 A;  4FD7 A;  2JDD A;  2FIW A;  2OH1 A;  4DNC A;  2FT0 A;  4CRY B;  4PSX A;  3UY5 A;  1V0C A;  4KVO E;  2Q7B A;  1S7K A;  3IWE A;  4IF5 A;  2B4D B;  2WPW A;  5J8C A;  2Z3N A;  2G3A A;  1MK4 A;  3DNS A;  3P2H A;  1TIQ A;  3JTK A;  2O28 A;  3F8K A;  3NE7 A;  2B4D A;  4E0A A;  4CYP A;  2PRB A;  1P4N A;  2FSR A;  4CAF A;  5JQ4 A;  1S5K A;  2WUU A;  5F48 A;  4KOY A;  5J8F A;  3EXN A;  4JXQ A;  4UWJ A;  1U6M A;  4JXR A;  2JEV A;  3DR6 A;  4KOU A;  1MJB A;  3IWG A;  1FY7 A;  2J8M A;  4UFW A;  4A33 A;  3JUW A;  4C7I A;  2Z11 A;  4C7H A;  3VWE A;  4CRZ B;  3S6F A;  1YVK A;  2PC1 A;  4YFJ A;  2HUZ A;  3TOB A;  3TO6 A;  4UCM A;  3IU2 A;  1M4D A;  3RYO A;  1NMT A;  2Z3M A;  4B12 A;  2Q04 A;  4R9M A;  1YGH A;  4XPK A;  1QSO A;  3JVN A;  4CAE A;  1OZP A;  2ZW4 A;  4AG9 A;  3D3S A;  2FL4 A;  1R57 A;  1IID A;  4KLV A;  4R57 A;  1SQH A;  2PR1 A;  5IV0 A;  3GY9 A;  2B3U A;  2A4N A;  3S6K A;  2OZG A;  4XPD C;  4AG7 A;  2Q4Y A;  4ONU A;  4XNH B;  1XMT A;  2Z0Z A;  2G0B A;  4CGM A;  1KUV A;  1M1D A;  2NMT A;  2BUE A;  3W6X A;  4U9Z A;  5HH1 A;  4KOR A;  4UCN A;  3TO9 A;  3A9L A;  5ISV A;  4KOV A;  4K30 A;  1Y7R A;  4B13 A;  2H5M A;  4UFV A;  3IGR A;  1MJA A;  3P2F A;  4NEX A;  2IL4 A;  2D4O A;  2ZW6 A;  5EBV A;  4MFP A;  5A28 A;  2GE3 A;  4H6Z A;  4Q36 A;  3N7Z A;  4Q38 A;  2D4P A;  4MFK A;  3G3S A;  2QIR A;  5GCN A;  2P6G A;  2VBQ A;  2DXQ A;  4GS4 A;  2CY2 A;  2YNC C;  1VKC A;  2REF A;  1I12 A;  4NSQ A;  4MFQ A;  4QUS A;  4AVA A;  4KOW A;  2Q44 A;  4NXY A;  2FS5 A;  1LRZ A;  1GHE A;  3BJ8 A;  2BEI A;  2B3V A;  4B11 A;  5AG5 A;  3T90 A;  4NCZ A;  4KS9 A;  4CS0 B;  1M44 A;  1I21 A;  3DR8 A;  4MI4 A;  5BWA B;  4B10 A;  4M85 A;  1QSN A;  1YX0 A;  1S60 A;  4UBR A;  2OB0 A;  4JWP A;  4QC6 A;  3SHP A;  4ZBG A;  3QAH A;  4UA3 A;  4U5Y A;  2AJ6 A;  3BLN A;  4F6A A;  3R1K A;  1YK3 A;  5G1Z A;  2Z3P A;  2C27 A;  2B58 A;  1YRE A;  2G3T A;  3H5Z A;  2WPX A;  2YND A;  4C2X A;  1S3Z A;  3EFA A;  1IYK A;  2PSW A;  2GIV A;  1QSM A;  1RO5 A;  3TO7 A;  4CAW A;  4CGP A;  1QST A;  3EC4 A;  3LD2 A;  2OU2 A;  4B5P A;  2QML A;  3BJ7 A;  4MBU A;  3G8W A;  3LOD A;  4B14 A;  2ZW7 A;  1PUA A;  3FB3 A;  2B5G A;  4R87 A;  3EY5 A;  3KKW A;  5DWN A;  4ORF A;  4YGO A;  1YR0 A;  4BMH A;  4HKF A;  1VHS A;  2CNT A;  4ZGY B;  4I49 A;  2VI7 A;  1M4I A;  4CYO A;  4UFX A;  2EUI A;  4UCP A;  3F5B A;  2ARH A;  2FXF A;  4A95 A;  2JDC A;  5CNP A;  1KUX A;  4AVC A;  2HQY A;  3GYA A;  4Y49 C;  5FVJ A;  4FD6 A;  5G21 A;  2WSA A;  2CNS A;  3CXP A;  5DWM A;  5KTC A;  1B87 A;  4KUB A;  5EC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...