2QIRA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a and kanamycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
172
Chain Sequence
b'SVTLRLMTEHDLAMLYEWLNRSHIVEWWARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 172
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2qirA00
2GIVA 2P6EA 1ON0A 5DWMA 1M44A 4QUSA 2PC1A 5KTDA 1V0CA 5ISVA 1MJAA 2G3AA 3VWDA 4BMHA 2FIAA 4E8OA 2FSRA 2QECA 2O28A 3BJ7A 1KUVA 1K4JA 1IYLA 3FYNA 3GYAA 4B5PB 1BO4A 2QIRA 3W6SA 3DR8A 4KVOE 4NSQA 2FL4A 3E0KA 2JDDA 1IICA 2RC4A 4AVCA 4KLVA 2I79A 3MGDA 5CNPA 4OAEA 4OLLA 3D2MA 3EC4A 4XPLA 4JD6A 3B8GA 1IYKA 2Q44A 1P0HA 4U9ZA 2VZZA 4R3LA 5EC4A 4CAXA 5KTAA 4J3GA 2P6GA 4Y49B 4AB7A 2F5IA 2VQYA 3F0AA 2OB0A 4FD5A 3PGPA 4YFJA 3R96A 4JXQA 1YGHA 3C26A 4X5KA 3D8PA 4UWIA 1BOBA 5JQ4A 3TTHA 1WWZA 1Y9WA 2R1IA 3DSBA 3IWGA 1M1DA 1B6BA 4QBJA 4LUAA 4RS2A 2HUZA 1R57A 1Z4EA 2KCWA 2G3TA 2FIWA 3SXNA 2DXQA 3IGRA 4U9YA 4B5PA 2CNTA 3R9FA 3PZJA 3VWEA 3TFYA 1S7FA 1KUXA 2FS5A 4CAVA 3FNCA 2H5MA 2FT0A 1J4JA 3LD2A 2B4DA 1KUYA 1Y9KA 3QAHA 4NXYA 2ZXVA 3F8KA 1YR0A 3SHPA 3EXNA 3ZJ0A 2J8NA 4QB9A 1XIXA 1Z9UA 2Z10A 1Z4RA 3S6KA 3P2FA 2I00A 4YRHA 2PR8A 2JEVA 2VZYA 5JPHA 5F49A 3DDDA 3CXQA 1M4IA 1VHSA 1YREA 4PK3A 4KOVA 2Y0MA 3R1KA 2R8VA 2CNMA 3UY5A 2BUEA 3TO7A 4HNWB 3JVNA 2NMTA 4NF1A 5KTCA 5GCNA 4HNXB 4YGOA 1VKCA 3NE7A 1YLEA 3R95A 1RXTA 3EY5A 4QC6A 1RO5A 4LX9A 2Q04A 2BSWA 1CM0A 4E0AA 3F5BA 3BLNA 2B58A 4KLWA 3S6GA 2CY2A 1N71A 3R9EA 2BL1A 4ORFA 1IB1E 4FD6A 4KOUA 3CXSA 1QSOA 2GANA 4AG9A 2ARHA 2Z0ZA 2ZW6A 4NCZA 3SXOA 2K5TA 4FD4A 4XNHB 4MI4A 4F0YA 2B4DB 2B3UA 1S5KA 4UBRA 3T9YA 1XF8A 4KUBA 3GKRA 4PSWA 1PU9A 4XPDB 2B3VA 3PP9A 4JJXA 5H84A 2REFA 5H86A 1B87A 2C27A 2OU2A 2Z11A 2PSWA 3KKWA 4HKFA 5C82A 4OADA 4KOYA 1Q2CA 3TO6A 2Q7BA 5IV0A 1XEBA 4UWJA 2BEIA 2VXKA 4R57A 3T90A 3TOAA 4JXRA 1L0CA 4PK2A 3FXTA 4KOTA 4ONUA 4XPKA 1GHEA 2QMLA 3TT2A 5F48A 3GY9A 4L8AA 4R3KA 2VI7A 4ZBGA 2OZHA 3DR6A 2PDOA 3TCVA 5J8FA 2D4PA 2AE6A 4I49A 5FVJA 2JDCA 2PQ8A 2Q4YA 4L89A 4K30A 3R9GA 1Y7RA 4GS4A 4XNHC 1I21A 4NEXA 2P0WA 5DWNA 2A4NA 2B4BA 2OH1A 2ZPAA 3CXPA 1NSLA 1KZFA 4PV6A 4JLYA 3FRMA 4XPDC 1XMTA 3W6XA 4KVME 2R98A 4KOXA 4II9A 4Y49C 2J8MA 2B5GA 2PR1A 3EO4A 3D3SA 1UFHA 5C88A 3FBUA 1TIQA 3BJ8A 1MK4A 1FY7A 1S7LA 1Q2DA 5F46A 5J8CA 4CS0B 3FIXA 4IF5A 2WPXA 5EBVA 4EVYA 3TOBA 4R87A 1YK3A 2G0BA 3DNSA 3H4QA 5E96A 2EUIA 2ZW4A 4HNYB 4RI1A 4KOSA 3W91A 4DNCA 4F6AA 2PRBA 5I0CA 5HMNA 1Q2YA 4MHDA 4JWPA 4MY0A 4MBUA 4CRYB 3TO9A 4E2AA 2IL4A 2R7HA 1YX0A 2FCKA 4KORA 2P6FA 3EFAA 2WPWA 1IIDA 4H6UA 3K9UA 1S60A 3OWCA 3S6FA 1QSTA 1QSNA 4AG7A 4QVTA 3ZZIA 1QSMA 1CJWA 4FD7A 2B5GB 4CRZB 2X7BA 1P4NA 1S7NA 1WK4A 2HV2A 3D2PA 4IUSA 1SQHA 4M85A 4PSXA 1U6MA 1LRZA 4M3SA 2ATRA 4KOWA 2EVNA 2FXFA 1PUAA 2ZW7A 2Q4VA 3I9SA 2REEA 3G8WA 2CNSA 3JUWA 1QSRA 3S6HA 4AVBA 2Q0YA 5IX3A 2OZUA 2ZW5A 1OZPA 2OZGA 1S3ZA 2JLMA 4KVXA 1YVKA 1M4DA 4MJ8A 5IB0A 1YVOA 2J8RA 1MJBA 1NE9A 2VEZA 4H6ZA 3WR7A 2HQYA 1I1DA 5HH1A 1M4GA 4H89A 4KZTA 2D4OA 4U5YA 1I12A 5F47A 3QB8A 4AVAA 3TE4A 3I3GA 3LODA 3G3SA 3RYOA 1XE4A 2AJ6A 4KUAA 4B5OA 4UA3A 2GE3A 3FB3A 3N7ZA 2VBQA 1NMTA 4MY3A 3V8IA 2FE7A 4CAWA 1S7KA 4R9MA 1MJ9A 3P2HA
chains in the Genus database with same CATH superfamily
1IU8A 2GIVA 2P6EA 3FJUA 1ON0A 4X8IA 1M44A 4QUSA 5DWMA 4C2XA 4P6YA 3VARA 2PC1A 5KTDA 2ZEFA 2ZEOA 1V0CA 5ISVA 3S9NA 1MJAA 2G3AA 1Q7LA 4RN7A 1EE3P 2FIAA 3VWDA 4BMHA 4E8OA 2FSRA 2QECA 2O28A 3BJ7A 1YQEA 1KUVA 1K4JA 2NYQA 4UCNA 3IFEA 2WZNA 4A39A 1IYLA 2BCOA 3V38A 1HDUA 3FYNA 3PFEA 4YWYA 5AG7A 5D8NA 4CAFA 3KI9A 3GYAA 4B5PB 1BO4A 3TC8A 2QIRA 4R7MA 3W6SA 4EFDA 3DR8A 1CX8A 4EWTA 8CPAA 4KVOE 5AGEA 4NSQA 2FL4A 2ZELA 4MFLA 3E0KA 5DS0A 3B3CA 2JDDA 1IICA 4FUUA 4ZX9A 2RC4A 4OC3A 3SJEA 3T8WA 2GFQA 4AVCA 2V8GA 4KLVA 1PYTB 3D7GA 5LYFA 2I79A 3MGDA 4CYQA 1VHOA 2CXAA 4UEZA 2XEGA 5CNPA 4OAEA 1UWYA 2Q7SA 4OLLA 4ZYQA 4MMOA 4X3RA 3D2MA 1ELMP 1F57A 3EC4A 3JRUA 3IWEA 4M6GA 4XPLA 4ZX8A 4OC0A 4TWEA 2NSMA 3B3SA 1R43A 4JD6A 3B8GA 4M6IA 2CTCA 3D7HA 2F8HA 1ARLA 3GIUA 1IYKA 1DE4C 1P0HA 2PJBA 2Q44A 4U9ZA 3LWUA 2VZZA 4R3LA 5EC4A 3IU2A 4P4EA 4CAXA 4Q38A 3A9LA 2C1CA 2EK9A 5K8MA 4J3GA 5KTAA 1LAMA 2P6GA 4Y49B 2F5IA 4AB7A 1BLLE 2XEFA 3FVLA 2VQYA 3F0AA 2OB0A 4FD5A 3PGPA 4OC5A 4P4DA 4YFJA 3D67A 2V8HA 3R96A 4JXQA 5AG6A 1YGHA 3C26A 4X5KA 4A33A 3IU1A 3D8PA 4KSFA 1LCPA 4UWIA 4OC2A 1BOBA 2C6CA 3TTHA 1WWZA 4KSAA 1XMBA 1Y9WA 5JQ4A 2R1IA 2PJ6A 4MFJA 4P4BA 3DSBA 3IWGA 1CPSA 1M1DA 4C68A 4UIAA 2GREA 4CYOA 1B6BA 4QBJA 2Q51A 4PXBA 3HLPA 4LUAA 4RS2A 2ODFA 2HUZA 1LOKA 1R57A 1Z4EA 2ZOGA 5IB9A 2KCWA 2G3TA 2FIWA 3SXNA 2DXQA 3CZXA 1Z5RA 3IGRA 2GLJA 1QQ9A 1X10A 4U9YA 2CNTA 4B5PA 1Z2LA 4FAIA 3R9FA 3PZJA 3VWEA 3NA6A 3TFYA 1TKHA 2IJZA 2EWBA 1S7FA 2PJ0A 1F2OA 1KUXA 2FS5A 4CAVA 5G21A 3FNCA 2H5MA 2FT0A 1Z8TA 4C2YA 1J4JA 4OP4A 4R6TA 1XBUA 3LD2A 2B4DA 1KUYA 1Y9KA 2EO8A 3QAHA 4NXYA 4F8ZA 4P4JA 1Y7EA 2ZXVA 1IOIA 3F8KA 1YR0A 1ZG9A 3SHPA 3EXNA 3ZJ0A 4F9VA 2J8NA 3B3TA 4QB9A 2PCUA 1XIXA 1Z9UA 2Z10A 4NGTA 1Z4RA 1F2PA 3S6KA 2EBJA 2ZEHA 3H5ZA 2I00A 3P2FA 4YRHA 5I4MA 1H8LA 3PB4X 7CPAA 2PR8A 4UCMA 2JEVA 4MFZA 1OBRA 2VZYA 2PRQA 1QMUA 4P45A 2AFMA 2AFOA 5CBMA 5F49A 3DDDA 4TNUA 3CXQA 5JPHA 1M4IA 1XOVA 3RZAA 1VHSA 4W9YA 1BPNA 4KSIA 1YREA 4PK3A 4OMEA 1YW6A 3NH5A 4BINA 4KOVA 2Y0MA 3R1KA 5G22A 2R8VA 3IIBA 4NFRA 2CNMA 3UY5A 2BUEA 3TO7A 4NGPA 1AUGA 3GUXA 4HNWB 1TXRA 4UFWA 3JVNA 3WT4A 2NMTA 1IY7A 2JBJA 2ZEPA 4MHPA 4NF1A 4B14A 5GCNA 4F9UA 3B3VA 4HNXB 4OC1A 5KTCA 4YGOA 1VKCA 3VATA 5LRGA 1FNOA 4P4IA 3NE7A 1YLEA 4NGRA 3R95A 4CYPA 2YNCC 3KR4A 1XFOA 1RXTA 3EY5A 4LQ6A 2PJ5A 4QC6A 4A94A 1VHEA 1RO5A 5THWA 4LX9A 4FBEA 3B3WA 4H2KA 1ZG7A 4KS9A 2Q04A 2BSWA 1CM0A 3KZWA 4E0AA 3F5BA 3BLNA 2B58A 4KLWA 3S6GA 2CY2A 1N71A 3R9EA 4ZY2A 4CGNA 2BL1A 3NH8A 1IB1E 3BHXA 4ORFA 4MCPA 3KGQA 4FD6A 2PJ4A 4KOUA 1GYTA 3CXSA 1QSOA 4GM5A 1AMPA 3D7FA 2GANA 4MHNA 4AG9A 5LYIA 3L2NA 4JZ0A 2ARHA 2Z0ZA 2ZW6A 2PJ1A 4NCZA 2YGWA 3SXOA 2K5TA 1R3NA 3CPXA 4FD4A 4XNHB 2WYRA 4MI4A 4F0YA 4NGNA 3ISZA 1CBXA 2B4DB 4YU9A 5JM6A 3FF3A 4UIBA 2B3UA 1S5KA 4CYNA 2ZOFA 3MN8A 4UBRA 3T9YA 1XF8A 3PBBA 5D29A 4KUBA 3GKRA 4PSWA 1PU9A 2PE3A 2B3VA 2DPTA 4XPDB 1FT7A 3PP9A 4JJXA 1LANA 5H84A 1NSAA 1TKJA 4B10A 3NH4A 4OC4A 2REFA 1Z8XA 1B87A 5H86A 4MXUA 2C27A 2OU2A 4A95A 2Z11A 4MFPA 4BBHA 3WC7A 2O4HA 4FWUA 3N5FA 2PSWA 3KKWA 4HKFA 5C82A 4OADA 4KOYA 2ZEGA 1Q2CA 4ZY0A 3TO6A 1VIXA 4NGQA 2Q7BA 3H8GA 1XEBA 5IV0A 1TF8A 3IJ3A 4UWJA 2OR4A 1CP6A 4WJBA 4A32A 2BEIA 1TF9A 1LFWA 2VXKA 4MHYA 4R57A 3D68A 3T90A 3TOAA 4JXRA 3KASA 1L0CA 3TX8A 4PK2A 3FXTA 4KOTA 4A31A 1PCAA 5HXDA 2GU2A 4ONUA 4XPKA 1GHEA 4UF4A 2QMLA 1YSJA 2ZEEA 3TT2A 1TKFA 5F48A 3GY9A 5LRJA 4L8AA 4R3KA 3KR5A 4UFXA 4AXVA 2AFSA 2QVPA 2OOTA 1YLOA 4B11A 4C7IA 3SI1A 4JYWA 3WC5A 2VI7A 4MCQA 4CAEA 4PXCA 4ZBGA 2OZHA 3DR6A 3D4UA 2PDOA 3TCVA 1A2ZA 5J8FA 2D4PA 4CGPA 2AE6A 4ZGYB 5JH9A 4IHMA 2JEWA 2POKA 2DEAA 4I49A 5FVJA 2JDCA 4MFKA 3I1UA 2PQ8A 4C7HA 2Q4YA 3LMSA 3PB8X 4NGSA 4L89A 2BO9A 2XEIA 4K30A 3SJXA 3R9GA 1Y7RA 2V8DA 1Y0RA 4GS4A 4XNHC 4MFQA 1I21A 4NEXA 2P0WA 2WSAA 5DWNA 2A4NA 2B4BA 3KHXA 2OH1A 2ZPAA 3PFOA 2YNDA 3CXPA 1NSLA 1KZFA 2Z3OA 4PV6A 4PXEA 4RUHA 4JLYA 3FRMA 5ELYA 4XPDC 2ZEMA 1BPMA 3FEDA 4UEFA 6CPAA 5G1ZA 3B2YA 1XMTA 3CPAA 3W6XA 4KVME 2Z3PA 2R98A 4G1PA 4KOXA 1JWQA 4II9A 4Y49C 2J8MA 5LRKA 2B5GA 2PR1A 3D7DA 3FX6A 4NJRA 3VH9A 3EO4A 3D3SA 1UFHA 1ZLIA 3BXMA 5CPAA 5C88A 3FBUA 3IC1A 1TIQA 3CDXA 2QYVA 4NJQA 3RO0A 3BJ8A 1MK4A 1FY7A 5HVGA 1S7LA 1Q2DA 5F46A 5J8CA 2XEJA 4F0XA 2AFXA 1ZO0A 2PVVA 4CS0B 3FIXA 4IF5A 4B13A 1AYEA 2PJAA 2WPXA 3FMCA 5EBVA 5EMIA 4EVYA 2ZENA 4Z65A 4OKOA 2J9AA 3TOBA 5K8OA 3PEIA 1YK3A 4R87A 2G0BA 4IAVA 2AFWA 3DNSA 2F7VA 2PJ2A 3H4QA 4MHZA 3KL9A 2HB6A 2EUIA 3H8FA 5E96A 2ZW4A 4HNYB 4RI1A 4KOSA 3W91A 1X12A 3BI0A 4DNCA 4F6AA 2PRBA 4MCSA 5I0CA 2GLFA 3GB0A 1IGBA 5HMNA 2O53A 5G20A 1Q2YA 1RTQA 2IMOA 2Q43A 3H8EA 4MHDA 5HVHA 3PRTA 1Y0YA 3IO1A 2JBKA 4JWPA 4MY0A 4A30A 3PB7X 4MBUA 4CRYB 4B12A 3TO9A 4E2AA 1M4LA 2IL4A 4R76A 2DF5A 2R7HA 1YX0A 3DLJA 2DPSA 3IEHA 2FCKA 1LAPA 2RB7A 4CGMA 4LQGA 2C6PA 4KORA 3HUVA 4CPAA 2P6FA 2PJCA 2WPWA 3EFAA 1XRYA 1IIDA 1CPXA 4H6UA 3KHZA 4NGMA 3BI1A 3IWWA 3K9UA 1IOFA 4PQAA 1S60A 4Q7AA 2C6GA 3OWCA 3S6FA 1QSTA 1QSNA 2Q4ZA 4AG7A 2PJ3A 4C2ZA 3K2KA 4QVTA 4ZI6A 3ZZIA 1CG2A 1QSMA 1CJWA 4FD7A 1HDQA 2ANPA 2B5GB 1HEEA 4OIWA 1ZLHA 4CRZB 4ONWA 3SJGA 2X7BA 2CF4A 2I3CA 4UFVA 4X2TA 1P4NA 3B7IA 1S7NA 1WK4A 2HV2A 4MCRA 4R8FA 3RBUA 5J1QA 3D2PA 4IUSA 5BWAB 1SQHA 3PBEA 4M85A 4A38A 5K8PA 3FH4A 4PSXA 1Z8WA 1U6MA 3LACA 2IQ6A 1JQGA 2V8VA 4P10A 1LRZA 4M3SA 2ATRA 2V77A 4KOWA 2RFHA 2EVNA 2FXFA 2PJ9A 4IK2A 3SI2A 2PIYA 1YMEA 1Z8LA 4K3NA 3S9MA 4ZY1A 2CIJA 4PXDA 1PUAA 5AG5A 2AFZA 2ZW7A 2Q4VA 4B6ZA 3I9SA 3FECA 1ELLP 2REEA 5JGFA 3D66A 3G8WA 2CNSA 3KQXA 1DTDA 3JUWA 4GXHA 3RAMA 3NFZA 1QSRA 2G9DA 3S6HA 2Z3MA 3CT9A 4AVBA 5LYDA 2QJ8A 3B35A 3RNZA 4P4FA 4CGLA 2Z3LA 4DUKA 3K9TA 2PJ7A 2Q0YA 2ZEDA 3S9LA 2PIZA 4UEEA 5A28A 5IX3A 1VGYA 2OZUA 2ZW5A 3QAYA 4UCPA 1OZPA 2OZGA 1S3ZA 4BD9A 2JLMA 4KVXA 4A37A 1YVKA 3ISXA 2ABZA 1M4DA 5K8NA 1ARMA 3JTKA 1BAVA 2VL1A 3NE8A 2Z3KA 3QNVA 4MJ8A 5IB0A 3WABA 1YVOA 2EK8A 3V7ZA 2J8RA 1MJBA 1NE9A 4WWVA 2VEZA 4H6ZA 4HPSA 3WR7A 3FEEA 4P44A 2HQYA 1I1DA 5HH1A 1M4GA 4H89A 4KZTA 2YNEA 1ZG8A 2PJ8A 3MRUA 2D4OA 2PVWA 3PB9X 1I12A 4U5YA 2BOAA 3QB8A 2HC9A 5F47A 3SJFA 4CGOA 4EMEA 5A27A 4MRIA 4AVAA 2Z3NA 4Q36A 4M6HA 2FVGA 3TE4A 2CTBA 1KWMA 4O23A 3I3GA 5F09A 3LODA 3G3SA 3RYOA 1XE4A 1YW4A 3GLJA 3SI0A 2AJ6A 4KUAA 4B5OA 4UA3A 2GE3A 3FB3A 5HVFA 3N7ZA 2YNCA 3WC6A 2VBQA 1NMTA 3PB6X 4DYOA 1XJOA 4MY3A 4OIDA 3V8IA 2FE7A 3KQZA 5LYLA 1CP7A 4CAWA 3DGVA 1S7KA 2AFUA 4R9MA 4DJLA 1MJ9A 4PPZA 2WUUA 3P2HA 5AG4A 4A2ZA
chains in the Genus database with same CATH topology
2GIVA 2P6EA 1ON0A 5DWMA 1M44A 4QUSA 4C2XA 2PC1A 5KTDA 1V0CA 5ISVA 1MJAA 2G3AA 3VWDA 4BMHA 2FIAA 4E8OA 2FSRA 2QECA 2O28A 3BJ7A 1KUVA 1K4JA 4UCNA 1IYLA 3FYNA 5AG7A 4CAFA 3GYAA 4B5PB 1BO4A 2QIRA 3W6SA 3DR8A 4KVOE 5AGEA 4NSQA 2FL4A 4MFLA 3E0KA 2JDDA 1IICA 2RC4A 4AVCA 4KLVA 2I79A 3MGDA 4CYQA 5CNPA 2CXAA 4OAEA 4OLLA 3D2MA 3EC4A 3IWEA 4XPLA 4JD6A 3B8GA 1IYKA 2Q44A 1P0HA 4U9ZA 2VZZA 4R3LA 5EC4A 3IU2A 4CAXA 4Q38A 3A9LA 5KTAA 4J3GA 2P6GA 4Y49B 4AB7A 2F5IA 2VQYA 3F0AA 2OB0A 4FD5A 3PGPA 4YFJA 3R96A 4JXQA 5AG6A 1YGHA 3C26A 4X5KA 4A33A 3IU1A 3D8PA 4KSFA 4UWIA 1BOBA 5JQ4A 3TTHA 1WWZA 4KSAA 1Y9WA 2R1IA 4MFJA 3DSBA 3IWGA 1M1DA 4C68A 4CYOA 1B6BA 4QBJA 4LUAA 4RS2A 2HUZA 1R57A 1Z4EA 2KCWA 2G3TA 2FIWA 3SXNA 2DXQA 3IGRA 4U9YA 4B5PA 2CNTA 3R9FA 3PZJA 3VWEA 3TFYA 1S7FA 1KUXA 2FS5A 4CAVA 5G21A 3FNCA 2H5MA 2FT0A 4C2YA 1J4JA 3LD2A 2B4DA 1KUYA 1Y9KA 3QAHA 4NXYA 2ZXVA 3F8KA 1YR0A 3SHPA 3EXNA 3ZJ0A 2J8NA 4QB9A 1XIXA 1Z9UA 2Z10A 1Z4RA 3S6KA 3H5ZA 3P2FA 2I00A 4YRHA 2PR8A 4UCMA 2JEVA 4MFZA 2VZYA 5JPHA 5F49A 3DDDA 3CXQA 1M4IA 1VHSA 1YREA 4PK3A 4KOVA 2Y0MA 3R1KA 5G22A 2R8VA 2CNMA 3UY5A 2BUEA 3TO7A 4HNWB 4UFWA 3JVNA 2NMTA 4NF1A 4B14A 5GCNA 5KTCA 4HNXB 4YGOA 1VKCA 3NE7A 1YLEA 3R95A 4CYPA 2YNCC 1RXTA 3EY5A 4QC6A 1RO5A 4LX9A 4KS9A 2Q04A 2BSWA 1CM0A 4E0AA 3F5BA 3BLNA 2B58A 4KLWA 3S6GA 2CY2A 1N71A 3R9EA 4CGNA 2BL1A 4ORFA 1IB1E 4FD6A 4KOUA 3CXSA 1QSOA 2GANA 4AG9A 2ARHA 2Z0ZA 2ZW6A 4NCZA 2YGWA 3SXOA 2K5TA 4FD4A 4XNHB 4MI4A 4F0YA 2B4DB 2B3UA 1S5KA 4CYNA 4UBRA 3T9YA 1XF8A 4KUBA 3GKRA 4PSWA 1PU9A 4XPDB 2B3VA 2DPTA 3PP9A 4JJXA 5H84A 4B10A 2REFA 5H86A 1B87A 2C27A 2OU2A 4A95A 2Z11A 4MFPA 4BBHA 2PSWA 3KKWA 4HKFA 5C82A 4OADA 4KOYA 1Q2CA 3TO6A 2Q7BA 5IV0A 1XEBA 4UWJA 4A32A 2BEIA 2VXKA 4R57A 3T90A 3TOAA 4JXRA 1L0CA 4PK2A 3FXTA 4KOTA 4A31A 4ONUA 4XPKA 1GHEA 2QMLA 3TT2A 5F48A 3GY9A 4L8AA 4R3KA 4UFXA 4B11A 4C7IA 2VI7A 4CAEA 4ZBGA 2OZHA 3DR6A 2PDOA 3TCVA 5J8FA 2D4PA 4CGPA 2AE6A 4ZGYB 4I49A 5FVJA 2JDCA 4MFKA 2PQ8A 4C7HA 2Q4YA 4L89A 4K30A 3R9GA 1Y7RA 4GS4A 4XNHC 4MFQA 1I21A 4NEXA 2P0WA 2WSAA 5DWNA 2A4NA 2B4BA 2OH1A 2ZPAA 2YNDA 3CXPA 1NSLA 1KZFA 2Z3OA 4PV6A 4JLYA 3FRMA 4XPDC 5G1ZA 1XMTA 3W6XA 4KVME 2Z3PA 2R98A 4KOXA 4II9A 4Y49C 2J8MA 2B5GA 2PR1A 3EO4A 3D3SA 1UFHA 5C88A 3FBUA 1TIQA 3BJ8A 1MK4A 1FY7A 1S7LA 1Q2DA 5F46A 5J8CA 4F0XA 1ZO0A 4CS0B 3FIXA 4IF5A 4B13A 2WPXA 5EBVA 4EVYA 3TOBA 4R87A 1YK3A 2G0BA 3DNSA 3H4QA 5E96A 2EUIA 2ZW4A 4HNYB 4RI1A 4KOSA 3W91A 4DNCA 4F6AA 2PRBA 5I0CA 5HMNA 5G20A 1Q2YA 4MHDA 4JWPA 4MY0A 4A30A 4MBUA 4CRYB 4B12A 3TO9A 4E2AA 2IL4A 2R7HA 1YX0A 2DPSA 2FCKA 4CGMA 4KORA 2P6FA 3EFAA 2WPWA 1IIDA 4H6UA 3K9UA 1S60A 3OWCA 3S6FA 1QSTA 1QSNA 4AG7A 4C2ZA 4QVTA 3ZZIA 1QSMA 1CJWA 4FD7A 2B5GB 4CRZB 2X7BA 4UFVA 1P4NA 1S7NA 1WK4A 2HV2A 3D2PA 4IUSA 5BWAB 1SQHA 4M85A 4PSXA 1U6MA 1LRZA 4M3SA 2ATRA 4KOWA 2EVNA 2FXFA 5AG5A 1PUAA 2ZW7A 2Q4VA 3I9SA 2REEA 3G8WA 2CNSA 3JUWA 1QSRA 3S6HA 2Z3MA 4AVBA 4CGLA 2Z3LA 2Q0YA 5A28A 5IX3A 2OZUA 2ZW5A 4UCPA 1OZPA 2OZGA 1S3ZA 2JLMA 4KVXA 1YVKA 1M4DA 3JTKA 2Z3KA 4MJ8A 5IB0A 1YVOA 2J8RA 1MJBA 1NE9A 2VEZA 4H6ZA 3WR7A 2HQYA 1I1DA 5HH1A 1M4GA 4H89A 4KZTA 2YNEA 2D4OA 4U5YA 1I12A 5F47A 4CGOA 3QB8A 5A27A 4AVAA 2Z3NA 4Q36A 3TE4A 3I3GA 3LODA 3G3SA 3RYOA 1XE4A 2AJ6A 4KUAA 4B5OA 4UA3A 2GE3A 3FB3A 3N7ZA 2YNCA 2VBQA 1NMTA 4MY3A 3V8IA 2FE7A 4CAWA 1S7KA 4R9MA 1MJ9A 2WUUA 3P2HA 5AG4A 4A2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GIV A;  2P6E A;  1ON0 A;  5DWM A;  1M44 A;  4QUS A;  2PC1 A;  5KTD A;  1V0C A;  5ISV A;  1MJA A;  2G3A A;  3VWD A;  4BMH A;  2FIA A;  4E8O A;  2FSR A;  2QEC A;  2O28 A;  3BJ7 A;  1KUV A;  1K4J A;  1IYL A;  3FYN A;  3GYA A;  4B5P B;  1BO4 A;  2QIR A;  3W6S A;  3DR8 A;  4KVO E;  4NSQ A;  2FL4 A;  3E0K A;  2JDD A;  1IIC A;  2RC4 A;  4AVC A;  4KLV A;  2I79 A;  3MGD A;  5CNP A;  4OAE A;  4OLL A;  3D2M A;  3EC4 A;  4XPL A;  4JD6 A;  3B8G A;  1IYK A;  2Q44 A;  1P0H A;  4U9Z A;  2VZZ A;  4R3L A;  5EC4 A;  4CAX A;  5KTA A;  4J3G A;  2P6G A;  4Y49 B;  4AB7 A;  2F5I A;  2VQY A;  3F0A A;  2OB0 A;  4FD5 A;  3PGP A;  4YFJ A;  3R96 A;  4JXQ A;  1YGH A;  3C26 A;  4X5K A;  3D8P A;  4UWI A;  1BOB A;  5JQ4 A;  3TTH A;  1WWZ A;  1Y9W A;  2R1I A;  3DSB A;  3IWG A;  1M1D A;  1B6B A;  4QBJ A;  4LUA A;  4RS2 A;  2HUZ A;  1R57 A;  1Z4E A;  2KCW A;  2G3T A;  2FIW A;  3SXN A;  2DXQ A;  3IGR A;  4U9Y A;  4B5P A;  2CNT A;  3R9F A;  3PZJ A;  3VWE A;  3TFY A;  1S7F A;  1KUX A;  2FS5 A;  4CAV A;  3FNC A;  2H5M A;  2FT0 A;  1J4J A;  3LD2 A;  2B4D A;  1KUY A;  1Y9K A;  3QAH A;  4NXY A;  2ZXV A;  3F8K A;  1YR0 A;  3SHP A;  3EXN A;  3ZJ0 A;  2J8N A;  4QB9 A;  1XIX A;  1Z9U A;  2Z10 A;  1Z4R A;  3S6K A;  3P2F A;  2I00 A;  4YRH A;  2PR8 A;  2JEV A;  2VZY A;  5JPH A;  5F49 A;  3DDD A;  3CXQ A;  1M4I A;  1VHS A;  1YRE A;  4PK3 A;  4KOV A;  2Y0M A;  3R1K A;  2R8V A;  2CNM A;  3UY5 A;  2BUE A;  3TO7 A;  4HNW B;  3JVN A;  2NMT A;  4NF1 A;  5KTC A;  5GCN A;  4HNX B;  4YGO A;  1VKC A;  3NE7 A;  1YLE A;  3R95 A;  1RXT A;  3EY5 A;  4QC6 A;  1RO5 A;  4LX9 A;  2Q04 A;  2BSW A;  1CM0 A;  4E0A A;  3F5B A;  3BLN A;  2B58 A;  4KLW A;  3S6G A;  2CY2 A;  1N71 A;  3R9E A;  2BL1 A;  4ORF A;  1IB1 E;  4FD6 A;  4KOU A;  3CXS A;  1QSO A;  2GAN A;  4AG9 A;  2ARH A;  2Z0Z A;  2ZW6 A;  4NCZ A;  3SXO A;  2K5T A;  4FD4 A;  4XNH B;  4MI4 A;  4F0Y A;  2B4D B;  2B3U A;  1S5K A;  4UBR A;  3T9Y A;  1XF8 A;  4KUB A;  3GKR A;  4PSW A;  1PU9 A;  4XPD B;  2B3V A;  3PP9 A;  4JJX A;  5H84 A;  2REF A;  5H86 A;  1B87 A;  2C27 A;  2OU2 A;  2Z11 A;  2PSW A;  3KKW A;  4HKF A;  5C82 A;  4OAD A;  4KOY A;  1Q2C A;  3TO6 A;  2Q7B A;  5IV0 A;  1XEB A;  4UWJ A;  2BEI A;  2VXK A;  4R57 A;  3T90 A;  3TOA A;  4JXR A;  1L0C A;  4PK2 A;  3FXT A;  4KOT A;  4ONU A;  4XPK A;  1GHE A;  2QML A;  3TT2 A;  5F48 A;  3GY9 A;  4L8A A;  4R3K A;  2VI7 A;  4ZBG A;  2OZH A;  3DR6 A;  2PDO A;  3TCV A;  5J8F A;  2D4P A;  2AE6 A;  4I49 A;  5FVJ A;  2JDC A;  2PQ8 A;  2Q4Y A;  4L89 A;  4K30 A;  3R9G A;  1Y7R A;  4GS4 A;  4XNH C;  1I21 A;  4NEX A;  2P0W A;  5DWN A;  2A4N A;  2B4B A;  2OH1 A;  2ZPA A;  3CXP A;  1NSL A;  1KZF A;  4PV6 A;  4JLY A;  3FRM A;  4XPD C;  1XMT A;  3W6X A;  4KVM E;  2R98 A;  4KOX A;  4II9 A;  4Y49 C;  2J8M A;  2B5G A;  2PR1 A;  3EO4 A;  3D3S A;  1UFH A;  5C88 A;  3FBU A;  1TIQ A;  3BJ8 A;  1MK4 A;  1FY7 A;  1S7L A;  1Q2D A;  5F46 A;  5J8C A;  4CS0 B;  3FIX A;  4IF5 A;  2WPX A;  5EBV A;  4EVY A;  3TOB A;  4R87 A;  1YK3 A;  2G0B A;  3DNS A;  3H4Q A;  5E96 A;  2EUI A;  2ZW4 A;  4HNY B;  4RI1 A;  4KOS A;  3W91 A;  4DNC A;  4F6A A;  2PRB A;  5I0C A;  5HMN A;  1Q2Y A;  4MHD A;  4JWP A;  4MY0 A;  4MBU A;  4CRY B;  3TO9 A;  4E2A A;  2IL4 A;  2R7H A;  1YX0 A;  2FCK A;  4KOR A;  2P6F A;  3EFA A;  2WPW A;  1IID A;  4H6U A;  3K9U A;  1S60 A;  3OWC A;  3S6F A;  1QST A;  1QSN A;  4AG7 A;  4QVT A;  3ZZI A;  1QSM A;  1CJW A;  4FD7 A;  2B5G B;  4CRZ B;  2X7B A;  1P4N A;  1S7N A;  1WK4 A;  2HV2 A;  3D2P A;  4IUS A;  1SQH A;  4M85 A;  4PSX A;  1U6M A;  1LRZ A;  4M3S A;  2ATR A;  4KOW A;  2EVN A;  2FXF A;  1PUA A;  2ZW7 A;  2Q4V A;  3I9S A;  2REE A;  3G8W A;  2CNS A;  3JUW A;  1QSR A;  3S6H A;  4AVB A;  2Q0Y A;  5IX3 A;  2OZU A;  2ZW5 A;  1OZP A;  2OZG A;  1S3Z A;  2JLM A;  4KVX A;  1YVK A;  1M4D A;  4MJ8 A;  5IB0 A;  1YVO A;  2J8R A;  1MJB A;  1NE9 A;  2VEZ A;  4H6Z A;  3WR7 A;  2HQY A;  1I1D A;  5HH1 A;  1M4G A;  4H89 A;  4KZT A;  2D4O A;  4U5Y A;  1I12 A;  5F47 A;  3QB8 A;  4AVA A;  3TE4 A;  3I3G A;  3LOD A;  3G3S A;  3RYO A;  1XE4 A;  2AJ6 A;  4KUA A;  4B5O A;  4UA3 A;  2GE3 A;  3FB3 A;  3N7Z A;  2VBQ A;  1NMT A;  4MY3 A;  3V8I A;  2FE7 A;  4CAW A;  1S7K A;  4R9M A;  1MJ9 A;  3P2H A; 
#chains in the Genus database with same CATH topology
 1IU8 A;  2GIV A;  2P6E A;  3FJU A;  1ON0 A;  4X8I A;  1M44 A;  4QUS A;  5DWM A;  4C2X A;  4P6Y A;  3VAR A;  2PC1 A;  5KTD A;  2ZEF A;  2ZEO A;  1V0C A;  5ISV A;  3S9N A;  1MJA A;  2G3A A;  1Q7L A;  4RN7 A;  1EE3 P;  2FIA A;  3VWD A;  4BMH A;  4E8O A;  2FSR A;  2QEC A;  2O28 A;  3BJ7 A;  1YQE A;  1KUV A;  1K4J A;  2NYQ A;  4UCN A;  3IFE A;  2WZN A;  4A39 A;  1IYL A;  2BCO A;  3V38 A;  1HDU A;  3FYN A;  3PFE A;  4YWY A;  5AG7 A;  5D8N A;  4CAF A;  3KI9 A;  3GYA A;  4B5P B;  1BO4 A;  3TC8 A;  2QIR A;  4R7M A;  3W6S A;  4EFD A;  3DR8 A;  1CX8 A;  4EWT A;  8CPA A;  4KVO E;  5AGE A;  4NSQ A;  2FL4 A;  2ZEL A;  4MFL A;  3E0K A;  5DS0 A;  3B3C A;  2JDD A;  1IIC A;  4FUU A;  4ZX9 A;  2RC4 A;  4OC3 A;  3SJE A;  3T8W A;  2GFQ A;  4AVC A;  2V8G A;  4KLV A;  1PYT B;  3D7G A;  5LYF A;  2I79 A;  3MGD A;  4CYQ A;  1VHO A;  2CXA A;  4UEZ A;  2XEG A;  5CNP A;  4OAE A;  1UWY A;  2Q7S A;  4OLL A;  4ZYQ A;  4MMO A;  4X3R A;  3D2M A;  1ELM P;  1F57 A;  3EC4 A;  3JRU A;  3IWE A;  4M6G A;  4XPL A;  4ZX8 A;  4OC0 A;  4TWE A;  2NSM A;  3B3S A;  1R43 A;  4JD6 A;  3B8G A;  4M6I A;  2CTC A;  3D7H A;  2F8H A;  1ARL A;  3GIU A;  1IYK A;  1DE4 C;  1P0H A;  2PJB A;  2Q44 A;  4U9Z A;  3LWU A;  2VZZ A;  4R3L A;  5EC4 A;  3IU2 A;  4P4E A;  4CAX A;  4Q38 A;  3A9L A;  2C1C A;  2EK9 A;  5K8M A;  4J3G A;  5KTA A;  1LAM A;  2P6G A;  4Y49 B;  2F5I A;  4AB7 A;  1BLL E;  2XEF A;  3FVL A;  2VQY A;  3F0A A;  2OB0 A;  4FD5 A;  3PGP A;  4OC5 A;  4P4D A;  4YFJ A;  3D67 A;  2V8H A;  3R96 A;  4JXQ A;  5AG6 A;  1YGH A;  3C26 A;  4X5K A;  4A33 A;  3IU1 A;  3D8P A;  4KSF A;  1LCP A;  4UWI A;  4OC2 A;  1BOB A;  2C6C A;  3TTH A;  1WWZ A;  4KSA A;  1XMB A;  1Y9W A;  5JQ4 A;  2R1I A;  2PJ6 A;  4MFJ A;  4P4B A;  3DSB A;  3IWG A;  1CPS A;  1M1D A;  4C68 A;  4UIA A;  2GRE A;  4CYO A;  1B6B A;  4QBJ A;  2Q51 A;  4PXB A;  3HLP A;  4LUA A;  4RS2 A;  2ODF A;  2HUZ A;  1LOK A;  1R57 A;  1Z4E A;  2ZOG A;  5IB9 A;  2KCW A;  2G3T A;  2FIW A;  3SXN A;  2DXQ A;  3CZX A;  1Z5R A;  3IGR A;  2GLJ A;  1QQ9 A;  1X10 A;  4U9Y A;  2CNT A;  4B5P A;  1Z2L A;  4FAI A;  3R9F A;  3PZJ A;  3VWE A;  3NA6 A;  3TFY A;  1TKH A;  2IJZ A;  2EWB A;  1S7F A;  2PJ0 A;  1F2O A;  1KUX A;  2FS5 A;  4CAV A;  5G21 A;  3FNC A;  2H5M A;  2FT0 A;  1Z8T A;  4C2Y A;  1J4J A;  4OP4 A;  4R6T A;  1XBU A;  3LD2 A;  2B4D A;  1KUY A;  1Y9K A;  2EO8 A;  3QAH A;  4NXY A;  4F8Z A;  4P4J A;  1Y7E A;  2ZXV A;  1IOI A;  3F8K A;  1YR0 A;  1ZG9 A;  3SHP A;  3EXN A;  3ZJ0 A;  4F9V A;  2J8N A;  3B3T A;  4QB9 A;  2PCU A;  1XIX A;  1Z9U A;  2Z10 A;  4NGT A;  1Z4R A;  1F2P A;  3S6K A;  2EBJ A;  2ZEH A;  3H5Z A;  2I00 A;  3P2F A;  4YRH A;  5I4M A;  1H8L A;  3PB4 X;  7CPA A;  2PR8 A;  4UCM A;  2JEV A;  4MFZ A;  1OBR A;  2VZY A;  2PRQ A;  1QMU A;  4P45 A;  2AFM A;  2AFO A;  5CBM A;  5F49 A;  3DDD A;  4TNU A;  3CXQ A;  5JPH A;  1M4I A;  1XOV A;  3RZA A;  1VHS A;  4W9Y A;  1BPN A;  4KSI A;  1YRE A;  4PK3 A;  4OME A;  1YW6 A;  3NH5 A;  4BIN A;  4KOV A;  2Y0M A;  3R1K A;  5G22 A;  2R8V A;  3IIB A;  4NFR A;  2CNM A;  3UY5 A;  2BUE A;  3TO7 A;  4NGP A;  1AUG A;  3GUX A;  4HNW B;  1TXR A;  4UFW A;  3JVN A;  3WT4 A;  2NMT A;  1IY7 A;  2JBJ A;  2ZEP A;  4MHP A;  4NF1 A;  4B14 A;  5GCN A;  4F9U A;  3B3V A;  4HNX B;  4OC1 A;  5KTC A;  4YGO A;  1VKC A;  3VAT A;  5LRG A;  1FNO A;  4P4I A;  3NE7 A;  1YLE A;  4NGR A;  3R95 A;  4CYP A;  2YNC C;  3KR4 A;  1XFO A;  1RXT A;  3EY5 A;  4LQ6 A;  2PJ5 A;  4QC6 A;  4A94 A;  1VHE A;  1RO5 A;  5THW A;  4LX9 A;  4FBE A;  3B3W A;  4H2K A;  1ZG7 A;  4KS9 A;  2Q04 A;  2BSW A;  1CM0 A;  3KZW A;  4E0A A;  3F5B A;  3BLN A;  2B58 A;  4KLW A;  3S6G A;  2CY2 A;  1N71 A;  3R9E A;  4ZY2 A;  4CGN A;  2BL1 A;  3NH8 A;  1IB1 E;  3BHX A;  4ORF A;  4MCP A;  3KGQ A;  4FD6 A;  2PJ4 A;  4KOU A;  1GYT A;  3CXS A;  1QSO A;  4GM5 A;  1AMP A;  3D7F A;  2GAN A;  4MHN A;  4AG9 A;  5LYI A;  3L2N A;  4JZ0 A;  2ARH A;  2Z0Z A;  2ZW6 A;  2PJ1 A;  4NCZ A;  2YGW A;  3SXO A;  2K5T A;  1R3N A;  3CPX A;  4FD4 A;  4XNH B;  2WYR A;  4MI4 A;  4F0Y A;  4NGN A;  3ISZ A;  1CBX A;  2B4D B;  4YU9 A;  5JM6 A;  3FF3 A;  4UIB A;  2B3U A;  1S5K A;  4CYN A;  2ZOF A;  3MN8 A;  4UBR A;  3T9Y A;  1XF8 A;  3PBB A;  5D29 A;  4KUB A;  3GKR A;  4PSW A;  1PU9 A;  2PE3 A;  2B3V A;  2DPT A;  4XPD B;  1FT7 A;  3PP9 A;  4JJX A;  1LAN A;  5H84 A;  1NSA A;  1TKJ A;  4B10 A;  3NH4 A;  4OC4 A;  2REF A;  1Z8X A;  1B87 A;  5H86 A;  4MXU A;  2C27 A;  2OU2 A;  4A95 A;  2Z11 A;  4MFP A;  4BBH A;  3WC7 A;  2O4H A;  4FWU A;  3N5F A;  2PSW A;  3KKW A;  4HKF A;  5C82 A;  4OAD A;  4KOY A;  2ZEG A;  1Q2C A;  4ZY0 A;  3TO6 A;  1VIX A;  4NGQ A;  2Q7B A;  3H8G A;  1XEB A;  5IV0 A;  1TF8 A;  3IJ3 A;  4UWJ A;  2OR4 A;  1CP6 A;  4WJB A;  4A32 A;  2BEI A;  1TF9 A;  1LFW A;  2VXK A;  4MHY A;  4R57 A;  3D68 A;  3T90 A;  3TOA A;  4JXR A;  3KAS A;  1L0C A;  3TX8 A;  4PK2 A;  3FXT A;  4KOT A;  4A31 A;  1PCA A;  5HXD A;  2GU2 A;  4ONU A;  4XPK A;  1GHE A;  4UF4 A;  2QML A;  1YSJ A;  2ZEE A;  3TT2 A;  1TKF A;  5F48 A;  3GY9 A;  5LRJ A;  4L8A A;  4R3K A;  3KR5 A;  4UFX A;  4AXV A;  2AFS A;  2QVP A;  2OOT A;  1YLO A;  4B11 A;  4C7I A;  3SI1 A;  4JYW A;  3WC5 A;  2VI7 A;  4MCQ A;  4CAE A;  4PXC A;  4ZBG A;  2OZH A;  3DR6 A;  3D4U A;  2PDO A;  3TCV A;  1A2Z A;  5J8F A;  2D4P A;  4CGP A;  2AE6 A;  4ZGY B;  5JH9 A;  4IHM A;  2JEW A;  2POK A;  2DEA A;  4I49 A;  5FVJ A;  2JDC A;  4MFK A;  3I1U A;  2PQ8 A;  4C7H A;  2Q4Y A;  3LMS A;  3PB8 X;  4NGS A;  4L89 A;  2BO9 A;  2XEI A;  4K30 A;  3SJX A;  3R9G A;  1Y7R A;  2V8D A;  1Y0R A;  4GS4 A;  4XNH C;  4MFQ A;  1I21 A;  4NEX A;  2P0W A;  2WSA A;  5DWN A;  2A4N A;  2B4B A;  3KHX A;  2OH1 A;  2ZPA A;  3PFO A;  2YND A;  3CXP A;  1NSL A;  1KZF A;  2Z3O A;  4PV6 A;  4PXE A;  4RUH A;  4JLY A;  3FRM A;  5ELY A;  4XPD C;  2ZEM A;  1BPM A;  3FED A;  4UEF A;  6CPA A;  5G1Z A;  3B2Y A;  1XMT A;  3CPA A;  3W6X A;  4KVM E;  2Z3P A;  2R98 A;  4G1P A;  4KOX A;  1JWQ A;  4II9 A;  4Y49 C;  2J8M A;  5LRK A;  2B5G A;  2PR1 A;  3D7D A;  3FX6 A;  4NJR A;  3VH9 A;  3EO4 A;  3D3S A;  1UFH A;  1ZLI A;  3BXM A;  5CPA A;  5C88 A;  3FBU A;  3IC1 A;  1TIQ A;  3CDX A;  2QYV A;  4NJQ A;  3RO0 A;  3BJ8 A;  1MK4 A;  1FY7 A;  5HVG A;  1S7L A;  1Q2D A;  5F46 A;  5J8C A;  2XEJ A;  4F0X A;  2AFX A;  1ZO0 A;  2PVV A;  4CS0 B;  3FIX A;  4IF5 A;  4B13 A;  1AYE A;  2PJA A;  2WPX A;  3FMC A;  5EBV A;  5EMI A;  4EVY A;  2ZEN A;  4Z65 A;  4OKO A;  2J9A A;  3TOB A;  5K8O A;  3PEI A;  1YK3 A;  4R87 A;  2G0B A;  4IAV A;  2AFW A;  3DNS A;  2F7V A;  2PJ2 A;  3H4Q A;  4MHZ A;  3KL9 A;  2HB6 A;  2EUI A;  3H8F A;  5E96 A;  2ZW4 A;  4HNY B;  4RI1 A;  4KOS A;  3W91 A;  1X12 A;  3BI0 A;  4DNC A;  4F6A A;  2PRB A;  4MCS A;  5I0C A;  2GLF A;  3GB0 A;  1IGB A;  5HMN A;  2O53 A;  5G20 A;  1Q2Y A;  1RTQ A;  2IMO A;  2Q43 A;  3H8E A;  4MHD A;  5HVH A;  3PRT A;  1Y0Y A;  3IO1 A;  2JBK A;  4JWP A;  4MY0 A;  4A30 A;  3PB7 X;  4MBU A;  4CRY B;  4B12 A;  3TO9 A;  4E2A A;  1M4L A;  2IL4 A;  4R76 A;  2DF5 A;  2R7H A;  1YX0 A;  3DLJ A;  2DPS A;  3IEH A;  2FCK A;  1LAP A;  2RB7 A;  4CGM A;  4LQG A;  2C6P A;  4KOR A;  3HUV A;  4CPA A;  2P6F A;  2PJC A;  2WPW A;  3EFA A;  1XRY A;  1IID A;  1CPX A;  4H6U A;  3KHZ A;  4NGM A;  3BI1 A;  3IWW A;  3K9U A;  1IOF A;  4PQA A;  1S60 A;  4Q7A A;  2C6G A;  3OWC A;  3S6F A;  1QST A;  1QSN A;  2Q4Z A;  4AG7 A;  2PJ3 A;  4C2Z A;  3K2K A;  4QVT A;  4ZI6 A;  3ZZI A;  1CG2 A;  1QSM A;  1CJW A;  4FD7 A;  1HDQ A;  2ANP A;  2B5G B;  1HEE A;  4OIW A;  1ZLH A;  4CRZ B;  4ONW A;  3SJG A;  2X7B A;  2CF4 A;  2I3C A;  4UFV A;  4X2T A;  1P4N A;  3B7I A;  1S7N A;  1WK4 A;  2HV2 A;  4MCR A;  4R8F A;  3RBU A;  5J1Q A;  3D2P A;  4IUS A;  5BWA B;  1SQH A;  3PBE A;  4M85 A;  4A38 A;  5K8P A;  3FH4 A;  4PSX A;  1Z8W A;  1U6M A;  3LAC A;  2IQ6 A;  1JQG A;  2V8V A;  4P10 A;  1LRZ A;  4M3S A;  2ATR A;  2V77 A;  4KOW A;  2RFH A;  2EVN A;  2FXF A;  2PJ9 A;  4IK2 A;  3SI2 A;  2PIY A;  1YME A;  1Z8L A;  4K3N A;  3S9M A;  4ZY1 A;  2CIJ A;  4PXD A;  1PUA A;  5AG5 A;  2AFZ A;  2ZW7 A;  2Q4V A;  4B6Z A;  3I9S A;  3FEC A;  1ELL P;  2REE A;  5JGF A;  3D66 A;  3G8W A;  2CNS A;  3KQX A;  1DTD A;  3JUW A;  4GXH A;  3RAM A;  3NFZ A;  1QSR A;  2G9D A;  3S6H A;  2Z3M A;  3CT9 A;  4AVB A;  5LYD A;  2QJ8 A;  3B35 A;  3RNZ A;  4P4F A;  4CGL A;  2Z3L A;  4DUK A;  3K9T A;  2PJ7 A;  2Q0Y A;  2ZED A;  3S9L A;  2PIZ A;  4UEE A;  5A28 A;  5IX3 A;  1VGY A;  2OZU A;  2ZW5 A;  3QAY A;  4UCP A;  1OZP A;  2OZG A;  1S3Z A;  4BD9 A;  2JLM A;  4KVX A;  4A37 A;  1YVK A;  3ISX A;  2ABZ A;  1M4D A;  5K8N A;  1ARM A;  3JTK A;  1BAV A;  2VL1 A;  3NE8 A;  2Z3K A;  3QNV A;  4MJ8 A;  5IB0 A;  3WAB A;  1YVO A;  2EK8 A;  3V7Z A;  2J8R A;  1MJB A;  1NE9 A;  4WWV A;  2VEZ A;  4H6Z A;  4HPS A;  3WR7 A;  3FEE A;  4P44 A;  2HQY A;  1I1D A;  5HH1 A;  1M4G A;  4H89 A;  4KZT A;  2YNE A;  1ZG8 A;  2PJ8 A;  3MRU A;  2D4O A;  2PVW A;  3PB9 X;  1I12 A;  4U5Y A;  2BOA A;  3QB8 A;  2HC9 A;  5F47 A;  3SJF A;  4CGO A;  4EME A;  5A27 A;  4MRI A;  4AVA A;  2Z3N A;  4Q36 A;  4M6H A;  2FVG A;  3TE4 A;  2CTB A;  1KWM A;  4O23 A;  3I3G A;  5F09 A;  3LOD A;  3G3S A;  3RYO A;  1XE4 A;  1YW4 A;  3GLJ A;  3SI0 A;  2AJ6 A;  4KUA A;  4B5O A;  4UA3 A;  2GE3 A;  3FB3 A;  5HVF A;  3N7Z A;  2YNC A;  3WC6 A;  2VBQ A;  1NMT A;  3PB6 X;  4DYO A;  1XJO A;  4MY3 A;  4OID A;  3V8I A;  2FE7 A;  3KQZ A;  5LYL A;  1CP7 A;  4CAW A;  3DGV A;  1S7K A;  2AFU A;  4R9M A;  4DJL A;  1MJ9 A;  4PPZ A;  2WUU A;  3P2H A;  5AG4 A;  4A2Z A; 
#chains in the Genus database with same CATH homology
 2GIV A;  2P6E A;  1ON0 A;  5DWM A;  1M44 A;  4QUS A;  4C2X A;  2PC1 A;  5KTD A;  1V0C A;  5ISV A;  1MJA A;  2G3A A;  3VWD A;  4BMH A;  2FIA A;  4E8O A;  2FSR A;  2QEC A;  2O28 A;  3BJ7 A;  1KUV A;  1K4J A;  4UCN A;  1IYL A;  3FYN A;  5AG7 A;  4CAF A;  3GYA A;  4B5P B;  1BO4 A;  2QIR A;  3W6S A;  3DR8 A;  4KVO E;  5AGE A;  4NSQ A;  2FL4 A;  4MFL A;  3E0K A;  2JDD A;  1IIC A;  2RC4 A;  4AVC A;  4KLV A;  2I79 A;  3MGD A;  4CYQ A;  5CNP A;  2CXA A;  4OAE A;  4OLL A;  3D2M A;  3EC4 A;  3IWE A;  4XPL A;  4JD6 A;  3B8G A;  1IYK A;  2Q44 A;  1P0H A;  4U9Z A;  2VZZ A;  4R3L A;  5EC4 A;  3IU2 A;  4CAX A;  4Q38 A;  3A9L A;  5KTA A;  4J3G A;  2P6G A;  4Y49 B;  4AB7 A;  2F5I A;  2VQY A;  3F0A A;  2OB0 A;  4FD5 A;  3PGP A;  4YFJ A;  3R96 A;  4JXQ A;  5AG6 A;  1YGH A;  3C26 A;  4X5K A;  4A33 A;  3IU1 A;  3D8P A;  4KSF A;  4UWI A;  1BOB A;  5JQ4 A;  3TTH A;  1WWZ A;  4KSA A;  1Y9W A;  2R1I A;  4MFJ A;  3DSB A;  3IWG A;  1M1D A;  4C68 A;  4CYO A;  1B6B A;  4QBJ A;  4LUA A;  4RS2 A;  2HUZ A;  1R57 A;  1Z4E A;  2KCW A;  2G3T A;  2FIW A;  3SXN A;  2DXQ A;  3IGR A;  4U9Y A;  4B5P A;  2CNT A;  3R9F A;  3PZJ A;  3VWE A;  3TFY A;  1S7F A;  1KUX A;  2FS5 A;  4CAV A;  5G21 A;  3FNC A;  2H5M A;  2FT0 A;  4C2Y A;  1J4J A;  3LD2 A;  2B4D A;  1KUY A;  1Y9K A;  3QAH A;  4NXY A;  2ZXV A;  3F8K A;  1YR0 A;  3SHP A;  3EXN A;  3ZJ0 A;  2J8N A;  4QB9 A;  1XIX A;  1Z9U A;  2Z10 A;  1Z4R A;  3S6K A;  3H5Z A;  3P2F A;  2I00 A;  4YRH A;  2PR8 A;  4UCM A;  2JEV A;  4MFZ A;  2VZY A;  5JPH A;  5F49 A;  3DDD A;  3CXQ A;  1M4I A;  1VHS A;  1YRE A;  4PK3 A;  4KOV A;  2Y0M A;  3R1K A;  5G22 A;  2R8V A;  2CNM A;  3UY5 A;  2BUE A;  3TO7 A;  4HNW B;  4UFW A;  3JVN A;  2NMT A;  4NF1 A;  4B14 A;  5GCN A;  5KTC A;  4HNX B;  4YGO A;  1VKC A;  3NE7 A;  1YLE A;  3R95 A;  4CYP A;  2YNC C;  1RXT A;  3EY5 A;  4QC6 A;  1RO5 A;  4LX9 A;  4KS9 A;  2Q04 A;  2BSW A;  1CM0 A;  4E0A A;  3F5B A;  3BLN A;  2B58 A;  4KLW A;  3S6G A;  2CY2 A;  1N71 A;  3R9E A;  4CGN A;  2BL1 A;  4ORF A;  1IB1 E;  4FD6 A;  4KOU A;  3CXS A;  1QSO A;  2GAN A;  4AG9 A;  2ARH A;  2Z0Z A;  2ZW6 A;  4NCZ A;  2YGW A;  3SXO A;  2K5T A;  4FD4 A;  4XNH B;  4MI4 A;  4F0Y A;  2B4D B;  2B3U A;  1S5K A;  4CYN A;  4UBR A;  3T9Y A;  1XF8 A;  4KUB A;  3GKR A;  4PSW A;  1PU9 A;  4XPD B;  2B3V A;  2DPT A;  3PP9 A;  4JJX A;  5H84 A;  4B10 A;  2REF A;  5H86 A;  1B87 A;  2C27 A;  2OU2 A;  4A95 A;  2Z11 A;  4MFP A;  4BBH A;  2PSW A;  3KKW A;  4HKF A;  5C82 A;  4OAD A;  4KOY A;  1Q2C A;  3TO6 A;  2Q7B A;  5IV0 A;  1XEB A;  4UWJ A;  4A32 A;  2BEI A;  2VXK A;  4R57 A;  3T90 A;  3TOA A;  4JXR A;  1L0C A;  4PK2 A;  3FXT A;  4KOT A;  4A31 A;  4ONU A;  4XPK A;  1GHE A;  2QML A;  3TT2 A;  5F48 A;  3GY9 A;  4L8A A;  4R3K A;  4UFX A;  4B11 A;  4C7I A;  2VI7 A;  4CAE A;  4ZBG A;  2OZH A;  3DR6 A;  2PDO A;  3TCV A;  5J8F A;  2D4P A;  4CGP A;  2AE6 A;  4ZGY B;  4I49 A;  5FVJ A;  2JDC A;  4MFK A;  2PQ8 A;  4C7H A;  2Q4Y A;  4L89 A;  4K30 A;  3R9G A;  1Y7R A;  4GS4 A;  4XNH C;  4MFQ A;  1I21 A;  4NEX A;  2P0W A;  2WSA A;  5DWN A;  2A4N A;  2B4B A;  2OH1 A;  2ZPA A;  2YND A;  3CXP A;  1NSL A;  1KZF A;  2Z3O A;  4PV6 A;  4JLY A;  3FRM A;  4XPD C;  5G1Z A;  1XMT A;  3W6X A;  4KVM E;  2Z3P A;  2R98 A;  4KOX A;  4II9 A;  4Y49 C;  2J8M A;  2B5G A;  2PR1 A;  3EO4 A;  3D3S A;  1UFH A;  5C88 A;  3FBU A;  1TIQ A;  3BJ8 A;  1MK4 A;  1FY7 A;  1S7L A;  1Q2D A;  5F46 A;  5J8C A;  4F0X A;  1ZO0 A;  4CS0 B;  3FIX A;  4IF5 A;  4B13 A;  2WPX A;  5EBV A;  4EVY A;  3TOB A;  4R87 A;  1YK3 A;  2G0B A;  3DNS A;  3H4Q A;  5E96 A;  2EUI A;  2ZW4 A;  4HNY B;  4RI1 A;  4KOS A;  3W91 A;  4DNC A;  4F6A A;  2PRB A;  5I0C A;  5HMN A;  5G20 A;  1Q2Y A;  4MHD A;  4JWP A;  4MY0 A;  4A30 A;  4MBU A;  4CRY B;  4B12 A;  3TO9 A;  4E2A A;  2IL4 A;  2R7H A;  1YX0 A;  2DPS A;  2FCK A;  4CGM A;  4KOR A;  2P6F A;  3EFA A;  2WPW A;  1IID A;  4H6U A;  3K9U A;  1S60 A;  3OWC A;  3S6F A;  1QST A;  1QSN A;  4AG7 A;  4C2Z A;  4QVT A;  3ZZI A;  1QSM A;  1CJW A;  4FD7 A;  2B5G B;  4CRZ B;  2X7B A;  4UFV A;  1P4N A;  1S7N A;  1WK4 A;  2HV2 A;  3D2P A;  4IUS A;  5BWA B;  1SQH A;  4M85 A;  4PSX A;  1U6M A;  1LRZ A;  4M3S A;  2ATR A;  4KOW A;  2EVN A;  2FXF A;  5AG5 A;  1PUA A;  2ZW7 A;  2Q4V A;  3I9S A;  2REE A;  3G8W A;  2CNS A;  3JUW A;  1QSR A;  3S6H A;  2Z3M A;  4AVB A;  4CGL A;  2Z3L A;  2Q0Y A;  5A28 A;  5IX3 A;  2OZU A;  2ZW5 A;  4UCP A;  1OZP A;  2OZG A;  1S3Z A;  2JLM A;  4KVX A;  1YVK A;  1M4D A;  3JTK A;  2Z3K A;  4MJ8 A;  5IB0 A;  1YVO A;  2J8R A;  1MJB A;  1NE9 A;  2VEZ A;  4H6Z A;  3WR7 A;  2HQY A;  1I1D A;  5HH1 A;  1M4G A;  4H89 A;  4KZT A;  2YNE A;  2D4O A;  4U5Y A;  1I12 A;  5F47 A;  4CGO A;  3QB8 A;  5A27 A;  4AVA A;  2Z3N A;  4Q36 A;  3TE4 A;  3I3G A;  3LOD A;  3G3S A;  3RYO A;  1XE4 A;  2AJ6 A;  4KUA A;  4B5O A;  4UA3 A;  2GE3 A;  3FB3 A;  3N7Z A;  2YNC A;  2VBQ A;  1NMT A;  4MY3 A;  3V8I A;  2FE7 A;  4CAW A;  1S7K A;  4R9M A;  1MJ9 A;  2WUU A;  3P2H A;  5AG4 A;  4A2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...