2QIRA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a and kanamycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
172
Chain Sequence
SVTLRLMTEHDLAMLYEWLNRSHIVEWWARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 172
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2qirA00
2GANA 4IUSA 2FIWA 1RO5A 5HH1A 4MY0A 4Y49C 2AE6A 2PDOA 2P0WA 3P2HA 4U9YA 2O28A 4RI1A 3NE7A 1S5KA 2HV2A 2B5GA 4R9MA 4KVXA 1KUXA 3FXTA 1OZPA 4QC6A 2QIRA 2B5GB 2B3UA 1TIQA 1NE9A 3PP9A 4NSQA 3UY5A 1Z4EA 2Z0ZA 2CY2A 5KTAA 3MGDA 4YGOA 5EBVA 1NSLA 5KTCA 1Q2YA 1YREA 4YRHA 5F49A 3D3SA 1YR0A 4QVTA 2OB0A 4JJXA 4NXYA 2ARHA 1YVKA 4B5PA 4KOTA 4CAWA 2JLMA 2CNTA 2REEA 4E8OA 2ZW5A 3F0AA 1B6BA 1S7NA 2P6FA 4B5PB 2FE7A 1Z4RA 1MK4A 2J8NA 2Z10A 1IYLA 4XPDB 4U9ZA 3FNCA 4KLWA 3GKRA 5CNPA 1I1DA 2PQ8A 3I3GA 2PSWA 4H6ZA 3VWEA 3K9UA 1K4JA 2QMLA 2R8VA 1NMTA 3TO7A 1N71A 3CXQA 2KCWA 2D4OA 4J3GA 2VZZA 1M4IA 3R95A 4R57A 3S6HA 5F46A 3FYNA 3WR7A 4AG7A 4OLLA 2OH1A 3EO4A 4LX9A 3LODA 3TO9A 1XMTA 5IV0A 1IIDA 5JQ4A 4UWJA 2VBQA 4UBRA 3TTHA 1VHSA 2VI7A 1S7FA 3BJ7A 1QSMA 3P2FA 3TE4A 2VEZA 3FRMA 4E0AA 1Q2DA 4JD6A 2R7HA 2Z11A 3GY9A 4U5YA 2DXQA 4QUSA 2Q7BA 2J8MA 2PC1A 1MJ9A 2FT0A 4XPLA 4K30A 4GS4A 4MHDA 2OZHA 4H6UA 3CXPA 2F5IA 5I0CA 2QECA 2RC4A 2ZW6A 2D4PA 2OU2A 4MI4A 1Y9WA 4PV6A 1WK4A 1B87A 4PSWA 4OADA 4FD6A 3QB8A 3R9FA 3BJ8A 2JDCA 3PGPA 4XPDC 1LRZA 3TOAA 2ZW7A 3FB3A 4AVCA 4KLVA 4PSXA 3LD2A 4KOUA 1XEBA 2I00A 1S60A 4MY3A 4B5OA 1WWZA 5E96A 3EFAA 4F0YA 3R9GA 3FBUA 2B4DB 4KZTA 3W91A 5ISVA 3KKWA 2P6EA 4R3KA 2Q0YA 5J8CA 5DWMA 1Y7RA 4FD7A 4JWPA 5F48A 2BEIA 2CNSA 4KOSA 1UFHA 1P0HA 4M3SA 3D2MA 3RYOA 3TT2A 3E0KA 1QSOA 4OAEA 4Y49B 1Y9KA 1Q2CA 3BLNA 4HNWB 2J8RA 4AVBA 2FCKA 1S7KA 4QB9A 3T9YA 3F8KA 5DWNA 1YLEA 4FD4A 2FIAA 4UWIA 4X5KA 2G0BA 2HUZA 2FSRA 1V0CA 2AJ6A 2PRBA 3VWDA 3H4QA 1VKCA 4PK2A 4FD5A 3IGRA 3SXOA 1IICA 3DSBA 4H89A 1MJAA 4XNHB 4KVOE 2BL1A 2JEVA 2ZPAA 4JXRA 2Q04A 2I79A 3TOBA 4CRZB 3EC4A 3S6GA 4AB7A 2GE3A 3DR6A 2R1IA 2ZXVA 4NF1A 4QBJA 1I12A 3S6FA 3D2PA 3JUWA 3G3SA 4XPKA 4MBUA 4CAVA 2VQYA 1IB1E 2VXKA 2Y0MA 3W6SA 1RXTA 5IB0A 3N7ZA 3TCVA 5C88A 3JVNA 4NEXA 3S6KA 2BUEA 2JDDA 3B8GA 3G8WA 2ZW4A 3FIXA 2IL4A 1KUYA 2Q4YA 4AG9A 2B3VA 3C26A 1M4DA 3W6XA 4R87A 2P6GA 3GYAA 4L89A 1Z9UA 3ZZIA 4YFJA 3QAHA 4EVYA 4HNYB 4UA3A 2WPXA 3TO6A 3T90A 1PUAA 2PR8A 1QSRA 2B58A 4KUBA 2B4DA 4ORFA 3EXNA 4JXQA 2WPWA 4HKFA 1GHEA 2ATRA 1CJWA 3IWGA 3R9EA 5FVJA 1XE4A 4LUAA 4KOVA 4M85A 5C82A 5IX3A 2NMTA 5J8FA 1YGHA 2FXFA 2G3TA 2GIVA 3DNSA 4XNHC 1FY7A 2HQYA 4F6AA 3V8IA 3PZJA 4KOXA 4MJ8A 4CRYB 1L0CA 5H84A 1R57A 1XF8A 1SQHA 1U6MA 5H86A 5F47A 2Q4VA 1KZFA 2VZYA 2FS5A 2X7BA 4DNCA 1BOBA 1YVOA 2C27A 3EY5A 4R3LA 4RS2A 3R1KA 1YK3A 2K5TA 4II9A 4KOYA 4E2AA 4KVME 1BO4A 1QSTA 1S3ZA 2H5MA 4PK3A 1ON0A 4JLYA 2EUIA 4CS0B 2B4BA 3R96A 3SHPA 3TFYA 2CNMA 1QSNA 5JPHA 1J4JA 2A4NA 1M44A 3DDDA 5HMNA 2PR1A 3CXSA 1PU9A 2OZGA 2R98A 2EVNA 3F5BA 3D8PA 4KOWA 3ZJ0A 1YX0A 1S7LA 4CAXA 3SXNA 4L8AA 1MJBA 2BSWA 4IF5A 2OZUA 5GCNA 3OWCA 1M1DA 4HNXB 4I49A 2G3AA 4AVAA 4BMHA 1CM0A 1KUVA 3I9SA 1IYKA 1XIXA 3DR8A 2REFA 2FL4A 5KTDA 4KORA 1P4NA 2Q44A 5EC4A 1I21A 1M4GA 4ONUA 4ZBGA 4KUAA 4NCZA
chains in the Genus database with same CATH superfamily
1Z8WA 2GANA 4IUSA 2FIWA 1RO5A 2JEWA 5HVGA 4P6YA 3WT4A 1TF9A 5HH1A 1R43A 2AFOA 4MY0A 4Y49C 2AE6A 3FJUA 3H8GA 2PDOA 2P0WA 3P2HA 4U9YA 2O28A 4RI1A 4CAFA 3NE7A 1IY7A 4JZ0A 2Z3OA 1DTDA 1S5KA 2VL1A 2HV2A 2B5GA 4UFWA 3SI2A 4R9MA 4IHMA 4UEZA 4KVXA 5LYLA 1KUXA 3FXTA 4NJRA 3KHXA 4R8FA 1OZPA 3BI0A 4TWEA 4QC6A 2PE3A 2QIRA 1IOIA 2B5GB 2ZEOA 3HUVA 4OMEA 2B3UA 4YWYA 1YLOA 1TIQA 3KL9A 3LWUA 3T8WA 2PJCA 1NE9A 4MFZA 3FX6A 1BPMA 2GLJA 3D7GA 3PP9A 1ZG7A 4UCPA 4CYOA 4NSQA 3UY5A 1Z4EA 2Z0ZA 3NE8A 1CP6A 2CY2A 4M6HA 5AG7A 5KTAA 3IEHA 4CGPA 3MGDA 4YGOA 3GUXA 5AGEA 2GREA 2WSAA 5D8NA 2Q51A 5EBVA 1NSLA 5KTCA 1Q2YA 3IU1A 1CPXA 3WC5A 1YREA 4YRHA 5F49A 3D3SA 3QNVA 2QVPA 1YW6A 3PBBA 4CGNA 4MFPA 4LQGA 1YR0A 4QVTA 2OB0A 4JJXA 4NXYA 1Z8TA 2PVWA 3V7ZA 2ARHA 1YVKA 4B5PA 4FWUA 2ANPA 4KOTA 4CAWA 2JLMA 2CNTA 3QAYA 2REEA 3BHXA 2RFHA 3VATA 4E8OA 4C2XA 2ZW5A 3F0AA 1Y0YA 1B6BA 1S7NA 2P6FA 1Y7EA 3SJFA 4B5PB 4Z65A 1HDUA 4CGLA 2FE7A 1Z4RA 1MK4A 2J8NA 2Z10A 1IYLA 4XPDB 4U9ZA 2DEAA 4MRIA 4PXCA 1ELMP 2YGWA 4MHYA 2EBJA 2PRQA 3FNCA 3GKRA 4KLWA 5CNPA 3IIBA 3IFEA 5EMIA 2BCOA 1YW4A 4KS9A 3D68A 3SJXA 3PEIA 1I1DA 2OR4A 2PQ8A 3I3GA 4H2KA 4A39A 4CYPA 1XBUA 3S9NA 2PSWA 1AMPA 4H6ZA 3VWEA 1XFOA 3K9UA 1IGBA 1K4JA 2QMLA 2R8VA 4A32A 1NMTA 3TO7A 1N71A 3CXQA 4C2YA 5CBMA 1LAPA 1TKHA 2KCWA 2D4OA 2ZEEA 3K2KA 4J3GA 2VZZA 2ZELA 3KGQA 2C6CA 3CPXA 1M4IA 2PJBA 3R95A 5AG6A 1CX8A 2YNCC 4R57A 2PJ7A 3S6HA 3FYNA 4F0XA 5F46A 4B11A 3MRUA 3V38A 3WR7A 4AG7A 4OLLA 2OH1A 3EO4A 3GB0A 1ZO0A 3IC1A 4PXEA 4A38A 1AYEA 3MN8A 4A30A 1CG2A 4LX9A 3LODA 5G20A 4ZY2A 3TO9A 1BLLE 1XMTA 2I3CA 5IV0A 1IIDA 5DS0A 5JQ4A 1CPSA 3FF3A 4UWJA 2VBQA 4UBRA 3TTHA 4A95A 1VHSA 1LANA 2VI7A 2ZOGA 4C68A 1CP7A 1VIXA 3NA6A 1S7FA 3BJ7A 1QSMA 1XJOA 3P2FA 1ZG9A 4A37A 3TE4A 1RTQA 2VEZA 2PJ9A 3FH4A 3FRMA 5JM6A 1Z5RA 5G1ZA 3GLJA 2ZENA 4F9UA 3RO0A 4E0AA 1Q2DA 4JD6A 2R7HA 2Z11A 3GY9A 4U5YA 3KI9A 3BXMA 4NGPA 2DXQA 4QUSA 2Q7BA 4DJLA 2J8MA 1QMUA 2PC1A 2OOTA 1YSJA 4P4BA 3HLPA 1MJ9A 3KR4A 3RBUA 3RNZA 2FT0A 1OBRA 2CF4A 4K30A 4XPLA 4BINA 4GS4A 2XEIA 4MHDA 2OZHA 4H6UA 2AFZA 3CXPA 2F5IA 4OC4A 5I0CA 2QECA 2RC4A 2Z3LA 2ZW6A 2D4PA 2OU2A 2V8HA 4MI4A 2CIJA 1Y9WA 4PV6A 4UIBA 1M4LA 1WK4A 3KHZA 1B87A 2O53A 2HC9A 4PSWA 4OADA 4B14A 5HVHA 4FD6A 1ZLHA 3QB8A 3R9FA 3BJ8A 4MFJA 2JDCA 4OC2A 4P44A 1XMBA 3PGPA 5HVFA 3B3WA 4XPDC 2BO9A 4X2TA 2XEFA 1LRZA 4NFRA 3TOAA 2ZW7A 3FB3A 4AVCA 1CBXA 3FMCA 4KLVA 2WUUA 4PSXA 4A31A 3LD2A 4NGTA 4P4JA 2PJ2A 4KOUA 4NGMA 3D7DA 1XEBA 2I00A 4CAEA 3PB8X 2CTBA 3L2NA 1S60A 3RZAA 4MY3A 5G22A 5J1QA 4B5OA 1WWZA 3FECA 5E96A 5IB9A 3EFAA 4R76A 4W9YA 1FT7A 4F0YA 3R9GA 3FBUA 4CGOA 5LRKA 2B4DB 4KZTA 3W91A 5ISVA 3ISZA 3KKWA 1PCAA 1ZLIA 2P6EA 2Q0YA 4R3KA 1TXRA 1Z2LA 2IJZA 5J8CA 1LAMA 4UFXA 1Y7RA 5DWMA 4FD7A 4JWPA 4A33A 2C6PA 2Z3KA 3FEDA 4F8ZA 2RB7A 3PBEA 4M6IA 1XOVA 4P4IA 5CPAA 2BEIA 5F48A 5LYDA 1F57A 2CNSA 2CTCA 4MCRA 1TKFA 3IU2A 1AUGA 4P4FA 4KOSA 2Z3MA 2DPTA 2EO8A 5AG5A 3SJEA 4CGMA 5LYFA 1UWYA 3B3VA 1JWQA 1UFHA 1P0HA 4M3SA 1HEEA 3D2MA 3RYOA 3TT2A 4NGQA 4UIAA 3SJGA 3E0KA 1QSOA 4OAEA 4CYQA 4DUKA 4Y49B 4NGRA 1Q2CA 1Y9KA 4ZYQA 4OC0A 4UF4A 3BLNA 2QJ8A 4HNWB 2DF5A 4X8IA 4UFVA 2J8RA 4AVBA 2O4HA 2FCKA 1S7KA 2EK8A 2PJ0A 2Z3NA 4QB9A 3T9YA 4P4DA 2AFUA 3F8KA 5DWNA 1YLEA 1VGYA 4FD4A 2FIAA 1ZG8A 4IK2A 4UWIA 4X5KA 2G0BA 2HUZA 2PIZA 3IWWA 4KSIA 2FSRA 1F2PA 1V0CA 2AJ6A 4C7HA 2PRBA 5THWA 3VWDA 3H4QA 1VKCA 4PK2A 2GU2A 4FD5A 4IAVA 4GM5A 1FNOA 3IGRA 2JBKA 3N5FA 3SXOA 1IICA 1LFWA 2V77A 3D66A 3DSBA 1ELLP 3NH4A 4H89A 1MJAA 4XNHB 4KVOE 2BL1A 3D67A 5K8OA 3KR5A 2JEVA 3B2YA 2ZPAA 4JXRA 3PRTA 3PFOA 4MXUA 2Q04A 1NSAA 2I79A 1X12A 4A2ZA 3TOBA 4CRZB 3PB4X 5A27A 2NYQA 3EC4A 2F7VA 4WJBA 1LCPA 3S6GA 3WC7A 2HB6A 2GE3A 3K9TA 4AB7A 3DR6A 2PJ5A 4PXBA 2ODFA 2R1IA 4Q38A 2Q4ZA 3TX8A 2V8GA 5ELYA 2ZXVA 2AFMA 4NF1A 4QBJA 5A28A 1I12A 3D7FA 3KQZA 5D29A 3S6FA 3D2PA 3JUWA 3NH5A 3G3SA 4LQ6A 4NGSA 4XPKA 1BPNA 4MBUA 4TNUA 4CAVA 2VQYA 2C1CA 1TF8A 4MFKA 1BAVA 1IB1E 2VXKA 2Y0MA 4F9VA 4ZI6A 3W6SA 1ARLA 1RXTA 4Q7AA 1JQGA 5IB0A 3D4UA 3N7ZA 3SI0A 3TCVA 2DPSA 5C88A 2PJAA 3JVNA 4NEXA 3S6KA 1Q7LA 4BBHA 3PB7X 4G1PA 2BUEA 2JDDA 3B3CA 3B8GA 5HXDA 2CXAA 2PIYA 3G8WA 3H8EA 4R6TA 5I4MA 1F2OA 2ZW4A 3NH8A 4MHPA 3TC8A 3FIXA 1IU8A 5LRGA 2IL4A 1KUYA 2Q4YA 3FVLA 2PJ1A 2ZEDA 4AG9A 2B3VA 4K3NA 1R3NA 3C26A 3KZWA 1M4DA 3W6XA 4MFLA 4R87A 2P6GA 2PCUA 3GYAA 4L89A 1Z9UA 1KWMA 3CDXA 4YU9A 3ZZIA 4YFJA 4ZY1A 1GYTA 2BOAA 2AFSA 3LACA 3QAHA 3VARA 4PXDA 4EVYA 3B35A 4HNYB 4UA3A 2Q7SA 2WPXA 3PFEA 2G9DA 3I1UA 3TO6A 2PJ6A 3T90A 1PUAA 3WABA 2PR8A 4OIDA 1QSRA 3ISXA 2V8VA 4R7MA 2GFQA 3IWEA 2B58A 4KUBA 4RUHA 2B4DA 2PJ3A 2GLFA 4ORFA 3EXNA 4KSFA 2AFWA 2YNEA 4JXQA 4PQAA 3DGVA 4OC5A 1Z8LA 2WPWA 4HKFA 1GHEA 2ATRA 1CJWA 3IWGA 3R9EA 4EMEA 2V8DA 4DYOA 4EWTA 5FVJA 4X3RA 3B3SA 1XE4A 4LUAA 4KOVA 1YMEA 5K8MA 4HPSA 4M85A 5C82A 5IX3A 2IMOA 2NMTA 5J8FA 2PVVA 1YGHA 2FXFA 2Z3PA 2ZEFA 2G3TA 2GIVA 1YQEA 3DNSA 4MHNA 2PJ4A 2ZEGA 4MCQA 4XNHC 6CPAA 1FY7A 2HQYA 4F6AA 3S9LA 3V8IA 3D7HA 4P45A 3PZJA 4NGNA 4KOXA 2EK9A 4MJ8A 1H8LA 1HDQA 3B3TA 4CRYB 3CT9A 1L0CA 4AXVA 4OKOA 5H84A 1LOKA 1R57A 3PB9X 1XF8A 1SQHA 1U6MA 2ZOFA 5H86A 4UCNA 1A2ZA 3H5ZA 4ZX8A 5F47A 2Q4VA 3CZXA 1KZFA 2VZYA 2FS5A 4P10A 2X7BA 2F8HA 4B6ZA 3KASA 3WC6A 4DNCA 1BOBA 4GXHA 1YVOA 2C27A 2AFXA 3EY5A 4R3LA 4JYWA 3R1KA 4RS2A 4B10A 1DE4C 4OP4A 1YK3A 2K5TA 4II9A 4MCSA 4KOYA 1X10A 4E2AA 2QYVA 4KVME 4CYNA 1BO4A 1QSTA 3FEEA 2EWBA 1S3ZA 4MHZA 2H5MA 4UCMA 4ZX9A 3VH9A 2XEGA 2ABZA 1Y0RA 3H8FA 4PK3A 1ON0A 1PYTB 4B12A 5K8PA 4JLYA 2EUIA 5G21A 4O23A 5JH9A 4CS0B 4OC1A 4C2ZA 2B4BA 3R96A 3SHPA 4BD9A 3TFYA 2CNMA 1XRYA 1QSNA 2ZEHA 5JPHA 4ONWA 1J4JA 3GIUA 2A4NA 4C7IA 1M44A 5LYIA 4OC3A 3DDDA 4FBEA 5K8NA 2POKA 3IO1A 4MMOA 4B13A 5HMNA 2PR1A 2JBJA 3CXSA 4MCPA 1PU9A 2OZGA 4EFDA 4FUUA 2R98A 4UEEA 2EVNA 1EE3P 3F5BA 3D8PA 4KOWA 3JTKA 4P4EA 3ZJ0A 4FAIA 1ARMA 3RAMA 3SI1A 1YX0A 3BI1A 3LMSA 4ZY0A 1S7LA 4CAXA 2FVGA 3SXNA 3B7IA 1MJBA 4L8AA 3KQXA 2PJ8A 2WYRA 2BSWA 2IQ6A 5LRJA 4IF5A 3S9MA 2OZUA 5GCNA 4CPAA 2ZEPA 2XEJA 3PB6X 3OWCA 1M1DA 4HNXB 4I49A 4Q36A 2G3AA 4WWVA 2Q43A 4AVAA 4BMHA 4NJQA 4RN7A 3A9LA 1VHEA 4MFQA 3NFZA 8CPAA 1VHOA 1QQ9A 5BWAB 1CM0A 1KUVA 3JRUA 3I9SA 4M6GA 2NSMA 3IJ3A 1IYKA 1XIXA 3DR8A 4ZGYB 2REFA 5F09A 2FL4A 1IOFA 5KTDA 2YNCA 7CPAA 4KORA 4PPZA 1P4NA 3CPAA 2Q44A 2WZNA 4UEFA 2YNDA 5EC4A 4KSAA 3DLJA 1I21A 1M4GA 4ONUA 5AG4A 5JGFA 4ZBGA 2C6GA 4KUAA 4A94A 1TKJA 4NCZA 4OIWA 2J9AA 2ZEMA 1Z8XA
chains in the Genus database with same CATH topology
2GANA 4IUSA 2FIWA 1RO5A 5HH1A 4MY0A 4Y49C 2AE6A 2PDOA 2P0WA 3P2HA 4U9YA 2O28A 4RI1A 4CAFA 3NE7A 2Z3OA 1S5KA 2HV2A 2B5GA 4UFWA 4R9MA 4KVXA 1KUXA 3FXTA 1OZPA 4QC6A 2QIRA 2B5GB 2B3UA 1TIQA 1NE9A 4MFZA 3PP9A 4UCPA 4CYOA 4NSQA 3UY5A 1Z4EA 2Z0ZA 2CY2A 5AG7A 5KTAA 4CGPA 3MGDA 4YGOA 5AGEA 2WSAA 5EBVA 1NSLA 5KTCA 1Q2YA 3IU1A 1YREA 4YRHA 5F49A 3D3SA 4CGNA 4MFPA 1YR0A 4QVTA 2OB0A 4JJXA 4NXYA 2ARHA 1YVKA 4B5PA 4KOTA 4CAWA 2JLMA 2CNTA 2REEA 4E8OA 4C2XA 2ZW5A 3F0AA 1B6BA 1S7NA 2P6FA 4B5PB 4CGLA 2FE7A 1Z4RA 1MK4A 2J8NA 2Z10A 1IYLA 4XPDB 4U9ZA 2YGWA 3FNCA 4KLWA 3GKRA 5CNPA 4KS9A 1I1DA 2PQ8A 3I3GA 4CYPA 2PSWA 4H6ZA 3VWEA 3K9UA 1K4JA 4C2YA 2QMLA 2R8VA 4A32A 1NMTA 3TO7A 1N71A 3CXQA 2KCWA 2D4OA 4J3GA 2VZZA 1M4IA 3R95A 5AG6A 2YNCC 4R57A 3S6HA 5F46A 3FYNA 4F0XA 4B11A 3WR7A 4AG7A 4OLLA 2OH1A 3EO4A 1ZO0A 4A30A 4LX9A 3LODA 5G20A 3TO9A 1XMTA 5IV0A 1IIDA 5JQ4A 4UWJA 2VBQA 4UBRA 3TTHA 4A95A 1VHSA 2VI7A 4C68A 1S7FA 3BJ7A 1QSMA 3P2FA 3TE4A 2VEZA 3FRMA 5G1ZA 4E0AA 1Q2DA 4JD6A 2R7HA 2Z11A 3GY9A 4U5YA 2DXQA 4QUSA 2Q7BA 2J8MA 2PC1A 1MJ9A 2FT0A 4XPLA 4K30A 4GS4A 4MHDA 2OZHA 4H6UA 3CXPA 2F5IA 5I0CA 2QECA 2RC4A 2Z3LA 2ZW6A 2D4PA 2OU2A 4MI4A 1Y9WA 4PV6A 1WK4A 1B87A 4PSWA 4OADA 4B14A 4FD6A 3QB8A 3R9FA 3BJ8A 4MFJA 2JDCA 3PGPA 4XPDC 1LRZA 3TOAA 2ZW7A 3FB3A 4AVCA 4KLVA 2WUUA 4PSXA 4A31A 3LD2A 4KOUA 1XEBA 2I00A 4CAEA 1S60A 4MY3A 5G22A 4B5OA 1WWZA 5E96A 3EFAA 4F0YA 3R9GA 3FBUA 4CGOA 2B4DB 4KZTA 3W91A 5ISVA 3KKWA 2P6EA 4R3KA 2Q0YA 5J8CA 4UFXA 1Y7RA 5DWMA 4FD7A 4JWPA 4A33A 2Z3KA 5F48A 2BEIA 2CNSA 3IU2A 4KOSA 2Z3MA 2DPTA 5AG5A 4CGMA 1UFHA 1P0HA 4M3SA 3D2MA 3RYOA 3TT2A 3E0KA 1QSOA 4OAEA 4CYQA 4Y49B 1Y9KA 1Q2CA 3BLNA 4HNWB 4UFVA 2J8RA 4AVBA 2FCKA 1S7KA 4QB9A 2Z3NA 3T9YA 3F8KA 5DWNA 1YLEA 4FD4A 2FIAA 4UWIA 4X5KA 2G0BA 2HUZA 2FSRA 4C7HA 1V0CA 2AJ6A 2PRBA 3VWDA 3H4QA 1VKCA 4PK2A 4FD5A 3IGRA 3SXOA 1IICA 3DSBA 4H89A 1MJAA 4XNHB 4KVOE 2BL1A 2JEVA 2ZPAA 4JXRA 2Q04A 2I79A 4A2ZA 3TOBA 4CRZB 5A27A 3EC4A 3S6GA 4AB7A 2GE3A 3DR6A 2R1IA 4Q38A 2ZXVA 4NF1A 4QBJA 5A28A 1I12A 3S6FA 3D2PA 3JUWA 3G3SA 4XPKA 4MBUA 4CAVA 2VQYA 4MFKA 1IB1E 2VXKA 2Y0MA 3W6SA 1RXTA 5IB0A 3N7ZA 3TCVA 2DPSA 5C88A 3JVNA 4NEXA 3S6KA 4BBHA 2BUEA 3B8GA 2JDDA 2CXAA 3G8WA 2ZW4A 3FIXA 2IL4A 1KUYA 2Q4YA 4AG9A 2B3VA 3C26A 1M4DA 3W6XA 4MFLA 4R87A 2P6GA 3GYAA 4L89A 1Z9UA 3ZZIA 4YFJA 3QAHA 4EVYA 4HNYB 4UA3A 2WPXA 3TO6A 3T90A 1PUAA 2PR8A 1QSRA 3IWEA 2B58A 4KUBA 2B4DA 4ORFA 3EXNA 4KSFA 2YNEA 4JXQA 2WPWA 4HKFA 1GHEA 2ATRA 1CJWA 3IWGA 3R9EA 5FVJA 1XE4A 4LUAA 4KOVA 4M85A 5C82A 5IX3A 2NMTA 5J8FA 1YGHA 2FXFA 2Z3PA 2G3TA 2GIVA 3DNSA 4XNHC 1FY7A 2HQYA 4F6AA 3V8IA 3PZJA 4KOXA 4MJ8A 4CRYB 1L0CA 5H84A 1R57A 1XF8A 1SQHA 1U6MA 5H86A 4UCNA 3H5ZA 5F47A 2Q4VA 1KZFA 2VZYA 2FS5A 2X7BA 4DNCA 1BOBA 1YVOA 2C27A 3EY5A 4R3LA 4RS2A 4B10A 3R1KA 1YK3A 2K5TA 4II9A 4KOYA 4E2AA 4KVME 4CYNA 1BO4A 1QSTA 4UCMA 1S3ZA 2H5MA 4PK3A 1ON0A 4B12A 4JLYA 2EUIA 5G21A 4CS0B 4C2ZA 2B4BA 3R96A 3SHPA 3TFYA 2CNMA 1QSNA 5JPHA 1J4JA 4C7IA 2A4NA 1M44A 3DDDA 5HMNA 4B13A 2PR1A 3CXSA 1PU9A 2OZGA 2R98A 2EVNA 3F5BA 3D8PA 4KOWA 3JTKA 3ZJ0A 1YX0A 1S7LA 4CAXA 3SXNA 4L8AA 1MJBA 2BSWA 4IF5A 2OZUA 5GCNA 3OWCA 1M1DA 4HNXB 4I49A 4Q36A 2G3AA 4AVAA 4BMHA 3A9LA 4MFQA 5BWAB 1CM0A 1KUVA 3I9SA 1IYKA 1XIXA 3DR8A 4ZGYB 2REFA 2FL4A 5KTDA 2YNCA 4KORA 1P4NA 2Q44A 2YNDA 5EC4A 4KSAA 1I21A 1M4GA 4ONUA 5AG4A 4ZBGA 4KUAA 4NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAN A;  4IUS A;  2FIW A;  1RO5 A;  5HH1 A;  4MY0 A;  4Y49 C;  2AE6 A;  2PDO A;  2P0W A;  3P2H A;  4U9Y A;  2O28 A;  4RI1 A;  3NE7 A;  1S5K A;  2HV2 A;  2B5G A;  4R9M A;  4KVX A;  1KUX A;  3FXT A;  1OZP A;  4QC6 A;  2QIR A;  2B5G B;  2B3U A;  1TIQ A;  1NE9 A;  3PP9 A;  4NSQ A;  3UY5 A;  1Z4E A;  2Z0Z A;  2CY2 A;  5KTA A;  3MGD A;  4YGO A;  5EBV A;  1NSL A;  5KTC A;  1Q2Y A;  1YRE A;  4YRH A;  5F49 A;  3D3S A;  1YR0 A;  4QVT A;  2OB0 A;  4JJX A;  4NXY A;  2ARH A;  1YVK A;  4B5P A;  4KOT A;  4CAW A;  2JLM A;  2CNT A;  2REE A;  4E8O A;  2ZW5 A;  3F0A A;  1B6B A;  1S7N A;  2P6F A;  4B5P B;  2FE7 A;  1Z4R A;  1MK4 A;  2J8N A;  2Z10 A;  1IYL A;  4XPD B;  4U9Z A;  3FNC A;  4KLW A;  3GKR A;  5CNP A;  1I1D A;  2PQ8 A;  3I3G A;  2PSW A;  4H6Z A;  3VWE A;  3K9U A;  1K4J A;  2QML A;  2R8V A;  1NMT A;  3TO7 A;  1N71 A;  3CXQ A;  2KCW A;  2D4O A;  4J3G A;  2VZZ A;  1M4I A;  3R95 A;  4R57 A;  3S6H A;  5F46 A;  3FYN A;  3WR7 A;  4AG7 A;  4OLL A;  2OH1 A;  3EO4 A;  4LX9 A;  3LOD A;  3TO9 A;  1XMT A;  5IV0 A;  1IID A;  5JQ4 A;  4UWJ A;  2VBQ A;  4UBR A;  3TTH A;  1VHS A;  2VI7 A;  1S7F A;  3BJ7 A;  1QSM A;  3P2F A;  3TE4 A;  2VEZ A;  3FRM A;  4E0A A;  1Q2D A;  4JD6 A;  2R7H A;  2Z11 A;  3GY9 A;  4U5Y A;  2DXQ A;  4QUS A;  2Q7B A;  2J8M A;  2PC1 A;  1MJ9 A;  2FT0 A;  4XPL A;  4K30 A;  4GS4 A;  4MHD A;  2OZH A;  4H6U A;  3CXP A;  2F5I A;  5I0C A;  2QEC A;  2RC4 A;  2ZW6 A;  2D4P A;  2OU2 A;  4MI4 A;  1Y9W A;  4PV6 A;  1WK4 A;  1B87 A;  4PSW A;  4OAD A;  4FD6 A;  3QB8 A;  3R9F A;  3BJ8 A;  2JDC A;  3PGP A;  4XPD C;  1LRZ A;  3TOA A;  2ZW7 A;  3FB3 A;  4AVC A;  4KLV A;  4PSX A;  3LD2 A;  4KOU A;  1XEB A;  2I00 A;  1S60 A;  4MY3 A;  4B5O A;  1WWZ A;  5E96 A;  3EFA A;  4F0Y A;  3R9G A;  3FBU A;  2B4D B;  4KZT A;  3W91 A;  5ISV A;  3KKW A;  2P6E A;  4R3K A;  2Q0Y A;  5J8C A;  5DWM A;  1Y7R A;  4FD7 A;  4JWP A;  5F48 A;  2BEI A;  2CNS A;  4KOS A;  1UFH A;  1P0H A;  4M3S A;  3D2M A;  3RYO A;  3TT2 A;  3E0K A;  1QSO A;  4OAE A;  4Y49 B;  1Y9K A;  1Q2C A;  3BLN A;  4HNW B;  2J8R A;  4AVB A;  2FCK A;  1S7K A;  4QB9 A;  3T9Y A;  3F8K A;  5DWN A;  1YLE A;  4FD4 A;  2FIA A;  4UWI A;  4X5K A;  2G0B A;  2HUZ A;  2FSR A;  1V0C A;  2AJ6 A;  2PRB A;  3VWD A;  3H4Q A;  1VKC A;  4PK2 A;  4FD5 A;  3IGR A;  3SXO A;  1IIC A;  3DSB A;  4H89 A;  1MJA A;  4XNH B;  4KVO E;  2BL1 A;  2JEV A;  2ZPA A;  4JXR A;  2Q04 A;  2I79 A;  3TOB A;  4CRZ B;  3EC4 A;  3S6G A;  4AB7 A;  2GE3 A;  3DR6 A;  2R1I A;  2ZXV A;  4NF1 A;  4QBJ A;  1I12 A;  3S6F A;  3D2P A;  3JUW A;  3G3S A;  4XPK A;  4MBU A;  4CAV A;  2VQY A;  1IB1 E;  2VXK A;  2Y0M A;  3W6S A;  1RXT A;  5IB0 A;  3N7Z A;  3TCV A;  5C88 A;  3JVN A;  4NEX A;  3S6K A;  2BUE A;  2JDD A;  3B8G A;  3G8W A;  2ZW4 A;  3FIX A;  2IL4 A;  1KUY A;  2Q4Y A;  4AG9 A;  2B3V A;  3C26 A;  1M4D A;  3W6X A;  4R87 A;  2P6G A;  3GYA A;  4L89 A;  1Z9U A;  3ZZI A;  4YFJ A;  3QAH A;  4EVY A;  4HNY B;  4UA3 A;  2WPX A;  3TO6 A;  3T90 A;  1PUA A;  2PR8 A;  1QSR A;  2B58 A;  4KUB A;  2B4D A;  4ORF A;  3EXN A;  4JXQ A;  2WPW A;  4HKF A;  1GHE A;  2ATR A;  1CJW A;  3IWG A;  3R9E A;  5FVJ A;  1XE4 A;  4LUA A;  4KOV A;  4M85 A;  5C82 A;  5IX3 A;  2NMT A;  5J8F A;  1YGH A;  2FXF A;  2G3T A;  2GIV A;  3DNS A;  4XNH C;  1FY7 A;  2HQY A;  4F6A A;  3V8I A;  3PZJ A;  4KOX A;  4MJ8 A;  4CRY B;  1L0C A;  5H84 A;  1R57 A;  1XF8 A;  1SQH A;  1U6M A;  5H86 A;  5F47 A;  2Q4V A;  1KZF A;  2VZY A;  2FS5 A;  2X7B A;  4DNC A;  1BOB A;  1YVO A;  2C27 A;  3EY5 A;  4R3L A;  4RS2 A;  3R1K A;  1YK3 A;  2K5T A;  4II9 A;  4KOY A;  4E2A A;  4KVM E;  1BO4 A;  1QST A;  1S3Z A;  2H5M A;  4PK3 A;  1ON0 A;  4JLY A;  2EUI A;  4CS0 B;  2B4B A;  3R96 A;  3SHP A;  3TFY A;  2CNM A;  1QSN A;  5JPH A;  1J4J A;  2A4N A;  1M44 A;  3DDD A;  5HMN A;  2PR1 A;  3CXS A;  1PU9 A;  2OZG A;  2R98 A;  2EVN A;  3F5B A;  3D8P A;  4KOW A;  3ZJ0 A;  1YX0 A;  1S7L A;  4CAX A;  3SXN A;  4L8A A;  1MJB A;  2BSW A;  4IF5 A;  2OZU A;  5GCN A;  3OWC A;  1M1D A;  4HNX B;  4I49 A;  2G3A A;  4AVA A;  4BMH A;  1CM0 A;  1KUV A;  3I9S A;  1IYK A;  1XIX A;  3DR8 A;  2REF A;  2FL4 A;  5KTD A;  4KOR A;  1P4N A;  2Q44 A;  5EC4 A;  1I21 A;  1M4G A;  4ONU A;  4ZBG A;  4KUA A;  4NCZ A; 
#chains in the Genus database with same CATH topology
 1Z8W A;  2GAN A;  4IUS A;  2FIW A;  1RO5 A;  2JEW A;  5HVG A;  4P6Y A;  3WT4 A;  1TF9 A;  5HH1 A;  1R43 A;  2AFO A;  4MY0 A;  4Y49 C;  2AE6 A;  3FJU A;  3H8G A;  2PDO A;  2P0W A;  3P2H A;  4U9Y A;  2O28 A;  4RI1 A;  4CAF A;  3NE7 A;  1IY7 A;  4JZ0 A;  2Z3O A;  1DTD A;  1S5K A;  2VL1 A;  2HV2 A;  2B5G A;  4UFW A;  3SI2 A;  4R9M A;  4IHM A;  4UEZ A;  4KVX A;  5LYL A;  1KUX A;  3FXT A;  4NJR A;  3KHX A;  4R8F A;  1OZP A;  3BI0 A;  4TWE A;  4QC6 A;  2PE3 A;  2QIR A;  1IOI A;  2B5G B;  2ZEO A;  3HUV A;  4OME A;  2B3U A;  4YWY A;  1YLO A;  1TIQ A;  3KL9 A;  3LWU A;  3T8W A;  2PJC A;  1NE9 A;  4MFZ A;  3FX6 A;  1BPM A;  2GLJ A;  3D7G A;  3PP9 A;  1ZG7 A;  4UCP A;  4CYO A;  4NSQ A;  3UY5 A;  1Z4E A;  2Z0Z A;  3NE8 A;  1CP6 A;  2CY2 A;  4M6H A;  5AG7 A;  5KTA A;  3IEH A;  4CGP A;  3MGD A;  4YGO A;  3GUX A;  5AGE A;  2GRE A;  2WSA A;  5D8N A;  2Q51 A;  5EBV A;  1NSL A;  5KTC A;  1Q2Y A;  3IU1 A;  1CPX A;  3WC5 A;  1YRE A;  4YRH A;  5F49 A;  3D3S A;  3QNV A;  2QVP A;  1YW6 A;  3PBB A;  4CGN A;  4MFP A;  4LQG A;  1YR0 A;  4QVT A;  2OB0 A;  4JJX A;  4NXY A;  1Z8T A;  2PVW A;  3V7Z A;  2ARH A;  1YVK A;  4B5P A;  4FWU A;  2ANP A;  4KOT A;  4CAW A;  2JLM A;  2CNT A;  3QAY A;  2REE A;  3BHX A;  2RFH A;  3VAT A;  4E8O A;  4C2X A;  2ZW5 A;  3F0A A;  1Y0Y A;  1B6B A;  1S7N A;  2P6F A;  1Y7E A;  3SJF A;  4B5P B;  4Z65 A;  1HDU A;  4CGL A;  2FE7 A;  1Z4R A;  1MK4 A;  2J8N A;  2Z10 A;  1IYL A;  4XPD B;  4U9Z A;  2DEA A;  4MRI A;  4PXC A;  1ELM P;  2YGW A;  4MHY A;  2EBJ A;  2PRQ A;  3FNC A;  3GKR A;  4KLW A;  5CNP A;  3IIB A;  3IFE A;  5EMI A;  2BCO A;  1YW4 A;  4KS9 A;  3D68 A;  3SJX A;  3PEI A;  1I1D A;  2OR4 A;  2PQ8 A;  3I3G A;  4H2K A;  4A39 A;  4CYP A;  1XBU A;  3S9N A;  2PSW A;  1AMP A;  4H6Z A;  3VWE A;  1XFO A;  3K9U A;  1IGB A;  1K4J A;  2QML A;  2R8V A;  4A32 A;  1NMT A;  3TO7 A;  1N71 A;  3CXQ A;  4C2Y A;  5CBM A;  1LAP A;  1TKH A;  2KCW A;  2D4O A;  2ZEE A;  3K2K A;  4J3G A;  2VZZ A;  2ZEL A;  3KGQ A;  2C6C A;  3CPX A;  1M4I A;  2PJB A;  3R95 A;  5AG6 A;  1CX8 A;  2YNC C;  4R57 A;  2PJ7 A;  3S6H A;  3FYN A;  4F0X A;  5F46 A;  4B11 A;  3MRU A;  3V38 A;  3WR7 A;  4AG7 A;  4OLL A;  2OH1 A;  3EO4 A;  3GB0 A;  1ZO0 A;  3IC1 A;  4PXE A;  4A38 A;  1AYE A;  3MN8 A;  4A30 A;  1CG2 A;  4LX9 A;  3LOD A;  5G20 A;  4ZY2 A;  3TO9 A;  1BLL E;  1XMT A;  2I3C A;  5IV0 A;  1IID A;  5DS0 A;  5JQ4 A;  1CPS A;  3FF3 A;  4UWJ A;  2VBQ A;  4UBR A;  3TTH A;  4A95 A;  1VHS A;  1LAN A;  2VI7 A;  2ZOG A;  4C68 A;  1CP7 A;  1VIX A;  3NA6 A;  1S7F A;  3BJ7 A;  1QSM A;  1XJO A;  3P2F A;  1ZG9 A;  4A37 A;  3TE4 A;  1RTQ A;  2VEZ A;  2PJ9 A;  3FH4 A;  3FRM A;  5JM6 A;  1Z5R A;  5G1Z A;  3GLJ A;  2ZEN A;  4F9U A;  3RO0 A;  4E0A A;  1Q2D A;  4JD6 A;  2R7H A;  2Z11 A;  3GY9 A;  4U5Y A;  3KI9 A;  3BXM A;  4NGP A;  2DXQ A;  4QUS A;  2Q7B A;  4DJL A;  2J8M A;  1QMU A;  2PC1 A;  2OOT A;  1YSJ A;  4P4B A;  3HLP A;  1MJ9 A;  3KR4 A;  3RBU A;  3RNZ A;  2FT0 A;  1OBR A;  2CF4 A;  4K30 A;  4XPL A;  4BIN A;  4GS4 A;  2XEI A;  4MHD A;  2OZH A;  4H6U A;  2AFZ A;  3CXP A;  2F5I A;  4OC4 A;  5I0C A;  2QEC A;  2RC4 A;  2Z3L A;  2ZW6 A;  2D4P A;  2OU2 A;  2V8H A;  4MI4 A;  2CIJ A;  1Y9W A;  4PV6 A;  4UIB A;  1M4L A;  1WK4 A;  3KHZ A;  1B87 A;  2O53 A;  2HC9 A;  4PSW A;  4OAD A;  4B14 A;  5HVH A;  4FD6 A;  1ZLH A;  3QB8 A;  3R9F A;  3BJ8 A;  4MFJ A;  2JDC A;  4OC2 A;  4P44 A;  1XMB A;  3PGP A;  5HVF A;  3B3W A;  4XPD C;  2BO9 A;  4X2T A;  2XEF A;  1LRZ A;  4NFR A;  3TOA A;  2ZW7 A;  3FB3 A;  4AVC A;  1CBX A;  3FMC A;  4KLV A;  2WUU A;  4PSX A;  4A31 A;  3LD2 A;  4NGT A;  4P4J A;  2PJ2 A;  4KOU A;  4NGM A;  3D7D A;  1XEB A;  2I00 A;  4CAE A;  3PB8 X;  2CTB A;  3L2N A;  1S60 A;  3RZA A;  4MY3 A;  5G22 A;  5J1Q A;  4B5O A;  1WWZ A;  3FEC A;  5E96 A;  5IB9 A;  3EFA A;  4R76 A;  4W9Y A;  1FT7 A;  4F0Y A;  3R9G A;  3FBU A;  4CGO A;  5LRK A;  2B4D B;  4KZT A;  3W91 A;  5ISV A;  3ISZ A;  3KKW A;  1PCA A;  1ZLI A;  2P6E A;  2Q0Y A;  4R3K A;  1TXR A;  1Z2L A;  2IJZ A;  5J8C A;  1LAM A;  4UFX A;  1Y7R A;  5DWM A;  4FD7 A;  4JWP A;  4A33 A;  2C6P A;  2Z3K A;  3FED A;  4F8Z A;  2RB7 A;  3PBE A;  4M6I A;  1XOV A;  4P4I A;  5CPA A;  2BEI A;  5F48 A;  5LYD A;  1F57 A;  2CNS A;  2CTC A;  4MCR A;  1TKF A;  3IU2 A;  1AUG A;  4P4F A;  4KOS A;  2Z3M A;  2DPT A;  2EO8 A;  5AG5 A;  3SJE A;  4CGM A;  5LYF A;  1UWY A;  3B3V A;  1JWQ A;  1UFH A;  1P0H A;  4M3S A;  1HEE A;  3D2M A;  3RYO A;  3TT2 A;  4NGQ A;  4UIA A;  3SJG A;  3E0K A;  1QSO A;  4OAE A;  4CYQ A;  4DUK A;  4Y49 B;  4NGR A;  1Q2C A;  1Y9K A;  4ZYQ A;  4OC0 A;  4UF4 A;  3BLN A;  2QJ8 A;  4HNW B;  2DF5 A;  4X8I A;  4UFV A;  2J8R A;  4AVB A;  2O4H A;  2FCK A;  1S7K A;  2EK8 A;  2PJ0 A;  2Z3N A;  4QB9 A;  3T9Y A;  4P4D A;  2AFU A;  3F8K A;  5DWN A;  1YLE A;  1VGY A;  4FD4 A;  2FIA A;  1ZG8 A;  4IK2 A;  4UWI A;  4X5K A;  2G0B A;  2HUZ A;  2PIZ A;  3IWW A;  4KSI A;  2FSR A;  1F2P A;  1V0C A;  2AJ6 A;  4C7H A;  2PRB A;  5THW A;  3VWD A;  3H4Q A;  1VKC A;  4PK2 A;  2GU2 A;  4FD5 A;  4IAV A;  4GM5 A;  1FNO A;  3IGR A;  2JBK A;  3N5F A;  3SXO A;  1IIC A;  1LFW A;  2V77 A;  3D66 A;  3DSB A;  1ELL P;  3NH4 A;  4H89 A;  1MJA A;  4XNH B;  4KVO E;  2BL1 A;  3D67 A;  5K8O A;  3KR5 A;  2JEV A;  3B2Y A;  2ZPA A;  4JXR A;  3PRT A;  3PFO A;  4MXU A;  2Q04 A;  1NSA A;  2I79 A;  1X12 A;  4A2Z A;  3TOB A;  4CRZ B;  3PB4 X;  5A27 A;  2NYQ A;  3EC4 A;  2F7V A;  4WJB A;  1LCP A;  3S6G A;  3WC7 A;  2HB6 A;  2GE3 A;  3K9T A;  4AB7 A;  3DR6 A;  2PJ5 A;  4PXB A;  2ODF A;  2R1I A;  4Q38 A;  2Q4Z A;  3TX8 A;  2V8G A;  5ELY A;  2ZXV A;  2AFM A;  4NF1 A;  4QBJ A;  5A28 A;  1I12 A;  3D7F A;  3KQZ A;  5D29 A;  3S6F A;  3D2P A;  3JUW A;  3NH5 A;  3G3S A;  4LQ6 A;  4NGS A;  4XPK A;  1BPN A;  4MBU A;  4TNU A;  4CAV A;  2VQY A;  2C1C A;  1TF8 A;  4MFK A;  1BAV A;  1IB1 E;  2VXK A;  2Y0M A;  4F9V A;  4ZI6 A;  3W6S A;  1ARL A;  1RXT A;  4Q7A A;  1JQG A;  5IB0 A;  3D4U A;  3N7Z A;  3SI0 A;  3TCV A;  2DPS A;  5C88 A;  2PJA A;  3JVN A;  4NEX A;  3S6K A;  1Q7L A;  4BBH A;  3PB7 X;  4G1P A;  2BUE A;  2JDD A;  3B3C A;  3B8G A;  5HXD A;  2CXA A;  2PIY A;  3G8W A;  3H8E A;  4R6T A;  5I4M A;  1F2O A;  2ZW4 A;  3NH8 A;  4MHP A;  3TC8 A;  3FIX A;  1IU8 A;  5LRG A;  2IL4 A;  1KUY A;  2Q4Y A;  3FVL A;  2PJ1 A;  2ZED A;  4AG9 A;  2B3V A;  4K3N A;  1R3N A;  3C26 A;  3KZW A;  1M4D A;  3W6X A;  4MFL A;  4R87 A;  2P6G A;  2PCU A;  3GYA A;  4L89 A;  1Z9U A;  1KWM A;  3CDX A;  4YU9 A;  3ZZI A;  4YFJ A;  4ZY1 A;  1GYT A;  2BOA A;  2AFS A;  3LAC A;  3QAH A;  3VAR A;  4PXD A;  4EVY A;  3B35 A;  4HNY B;  4UA3 A;  2Q7S A;  2WPX A;  3PFE A;  2G9D A;  3I1U A;  3TO6 A;  2PJ6 A;  3T90 A;  1PUA A;  3WAB A;  2PR8 A;  4OID A;  1QSR A;  3ISX A;  2V8V A;  4R7M A;  2GFQ A;  3IWE A;  2B58 A;  4KUB A;  4RUH A;  2B4D A;  2PJ3 A;  2GLF A;  4ORF A;  3EXN A;  4KSF A;  2AFW A;  2YNE A;  4JXQ A;  4PQA A;  3DGV A;  4OC5 A;  1Z8L A;  2WPW A;  4HKF A;  1GHE A;  2ATR A;  1CJW A;  3IWG A;  3R9E A;  4EME A;  2V8D A;  4DYO A;  4EWT A;  5FVJ A;  4X3R A;  3B3S A;  1XE4 A;  4LUA A;  4KOV A;  1YME A;  5K8M A;  4HPS A;  4M85 A;  5C82 A;  5IX3 A;  2IMO A;  2NMT A;  5J8F A;  2PVV A;  1YGH A;  2FXF A;  2Z3P A;  2ZEF A;  2G3T A;  2GIV A;  1YQE A;  3DNS A;  4MHN A;  2PJ4 A;  2ZEG A;  4MCQ A;  4XNH C;  6CPA A;  1FY7 A;  2HQY A;  4F6A A;  3S9L A;  3V8I A;  3D7H A;  4P45 A;  3PZJ A;  4NGN A;  4KOX A;  2EK9 A;  4MJ8 A;  1H8L A;  1HDQ A;  3B3T A;  4CRY B;  3CT9 A;  1L0C A;  4AXV A;  4OKO A;  5H84 A;  1LOK A;  1R57 A;  3PB9 X;  1XF8 A;  1SQH A;  1U6M A;  2ZOF A;  5H86 A;  4UCN A;  1A2Z A;  3H5Z A;  4ZX8 A;  5F47 A;  2Q4V A;  3CZX A;  1KZF A;  2VZY A;  2FS5 A;  4P10 A;  2X7B A;  2F8H A;  4B6Z A;  3KAS A;  3WC6 A;  4DNC A;  1BOB A;  4GXH A;  1YVO A;  2C27 A;  2AFX A;  3EY5 A;  4R3L A;  4JYW A;  3R1K A;  4RS2 A;  4B10 A;  1DE4 C;  4OP4 A;  1YK3 A;  2K5T A;  4II9 A;  4MCS A;  4KOY A;  1X10 A;  4E2A A;  2QYV A;  4KVM E;  4CYN A;  1BO4 A;  1QST A;  3FEE A;  2EWB A;  1S3Z A;  4MHZ A;  2H5M A;  4UCM A;  4ZX9 A;  3VH9 A;  2XEG A;  2ABZ A;  1Y0R A;  3H8F A;  4PK3 A;  1ON0 A;  1PYT B;  4B12 A;  5K8P A;  4JLY A;  2EUI A;  5G21 A;  4O23 A;  5JH9 A;  4CS0 B;  4OC1 A;  4C2Z A;  2B4B A;  3R96 A;  3SHP A;  4BD9 A;  3TFY A;  2CNM A;  1XRY A;  1QSN A;  2ZEH A;  5JPH A;  4ONW A;  1J4J A;  3GIU A;  2A4N A;  4C7I A;  1M44 A;  5LYI A;  4OC3 A;  3DDD A;  4FBE A;  5K8N A;  2POK A;  3IO1 A;  4MMO A;  4B13 A;  5HMN A;  2PR1 A;  2JBJ A;  3CXS A;  4MCP A;  1PU9 A;  2OZG A;  4EFD A;  4FUU A;  2R98 A;  4UEE A;  2EVN A;  1EE3 P;  3F5B A;  3D8P A;  4KOW A;  3JTK A;  4P4E A;  3ZJ0 A;  4FAI A;  1ARM A;  3RAM A;  3SI1 A;  1YX0 A;  3BI1 A;  3LMS A;  4ZY0 A;  1S7L A;  4CAX A;  2FVG A;  3SXN A;  3B7I A;  1MJB A;  4L8A A;  3KQX A;  2PJ8 A;  2WYR A;  2BSW A;  2IQ6 A;  5LRJ A;  4IF5 A;  3S9M A;  2OZU A;  5GCN A;  4CPA A;  2ZEP A;  2XEJ A;  3PB6 X;  3OWC A;  1M1D A;  4HNX B;  4I49 A;  4Q36 A;  2G3A A;  4WWV A;  2Q43 A;  4AVA A;  4BMH A;  4NJQ A;  4RN7 A;  3A9L A;  1VHE A;  4MFQ A;  3NFZ A;  8CPA A;  1VHO A;  1QQ9 A;  5BWA B;  1CM0 A;  1KUV A;  3JRU A;  3I9S A;  4M6G A;  2NSM A;  3IJ3 A;  1IYK A;  1XIX A;  3DR8 A;  4ZGY B;  2REF A;  5F09 A;  2FL4 A;  1IOF A;  5KTD A;  2YNC A;  7CPA A;  4KOR A;  4PPZ A;  1P4N A;  3CPA A;  2Q44 A;  2WZN A;  4UEF A;  2YND A;  5EC4 A;  4KSA A;  3DLJ A;  1I21 A;  1M4G A;  4ONU A;  5AG4 A;  5JGF A;  4ZBG A;  2C6G A;  4KUA A;  4A94 A;  1TKJ A;  4NCZ A;  4OIW A;  2J9A A;  2ZEM A;  1Z8X A; 
#chains in the Genus database with same CATH homology
 2GAN A;  4IUS A;  2FIW A;  1RO5 A;  5HH1 A;  4MY0 A;  4Y49 C;  2AE6 A;  2PDO A;  2P0W A;  3P2H A;  4U9Y A;  2O28 A;  4RI1 A;  4CAF A;  3NE7 A;  2Z3O A;  1S5K A;  2HV2 A;  2B5G A;  4UFW A;  4R9M A;  4KVX A;  1KUX A;  3FXT A;  1OZP A;  4QC6 A;  2QIR A;  2B5G B;  2B3U A;  1TIQ A;  1NE9 A;  4MFZ A;  3PP9 A;  4UCP A;  4CYO A;  4NSQ A;  3UY5 A;  1Z4E A;  2Z0Z A;  2CY2 A;  5AG7 A;  5KTA A;  4CGP A;  3MGD A;  4YGO A;  5AGE A;  2WSA A;  5EBV A;  1NSL A;  5KTC A;  1Q2Y A;  3IU1 A;  1YRE A;  4YRH A;  5F49 A;  3D3S A;  4CGN A;  4MFP A;  1YR0 A;  4QVT A;  2OB0 A;  4JJX A;  4NXY A;  2ARH A;  1YVK A;  4B5P A;  4KOT A;  4CAW A;  2JLM A;  2CNT A;  2REE A;  4E8O A;  4C2X A;  2ZW5 A;  3F0A A;  1B6B A;  1S7N A;  2P6F A;  4B5P B;  4CGL A;  2FE7 A;  1Z4R A;  1MK4 A;  2J8N A;  2Z10 A;  1IYL A;  4XPD B;  4U9Z A;  2YGW A;  3FNC A;  4KLW A;  3GKR A;  5CNP A;  4KS9 A;  1I1D A;  2PQ8 A;  3I3G A;  4CYP A;  2PSW A;  4H6Z A;  3VWE A;  3K9U A;  1K4J A;  4C2Y A;  2QML A;  2R8V A;  4A32 A;  1NMT A;  3TO7 A;  1N71 A;  3CXQ A;  2KCW A;  2D4O A;  4J3G A;  2VZZ A;  1M4I A;  3R95 A;  5AG6 A;  2YNC C;  4R57 A;  3S6H A;  5F46 A;  3FYN A;  4F0X A;  4B11 A;  3WR7 A;  4AG7 A;  4OLL A;  2OH1 A;  3EO4 A;  1ZO0 A;  4A30 A;  4LX9 A;  3LOD A;  5G20 A;  3TO9 A;  1XMT A;  5IV0 A;  1IID A;  5JQ4 A;  4UWJ A;  2VBQ A;  4UBR A;  3TTH A;  4A95 A;  1VHS A;  2VI7 A;  4C68 A;  1S7F A;  3BJ7 A;  1QSM A;  3P2F A;  3TE4 A;  2VEZ A;  3FRM A;  5G1Z A;  4E0A A;  1Q2D A;  4JD6 A;  2R7H A;  2Z11 A;  3GY9 A;  4U5Y A;  2DXQ A;  4QUS A;  2Q7B A;  2J8M A;  2PC1 A;  1MJ9 A;  2FT0 A;  4XPL A;  4K30 A;  4GS4 A;  4MHD A;  2OZH A;  4H6U A;  3CXP A;  2F5I A;  5I0C A;  2QEC A;  2RC4 A;  2Z3L A;  2ZW6 A;  2D4P A;  2OU2 A;  4MI4 A;  1Y9W A;  4PV6 A;  1WK4 A;  1B87 A;  4PSW A;  4OAD A;  4B14 A;  4FD6 A;  3QB8 A;  3R9F A;  3BJ8 A;  4MFJ A;  2JDC A;  3PGP A;  4XPD C;  1LRZ A;  3TOA A;  2ZW7 A;  3FB3 A;  4AVC A;  4KLV A;  2WUU A;  4PSX A;  4A31 A;  3LD2 A;  4KOU A;  1XEB A;  2I00 A;  4CAE A;  1S60 A;  4MY3 A;  5G22 A;  4B5O A;  1WWZ A;  5E96 A;  3EFA A;  4F0Y A;  3R9G A;  3FBU A;  4CGO A;  2B4D B;  4KZT A;  3W91 A;  5ISV A;  3KKW A;  2P6E A;  4R3K A;  2Q0Y A;  5J8C A;  4UFX A;  1Y7R A;  5DWM A;  4FD7 A;  4JWP A;  4A33 A;  2Z3K A;  5F48 A;  2BEI A;  2CNS A;  3IU2 A;  4KOS A;  2Z3M A;  2DPT A;  5AG5 A;  4CGM A;  1UFH A;  1P0H A;  4M3S A;  3D2M A;  3RYO A;  3TT2 A;  3E0K A;  1QSO A;  4OAE A;  4CYQ A;  4Y49 B;  1Y9K A;  1Q2C A;  3BLN A;  4HNW B;  4UFV A;  2J8R A;  4AVB A;  2FCK A;  1S7K A;  4QB9 A;  2Z3N A;  3T9Y A;  3F8K A;  5DWN A;  1YLE A;  4FD4 A;  2FIA A;  4UWI A;  4X5K A;  2G0B A;  2HUZ A;  2FSR A;  4C7H A;  1V0C A;  2AJ6 A;  2PRB A;  3VWD A;  3H4Q A;  1VKC A;  4PK2 A;  4FD5 A;  3IGR A;  3SXO A;  1IIC A;  3DSB A;  4H89 A;  1MJA A;  4XNH B;  4KVO E;  2BL1 A;  2JEV A;  2ZPA A;  4JXR A;  2Q04 A;  2I79 A;  4A2Z A;  3TOB A;  4CRZ B;  5A27 A;  3EC4 A;  3S6G A;  4AB7 A;  2GE3 A;  3DR6 A;  2R1I A;  4Q38 A;  2ZXV A;  4NF1 A;  4QBJ A;  5A28 A;  1I12 A;  3S6F A;  3D2P A;  3JUW A;  3G3S A;  4XPK A;  4MBU A;  4CAV A;  2VQY A;  4MFK A;  1IB1 E;  2VXK A;  2Y0M A;  3W6S A;  1RXT A;  5IB0 A;  3N7Z A;  3TCV A;  2DPS A;  5C88 A;  3JVN A;  4NEX A;  3S6K A;  4BBH A;  2BUE A;  3B8G A;  2JDD A;  2CXA A;  3G8W A;  2ZW4 A;  3FIX A;  2IL4 A;  1KUY A;  2Q4Y A;  4AG9 A;  2B3V A;  3C26 A;  1M4D A;  3W6X A;  4MFL A;  4R87 A;  2P6G A;  3GYA A;  4L89 A;  1Z9U A;  3ZZI A;  4YFJ A;  3QAH A;  4EVY A;  4HNY B;  4UA3 A;  2WPX A;  3TO6 A;  3T90 A;  1PUA A;  2PR8 A;  1QSR A;  3IWE A;  2B58 A;  4KUB A;  2B4D A;  4ORF A;  3EXN A;  4KSF A;  2YNE A;  4JXQ A;  2WPW A;  4HKF A;  1GHE A;  2ATR A;  1CJW A;  3IWG A;  3R9E A;  5FVJ A;  1XE4 A;  4LUA A;  4KOV A;  4M85 A;  5C82 A;  5IX3 A;  2NMT A;  5J8F A;  1YGH A;  2FXF A;  2Z3P A;  2G3T A;  2GIV A;  3DNS A;  4XNH C;  1FY7 A;  2HQY A;  4F6A A;  3V8I A;  3PZJ A;  4KOX A;  4MJ8 A;  4CRY B;  1L0C A;  5H84 A;  1R57 A;  1XF8 A;  1SQH A;  1U6M A;  5H86 A;  4UCN A;  3H5Z A;  5F47 A;  2Q4V A;  1KZF A;  2VZY A;  2FS5 A;  2X7B A;  4DNC A;  1BOB A;  1YVO A;  2C27 A;  3EY5 A;  4R3L A;  4RS2 A;  4B10 A;  3R1K A;  1YK3 A;  2K5T A;  4II9 A;  4KOY A;  4E2A A;  4KVM E;  4CYN A;  1BO4 A;  1QST A;  4UCM A;  1S3Z A;  2H5M A;  4PK3 A;  1ON0 A;  4B12 A;  4JLY A;  2EUI A;  5G21 A;  4CS0 B;  4C2Z A;  2B4B A;  3R96 A;  3SHP A;  3TFY A;  2CNM A;  1QSN A;  5JPH A;  1J4J A;  4C7I A;  2A4N A;  1M44 A;  3DDD A;  5HMN A;  4B13 A;  2PR1 A;  3CXS A;  1PU9 A;  2OZG A;  2R98 A;  2EVN A;  3F5B A;  3D8P A;  4KOW A;  3JTK A;  3ZJ0 A;  1YX0 A;  1S7L A;  4CAX A;  3SXN A;  4L8A A;  1MJB A;  2BSW A;  4IF5 A;  2OZU A;  5GCN A;  3OWC A;  1M1D A;  4HNX B;  4I49 A;  4Q36 A;  2G3A A;  4AVA A;  4BMH A;  3A9L A;  4MFQ A;  5BWA B;  1CM0 A;  1KUV A;  3I9S A;  1IYK A;  1XIX A;  3DR8 A;  4ZGY B;  2REF A;  2FL4 A;  5KTD A;  2YNC A;  4KOR A;  1P4N A;  2Q44 A;  2YND A;  5EC4 A;  4KSA A;  1I21 A;  1M4G A;  4ONU A;  5AG4 A;  4ZBG A;  4KUA A;  4NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...