2QIRA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a and kanamycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
172
Chain Sequence
SVTLRLMTEHDLAMLYEWLNRSHIVEWWARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 50
structure length 172
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2qirA00
1M1DA 1CM0A 2OU2A 2B4DA 1S3ZA 5KTDA 1NMTA 5J8FA 3SXNA 3JVNA 3EC4A 3W91A 4YRHA 5CNPA 1MJ9A 2Q04A 3VWDA 4PV6A 2HUZA 4XPDB 2B5GB 1TIQA 3D3SA 2R1IA 4JD6A 2PC1A 5EC4A 2Z10A 2AJ6A 2VZZA 4U5YA 4JXRA 2FCKA 4R3LA 5C82A 5I0CA 2AE6A 4OAEA 1IB1E 1YLEA 4U9ZA 4CAWA 1KZFA 3ZZIA 3NE7A 2K5TA 2HV2A 4DNCA 3BJ8A 4CRYB 1VKCA 2Q4YA 4MI4A 4AG7A 4YFJA 4LX9A 2PR8A 4ONUA 2B4BA 2BEIA 3W6XA 4MY3A 4KZTA 3R1KA 4L89A 1FY7A 4XPDC 3PGPA 3SXOA 3GY9A 5FVJA 4BMHA 4XPKA 4J3GA 3TFYA 2B3VA 4PK3A 4H6ZA 1NSLA 4QUSA 4MBUA 1YVKA 2OB0A 4KLWA 5ISVA 2PDOA 4MHDA 2CNTA 1S60A 1I21A 4JLYA 1MJAA 4UBRA 5IB0A 2F5IA 2ZW5A 3K9UA 2PSWA 1Q2CA 1S5KA 3T9YA 2Z11A 4R87A 1XMTA 4AG9A 3TTHA 3S6FA 2Q7BA 3TT2A 2HQYA 3BLNA 2FE7A 2B4DB 1NE9A 5IV0A 3IWGA 2G0BA 2D4OA 1Y9WA 1LRZA 4PK2A 1Q2DA 4PSWA 1IYLA 5E96A 2CNMA 4RI1A 3PP9A 4LUAA 4M85A 1QSRA 1R57A 3FRMA 2JDDA 4QVTA 2X7BA 3PZJA 2EUIA 4B5PA 3EY5A 2FIWA 3S6HA 1M4IA 3FBUA 1KUXA 2P6EA 2IL4A 3F8KA 2ZW7A 2VEZA 2VZYA 1V0CA 3TO9A 4GS4A 3W6SA 3D2MA 4KVOE 3DR8A 3LODA 4QBJA 2J8MA 2VXKA 3FIXA 2ARHA 3G3SA 3T90A 2REEA 4L8AA 4K30A 3V8IA 4UWJA 2ZPAA 1P0HA 3R95A 2BL1A 4UWIA 4JJXA 2R98A 2OZGA 4FD4A 4H6UA 3TO7A 4CAXA 4XNHB 4U9YA 2R8VA 4II9A 5DWMA 4KOUA 3CXPA 1WK4A 3N7ZA 3P2HA 2FS5A 1S7NA 1YR0A 2NMTA 1SQHA 2ZXVA 1Z4EA 4NEXA 4CS0B 2ZW6A 3RYOA 4KORA 1M4DA 4AVCA 2CY2A 3CXQA 1YX0A 2P6GA 2PQ8A 4HKFA 1Y7RA 2A4NA 2B5GA 4CRZB 5DWNA 4XPLA 1QSTA 2PR1A 3EFAA 1BOBA 1S7KA 3FYNA 4I49A 5J8CA 4H89A 2GIVA 2QIRA 2EVNA 3D2PA 3OWCA 2GANA 2FT0A 4XNHC 4KLVA 1I12A 3KKWA 1I1DA 5JQ4A 4R57A 4EVYA 1IYKA 5HH1A 2ATRA 2I79A 1Y9KA 5KTCA 3IGRA 2WPWA 4PSXA 1Q2YA 3TE4A 4R3KA 5H86A 3E0KA 4OADA 4F6AA 5IX3A 2BUEA 4MY0A 4KUBA 4OLLA 5KTAA 1P4NA 5F49A 4KOYA 2O28A 1ON0A 1PUAA 1GHEA 2ZW4A 1U6MA 1XE4A 2FXFA 4KUAA 2P6FA 4CAVA 4KOVA 3SHPA 3R9FA 4Y49B 4UA3A 3F5BA 3R9GA 3DNSA 5GCNA 3DSBA 1RXTA 2Q44A 4R9MA 3ZJ0A 2VBQA 5F46A 4ZBGA 2KCWA 1J4JA 1K4JA 2Q0YA 4M3SA 4ORFA 3MGDA 1YVOA 3BJ7A 5C88A 2DXQA 3JUWA 5EBVA 3GYAA 4E8OA 2G3AA 4NF1A 2Q4VA 4NCZA 1BO4A 3LD2A 1YGHA 2P0WA 3GKRA 3I3GA 4QB9A 4FD7A 2B58A 4E2AA 2J8RA 1KUYA 2D4PA 4HNXB 2WPXA 1Z9UA 5F48A 1QSNA 4Y49C 1UFHA 1B6BA 1Z4RA 1OZPA 4KOXA 4F0YA 3FXTA 4HNWB 4KOWA 2CNSA 1M4GA 1QSOA 3F0AA 5H84A 4YGOA 2C27A 4RS2A 2J8NA 3FNCA 2QECA 2QMLA 2G3TA 1VHSA 5HMNA 2FIAA 4KOTA 3WR7A 1S7FA 4NXYA 1L0CA 2FSRA 3FB3A 2PRBA 2VI7A 3TO6A 3S6KA 2JLMA 4KVXA 1IICA 1M44A 5JPHA 4KVME 4AB7A 4QC6A 2JDCA 3S6GA 3G8WA 4E0AA 1QSMA 4X5KA 5F47A 3EXNA 4AVBA 4JWPA 3C26A 4FD6A 1MK4A 4NSQA 1XIXA 3DR6A 3I9SA 3B8GA 2OZUA 1S7LA 3P2FA 4B5PB 2GE3A 2I00A 1YREA 1N71A 3QAHA 1WWZA 3EO4A 2REFA 1IIDA 4AVAA 3DDDA 1PU9A 1B87A 2FL4A 4JXQA 3CXSA 4KOSA 2VQYA 3VWEA 2BSWA 3TCVA 2Y0MA 4HNYB 2OZHA 2R7HA 2B3UA 1YK3A 1MJBA 3TOBA 3D8PA 3R9EA 1XEBA 2OH1A 1CJWA 2RC4A 4IF5A 3TOAA 2Z0ZA 3H4QA 4MJ8A 3R96A 4IUSA 1XF8A 3UY5A 1RO5A 4FD5A 3QB8A 1KUVA 4B5OA 2JEVA 2H5MA
chains in the Genus database with same CATH superfamily
1M1DA 1CM0A 2OU2A 2B4DA 2IMOA 5JH9A 3VATA 1LCPA 1S3ZA 1DTDA 1XMBA 1YSJA 3LACA 1NMTA 4MCQA 3VH9A 5KTDA 1CX8A 4EMEA 4OC2A 5J8FA 2C1CA 3FF3A 3SXNA 4W9YA 5HVGA 3JVNA 3EC4A 2ODFA 2F7VA 4BBHA 1JQGA 3W91A 4M6HA 3GUXA 4YRHA 1VGYA 5CNPA 1MJ9A 2Q04A 3VWDA 4B12A 4PV6A 4DUKA 2HUZA 4XPDB 2B5GB 1LAPA 1TIQA 3D3SA 3SJEA 3KR4A 2PJCA 2R1IA 4P6YA 4JD6A 1PCAA 2PC1A 2Z10A 1LOKA 2F8HA 1GYTA 1AYEA 5EC4A 2AJ6A 3D7FA 2VZZA 4PXBA 4RUHA 4U5YA 4MMOA 4JXRA 1Z2LA 3KASA 4ZY1A 2CXAA 3PBEA 1XOVA 2FCKA 3GB0A 3B3TA 4R3LA 1Y0YA 1Y7EA 4ZY2A 3D7GA 3IU2A 3IWEA 4CGOA 5C82A 5I0CA 2NYQA 3WC5A 2AE6A 2HB6A 2WYRA 4OAEA 1IB1E 3BI0A 2PJ5A 3FECA 5LYIA 5LYFA 1YLEA 4U9ZA 4CAWA 5CBMA 3FJUA 1KZFA 3PRTA 3ZZIA 3NE7A 5LRKA 1CP7A 2K5TA 2HV2A 4DNCA 3BJ8A 2ANPA 4CRYB 2WUUA 1VKCA 2Q4YA 3MN8A 4MI4A 4AG7A 3PB9X 4YFJA 4LX9A 4OC0A 4A31A 3CDXA 2PR8A 2JBJA 2B4BA 3JRUA 2BEIA 4ONUA 3W6XA 4MY3A 3H5ZA 2YNEA 4KZTA 3R1KA 4L89A 1FY7A 1ZLHA 2PRQA 3I1UA 4XPDC 3WC7A 2AFZA 5A28A 1ZG9A 3PGPA 3SXOA 2BOAA 3GY9A 5FVJA 4BMHA 4XPKA 4GM5A 4CGNA 4J3GA 3TFYA 4ONWA 2B3VA 2QYVA 4R8FA 2ZEMA 1X12A 2WZNA 4IHMA 4PK3A 1TXRA 2EWBA 3SI1A 4H6ZA 1NSLA 4QUSA 4MBUA 1YVKA 3WABA 4MHZA 2OB0A 4KLWA 5ISVA 4WWVA 2PDOA 4NFRA 1XJOA 2AFWA 2CNTA 4MHDA 4MHYA 5AG6A 1S60A 1I21A 4JLYA 1MJAA 4UBRA 5IB0A 5JM6A 4B6ZA 1YW6A 1PYTB 2F5IA 2PVVA 4HPSA 2ZW5A 2PJ4A 3JTKA 3K9UA 2PSWA 4OMEA 3KHZA 1Q2CA 1S5KA 4PXEA 4A2ZA 3T9YA 2Z11A 4R87A 2CF4A 1XMTA 4AG9A 3KI9A 3TTHA 4ZGYB 2PJ0A 3S6FA 2Q7BA 3TT2A 2HQYA 3PFEA 4G1PA 4P4EA 3SI2A 3BLNA 4CYPA 4F9UA 2IQ6A 2WSAA 2FE7A 2B4DB 2ZOGA 3RZAA 5BWAB 5AG5A 4MCPA 1ARMA 3NE8A 4FUUA 1NE9A 5IV0A 4ZX8A 3IWGA 2G0BA 3NA6A 7CPAA 2D4OA 1Y9WA 1LRZA 2YNCC 5AG4A 3BXMA 1ZO0A 4PK2A 1Q2DA 3WC6A 4PSWA 1TKFA 2EBJA 2V8DA 1YQEA 3HUVA 4UIBA 1RTQA 2ZELA 1IYLA 2ZEPA 5E96A 1R43A 2CNMA 4RI1A 3B3SA 4FAIA 2JEWA 3PP9A 4LUAA 4UF4A 2YGWA 3LWUA 2PJAA 4M85A 4DJLA 4UEEA 2AFMA 5LYDA 1QSRA 1R57A 4NGTA 3IJ3A 3FMCA 4MFPA 3FRMA 2Z3MA 2JDDA 3FEDA 1CBXA 2G9DA 2X7BA 2XEGA 4QVTA 2DF5A 1DE4C 3IC1A 3PZJA 2EUIA 3KZWA 2PIYA 4B5PA 1VHEA 4K3NA 3EY5A 2FIWA 4IAVA 3S6HA 2OR4A 2ZEFA 1M4IA 3IFEA 4C2ZA 2EO8A 1H8LA 3FBUA 1KUXA 3NH8A 2P6EA 4MHNA 5K8PA 2IL4A 3B3CA 3F8KA 2ZW7A 3BI1A 2VEZA 2VZYA 1V0CA 5G20A 3TO9A 4GS4A 1HEEA 3W6SA 3D2MA 3NH5A 3RBUA 3D7HA 2Z3KA 4KVOE 1HDQA 3DR8A 3FVLA 4JZ0A 1TKHA 3LODA 4QBJA 2J8MA 2VXKA 5G22A 3FIXA 4YWYA 2ARHA 3G3SA 4KS9A 3T90A 2REEA 3B2YA 3SJFA 1Z8LA 3D7DA 4X8IA 4L8AA 4K30A 3V8IA 4UWJA 4UCPA 4P45A 2HC9A 3B35A 2PJ9A 2ZEOA 3VARA 1VHOA 3PEIA 2ZPAA 1P0HA 2EK8A 3R95A 2BL1A 4OKOA 3TX8A 2XEFA 4UWIA 4UFXA 4JJXA 4CYNA 2R98A 4A30A 4MFQA 1NSAA 4NGQA 2OZGA 4CYQA 4A33A 4FD4A 4H6UA 5K8OA 3TO7A 1IOIA 4CAXA 4XNHB 2YNDA 4Q36A 1IOFA 2Q4ZA 2C6PA 2R8VA 4U9YA 5DWMA 4II9A 2Z3PA 2ZEDA 1TKJA 2XEJA 4R76A 1YW4A 4KOUA 2CTBA 3CXPA 2CIJA 1WK4A 3N7ZA 4JYWA 3P2HA 2FS5A 1S7NA 1YR0A 5G21A 2NMTA 1SQHA 2ZXVA 3K2KA 1Z4EA 3FX6A 4NEXA 4CS0B 2ZW6A 4NGNA 4MFJA 3RYOA 4KORA 3NFZA 1M4DA 3KL9A 3PFOA 2Q7SA 4AVCA 5THWA 2CY2A 5HXDA 1CG2A 2PJ3A 3B7IA 3CXQA 1YX0A 2P6GA 1Z8TA 1IGBA 2ZEGA 2PQ8A 2AFUA 4A32A 4HKFA 4RN7A 4X3RA 1Y7RA 2A4NA 5LYLA 3LMSA 4C68A 1FNOA 2B5GA 4CRZB 5DWNA 4Z65A 4XPLA 1QSTA 4KSAA 2PR1A 1ZG7A 4NJQA 3EFAA 4IK2A 1BOBA 2QJ8A 1S7KA 3FYNA 4I49A 5J8CA 5IB9A 4H89A 2V77A 2Z3NA 4OC5A 4MFLA 2GIVA 2QIRA 2Z3LA 4NGSA 2EVNA 3D2PA 3OWCA 3N5FA 5D29A 1OBRA 2GANA 2FT0A 4XNHC 4KLVA 1LAMA 4F9VA 4OC1A 3WT4A 3K9TA 1I12A 4LQ6A 3KKWA 1I1DA 5JQ4A 2PJ7A 4R57A 4EVYA 1BPMA 1IYKA 2PVWA 3PBBA 5HH1A 2ATRA 4B14A 2I79A 1Y9KA 3H8EA 5KTCA 2VL1A 4ZI6A 4P4DA 3IGRA 2WPWA 4PSXA 1Q2YA 2O4HA 3TE4A 4R3KA 4BD9A 5H86A 3E0KA 3IWWA 4OADA 4OC3A 4F6AA 2BUEA 4MY0A 4AXVA 5IX3A 4KUBA 4OLLA 8CPAA 3KR5A 4MCRA 5KTAA 1P4NA 4UEZA 5D8NA 5F49A 4OIDA 4F8ZA 4KOYA 2O28A 1ON0A 2V8HA 4PPZA 1PUAA 1GHEA 2C6CA 2ZW4A 1U6MA 1XE4A 2FXFA 4C2XA 4KUAA 2P6FA 2JBKA 4CAVA 3DGVA 4KOVA 1AMPA 3D67A 3SHPA 3R9FA 4Y49B 4UA3A 5ELYA 3ISZA 2YNCA 3F5BA 4X2TA 3R9GA 4B10A 1F2PA 3DNSA 5AG7A 3DSBA 5GCNA 4C7HA 4A38A 4EFDA 1RXTA 2Q44A 4R9MA 3ZJ0A 3IIBA 2IJZA 2PCUA 4BINA 4UIAA 2ZENA 2VBQA 4C7IA 5F46A 5F09A 3CZXA 1YLOA 4ZBGA 1YMEA 2ABZA 2C6GA 2KCWA 2Z3OA 4M6GA 5JGFA 1J4JA 3DLJA 1K4JA 2Q0YA 4M3SA 3PB7X 3B3WA 4ORFA 3MGDA 1YVOA 3BJ7A 2O53A 5C88A 4OP4A 2ZEHA 1Z8XA 1AUGA 4FBEA 4ZYQA 2DXQA 3CPXA 3JUWA 5EBVA 4PXCA 1QQ9A 3GYAA 4E8OA 4ZY0A 2G3AA 4NGRA 4NF1A 2Q4VA 1XFOA 4NCZA 5CPAA 1BO4A 2GLJA 3PB8X 5HVHA 3LD2A 1YGHA 2P0WA 3GKRA 3I3GA 4H2KA 1Z5RA 1HDUA 4QB9A 3D4UA 3H8FA 2J9AA 4FD7A 2B58A 3KHXA 4E2AA 4ZX9A 4UFWA 4KSFA 2J8RA 1KUYA 1X10A 2D4PA 4HNXB 2WPXA 1Z9UA 1M4LA 2PJ2A 4A39A 3FH4A 5F48A 4B13A 1QSNA 1CPXA 1UFHA 4NGPA 4P44A 3L2NA 4Y49C 5HVFA 3RO0A 2BO9A 1R3NA 1B6BA 4OC4A 4WJBA 1Z4RA 1OZPA 3S9LA 4KOXA 4R7MA 4F0YA 1CPSA 3FXTA 4PQAA 2ZEEA 4HNWB 4KOWA 3V7ZA 1TF9A 2CNSA 2PJ1A 1M4GA 1QSOA 2DPTA 3B3VA 4Q38A 4Q7AA 3F0AA 3SJGA 5H84A 4YGOA 2C27A 4A95A 4RS2A 2ZOFA 2J8NA 2GREA 3H8GA 4F0XA 3FNCA 2RFHA 1TF8A 1LFWA 2PE3A 4MHPA 2QECA 2QMLA 4C2YA 2G3TA 1VHSA 5HMNA 1XBUA 2V8VA 3FEEA 2FIAA 2PIZA 4KOTA 4MRIA 4FWUA 3WR7A 2EK9A 1S7FA 1KWMA 4NXYA 4CGPA 1EE3P 4LQGA 1IU8A 1A2ZA 2AFOA 4EWTA 1L0CA 2FSRA 3FB3A 3CT9A 4MFZA 1VIXA 2DPSA 2PRBA 2Q43A 2VI7A 3TO6A 3S6KA 2OOTA 2JLMA 4KVXA 1IICA 2QVPA 1M44A 4CPAA 4PXDA 5J1QA 3KGQA 5K8MA 4P4FA 2GLFA 4KVME 4AB7A 3D68A 5JPHA 2CTCA 4QC6A 2RB7A 3S9MA 5K8NA 2JDCA 2PJ8A 3RNZA 3S6GA 4B11A 5EMIA 3G8WA 3RAMA 1ELMP 4E0AA 1QSMA 3GIUA 4MFKA 4UFVA 4X5KA 2GFQA 5F47A 3EXNA 4AVBA 3D66A 4JWPA 4M6IA 1FT7A 3C26A 2DEAA 3GLJA 3HLPA 4FD6A 4TWEA 5DS0A 1MK4A 4O23A 1Q7LA 4NSQA 1XIXA 2AFXA 3DR6A 3IO1A 3MRUA 3SJXA 3I9SA 3B8GA 4A37A 2OZUA 1S7LA 1BAVA 2FVGA 3SI0A 3T8WA 5I4MA 1ARLA 2XEIA 4CAEA 3P2FA 1CP6A 1IY7A 4P4BA 4B5PB 1QMUA 3KQXA 2GE3A 2I00A 1YREA 1N71A 3QAHA 1WWZA 3EO4A 4UCMA 2REFA 1IIDA 4AVAA 1ZLIA 3NH4A 1XRYA 3DDDA 2I3CA 4GXHA 1PU9A 1B87A 2GU2A 4OIWA 4TNUA 3CPAA 4YU9A 3ISXA 1JWQA 1BLLE 2FL4A 4NJRA 1UWYA 2PJBA 4JXQA 3CXSA 4KOSA 4CGMA 3TC8A 2VQYA 3VWEA 5A27A 3IU1A 4P4IA 1F57A 3PB4X 2BSWA 3TCVA 2Y0MA 4HNYB 4R6TA 4CYOA 1Z8WA 2OZHA 2PJ6A 2POKA 4MCSA 2R7HA 4MXUA 3BHXA 4NGMA 4UCNA 5LRJA 5LRGA 2B3UA 4P4JA 4P10A 2V8GA 1YK3A 1MJBA 3A9LA 4A94A 3QNVA 3TOBA 5AGEA 4DYOA 3KQZA 3PB6X 3D8PA 3R9EA 4CGLA 3V38A 1LANA 1XEBA 2OH1A 1CJWA 2RC4A 4IF5A 3TOAA 3QAYA 2Z0ZA 1ZG8A 2NSMA 2Q51A 3H4QA 4MJ8A 3R96A 4IUSA 3S9NA 1F2OA 1XF8A 5G1ZA 6CPAA 3UY5A 4KSIA 1RO5A 1Y0RA 1BPNA 4FD5A 4CAFA 2AFSA 1ELLP 3QB8A 1KUVA 4B5OA 2JEVA 2H5MA 3IEHA 2BCOA 4UEFA
chains in the Genus database with same CATH topology
1M1DA 1CM0A 2OU2A 2B4DA 1S3ZA 5KTDA 1NMTA 5J8FA 3SXNA 3JVNA 3EC4A 4BBHA 3W91A 4YRHA 5CNPA 1MJ9A 2Q04A 3VWDA 4B12A 4PV6A 2HUZA 4XPDB 2B5GB 1TIQA 3D3SA 2R1IA 4JD6A 2PC1A 5EC4A 2Z10A 2AJ6A 2VZZA 4U5YA 4JXRA 2CXAA 2FCKA 4R3LA 3IU2A 3IWEA 4CGOA 5C82A 5I0CA 2AE6A 4OAEA 1IB1E 1YLEA 4U9ZA 4CAWA 1KZFA 3ZZIA 3NE7A 2K5TA 2HV2A 4DNCA 3BJ8A 4CRYB 2WUUA 1VKCA 2Q4YA 4MI4A 4AG7A 4YFJA 4LX9A 4A31A 2PR8A 4ONUA 2B4BA 2BEIA 3W6XA 4MY3A 3H5ZA 2YNEA 4KZTA 3R1KA 4L89A 1FY7A 4XPDC 5A28A 3PGPA 3SXOA 3GY9A 5FVJA 4BMHA 4XPKA 4CGNA 4J3GA 3TFYA 2B3VA 4PK3A 4H6ZA 1NSLA 4QUSA 4MBUA 1YVKA 2OB0A 4KLWA 5ISVA 2PDOA 4MHDA 2CNTA 5AG6A 1S60A 1I21A 4JLYA 1MJAA 4UBRA 5IB0A 2F5IA 2ZW5A 3JTKA 3K9UA 2PSWA 1Q2CA 1S5KA 4A2ZA 3T9YA 2Z11A 4R87A 1XMTA 4AG9A 4ZGYB 3TTHA 3S6FA 2Q7BA 3TT2A 2HQYA 4CYPA 3BLNA 2WSAA 2FE7A 2B4DB 5BWAB 5AG5A 1NE9A 5IV0A 3IWGA 2G0BA 2D4OA 1Y9WA 1LRZA 2YNCC 5AG4A 1ZO0A 4PK2A 1Q2DA 4PSWA 1IYLA 5E96A 2CNMA 4RI1A 3PP9A 4LUAA 2YGWA 4M85A 1QSRA 1R57A 4MFPA 3FRMA 2Z3MA 2JDDA 4QVTA 2X7BA 3PZJA 2EUIA 4B5PA 3EY5A 2FIWA 3S6HA 1M4IA 4C2ZA 3FBUA 1KUXA 2P6EA 2IL4A 3F8KA 2ZW7A 2VEZA 2VZYA 1V0CA 5G20A 3TO9A 4GS4A 3W6SA 3D2MA 2Z3KA 4KVOE 3DR8A 3LODA 4QBJA 2J8MA 2VXKA 5G22A 3FIXA 3G3SA 2ARHA 4KS9A 3T90A 2REEA 4L8AA 4K30A 3V8IA 4UWJA 4UCPA 2ZPAA 1P0HA 3R95A 2BL1A 4UWIA 4UFXA 4JJXA 4CYNA 2R98A 4A30A 4MFQA 2OZGA 4CYQA 4A33A 4FD4A 4H6UA 3TO7A 4CAXA 4XNHB 2YNDA 4Q36A 4U9YA 2R8VA 4II9A 5DWMA 2Z3PA 4KOUA 3CXPA 1WK4A 3N7ZA 3P2HA 2FS5A 1S7NA 1YR0A 5G21A 2NMTA 1SQHA 2ZXVA 1Z4EA 4NEXA 4CS0B 2ZW6A 4MFJA 3RYOA 4KORA 1M4DA 4AVCA 2CY2A 3CXQA 1YX0A 2P6GA 2PQ8A 4A32A 4HKFA 1Y7RA 2A4NA 4C68A 2B5GA 4CRZB 5DWNA 4XPLA 1QSTA 4KSAA 2PR1A 3EFAA 1BOBA 1S7KA 3FYNA 4I49A 5J8CA 4H89A 2Z3NA 4MFLA 2GIVA 2QIRA 2Z3LA 2EVNA 3D2PA 3OWCA 2GANA 2FT0A 4XNHC 4KLVA 1I12A 3KKWA 1I1DA 5JQ4A 4R57A 4EVYA 1IYKA 5HH1A 2ATRA 4B14A 2I79A 1Y9KA 5KTCA 3IGRA 2WPWA 4PSXA 1Q2YA 3TE4A 4R3KA 5H86A 3E0KA 4OADA 4F6AA 5IX3A 2BUEA 4MY0A 4KUBA 4OLLA 5KTAA 1P4NA 5F49A 4KOYA 2O28A 1ON0A 1PUAA 1GHEA 2ZW4A 1U6MA 1XE4A 2FXFA 4C2XA 4KUAA 2P6FA 4CAVA 4KOVA 3SHPA 3R9FA 4Y49B 4UA3A 2YNCA 3F5BA 3R9GA 4B10A 3DNSA 5AG7A 5GCNA 3DSBA 4C7HA 1RXTA 2Q44A 4R9MA 3ZJ0A 2VBQA 4C7IA 5F46A 4ZBGA 2Z3OA 2KCWA 1J4JA 1K4JA 2Q0YA 4M3SA 4ORFA 3MGDA 1YVOA 3BJ7A 5C88A 2DXQA 3JUWA 5EBVA 3GYAA 4E8OA 2G3AA 4NF1A 2Q4VA 4NCZA 1BO4A 3LD2A 1YGHA 2P0WA 3GKRA 3I3GA 4QB9A 4FD7A 2B58A 4E2AA 4UFWA 4KSFA 2J8RA 1KUYA 2D4PA 4HNXB 2WPXA 1Z9UA 5F48A 4B13A 1QSNA 4Y49C 1UFHA 1B6BA 1Z4RA 1OZPA 4KOXA 4F0YA 3FXTA 4HNWB 4KOWA 2CNSA 1M4GA 1QSOA 2DPTA 4Q38A 3F0AA 5H84A 4YGOA 2C27A 4A95A 4RS2A 2J8NA 4F0XA 3FNCA 2QECA 2QMLA 4C2YA 2G3TA 1VHSA 5HMNA 2FIAA 4KOTA 3WR7A 1S7FA 4NXYA 4CGPA 1L0CA 2FSRA 3FB3A 4MFZA 2DPSA 2PRBA 2VI7A 3TO6A 3S6KA 2JLMA 4KVXA 1IICA 1M44A 5JPHA 4KVME 4AB7A 4QC6A 2JDCA 4B11A 3S6GA 3G8WA 4E0AA 1QSMA 4MFKA 4UFVA 4X5KA 5F47A 3EXNA 4AVBA 4JWPA 3C26A 4FD6A 1MK4A 4NSQA 1XIXA 3DR6A 3I9SA 3B8GA 2OZUA 1S7LA 4CAEA 3P2FA 4B5PB 2GE3A 2I00A 1YREA 1N71A 3QAHA 1WWZA 3EO4A 4UCMA 2REFA 1IIDA 4AVAA 3DDDA 1PU9A 1B87A 2FL4A 4JXQA 3CXSA 4KOSA 4CGMA 2VQYA 3VWEA 5A27A 3IU1A 2BSWA 3TCVA 2Y0MA 4HNYB 4CYOA 2OZHA 2R7HA 4UCNA 2B3UA 1YK3A 1MJBA 3A9LA 3TOBA 5AGEA 3D8PA 3R9EA 4CGLA 1XEBA 2OH1A 1CJWA 2RC4A 4IF5A 3TOAA 2Z0ZA 3H4QA 4MJ8A 3R96A 4IUSA 1XF8A 5G1ZA 3UY5A 1RO5A 4CAFA 4FD5A 3QB8A 1KUVA 4B5OA 2JEVA 2H5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1D A;  1CM0 A;  2OU2 A;  2B4D A;  1S3Z A;  5KTD A;  1NMT A;  5J8F A;  3SXN A;  3JVN A;  3EC4 A;  3W91 A;  4YRH A;  5CNP A;  1MJ9 A;  2Q04 A;  3VWD A;  4PV6 A;  2HUZ A;  4XPD B;  2B5G B;  1TIQ A;  3D3S A;  2R1I A;  4JD6 A;  2PC1 A;  5EC4 A;  2Z10 A;  2AJ6 A;  2VZZ A;  4U5Y A;  4JXR A;  2FCK A;  4R3L A;  5C82 A;  5I0C A;  2AE6 A;  4OAE A;  1IB1 E;  1YLE A;  4U9Z A;  4CAW A;  1KZF A;  3ZZI A;  3NE7 A;  2K5T A;  2HV2 A;  4DNC A;  3BJ8 A;  4CRY B;  1VKC A;  2Q4Y A;  4MI4 A;  4AG7 A;  4YFJ A;  4LX9 A;  2PR8 A;  4ONU A;  2B4B A;  2BEI A;  3W6X A;  4MY3 A;  4KZT A;  3R1K A;  4L89 A;  1FY7 A;  4XPD C;  3PGP A;  3SXO A;  3GY9 A;  5FVJ A;  4BMH A;  4XPK A;  4J3G A;  3TFY A;  2B3V A;  4PK3 A;  4H6Z A;  1NSL A;  4QUS A;  4MBU A;  1YVK A;  2OB0 A;  4KLW A;  5ISV A;  2PDO A;  4MHD A;  2CNT A;  1S60 A;  1I21 A;  4JLY A;  1MJA A;  4UBR A;  5IB0 A;  2F5I A;  2ZW5 A;  3K9U A;  2PSW A;  1Q2C A;  1S5K A;  3T9Y A;  2Z11 A;  4R87 A;  1XMT A;  4AG9 A;  3TTH A;  3S6F A;  2Q7B A;  3TT2 A;  2HQY A;  3BLN A;  2FE7 A;  2B4D B;  1NE9 A;  5IV0 A;  3IWG A;  2G0B A;  2D4O A;  1Y9W A;  1LRZ A;  4PK2 A;  1Q2D A;  4PSW A;  1IYL A;  5E96 A;  2CNM A;  4RI1 A;  3PP9 A;  4LUA A;  4M85 A;  1QSR A;  1R57 A;  3FRM A;  2JDD A;  4QVT A;  2X7B A;  3PZJ A;  2EUI A;  4B5P A;  3EY5 A;  2FIW A;  3S6H A;  1M4I A;  3FBU A;  1KUX A;  2P6E A;  2IL4 A;  3F8K A;  2ZW7 A;  2VEZ A;  2VZY A;  1V0C A;  3TO9 A;  4GS4 A;  3W6S A;  3D2M A;  4KVO E;  3DR8 A;  3LOD A;  4QBJ A;  2J8M A;  2VXK A;  3FIX A;  2ARH A;  3G3S A;  3T90 A;  2REE A;  4L8A A;  4K30 A;  3V8I A;  4UWJ A;  2ZPA A;  1P0H A;  3R95 A;  2BL1 A;  4UWI A;  4JJX A;  2R98 A;  2OZG A;  4FD4 A;  4H6U A;  3TO7 A;  4CAX A;  4XNH B;  4U9Y A;  2R8V A;  4II9 A;  5DWM A;  4KOU A;  3CXP A;  1WK4 A;  3N7Z A;  3P2H A;  2FS5 A;  1S7N A;  1YR0 A;  2NMT A;  1SQH A;  2ZXV A;  1Z4E A;  4NEX A;  4CS0 B;  2ZW6 A;  3RYO A;  4KOR A;  1M4D A;  4AVC A;  2CY2 A;  3CXQ A;  1YX0 A;  2P6G A;  2PQ8 A;  4HKF A;  1Y7R A;  2A4N A;  2B5G A;  4CRZ B;  5DWN A;  4XPL A;  1QST A;  2PR1 A;  3EFA A;  1BOB A;  1S7K A;  3FYN A;  4I49 A;  5J8C A;  4H89 A;  2GIV A;  2QIR A;  2EVN A;  3D2P A;  3OWC A;  2GAN A;  2FT0 A;  4XNH C;  4KLV A;  1I12 A;  3KKW A;  1I1D A;  5JQ4 A;  4R57 A;  4EVY A;  1IYK A;  5HH1 A;  2ATR A;  2I79 A;  1Y9K A;  5KTC A;  3IGR A;  2WPW A;  4PSX A;  1Q2Y A;  3TE4 A;  4R3K A;  5H86 A;  3E0K A;  4OAD A;  4F6A A;  5IX3 A;  2BUE A;  4MY0 A;  4KUB A;  4OLL A;  5KTA A;  1P4N A;  5F49 A;  4KOY A;  2O28 A;  1ON0 A;  1PUA A;  1GHE A;  2ZW4 A;  1U6M A;  1XE4 A;  2FXF A;  4KUA A;  2P6F A;  4CAV A;  4KOV A;  3SHP A;  3R9F A;  4Y49 B;  4UA3 A;  3F5B A;  3R9G A;  3DNS A;  5GCN A;  3DSB A;  1RXT A;  2Q44 A;  4R9M A;  3ZJ0 A;  2VBQ A;  5F46 A;  4ZBG A;  2KCW A;  1J4J A;  1K4J A;  2Q0Y A;  4M3S A;  4ORF A;  3MGD A;  1YVO A;  3BJ7 A;  5C88 A;  2DXQ A;  3JUW A;  5EBV A;  3GYA A;  4E8O A;  2G3A A;  4NF1 A;  2Q4V A;  4NCZ A;  1BO4 A;  3LD2 A;  1YGH A;  2P0W A;  3GKR A;  3I3G A;  4QB9 A;  4FD7 A;  2B58 A;  4E2A A;  2J8R A;  1KUY A;  2D4P A;  4HNX B;  2WPX A;  1Z9U A;  5F48 A;  1QSN A;  4Y49 C;  1UFH A;  1B6B A;  1Z4R A;  1OZP A;  4KOX A;  4F0Y A;  3FXT A;  4HNW B;  4KOW A;  2CNS A;  1M4G A;  1QSO A;  3F0A A;  5H84 A;  4YGO A;  2C27 A;  4RS2 A;  2J8N A;  3FNC A;  2QEC A;  2QML A;  2G3T A;  1VHS A;  5HMN A;  2FIA A;  4KOT A;  3WR7 A;  1S7F A;  4NXY A;  1L0C A;  2FSR A;  3FB3 A;  2PRB A;  2VI7 A;  3TO6 A;  3S6K A;  2JLM A;  4KVX A;  1IIC A;  1M44 A;  5JPH A;  4KVM E;  4AB7 A;  4QC6 A;  2JDC A;  3S6G A;  3G8W A;  4E0A A;  1QSM A;  4X5K A;  5F47 A;  3EXN A;  4AVB A;  4JWP A;  3C26 A;  4FD6 A;  1MK4 A;  4NSQ A;  1XIX A;  3DR6 A;  3I9S A;  3B8G A;  2OZU A;  1S7L A;  3P2F A;  4B5P B;  2GE3 A;  2I00 A;  1YRE A;  1N71 A;  3QAH A;  1WWZ A;  3EO4 A;  2REF A;  1IID A;  4AVA A;  3DDD A;  1PU9 A;  1B87 A;  2FL4 A;  4JXQ A;  3CXS A;  4KOS A;  2VQY A;  3VWE A;  2BSW A;  3TCV A;  2Y0M A;  4HNY B;  2OZH A;  2R7H A;  2B3U A;  1YK3 A;  1MJB A;  3TOB A;  3D8P A;  3R9E A;  1XEB A;  2OH1 A;  1CJW A;  2RC4 A;  4IF5 A;  3TOA A;  2Z0Z A;  3H4Q A;  4MJ8 A;  3R96 A;  4IUS A;  1XF8 A;  3UY5 A;  1RO5 A;  4FD5 A;  3QB8 A;  1KUV A;  4B5O A;  2JEV A;  2H5M A; 
#chains in the Genus database with same CATH topology
 1M1D A;  1CM0 A;  2OU2 A;  2B4D A;  2IMO A;  5JH9 A;  3VAT A;  1LCP A;  1S3Z A;  1DTD A;  1XMB A;  1YSJ A;  3LAC A;  1NMT A;  4MCQ A;  3VH9 A;  5KTD A;  1CX8 A;  4EME A;  4OC2 A;  5J8F A;  2C1C A;  3FF3 A;  3SXN A;  4W9Y A;  5HVG A;  3JVN A;  3EC4 A;  2ODF A;  2F7V A;  4BBH A;  1JQG A;  3W91 A;  4M6H A;  3GUX A;  4YRH A;  1VGY A;  5CNP A;  1MJ9 A;  2Q04 A;  3VWD A;  4B12 A;  4PV6 A;  4DUK A;  2HUZ A;  4XPD B;  2B5G B;  1LAP A;  1TIQ A;  3D3S A;  3SJE A;  3KR4 A;  2PJC A;  2R1I A;  4P6Y A;  4JD6 A;  1PCA A;  2PC1 A;  2Z10 A;  1LOK A;  2F8H A;  1GYT A;  1AYE A;  5EC4 A;  2AJ6 A;  3D7F A;  2VZZ A;  4PXB A;  4RUH A;  4U5Y A;  4MMO A;  4JXR A;  1Z2L A;  3KAS A;  4ZY1 A;  2CXA A;  3PBE A;  1XOV A;  2FCK A;  3GB0 A;  3B3T A;  4R3L A;  1Y0Y A;  1Y7E A;  4ZY2 A;  3D7G A;  3IU2 A;  3IWE A;  4CGO A;  5C82 A;  5I0C A;  2NYQ A;  3WC5 A;  2AE6 A;  2HB6 A;  2WYR A;  4OAE A;  1IB1 E;  3BI0 A;  2PJ5 A;  3FEC A;  5LYI A;  5LYF A;  1YLE A;  4U9Z A;  4CAW A;  5CBM A;  3FJU A;  1KZF A;  3PRT A;  3ZZI A;  3NE7 A;  5LRK A;  1CP7 A;  2K5T A;  2HV2 A;  4DNC A;  3BJ8 A;  2ANP A;  4CRY B;  2WUU A;  1VKC A;  2Q4Y A;  3MN8 A;  4MI4 A;  4AG7 A;  3PB9 X;  4YFJ A;  4LX9 A;  4OC0 A;  4A31 A;  3CDX A;  2PR8 A;  2JBJ A;  2B4B A;  3JRU A;  2BEI A;  4ONU A;  3W6X A;  4MY3 A;  3H5Z A;  2YNE A;  4KZT A;  3R1K A;  4L89 A;  1FY7 A;  1ZLH A;  2PRQ A;  3I1U A;  4XPD C;  3WC7 A;  2AFZ A;  5A28 A;  1ZG9 A;  3PGP A;  3SXO A;  2BOA A;  3GY9 A;  5FVJ A;  4BMH A;  4XPK A;  4GM5 A;  4CGN A;  4J3G A;  3TFY A;  4ONW A;  2B3V A;  2QYV A;  4R8F A;  2ZEM A;  1X12 A;  2WZN A;  4IHM A;  4PK3 A;  1TXR A;  2EWB A;  3SI1 A;  4H6Z A;  1NSL A;  4QUS A;  4MBU A;  1YVK A;  3WAB A;  4MHZ A;  2OB0 A;  4KLW A;  5ISV A;  4WWV A;  2PDO A;  4NFR A;  1XJO A;  2AFW A;  2CNT A;  4MHD A;  4MHY A;  5AG6 A;  1S60 A;  1I21 A;  4JLY A;  1MJA A;  4UBR A;  5IB0 A;  5JM6 A;  4B6Z A;  1YW6 A;  1PYT B;  2F5I A;  2PVV A;  4HPS A;  2ZW5 A;  2PJ4 A;  3JTK A;  3K9U A;  2PSW A;  4OME A;  3KHZ A;  1Q2C A;  1S5K A;  4PXE A;  4A2Z A;  3T9Y A;  2Z11 A;  4R87 A;  2CF4 A;  1XMT A;  4AG9 A;  3KI9 A;  3TTH A;  4ZGY B;  2PJ0 A;  3S6F A;  2Q7B A;  3TT2 A;  2HQY A;  3PFE A;  4G1P A;  4P4E A;  3SI2 A;  3BLN A;  4CYP A;  4F9U A;  2IQ6 A;  2WSA A;  2FE7 A;  2B4D B;  2ZOG A;  3RZA A;  5BWA B;  5AG5 A;  4MCP A;  1ARM A;  3NE8 A;  4FUU A;  1NE9 A;  5IV0 A;  4ZX8 A;  3IWG A;  2G0B A;  3NA6 A;  7CPA A;  2D4O A;  1Y9W A;  1LRZ A;  2YNC C;  5AG4 A;  3BXM A;  1ZO0 A;  4PK2 A;  1Q2D A;  3WC6 A;  4PSW A;  1TKF A;  2EBJ A;  2V8D A;  1YQE A;  3HUV A;  4UIB A;  1RTQ A;  2ZEL A;  1IYL A;  2ZEP A;  5E96 A;  1R43 A;  2CNM A;  4RI1 A;  3B3S A;  4FAI A;  2JEW A;  3PP9 A;  4LUA A;  4UF4 A;  2YGW A;  3LWU A;  2PJA A;  4M85 A;  4DJL A;  4UEE A;  2AFM A;  5LYD A;  1QSR A;  1R57 A;  4NGT A;  3IJ3 A;  3FMC A;  4MFP A;  3FRM A;  2Z3M A;  2JDD A;  3FED A;  1CBX A;  2G9D A;  2X7B A;  2XEG A;  4QVT A;  2DF5 A;  1DE4 C;  3IC1 A;  3PZJ A;  2EUI A;  3KZW A;  2PIY A;  4B5P A;  1VHE A;  4K3N A;  3EY5 A;  2FIW A;  4IAV A;  3S6H A;  2OR4 A;  2ZEF A;  1M4I A;  3IFE A;  4C2Z A;  2EO8 A;  1H8L A;  3FBU A;  1KUX A;  3NH8 A;  2P6E A;  4MHN A;  5K8P A;  2IL4 A;  3B3C A;  3F8K A;  2ZW7 A;  3BI1 A;  2VEZ A;  2VZY A;  1V0C A;  5G20 A;  3TO9 A;  4GS4 A;  1HEE A;  3W6S A;  3D2M A;  3NH5 A;  3RBU A;  3D7H A;  2Z3K A;  4KVO E;  1HDQ A;  3DR8 A;  3FVL A;  4JZ0 A;  1TKH A;  3LOD A;  4QBJ A;  2J8M A;  2VXK A;  5G22 A;  3FIX A;  4YWY A;  2ARH A;  3G3S A;  4KS9 A;  3T90 A;  2REE A;  3B2Y A;  3SJF A;  1Z8L A;  3D7D A;  4X8I A;  4L8A A;  4K30 A;  3V8I A;  4UWJ A;  4UCP A;  4P45 A;  2HC9 A;  3B35 A;  2PJ9 A;  2ZEO A;  3VAR A;  1VHO A;  3PEI A;  2ZPA A;  1P0H A;  2EK8 A;  3R95 A;  2BL1 A;  4OKO A;  3TX8 A;  2XEF A;  4UWI A;  4UFX A;  4JJX A;  4CYN A;  2R98 A;  4A30 A;  4MFQ A;  1NSA A;  4NGQ A;  2OZG A;  4CYQ A;  4A33 A;  4FD4 A;  4H6U A;  5K8O A;  3TO7 A;  1IOI A;  4CAX A;  4XNH B;  2YND A;  4Q36 A;  1IOF A;  2Q4Z A;  2C6P A;  2R8V A;  4U9Y A;  5DWM A;  4II9 A;  2Z3P A;  2ZED A;  1TKJ A;  2XEJ A;  4R76 A;  1YW4 A;  4KOU A;  2CTB A;  3CXP A;  2CIJ A;  1WK4 A;  3N7Z A;  4JYW A;  3P2H A;  2FS5 A;  1S7N A;  1YR0 A;  5G21 A;  2NMT A;  1SQH A;  2ZXV A;  3K2K A;  1Z4E A;  3FX6 A;  4NEX A;  4CS0 B;  2ZW6 A;  4NGN A;  4MFJ A;  3RYO A;  4KOR A;  3NFZ A;  1M4D A;  3KL9 A;  3PFO A;  2Q7S A;  4AVC A;  5THW A;  2CY2 A;  5HXD A;  1CG2 A;  2PJ3 A;  3B7I A;  3CXQ A;  1YX0 A;  2P6G A;  1Z8T A;  1IGB A;  2ZEG A;  2PQ8 A;  2AFU A;  4A32 A;  4HKF A;  4RN7 A;  4X3R A;  1Y7R A;  2A4N A;  5LYL A;  3LMS A;  4C68 A;  1FNO A;  2B5G A;  4CRZ B;  5DWN A;  4Z65 A;  4XPL A;  1QST A;  4KSA A;  2PR1 A;  1ZG7 A;  4NJQ A;  3EFA A;  4IK2 A;  1BOB A;  2QJ8 A;  1S7K A;  3FYN A;  4I49 A;  5J8C A;  5IB9 A;  4H89 A;  2V77 A;  2Z3N A;  4OC5 A;  4MFL A;  2GIV A;  2QIR A;  2Z3L A;  4NGS A;  2EVN A;  3D2P A;  3OWC A;  3N5F A;  5D29 A;  1OBR A;  2GAN A;  2FT0 A;  4XNH C;  4KLV A;  1LAM A;  4F9V A;  4OC1 A;  3WT4 A;  3K9T A;  1I12 A;  4LQ6 A;  3KKW A;  1I1D A;  5JQ4 A;  2PJ7 A;  4R57 A;  4EVY A;  1BPM A;  1IYK A;  2PVW A;  3PBB A;  5HH1 A;  2ATR A;  4B14 A;  2I79 A;  1Y9K A;  3H8E A;  5KTC A;  2VL1 A;  4ZI6 A;  4P4D A;  3IGR A;  2WPW A;  4PSX A;  1Q2Y A;  2O4H A;  3TE4 A;  4R3K A;  4BD9 A;  5H86 A;  3E0K A;  3IWW A;  4OAD A;  4OC3 A;  4F6A A;  2BUE A;  4MY0 A;  4AXV A;  5IX3 A;  4KUB A;  4OLL A;  8CPA A;  3KR5 A;  4MCR A;  5KTA A;  1P4N A;  4UEZ A;  5D8N A;  5F49 A;  4OID A;  4F8Z A;  4KOY A;  2O28 A;  1ON0 A;  2V8H A;  4PPZ A;  1PUA A;  1GHE A;  2C6C A;  2ZW4 A;  1U6M A;  1XE4 A;  2FXF A;  4C2X A;  4KUA A;  2P6F A;  2JBK A;  4CAV A;  3DGV A;  4KOV A;  1AMP A;  3D67 A;  3SHP A;  3R9F A;  4Y49 B;  4UA3 A;  5ELY A;  3ISZ A;  2YNC A;  3F5B A;  4X2T A;  3R9G A;  4B10 A;  1F2P A;  3DNS A;  5AG7 A;  3DSB A;  5GCN A;  4C7H A;  4A38 A;  4EFD A;  1RXT A;  2Q44 A;  4R9M A;  3ZJ0 A;  3IIB A;  2IJZ A;  2PCU A;  4BIN A;  4UIA A;  2ZEN A;  2VBQ A;  4C7I A;  5F46 A;  5F09 A;  3CZX A;  1YLO A;  4ZBG A;  1YME A;  2ABZ A;  2C6G A;  2KCW A;  2Z3O A;  4M6G A;  5JGF A;  1J4J A;  3DLJ A;  1K4J A;  2Q0Y A;  4M3S A;  3PB7 X;  3B3W A;  4ORF A;  3MGD A;  1YVO A;  3BJ7 A;  2O53 A;  5C88 A;  4OP4 A;  2ZEH A;  1Z8X A;  1AUG A;  4FBE A;  4ZYQ A;  2DXQ A;  3CPX A;  3JUW A;  5EBV A;  4PXC A;  1QQ9 A;  3GYA A;  4E8O A;  4ZY0 A;  2G3A A;  4NGR A;  4NF1 A;  2Q4V A;  1XFO A;  4NCZ A;  5CPA A;  1BO4 A;  2GLJ A;  3PB8 X;  5HVH A;  3LD2 A;  1YGH A;  2P0W A;  3GKR A;  3I3G A;  4H2K A;  1Z5R A;  1HDU A;  4QB9 A;  3D4U A;  3H8F A;  2J9A A;  4FD7 A;  2B58 A;  3KHX A;  4E2A A;  4ZX9 A;  4UFW A;  4KSF A;  2J8R A;  1KUY A;  1X10 A;  2D4P A;  4HNX B;  2WPX A;  1Z9U A;  1M4L A;  2PJ2 A;  4A39 A;  3FH4 A;  5F48 A;  4B13 A;  1QSN A;  1CPX A;  1UFH A;  4NGP A;  4P44 A;  3L2N A;  4Y49 C;  5HVF A;  3RO0 A;  2BO9 A;  1R3N A;  1B6B A;  4OC4 A;  4WJB A;  1Z4R A;  1OZP A;  3S9L A;  4KOX A;  4R7M A;  4F0Y A;  1CPS A;  3FXT A;  4PQA A;  2ZEE A;  4HNW B;  4KOW A;  3V7Z A;  1TF9 A;  2CNS A;  2PJ1 A;  1M4G A;  1QSO A;  2DPT A;  3B3V A;  4Q38 A;  4Q7A A;  3F0A A;  3SJG A;  5H84 A;  4YGO A;  2C27 A;  4A95 A;  4RS2 A;  2ZOF A;  2J8N A;  2GRE A;  3H8G A;  4F0X A;  3FNC A;  2RFH A;  1TF8 A;  1LFW A;  2PE3 A;  4MHP A;  2QEC A;  2QML A;  4C2Y A;  2G3T A;  1VHS A;  5HMN A;  1XBU A;  2V8V A;  3FEE A;  2FIA A;  2PIZ A;  4KOT A;  4MRI A;  4FWU A;  3WR7 A;  2EK9 A;  1S7F A;  1KWM A;  4NXY A;  4CGP A;  1EE3 P;  4LQG A;  1IU8 A;  1A2Z A;  2AFO A;  4EWT A;  1L0C A;  2FSR A;  3FB3 A;  3CT9 A;  4MFZ A;  1VIX A;  2DPS A;  2PRB A;  2Q43 A;  2VI7 A;  3TO6 A;  3S6K A;  2OOT A;  2JLM A;  4KVX A;  1IIC A;  2QVP A;  1M44 A;  4CPA A;  4PXD A;  5J1Q A;  3KGQ A;  5K8M A;  4P4F A;  2GLF A;  4KVM E;  4AB7 A;  3D68 A;  5JPH A;  2CTC A;  4QC6 A;  2RB7 A;  3S9M A;  5K8N A;  2JDC A;  2PJ8 A;  3RNZ A;  3S6G A;  4B11 A;  5EMI A;  3G8W A;  3RAM A;  1ELM P;  4E0A A;  1QSM A;  3GIU A;  4MFK A;  4UFV A;  4X5K A;  2GFQ A;  5F47 A;  3EXN A;  4AVB A;  3D66 A;  4JWP A;  4M6I A;  1FT7 A;  3C26 A;  2DEA A;  3GLJ A;  3HLP A;  4FD6 A;  4TWE A;  5DS0 A;  1MK4 A;  4O23 A;  1Q7L A;  4NSQ A;  1XIX A;  2AFX A;  3DR6 A;  3IO1 A;  3MRU A;  3SJX A;  3I9S A;  3B8G A;  4A37 A;  2OZU A;  1S7L A;  1BAV A;  2FVG A;  3SI0 A;  3T8W A;  5I4M A;  1ARL A;  2XEI A;  4CAE A;  3P2F A;  1CP6 A;  1IY7 A;  4P4B A;  4B5P B;  1QMU A;  3KQX A;  2GE3 A;  2I00 A;  1YRE A;  1N71 A;  3QAH A;  1WWZ A;  3EO4 A;  4UCM A;  2REF A;  1IID A;  4AVA A;  1ZLI A;  3NH4 A;  1XRY A;  3DDD A;  2I3C A;  4GXH A;  1PU9 A;  1B87 A;  2GU2 A;  4OIW A;  4TNU A;  3CPA A;  4YU9 A;  3ISX A;  1JWQ A;  1BLL E;  2FL4 A;  4NJR A;  1UWY A;  2PJB A;  4JXQ A;  3CXS A;  4KOS A;  4CGM A;  3TC8 A;  2VQY A;  3VWE A;  5A27 A;  3IU1 A;  4P4I A;  1F57 A;  3PB4 X;  2BSW A;  3TCV A;  2Y0M A;  4HNY B;  4R6T A;  4CYO A;  1Z8W A;  2OZH A;  2PJ6 A;  2POK A;  4MCS A;  2R7H A;  4MXU A;  3BHX A;  4NGM A;  4UCN A;  5LRJ A;  5LRG A;  2B3U A;  4P4J A;  4P10 A;  2V8G A;  1YK3 A;  1MJB A;  3A9L A;  4A94 A;  3QNV A;  3TOB A;  5AGE A;  4DYO A;  3KQZ A;  3PB6 X;  3D8P A;  3R9E A;  4CGL A;  3V38 A;  1LAN A;  1XEB A;  2OH1 A;  1CJW A;  2RC4 A;  4IF5 A;  3TOA A;  3QAY A;  2Z0Z A;  1ZG8 A;  2NSM A;  2Q51 A;  3H4Q A;  4MJ8 A;  3R96 A;  4IUS A;  3S9N A;  1F2O A;  1XF8 A;  5G1Z A;  6CPA A;  3UY5 A;  4KSI A;  1RO5 A;  1Y0R A;  1BPN A;  4FD5 A;  4CAF A;  2AFS A;  1ELL P;  3QB8 A;  1KUV A;  4B5O A;  2JEV A;  2H5M A;  3IEH A;  2BCO A;  4UEF A; 
#chains in the Genus database with same CATH homology
 1M1D A;  1CM0 A;  2OU2 A;  2B4D A;  1S3Z A;  5KTD A;  1NMT A;  5J8F A;  3SXN A;  3JVN A;  3EC4 A;  4BBH A;  3W91 A;  4YRH A;  5CNP A;  1MJ9 A;  2Q04 A;  3VWD A;  4B12 A;  4PV6 A;  2HUZ A;  4XPD B;  2B5G B;  1TIQ A;  3D3S A;  2R1I A;  4JD6 A;  2PC1 A;  5EC4 A;  2Z10 A;  2AJ6 A;  2VZZ A;  4U5Y A;  4JXR A;  2CXA A;  2FCK A;  4R3L A;  3IU2 A;  3IWE A;  4CGO A;  5C82 A;  5I0C A;  2AE6 A;  4OAE A;  1IB1 E;  1YLE A;  4U9Z A;  4CAW A;  1KZF A;  3ZZI A;  3NE7 A;  2K5T A;  2HV2 A;  4DNC A;  3BJ8 A;  4CRY B;  2WUU A;  1VKC A;  2Q4Y A;  4MI4 A;  4AG7 A;  4YFJ A;  4LX9 A;  4A31 A;  2PR8 A;  4ONU A;  2B4B A;  2BEI A;  3W6X A;  4MY3 A;  3H5Z A;  2YNE A;  4KZT A;  3R1K A;  4L89 A;  1FY7 A;  4XPD C;  5A28 A;  3PGP A;  3SXO A;  3GY9 A;  5FVJ A;  4BMH A;  4XPK A;  4CGN A;  4J3G A;  3TFY A;  2B3V A;  4PK3 A;  4H6Z A;  1NSL A;  4QUS A;  4MBU A;  1YVK A;  2OB0 A;  4KLW A;  5ISV A;  2PDO A;  4MHD A;  2CNT A;  5AG6 A;  1S60 A;  1I21 A;  4JLY A;  1MJA A;  4UBR A;  5IB0 A;  2F5I A;  2ZW5 A;  3JTK A;  3K9U A;  2PSW A;  1Q2C A;  1S5K A;  4A2Z A;  3T9Y A;  2Z11 A;  4R87 A;  1XMT A;  4AG9 A;  4ZGY B;  3TTH A;  3S6F A;  2Q7B A;  3TT2 A;  2HQY A;  4CYP A;  3BLN A;  2WSA A;  2FE7 A;  2B4D B;  5BWA B;  5AG5 A;  1NE9 A;  5IV0 A;  3IWG A;  2G0B A;  2D4O A;  1Y9W A;  1LRZ A;  2YNC C;  5AG4 A;  1ZO0 A;  4PK2 A;  1Q2D A;  4PSW A;  1IYL A;  5E96 A;  2CNM A;  4RI1 A;  3PP9 A;  4LUA A;  2YGW A;  4M85 A;  1QSR A;  1R57 A;  4MFP A;  3FRM A;  2Z3M A;  2JDD A;  4QVT A;  2X7B A;  3PZJ A;  2EUI A;  4B5P A;  3EY5 A;  2FIW A;  3S6H A;  1M4I A;  4C2Z A;  3FBU A;  1KUX A;  2P6E A;  2IL4 A;  3F8K A;  2ZW7 A;  2VEZ A;  2VZY A;  1V0C A;  5G20 A;  3TO9 A;  4GS4 A;  3W6S A;  3D2M A;  2Z3K A;  4KVO E;  3DR8 A;  3LOD A;  4QBJ A;  2J8M A;  2VXK A;  5G22 A;  3FIX A;  3G3S A;  2ARH A;  4KS9 A;  3T90 A;  2REE A;  4L8A A;  4K30 A;  3V8I A;  4UWJ A;  4UCP A;  2ZPA A;  1P0H A;  3R95 A;  2BL1 A;  4UWI A;  4UFX A;  4JJX A;  4CYN A;  2R98 A;  4A30 A;  4MFQ A;  2OZG A;  4CYQ A;  4A33 A;  4FD4 A;  4H6U A;  3TO7 A;  4CAX A;  4XNH B;  2YND A;  4Q36 A;  4U9Y A;  2R8V A;  4II9 A;  5DWM A;  2Z3P A;  4KOU A;  3CXP A;  1WK4 A;  3N7Z A;  3P2H A;  2FS5 A;  1S7N A;  1YR0 A;  5G21 A;  2NMT A;  1SQH A;  2ZXV A;  1Z4E A;  4NEX A;  4CS0 B;  2ZW6 A;  4MFJ A;  3RYO A;  4KOR A;  1M4D A;  4AVC A;  2CY2 A;  3CXQ A;  1YX0 A;  2P6G A;  2PQ8 A;  4A32 A;  4HKF A;  1Y7R A;  2A4N A;  4C68 A;  2B5G A;  4CRZ B;  5DWN A;  4XPL A;  1QST A;  4KSA A;  2PR1 A;  3EFA A;  1BOB A;  1S7K A;  3FYN A;  4I49 A;  5J8C A;  4H89 A;  2Z3N A;  4MFL A;  2GIV A;  2QIR A;  2Z3L A;  2EVN A;  3D2P A;  3OWC A;  2GAN A;  2FT0 A;  4XNH C;  4KLV A;  1I12 A;  3KKW A;  1I1D A;  5JQ4 A;  4R57 A;  4EVY A;  1IYK A;  5HH1 A;  2ATR A;  4B14 A;  2I79 A;  1Y9K A;  5KTC A;  3IGR A;  2WPW A;  4PSX A;  1Q2Y A;  3TE4 A;  4R3K A;  5H86 A;  3E0K A;  4OAD A;  4F6A A;  5IX3 A;  2BUE A;  4MY0 A;  4KUB A;  4OLL A;  5KTA A;  1P4N A;  5F49 A;  4KOY A;  2O28 A;  1ON0 A;  1PUA A;  1GHE A;  2ZW4 A;  1U6M A;  1XE4 A;  2FXF A;  4C2X A;  4KUA A;  2P6F A;  4CAV A;  4KOV A;  3SHP A;  3R9F A;  4Y49 B;  4UA3 A;  2YNC A;  3F5B A;  3R9G A;  4B10 A;  3DNS A;  5AG7 A;  5GCN A;  3DSB A;  4C7H A;  1RXT A;  2Q44 A;  4R9M A;  3ZJ0 A;  2VBQ A;  4C7I A;  5F46 A;  4ZBG A;  2Z3O A;  2KCW A;  1J4J A;  1K4J A;  2Q0Y A;  4M3S A;  4ORF A;  3MGD A;  1YVO A;  3BJ7 A;  5C88 A;  2DXQ A;  3JUW A;  5EBV A;  3GYA A;  4E8O A;  2G3A A;  4NF1 A;  2Q4V A;  4NCZ A;  1BO4 A;  3LD2 A;  1YGH A;  2P0W A;  3GKR A;  3I3G A;  4QB9 A;  4FD7 A;  2B58 A;  4E2A A;  4UFW A;  4KSF A;  2J8R A;  1KUY A;  2D4P A;  4HNX B;  2WPX A;  1Z9U A;  5F48 A;  4B13 A;  1QSN A;  4Y49 C;  1UFH A;  1B6B A;  1Z4R A;  1OZP A;  4KOX A;  4F0Y A;  3FXT A;  4HNW B;  4KOW A;  2CNS A;  1M4G A;  1QSO A;  2DPT A;  4Q38 A;  3F0A A;  5H84 A;  4YGO A;  2C27 A;  4A95 A;  4RS2 A;  2J8N A;  4F0X A;  3FNC A;  2QEC A;  2QML A;  4C2Y A;  2G3T A;  1VHS A;  5HMN A;  2FIA A;  4KOT A;  3WR7 A;  1S7F A;  4NXY A;  4CGP A;  1L0C A;  2FSR A;  3FB3 A;  4MFZ A;  2DPS A;  2PRB A;  2VI7 A;  3TO6 A;  3S6K A;  2JLM A;  4KVX A;  1IIC A;  1M44 A;  5JPH A;  4KVM E;  4AB7 A;  4QC6 A;  2JDC A;  4B11 A;  3S6G A;  3G8W A;  4E0A A;  1QSM A;  4MFK A;  4UFV A;  4X5K A;  5F47 A;  3EXN A;  4AVB A;  4JWP A;  3C26 A;  4FD6 A;  1MK4 A;  4NSQ A;  1XIX A;  3DR6 A;  3I9S A;  3B8G A;  2OZU A;  1S7L A;  4CAE A;  3P2F A;  4B5P B;  2GE3 A;  2I00 A;  1YRE A;  1N71 A;  3QAH A;  1WWZ A;  3EO4 A;  4UCM A;  2REF A;  1IID A;  4AVA A;  3DDD A;  1PU9 A;  1B87 A;  2FL4 A;  4JXQ A;  3CXS A;  4KOS A;  4CGM A;  2VQY A;  3VWE A;  5A27 A;  3IU1 A;  2BSW A;  3TCV A;  2Y0M A;  4HNY B;  4CYO A;  2OZH A;  2R7H A;  4UCN A;  2B3U A;  1YK3 A;  1MJB A;  3A9L A;  3TOB A;  5AGE A;  3D8P A;  3R9E A;  4CGL A;  1XEB A;  2OH1 A;  1CJW A;  2RC4 A;  4IF5 A;  3TOA A;  2Z0Z A;  3H4Q A;  4MJ8 A;  3R96 A;  4IUS A;  1XF8 A;  5G1Z A;  3UY5 A;  1RO5 A;  4CAF A;  4FD5 A;  3QB8 A;  1KUV A;  4B5O A;  2JEV A;  2H5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...