2QIRA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a and kanamycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
172
Chain Sequence
SVTLRLMTEHDLAMLYEWLNRSHIVEWWARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 172
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2qirA00
3QAHA 4Y49C 3OWCA 1YLEA 3NE7A 5DWNA 2ZW5A 2OB0A 4H6ZA 3EXNA 3R9FA 3W91A 2FSRA 5J8FA 4OLLA 3SHPA 5KTAA 3SXNA 3D8PA 3EO4A 3FNCA 4JXRA 2EVNA 3F5BA 1MJAA 4UWJA 4OAEA 1K4JA 4NEXA 4AVAA 2VZYA 4FD6A 4KOXA 3DR6A 2VEZA 2P0WA 1KZFA 1M44A 2R8VA 1BO4A 4MY0A 3ZJ0A 4R3LA 3I3GA 1QSMA 4E0AA 2ZW7A 1Q2DA 3JVNA 4R87A 1TIQA 2CNTA 3P2FA 4H89A 3LD2A 2Q04A 4YRHA 5IX3A 4ZBGA 2BEIA 4UA3A 2HUZA 2VZZA 4JLYA 1I21A 1Y9WA 1LRZA 2EUIA 4PSWA 4K30A 1B87A 1Q2CA 2H5MA 2RC4A 1CJWA 3TTHA 1M4DA 4MBUA 3UY5A 1P0HA 1P4NA 3FB3A 4J3GA 2B58A 1S60A 4NSQA 3FRMA 5CNPA 3D2PA 4QBJA 1S7NA 4MJ8A 4X5KA 4U5YA 5ISVA 3DR8A 1Q2YA 5IV0A 4M3SA 4L8AA 1WK4A 3F0AA 3R95A 5C88A 3R9GA 4U9YA 2J8NA 5HH1A 3IWGA 3QB8A 4FD4A 3TT2A 3D2MA 2K5TA 2Z0ZA 1XE4A 5JPHA 3DDDA 2DXQA 1Z9UA 2FL4A 2IL4A 2D4PA 5E96A 2Z10A 3TOBA 4E8OA 5C82A 2JDCA 1RXTA 4QB9A 3KKWA 4AVBA 3F8KA 1U6MA 4Y49B 4E2AA 2JDDA 2VQYA 1QSTA 4QVTA 5IB0A 3N7ZA 3FBUA 2VI7A 2VBQA 1ON0A 1KUYA 5H84A 3TO6A 3FIXA 2BL1A 1MK4A 2ZW6A 1SQHA 3GY9A 2FE7A 4KLWA 2HQYA 1Z4EA 3W6XA 5H86A 5EC4A 3RYOA 4QC6A 3PZJA 3S6GA 1S7LA 4KZTA 2Q44A 3TE4A 4AVCA 4KOYA 2CY2A 4BMHA 3FXTA 3K9UA 2PR1A 2OU2A 1YGHA 1PUAA 2REFA 2ARHA 1M1DA 2F5IA 4KVME 2J8MA 4UBRA 4CS0B 1CM0A 2PQ8A 5HMNA 4KOSA 3G3SA 2PSWA 4PV6A 3T90A 2NMTA 4II9A 1YREA 2R98A 1Y7RA 2OZUA 4CRYB 4H6UA 2PC1A 4AB7A 1IICA 2VXKA 4PK3A 4RS2A 4XPDB 5DWMA 4KVOE 2GE3A 4R3KA 1GHEA 2Q0YA 2KCWA 1IYLA 4B5PA 1L0CA 1Z4RA 3I9SA 1WWZA 2P6FA 1QSRA 4HNWB 1V0CA 2X7BA 2FIWA 4MI4A 5F46A 3VWDA 4JWPA 1PU9A 3BJ8A 3CXPA 1QSOA 2Q4YA 1S7FA 5F47A 4LX9A 1Y9KA 2PRBA 4XNHC 3S6HA 4EVYA 2JEVA 4L89A 2Q4VA 4XPLA 4U9ZA 1BOBA 4KLVA 5KTDA 1NE9A 2FT0A 4R57A 4DNCA 1MJBA 4KOUA 4KVXA 4QUSA 4KORA 4XPKA 3PP9A 4CRZB 1FY7A 2AJ6A 2Q7BA 4NXYA 3P2HA 2REEA 4NCZA 1NSLA 4KOVA 1YVOA 5EBVA 3WR7A 2D4OA 1M4GA 3EC4A 4M85A 2R1IA 4FD7A 1S5KA 4F0YA 1RO5A 5F49A 3R9EA 2B5GA 2CNMA 2PR8A 2FIAA 1QSNA 4B5PB 1KUVA 1MJ9A 4B5OA 1YVKA 2B3VA 5JQ4A 4LUAA 4AG9A 4OADA 3ZZIA 1KUXA 4HKFA 2P6GA 2GANA 3B8GA 1I12A 3JUWA 3CXQA 3TO7A 2B4DA 4JD6A 5GCNA 4ONUA 2OZHA 1XIXA 3D3SA 3FYNA 4JJXA 3IGRA 3G8WA 2I00A 4IF5A 2Y0MA 3V8IA 2A4NA 4PK2A 2FCKA 3CXSA 2B4BA 2FXFA 4KOWA 4KUAA 1J4JA 2I79A 2HV2A 2ATRA 5F48A 4I49A 5J8CA 4KOTA 2ZXVA 3TCVA 3TO9A 1YR0A 1I1DA 2B5GB 1S7KA 4KUBA 1N71A 2GIVA 1XEBA 2QECA 4CAVA 2PDOA 3R1KA 1B6BA 3W6SA 4MHDA 3H4QA 1OZPA 1VHSA 1YK3A 2QIRA 3LODA 2BSWA 2G3AA 1M4IA 4XPDC 1IB1E 2R7HA 2B3UA 2B4DB 4ORFA 4IUSA 2Z11A 3C26A 3TOAA 1R57A 4GS4A 4RI1A 3E0KA 2AE6A 4HNYB 2WPWA 3S6FA 4PSXA 5I0CA 2QMLA 2OZGA 2BUEA 5FVJA 4XNHB 2C27A 2ZW4A 4JXQA 1S3ZA 2FS5A 1XMTA 3EY5A 3BJ7A 2CNSA 4CAXA 3TFYA 3GKRA 4UWIA 4R9MA 4HNXB 4F6AA 4YGOA 1IYKA 3MGDA 3VWEA 4NF1A 2ZPAA 3R96A 1VKCA 4FD5A 2JLMA 3BLNA 5KTCA 3DNSA 3GYAA 1XF8A 2P6EA 4MY3A 3DSBA 3T9YA 1IIDA 3S6KA 4YFJA 4CAWA 1UFHA 4AG7A 1YX0A 2OH1A 3PGPA 2WPXA 3EFAA 2G3TA 2O28A 2G0BA 1NMTA 3SXOA 2J8RA
chains in the Genus database with same CATH superfamily
1A2ZA 4F0XA 3QAHA 4Q38A 3I1UA 4Y49C 3OWCA 5JM6A 5AG7A 2AFMA 3BI1A 1YLEA 4M6IA 4P6YA 1VHOA 1LANA 2FVGA 4P4JA 1LAPA 3NE7A 3IJ3A 5DWNA 2ZW5A 2YNCC 2OB0A 3RAMA 4H6ZA 3EXNA 3R9FA 3W91A 5K8MA 2FSRA 2ANPA 4P45A 5J8FA 4W9YA 4A2ZA 3D66A 4OLLA 1X10A 3SHPA 3B3CA 3NA6A 4C7HA 3IIBA 4DYOA 2XEGA 4MFZA 4ZI6A 1YSJA 4TNUA 4K3NA 4CYOA 5KTAA 2PIZA 3PB8X 1Z8XA 4MFJA 3SXNA 3D8PA 2PJBA 3RBUA 2PJ3A 2EO8A 3EO4A 3FNCA 2EVNA 4JXRA 1BPMA 4ZX9A 3H5ZA 3D7FA 1MJAA 3F5BA 4CAFA 1HDQA 3LACA 2GLJA 1ELMP 4UWJA 4OAEA 1F57A 1K4JA 2C6CA 4NEXA 4AVAA 2VZYA 2RB7A 2QVPA 5K8PA 3FEEA 4FD6A 4UIAA 4KOXA 3DR6A 5EMIA 2VEZA 2P0WA 1ZG8A 1KZFA 1M44A 1IGBA 2R8VA 1BO4A 4MY0A 3ZJ0A 4R3LA 3I3GA 4BD9A 1LFWA 4MMOA 4OP4A 1QSMA 4NGPA 4E0AA 2PE3A 1Q2DA 2ZW7A 3JVNA 3SJFA 1TXRA 4R87A 3T8WA 1ZLHA 3HLPA 3FJUA 1TIQA 2CNTA 3P2FA 2CIJA 2Z3OA 4UCMA 3H8FA 4H89A 3LWUA 1H8LA 3LD2A 2Q04A 4YRHA 5IX3A 2V77A 2HC9A 4C7IA 1HEEA 4ZBGA 2BEIA 3KR5A 4UA3A 4UEZA 2HUZA 1CP6A 2VZZA 4JLYA 3KQXA 1I21A 1Y9WA 4B6ZA 3LMSA 1LRZA 3SI2A 2EUIA 5AGEA 3L2NA 3ISXA 4OC4A 2CXAA 3FH4A 2Q7SA 4PSWA 1IY7A 2EBJA 2YNEA 5LRJA 4ZY0A 4K30A 4UCNA 1B87A 5THWA 4UFVA 1Q2CA 1XFOA 2H5MA 1CJWA 2DF5A 2RC4A 3TTHA 4UCPA 4CYQA 1M4DA 4MBUA 3UY5A 1CPXA 1HDUA 4ZY1A 1P0HA 1P4NA 4R8FA 3FB3A 3IC1A 4P44A 4CAEA 4J3GA 2B58A 1S60A 4NSQA 4CYNA 3FRMA 1ARMA 2XEIA 1F2PA 2AFUA 5CNPA 3QAYA 3D2PA 4Q36A 4QBJA 3DLJA 1S7NA 2EK8A 4MJ8A 4X5KA 4U5YA 3VATA 5ISVA 2WZNA 3DR8A 1Q2YA 4PPZA 5IV0A 4CGLA 3N5FA 4M3SA 4L8AA 1WK4A 4CGPA 2IQ6A 3F0AA 4MCPA 4OIDA 3R95A 5F09A 5C88A 4EMEA 3R9GA 4U9YA 4OC5A 4UEFA 4OC2A 4EWTA 2J8NA 5HH1A 2F8HA 3IWGA 5HVHA 3QB8A 4A30A 4FD4A 3TT2A 3B3VA 3PBBA 5G20A 3D2MA 4A33A 2K5TA 3V7ZA 1PCAA 2AFZA 2Z0ZA 1XE4A 5JPHA 1IOFA 2ODFA 4MXUA 3SJGA 3DDDA 2DXQA 1Z9UA 1QQ9A 2FL4A 2IL4A 3RO0A 2D4PA 5E96A 2Z10A 4GXHA 4OKOA 4OC1A 3TOBA 4E8OA 5C82A 4B11A 2JDCA 3SI1A 4YWYA 4C2ZA 1RXTA 4JYWA 4KSAA 4Q7AA 4QB9A 3B3WA 2AFXA 3KKWA 3KL9A 3FMCA 4AVBA 3S9NA 3F8KA 1U6MA 4O23A 4Y49B 3JRUA 2YNDA 2JDDA 2DEAA 1QSTA 2VQYA 4E2AA 3BXMA 4QVTA 5IB0A 3N7ZA 3FBUA 4NGQA 2VI7A 2O53A 2VL1A 2VBQA 5G21A 3PB4X 1ON0A 2ZEFA 1KUYA 2BO9A 4LQGA 5G22A 1XMBA 5AG5A 2C6PA 1CX8A 5CPAA 5H84A 2PVWA 3TO6A 2PJ0A 3FIXA 2BL1A 3WABA 1MK4A 2ZW6A 1SQHA 2HB6A 4JZ0A 3IO1A 4C2XA 2ZEGA 3GY9A 4NGRA 4P4FA 4A38A 2FE7A 4ZY2A 4KLWA 2Z3PA 2HQYA 2AFWA 3KZWA 1FT7A 1Z4EA 1Z5RA 3B3TA 1TKHA 3W6XA 5H86A 1Z2LA 5EC4A 3RYOA 4R7MA 4QC6A 5LYFA 3PB9X 1EE3P 3PZJA 4IK2A 2ZEEA 3S6GA 4A39A 1S7LA 4KZTA 2Q44A 4MHZA 3TE4A 3B3SA 1QMUA 3D7HA 4AVCA 3S9LA 1XRYA 1AUGA 4KOYA 1Z8LA 2WSAA 4X3RA 2CY2A 3D68A 4F8ZA 4OIWA 3PBEA 4F9VA 4UFWA 3VARA 4FBEA 3BI0A 4BMHA 2Z3KA 3FXTA 1CP7A 2DPTA 3K9UA 2PR1A 1OBRA 4IHMA 2OU2A 1YGHA 1ARLA 1PUAA 2JBJA 2V8VA 2REFA 2ARHA 1M1DA 2F5IA 4KVME 2J8MA 4UBRA 4CS0B 1CM0A 2PQ8A 5HMNA 4KOSA 3G3SA 2PSWA 2PVVA 4PV6A 4X8IA 3WC6A 3T90A 2NMTA 2ZENA 4II9A 1YREA 4ZX8A 2XEJA 4OC3A 2IJZA 8CPAA 4P10A 2R98A 3RNZA 1Y7RA 4P4BA 2OZUA 4NGMA 4CRYB 1BLLE 1GYTA 4H6UA 2PC1A 4AB7A 1IICA 2ZOGA 4MHYA 2VXKA 4PK3A 4RS2A 4XPDB 4OC0A 5DWMA 2NYQA 3B35A 4KVOE 4NJQA 2GE3A 6CPAA 3NH5A 2CF4A 1XJOA 4R3KA 1YW4A 1YQEA 3TC8A 1GHEA 2Q0YA 2KCWA 4EFDA 3PFEA 1IYLA 2F7VA 4B5PA 3KHXA 1AYEA 1L0CA 5ELYA 1Z4RA 2Z3NA 3I9SA 1WWZA 2P6FA 1QSRA 5K8OA 4HNWB 5K8NA 1V0CA 5LRGA 2YNCA 2AFSA 2EWBA 4WJBA 2X7BA 2FIWA 4MI4A 3JTKA 2PJ7A 4ZGYB 5F46A 3VWDA 1LAMA 4JWPA 1PU9A 4M6GA 4A37A 1UWYA 3BJ8A 3CXPA 1QSOA 5LYLA 2Q4YA 1S7FA 3KI9A 3S9MA 3WC5A 5F47A 4MHNA 2NSMA 4A31A 4CGMA 4LX9A 1Y9KA 1YW6A 2PRBA 2POKA 4XNHC 2JEVA 4L89A 3S6HA 4EVYA 2Q4VA 2XEFA 4XPLA 3B2YA 4A95A 2PJCA 4FWUA 4U9ZA 5JH9A 4ZYQA 1BOBA 4KLVA 4MFKA 5KTDA 1NE9A 2Q43A 4KSFA 3GLJA 4MRIA 4RN7A 4BBHA 4WWVA 2FT0A 4A32A 1Y0YA 3D67A 3HUVA 4MFQA 4R57A 1MJBA 4BINA 4KOUA 4C2YA 4DNCA 3NH8A 4KVXA 3FF3A 4QUSA 4KORA 4XPKA 1BPNA 3PP9A 4LQ6A 4CRZB 1IU8A 1FY7A 4P4EA 2AJ6A 1X12A 2Q7BA 2I3CA 4NGSA 1NSAA 4NXYA 3IEHA 3P2HA 2REEA 4UEEA 4NCZA 5D8NA 3ISZA 4G1PA 1NSLA 4KOVA 1YVOA 5EBVA 3WR7A 2J9AA 3NE8A 3NH4A 2DPSA 2CTBA 3CT9A 3K2KA 4KS9A 2D4OA 1M4GA 3EC4A 4B13A 4M85A 4Z65A 2R1IA 4FD7A 1S5KA 4F0YA 1RO5A 4MCRA 2Q4ZA 2PIYA 5F49A 2Z3MA 3R9EA 5HXDA 2B5GA 2CNMA 2PR8A 2V8GA 3B7IA 1ZLIA 3TX8A 1VGYA 2FIAA 1QSNA 4B5PB 1KUVA 3FECA 3IU2A 1MJ9A 4B5OA 5G1ZA 1ZG7A 4CYPA 1YVKA 2B3VA 4PXBA 5JQ4A 1FNOA 3MN8A 3SI0A 4LUAA 3DGVA 4M6HA 4AG9A 4NJRA 2JBKA 4OADA 3ZZIA 2G9DA 1AMPA 1KUXA 4HKFA 2P6GA 1ZG9A 5AG6A 1CBXA 2GANA 3B8GA 4PXDA 4UIBA 1I12A 2PJ4A 3D7DA 3IWEA 3CXQA 3JUWA 3TO7A 4CGOA 1F2OA 1M4LA 3WC7A 2B4DA 2PRQA 4JD6A 5CBMA 3SJEA 2PJ2A 5GCNA 4F9UA 5LRKA 3CPAA 4ONUA 2OZHA 1XIXA 4GM5A 2JEWA 5BWAB 3MRUA 3PRTA 2Q51A 5I4MA 3D3SA 2ZEPA 2WYRA 3FYNA 5HVFA 4B14A 4JJXA 4IAVA 4MCSA 2C1CA 4YU9A 2ZEHA 1Y7EA 3IGRA 4MHPA 3PFOA 4P4DA 3BHXA 3FX6A 3G8WA 4NFRA 2I00A 4RUHA 4MFLA 3FVLA 4IF5A 2Y0MA 2C6GA 3V8IA 2A4NA 3SJXA 4PK2A 4R76A 3GB0A 3K9TA 1TF9A 5IB9A 4UFXA 4B12A 4DJLA 2FCKA 3CXSA 4B10A 1Y0RA 1VHEA 2B4BA 2FXFA 1LOKA 4KOWA 4KUAA 1J4JA 1Z8WA 5DS0A 2I79A 4YFJA 3QNVA 1DE4C 2HV2A 2ZEMA 4ONWA 3VH9A 1JWQA 2ATRA 5F48A 4I49A 5HVGA 1YLOA 4KOTA 5J8CA 1XBUA 2ZXVA 3TCVA 1RTQA 4X2TA 3TO9A 3V38A 1YR0A 1I1DA 2B5GB 1S7KA 4P4IA 5D29A 1Z8TA 4KUBA 2QJ8A 1TF8A 4AXVA 1N71A 2GIVA 4FUUA 1XEBA 1KWMA 2QECA 2PDOA 3R1KA 4NGNA 1TKFA 4CAVA 1B6BA 3W6SA 4C68A 4MHDA 5LYIA 3H4QA 1IOIA 3PB6X 4UF4A 1OZPA 1VHSA 2PCUA 2PJ1A 2ZEOA 3GUXA 1YK3A 2QIRA 3LODA 2BSWA 2G3AA 1M4IA 1CG2A 2ABZA 4XPDC 1ELLP 1IB1E 7CPAA 2R7HA 2B3UA 2B4DB 2O4HA 2WUUA 3D7GA 3H8EA 4ORFA 4PQAA 4TWEA 4IUSA 2Z11A 3C26A 4H2KA 4MCQA 3TOAA 1R57A 4GS4A 4RI1A 1R3NA 1Q7LA 2RFHA 3E0KA 2AE6A 2BCOA 3H8GA 3NFZA 4HNYB 2WPWA 1TKJA 4HPSA 3S6FA 2OR4A 4PSXA 4FAIA 2V8HA 5I0CA 2QMLA 2OZGA 2BUEA 5FVJA 4NGTA 2PJ8A 4XNHB 2C27A 2ZW4A 3KASA 3IWWA 4JXQA 1S3ZA 2FS5A 1XMTA 1R43A 2PJAA 1XOVA 3EY5A 3BJ7A 2CNSA 3GIUA 3WT4A 5AG4A 3D4UA 2ZEDA 4CAXA 4PXEA 3TFYA 1BAVA 4DUKA 3GKRA 4UWIA 3CZXA 4R9MA 2QYVA 4HNXB 4F6AA 2PJ9A 4YGOA 2Z3LA 1IYKA 1VIXA 2BOAA 3MGDA 5A27A 5JGFA 1YMEA 2GU2A 5LYDA 1DTDA 2AFOA 2ZELA 5J1QA 3IU1A 3VWEA 4A94A 4NF1A 2ZPAA 4OMEA 3R96A 1VKCA 4PXCA 4FD5A 2JLMA 3BLNA 1LCPA 3KHZA 2OOTA 2CTCA 3PB7X 5KTCA 3DNSA 1XF8A 3GYAA 1PYTB 1JQGA 1ZO0A 2P6EA 2PJ6A 3FEDA 4MY3A 3A9LA 3DSBA 1IIDA 3S6KA 4MFPA 3PEIA 3T9YA 1UFHA 4CAWA 4AG7A 1YX0A 4CGNA 2OH1A 3IFEA 3PGPA 2IMOA 2WPXA 3EFAA 3RZAA 2G3TA 2O28A 2GREA 2G0BA 2V8DA 4R6TA 2ZOFA 1NMTA 2YGWA 2PJ5A 3KGQA 2EK9A 2GFQA 4KSIA 3SXOA 3KQZA 4CPAA 5A28A 3CDXA 2GLFA 3CPXA 1CPSA 2J8RA 3KR4A
chains in the Genus database with same CATH topology
4F0XA 3QAHA 4Q38A 4Y49C 3OWCA 5AG7A 1YLEA 3NE7A 5DWNA 2ZW5A 2YNCC 2OB0A 4H6ZA 3EXNA 3R9FA 3W91A 2FSRA 5J8FA 4A2ZA 4OLLA 3SHPA 4C7HA 4MFZA 4CYOA 5KTAA 4MFJA 3SXNA 3D8PA 3EO4A 3FNCA 4JXRA 2EVNA 3H5ZA 3F5BA 1MJAA 4CAFA 4UWJA 4OAEA 1K4JA 4NEXA 4AVAA 2VZYA 4FD6A 4KOXA 3DR6A 2VEZA 2P0WA 1KZFA 1M44A 2R8VA 1BO4A 4MY0A 3ZJ0A 4R3LA 3I3GA 1QSMA 4E0AA 2ZW7A 1Q2DA 3JVNA 4R87A 1TIQA 2CNTA 3P2FA 2Z3OA 4UCMA 4H89A 3LD2A 2Q04A 4YRHA 5IX3A 4C7IA 4ZBGA 2BEIA 4UA3A 2HUZA 2VZZA 4JLYA 1I21A 1Y9WA 1LRZA 2EUIA 5AGEA 2CXAA 4PSWA 2YNEA 4K30A 4UCNA 1B87A 4UFVA 1Q2CA 2H5MA 2RC4A 1CJWA 3TTHA 4UCPA 4CYQA 1M4DA 4MBUA 3UY5A 1P0HA 1P4NA 3FB3A 4CAEA 4J3GA 2B58A 1S60A 4NSQA 4CYNA 3FRMA 5CNPA 3D2PA 4Q36A 4QBJA 1S7NA 4MJ8A 4X5KA 4U5YA 5ISVA 3DR8A 1Q2YA 5IV0A 4CGLA 4M3SA 4L8AA 1WK4A 4CGPA 3F0AA 3R95A 5C88A 3R9GA 4U9YA 2J8NA 5HH1A 3IWGA 3QB8A 4A30A 4FD4A 3TT2A 5G20A 3D2MA 4A33A 2K5TA 2Z0ZA 1XE4A 5JPHA 3DDDA 2DXQA 1Z9UA 2FL4A 2IL4A 2D4PA 5E96A 2Z10A 3TOBA 4E8OA 5C82A 4B11A 2JDCA 4C2ZA 1RXTA 4KSAA 4QB9A 3KKWA 4AVBA 3F8KA 1U6MA 4Y49B 4E2AA 2YNDA 2JDDA 2VQYA 1QSTA 4QVTA 5IB0A 3N7ZA 3FBUA 2VI7A 2VBQA 5G21A 1ON0A 1KUYA 5G22A 5AG5A 5H84A 3TO6A 3FIXA 2BL1A 1MK4A 2ZW6A 1SQHA 4C2XA 3GY9A 2FE7A 4KLWA 2Z3PA 2HQYA 1Z4EA 3W6XA 5H86A 5EC4A 3RYOA 4QC6A 3PZJA 3S6GA 1S7LA 4KZTA 2Q44A 3TE4A 4AVCA 4KOYA 2WSAA 2CY2A 4UFWA 4BMHA 2Z3KA 3FXTA 2DPTA 3K9UA 2PR1A 2OU2A 1YGHA 1PUAA 2REFA 2ARHA 1M1DA 2F5IA 4KVME 2J8MA 4UBRA 4CS0B 1CM0A 2PQ8A 5HMNA 4KOSA 3G3SA 2PSWA 4PV6A 3T90A 2NMTA 4II9A 1YREA 2R98A 1Y7RA 2OZUA 4CRYB 4H6UA 2PC1A 4AB7A 1IICA 2VXKA 4PK3A 4RS2A 4XPDB 5DWMA 4KVOE 2GE3A 4R3KA 1GHEA 2Q0YA 2KCWA 1IYLA 4B5PA 1L0CA 1Z4RA 2Z3NA 3I9SA 1WWZA 2P6FA 1QSRA 4HNWB 1V0CA 2YNCA 2X7BA 2FIWA 4MI4A 3JTKA 4ZGYB 5F46A 3VWDA 4JWPA 1PU9A 3BJ8A 3CXPA 1QSOA 2Q4YA 1S7FA 5F47A 4A31A 4CGMA 4LX9A 1Y9KA 2PRBA 4XNHC 3S6HA 4EVYA 2JEVA 4L89A 2Q4VA 4XPLA 4A95A 4U9ZA 1BOBA 4KLVA 4MFKA 5KTDA 1NE9A 4KSFA 4BBHA 2FT0A 4A32A 4MFQA 4R57A 4DNCA 4C2YA 1MJBA 4KOUA 4KVXA 4QUSA 4KORA 4XPKA 3PP9A 4CRZB 1FY7A 2AJ6A 2Q7BA 4NXYA 3P2HA 2REEA 4NCZA 1NSLA 4KOVA 1YVOA 5EBVA 3WR7A 2DPSA 4KS9A 2D4OA 1M4GA 3EC4A 4B13A 4M85A 2R1IA 4FD7A 1S5KA 4F0YA 1RO5A 5F49A 2Z3MA 3R9EA 2B5GA 2CNMA 2PR8A 2FIAA 1QSNA 4B5PB 1KUVA 3IU2A 1MJ9A 4B5OA 5G1ZA 4CYPA 1YVKA 2B3VA 5JQ4A 4LUAA 4AG9A 4OADA 3ZZIA 1KUXA 4HKFA 2P6GA 5AG6A 2GANA 3B8GA 1I12A 3IWEA 3JUWA 3CXQA 3TO7A 4CGOA 2B4DA 4JD6A 5GCNA 4ONUA 2OZHA 1XIXA 5BWAB 3D3SA 4B14A 3FYNA 4JJXA 3IGRA 3G8WA 2I00A 4MFLA 4IF5A 2Y0MA 3V8IA 2A4NA 4PK2A 4UFXA 4B12A 2FCKA 3CXSA 4B10A 2B4BA 2FXFA 4KOWA 4KUAA 1J4JA 2I79A 2HV2A 2ATRA 5F48A 4I49A 5J8CA 4KOTA 2ZXVA 3TCVA 3TO9A 1YR0A 1I1DA 2B5GB 1S7KA 4KUBA 1N71A 2GIVA 1XEBA 2QECA 4CAVA 2PDOA 3R1KA 1B6BA 3W6SA 4C68A 4MHDA 3H4QA 1OZPA 1VHSA 1YK3A 2QIRA 3LODA 2BSWA 2G3AA 1M4IA 4XPDC 1IB1E 2R7HA 2B3UA 2B4DB 4ORFA 2WUUA 4IUSA 2Z11A 3C26A 3TOAA 1R57A 4GS4A 4RI1A 3E0KA 2AE6A 4HNYB 2WPWA 3S6FA 4PSXA 5I0CA 2QMLA 2OZGA 2BUEA 5FVJA 4XNHB 2C27A 2ZW4A 4JXQA 1S3ZA 2FS5A 1XMTA 3EY5A 3BJ7A 2CNSA 5AG4A 4CAXA 3TFYA 3GKRA 4UWIA 4R9MA 4HNXB 4F6AA 4YGOA 2Z3LA 1IYKA 3MGDA 5A27A 3IU1A 3VWEA 4NF1A 2ZPAA 3R96A 1VKCA 4FD5A 2JLMA 3BLNA 5KTCA 3DNSA 3GYAA 1XF8A 1ZO0A 2P6EA 4MY3A 3A9LA 3DSBA 1IIDA 3S6KA 4MFPA 3T9YA 4CAWA 1UFHA 4CGNA 4AG7A 1YX0A 4YFJA 2OH1A 3PGPA 2WPXA 3EFAA 2G3TA 2O28A 2G0BA 1NMTA 2YGWA 3SXOA 5A28A 2J8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAH A;  4Y49 C;  3OWC A;  1YLE A;  3NE7 A;  5DWN A;  2ZW5 A;  2OB0 A;  4H6Z A;  3EXN A;  3R9F A;  3W91 A;  2FSR A;  5J8F A;  4OLL A;  3SHP A;  5KTA A;  3SXN A;  3D8P A;  3EO4 A;  3FNC A;  4JXR A;  2EVN A;  3F5B A;  1MJA A;  4UWJ A;  4OAE A;  1K4J A;  4NEX A;  4AVA A;  2VZY A;  4FD6 A;  4KOX A;  3DR6 A;  2VEZ A;  2P0W A;  1KZF A;  1M44 A;  2R8V A;  1BO4 A;  4MY0 A;  3ZJ0 A;  4R3L A;  3I3G A;  1QSM A;  4E0A A;  2ZW7 A;  1Q2D A;  3JVN A;  4R87 A;  1TIQ A;  2CNT A;  3P2F A;  4H89 A;  3LD2 A;  2Q04 A;  4YRH A;  5IX3 A;  4ZBG A;  2BEI A;  4UA3 A;  2HUZ A;  2VZZ A;  4JLY A;  1I21 A;  1Y9W A;  1LRZ A;  2EUI A;  4PSW A;  4K30 A;  1B87 A;  1Q2C A;  2H5M A;  2RC4 A;  1CJW A;  3TTH A;  1M4D A;  4MBU A;  3UY5 A;  1P0H A;  1P4N A;  3FB3 A;  4J3G A;  2B58 A;  1S60 A;  4NSQ A;  3FRM A;  5CNP A;  3D2P A;  4QBJ A;  1S7N A;  4MJ8 A;  4X5K A;  4U5Y A;  5ISV A;  3DR8 A;  1Q2Y A;  5IV0 A;  4M3S A;  4L8A A;  1WK4 A;  3F0A A;  3R95 A;  5C88 A;  3R9G A;  4U9Y A;  2J8N A;  5HH1 A;  3IWG A;  3QB8 A;  4FD4 A;  3TT2 A;  3D2M A;  2K5T A;  2Z0Z A;  1XE4 A;  5JPH A;  3DDD A;  2DXQ A;  1Z9U A;  2FL4 A;  2IL4 A;  2D4P A;  5E96 A;  2Z10 A;  3TOB A;  4E8O A;  5C82 A;  2JDC A;  1RXT A;  4QB9 A;  3KKW A;  4AVB A;  3F8K A;  1U6M A;  4Y49 B;  4E2A A;  2JDD A;  2VQY A;  1QST A;  4QVT A;  5IB0 A;  3N7Z A;  3FBU A;  2VI7 A;  2VBQ A;  1ON0 A;  1KUY A;  5H84 A;  3TO6 A;  3FIX A;  2BL1 A;  1MK4 A;  2ZW6 A;  1SQH A;  3GY9 A;  2FE7 A;  4KLW A;  2HQY A;  1Z4E A;  3W6X A;  5H86 A;  5EC4 A;  3RYO A;  4QC6 A;  3PZJ A;  3S6G A;  1S7L A;  4KZT A;  2Q44 A;  3TE4 A;  4AVC A;  4KOY A;  2CY2 A;  4BMH A;  3FXT A;  3K9U A;  2PR1 A;  2OU2 A;  1YGH A;  1PUA A;  2REF A;  2ARH A;  1M1D A;  2F5I A;  4KVM E;  2J8M A;  4UBR A;  4CS0 B;  1CM0 A;  2PQ8 A;  5HMN A;  4KOS A;  3G3S A;  2PSW A;  4PV6 A;  3T90 A;  2NMT A;  4II9 A;  1YRE A;  2R98 A;  1Y7R A;  2OZU A;  4CRY B;  4H6U A;  2PC1 A;  4AB7 A;  1IIC A;  2VXK A;  4PK3 A;  4RS2 A;  4XPD B;  5DWM A;  4KVO E;  2GE3 A;  4R3K A;  1GHE A;  2Q0Y A;  2KCW A;  1IYL A;  4B5P A;  1L0C A;  1Z4R A;  3I9S A;  1WWZ A;  2P6F A;  1QSR A;  4HNW B;  1V0C A;  2X7B A;  2FIW A;  4MI4 A;  5F46 A;  3VWD A;  4JWP A;  1PU9 A;  3BJ8 A;  3CXP A;  1QSO A;  2Q4Y A;  1S7F A;  5F47 A;  4LX9 A;  1Y9K A;  2PRB A;  4XNH C;  3S6H A;  4EVY A;  2JEV A;  4L89 A;  2Q4V A;  4XPL A;  4U9Z A;  1BOB A;  4KLV A;  5KTD A;  1NE9 A;  2FT0 A;  4R57 A;  4DNC A;  1MJB A;  4KOU A;  4KVX A;  4QUS A;  4KOR A;  4XPK A;  3PP9 A;  4CRZ B;  1FY7 A;  2AJ6 A;  2Q7B A;  4NXY A;  3P2H A;  2REE A;  4NCZ A;  1NSL A;  4KOV A;  1YVO A;  5EBV A;  3WR7 A;  2D4O A;  1M4G A;  3EC4 A;  4M85 A;  2R1I A;  4FD7 A;  1S5K A;  4F0Y A;  1RO5 A;  5F49 A;  3R9E A;  2B5G A;  2CNM A;  2PR8 A;  2FIA A;  1QSN A;  4B5P B;  1KUV A;  1MJ9 A;  4B5O A;  1YVK A;  2B3V A;  5JQ4 A;  4LUA A;  4AG9 A;  4OAD A;  3ZZI A;  1KUX A;  4HKF A;  2P6G A;  2GAN A;  3B8G A;  1I12 A;  3JUW A;  3CXQ A;  3TO7 A;  2B4D A;  4JD6 A;  5GCN A;  4ONU A;  2OZH A;  1XIX A;  3D3S A;  3FYN A;  4JJX A;  3IGR A;  3G8W A;  2I00 A;  4IF5 A;  2Y0M A;  3V8I A;  2A4N A;  4PK2 A;  2FCK A;  3CXS A;  2B4B A;  2FXF A;  4KOW A;  4KUA A;  1J4J A;  2I79 A;  2HV2 A;  2ATR A;  5F48 A;  4I49 A;  5J8C A;  4KOT A;  2ZXV A;  3TCV A;  3TO9 A;  1YR0 A;  1I1D A;  2B5G B;  1S7K A;  4KUB A;  1N71 A;  2GIV A;  1XEB A;  2QEC A;  4CAV A;  2PDO A;  3R1K A;  1B6B A;  3W6S A;  4MHD A;  3H4Q A;  1OZP A;  1VHS A;  1YK3 A;  2QIR A;  3LOD A;  2BSW A;  2G3A A;  1M4I A;  4XPD C;  1IB1 E;  2R7H A;  2B3U A;  2B4D B;  4ORF A;  4IUS A;  2Z11 A;  3C26 A;  3TOA A;  1R57 A;  4GS4 A;  4RI1 A;  3E0K A;  2AE6 A;  4HNY B;  2WPW A;  3S6F A;  4PSX A;  5I0C A;  2QML A;  2OZG A;  2BUE A;  5FVJ A;  4XNH B;  2C27 A;  2ZW4 A;  4JXQ A;  1S3Z A;  2FS5 A;  1XMT A;  3EY5 A;  3BJ7 A;  2CNS A;  4CAX A;  3TFY A;  3GKR A;  4UWI A;  4R9M A;  4HNX B;  4F6A A;  4YGO A;  1IYK A;  3MGD A;  3VWE A;  4NF1 A;  2ZPA A;  3R96 A;  1VKC A;  4FD5 A;  2JLM A;  3BLN A;  5KTC A;  3DNS A;  3GYA A;  1XF8 A;  2P6E A;  4MY3 A;  3DSB A;  3T9Y A;  1IID A;  3S6K A;  4YFJ A;  4CAW A;  1UFH A;  4AG7 A;  1YX0 A;  2OH1 A;  3PGP A;  2WPX A;  3EFA A;  2G3T A;  2O28 A;  2G0B A;  1NMT A;  3SXO A;  2J8R A; 
#chains in the Genus database with same CATH topology
 1A2Z A;  4F0X A;  3QAH A;  4Q38 A;  3I1U A;  4Y49 C;  3OWC A;  5JM6 A;  5AG7 A;  2AFM A;  3BI1 A;  1YLE A;  4M6I A;  4P6Y A;  1VHO A;  1LAN A;  2FVG A;  4P4J A;  1LAP A;  3NE7 A;  3IJ3 A;  5DWN A;  2ZW5 A;  2YNC C;  2OB0 A;  3RAM A;  4H6Z A;  3EXN A;  3R9F A;  3W91 A;  5K8M A;  2FSR A;  2ANP A;  4P45 A;  5J8F A;  4W9Y A;  4A2Z A;  3D66 A;  4OLL A;  1X10 A;  3SHP A;  3B3C A;  3NA6 A;  4C7H A;  3IIB A;  4DYO A;  2XEG A;  4MFZ A;  4ZI6 A;  1YSJ A;  4TNU A;  4K3N A;  4CYO A;  5KTA A;  2PIZ A;  3PB8 X;  1Z8X A;  4MFJ A;  3SXN A;  3D8P A;  2PJB A;  3RBU A;  2PJ3 A;  2EO8 A;  3EO4 A;  3FNC A;  2EVN A;  4JXR A;  1BPM A;  4ZX9 A;  3H5Z A;  3D7F A;  1MJA A;  3F5B A;  4CAF A;  1HDQ A;  3LAC A;  2GLJ A;  1ELM P;  4UWJ A;  4OAE A;  1F57 A;  1K4J A;  2C6C A;  4NEX A;  4AVA A;  2VZY A;  2RB7 A;  2QVP A;  5K8P A;  3FEE A;  4FD6 A;  4UIA A;  4KOX A;  3DR6 A;  5EMI A;  2VEZ A;  2P0W A;  1ZG8 A;  1KZF A;  1M44 A;  1IGB A;  2R8V A;  1BO4 A;  4MY0 A;  3ZJ0 A;  4R3L A;  3I3G A;  4BD9 A;  1LFW A;  4MMO A;  4OP4 A;  1QSM A;  4NGP A;  4E0A A;  2PE3 A;  1Q2D A;  2ZW7 A;  3JVN A;  3SJF A;  1TXR A;  4R87 A;  3T8W A;  1ZLH A;  3HLP A;  3FJU A;  1TIQ A;  2CNT A;  3P2F A;  2CIJ A;  2Z3O A;  4UCM A;  3H8F A;  4H89 A;  3LWU A;  1H8L A;  3LD2 A;  2Q04 A;  4YRH A;  5IX3 A;  2V77 A;  2HC9 A;  4C7I A;  1HEE A;  4ZBG A;  2BEI A;  3KR5 A;  4UA3 A;  4UEZ A;  2HUZ A;  1CP6 A;  2VZZ A;  4JLY A;  3KQX A;  1I21 A;  1Y9W A;  4B6Z A;  3LMS A;  1LRZ A;  3SI2 A;  2EUI A;  5AGE A;  3L2N A;  3ISX A;  4OC4 A;  2CXA A;  3FH4 A;  2Q7S A;  4PSW A;  1IY7 A;  2EBJ A;  2YNE A;  5LRJ A;  4ZY0 A;  4K30 A;  4UCN A;  1B87 A;  5THW A;  4UFV A;  1Q2C A;  1XFO A;  2H5M A;  1CJW A;  2DF5 A;  2RC4 A;  3TTH A;  4UCP A;  4CYQ A;  1M4D A;  4MBU A;  3UY5 A;  1CPX A;  1HDU A;  4ZY1 A;  1P0H A;  1P4N A;  4R8F A;  3FB3 A;  3IC1 A;  4P44 A;  4CAE A;  4J3G A;  2B58 A;  1S60 A;  4NSQ A;  4CYN A;  3FRM A;  1ARM A;  2XEI A;  1F2P A;  2AFU A;  5CNP A;  3QAY A;  3D2P A;  4Q36 A;  4QBJ A;  3DLJ A;  1S7N A;  2EK8 A;  4MJ8 A;  4X5K A;  4U5Y A;  3VAT A;  5ISV A;  2WZN A;  3DR8 A;  1Q2Y A;  4PPZ A;  5IV0 A;  4CGL A;  3N5F A;  4M3S A;  4L8A A;  1WK4 A;  4CGP A;  2IQ6 A;  3F0A A;  4MCP A;  4OID A;  3R95 A;  5F09 A;  5C88 A;  4EME A;  3R9G A;  4U9Y A;  4OC5 A;  4UEF A;  4OC2 A;  4EWT A;  2J8N A;  5HH1 A;  2F8H A;  3IWG A;  5HVH A;  3QB8 A;  4A30 A;  4FD4 A;  3TT2 A;  3B3V A;  3PBB A;  5G20 A;  3D2M A;  4A33 A;  2K5T A;  3V7Z A;  1PCA A;  2AFZ A;  2Z0Z A;  1XE4 A;  5JPH A;  1IOF A;  2ODF A;  4MXU A;  3SJG A;  3DDD A;  2DXQ A;  1Z9U A;  1QQ9 A;  2FL4 A;  2IL4 A;  3RO0 A;  2D4P A;  5E96 A;  2Z10 A;  4GXH A;  4OKO A;  4OC1 A;  3TOB A;  4E8O A;  5C82 A;  4B11 A;  2JDC A;  3SI1 A;  4YWY A;  4C2Z A;  1RXT A;  4JYW A;  4KSA A;  4Q7A A;  4QB9 A;  3B3W A;  2AFX A;  3KKW A;  3KL9 A;  3FMC A;  4AVB A;  3S9N A;  3F8K A;  1U6M A;  4O23 A;  4Y49 B;  3JRU A;  2YND A;  2JDD A;  2DEA A;  1QST A;  2VQY A;  4E2A A;  3BXM A;  4QVT A;  5IB0 A;  3N7Z A;  3FBU A;  4NGQ A;  2VI7 A;  2O53 A;  2VL1 A;  2VBQ A;  5G21 A;  3PB4 X;  1ON0 A;  2ZEF A;  1KUY A;  2BO9 A;  4LQG A;  5G22 A;  1XMB A;  5AG5 A;  2C6P A;  1CX8 A;  5CPA A;  5H84 A;  2PVW A;  3TO6 A;  2PJ0 A;  3FIX A;  2BL1 A;  3WAB A;  1MK4 A;  2ZW6 A;  1SQH A;  2HB6 A;  4JZ0 A;  3IO1 A;  4C2X A;  2ZEG A;  3GY9 A;  4NGR A;  4P4F A;  4A38 A;  2FE7 A;  4ZY2 A;  4KLW A;  2Z3P A;  2HQY A;  2AFW A;  3KZW A;  1FT7 A;  1Z4E A;  1Z5R A;  3B3T A;  1TKH A;  3W6X A;  5H86 A;  1Z2L A;  5EC4 A;  3RYO A;  4R7M A;  4QC6 A;  5LYF A;  3PB9 X;  1EE3 P;  3PZJ A;  4IK2 A;  2ZEE A;  3S6G A;  4A39 A;  1S7L A;  4KZT A;  2Q44 A;  4MHZ A;  3TE4 A;  3B3S A;  1QMU A;  3D7H A;  4AVC A;  3S9L A;  1XRY A;  1AUG A;  4KOY A;  1Z8L A;  2WSA A;  4X3R A;  2CY2 A;  3D68 A;  4F8Z A;  4OIW A;  3PBE A;  4F9V A;  4UFW A;  3VAR A;  4FBE A;  3BI0 A;  4BMH A;  2Z3K A;  3FXT A;  1CP7 A;  2DPT A;  3K9U A;  2PR1 A;  1OBR A;  4IHM A;  2OU2 A;  1YGH A;  1ARL A;  1PUA A;  2JBJ A;  2V8V A;  2REF A;  2ARH A;  1M1D A;  2F5I A;  4KVM E;  2J8M A;  4UBR A;  4CS0 B;  1CM0 A;  2PQ8 A;  5HMN A;  4KOS A;  3G3S A;  2PSW A;  2PVV A;  4PV6 A;  4X8I A;  3WC6 A;  3T90 A;  2NMT A;  2ZEN A;  4II9 A;  1YRE A;  4ZX8 A;  2XEJ A;  4OC3 A;  2IJZ A;  8CPA A;  4P10 A;  2R98 A;  3RNZ A;  1Y7R A;  4P4B A;  2OZU A;  4NGM A;  4CRY B;  1BLL E;  1GYT A;  4H6U A;  2PC1 A;  4AB7 A;  1IIC A;  2ZOG A;  4MHY A;  2VXK A;  4PK3 A;  4RS2 A;  4XPD B;  4OC0 A;  5DWM A;  2NYQ A;  3B35 A;  4KVO E;  4NJQ A;  2GE3 A;  6CPA A;  3NH5 A;  2CF4 A;  1XJO A;  4R3K A;  1YW4 A;  1YQE A;  3TC8 A;  1GHE A;  2Q0Y A;  2KCW A;  4EFD A;  3PFE A;  1IYL A;  2F7V A;  4B5P A;  3KHX A;  1AYE A;  1L0C A;  5ELY A;  1Z4R A;  2Z3N A;  3I9S A;  1WWZ A;  2P6F A;  1QSR A;  5K8O A;  4HNW B;  5K8N A;  1V0C A;  5LRG A;  2YNC A;  2AFS A;  2EWB A;  4WJB A;  2X7B A;  2FIW A;  4MI4 A;  3JTK A;  2PJ7 A;  4ZGY B;  5F46 A;  3VWD A;  1LAM A;  4JWP A;  1PU9 A;  4M6G A;  4A37 A;  1UWY A;  3BJ8 A;  3CXP A;  1QSO A;  5LYL A;  2Q4Y A;  1S7F A;  3KI9 A;  3S9M A;  3WC5 A;  5F47 A;  4MHN A;  2NSM A;  4A31 A;  4CGM A;  4LX9 A;  1Y9K A;  1YW6 A;  2PRB A;  2POK A;  4XNH C;  2JEV A;  4L89 A;  3S6H A;  4EVY A;  2Q4V A;  2XEF A;  4XPL A;  3B2Y A;  4A95 A;  2PJC A;  4FWU A;  4U9Z A;  5JH9 A;  4ZYQ A;  1BOB A;  4KLV A;  4MFK A;  5KTD A;  1NE9 A;  2Q43 A;  4KSF A;  3GLJ A;  4MRI A;  4RN7 A;  4BBH A;  4WWV A;  2FT0 A;  4A32 A;  1Y0Y A;  3D67 A;  3HUV A;  4MFQ A;  4R57 A;  1MJB A;  4BIN A;  4KOU A;  4C2Y A;  4DNC A;  3NH8 A;  4KVX A;  3FF3 A;  4QUS A;  4KOR A;  4XPK A;  1BPN A;  3PP9 A;  4LQ6 A;  4CRZ B;  1IU8 A;  1FY7 A;  4P4E A;  2AJ6 A;  1X12 A;  2Q7B A;  2I3C A;  4NGS A;  1NSA A;  4NXY A;  3IEH A;  3P2H A;  2REE A;  4UEE A;  4NCZ A;  5D8N A;  3ISZ A;  4G1P A;  1NSL A;  4KOV A;  1YVO A;  5EBV A;  3WR7 A;  2J9A A;  3NE8 A;  3NH4 A;  2DPS A;  2CTB A;  3CT9 A;  3K2K A;  4KS9 A;  2D4O A;  1M4G A;  3EC4 A;  4B13 A;  4M85 A;  4Z65 A;  2R1I A;  4FD7 A;  1S5K A;  4F0Y A;  1RO5 A;  4MCR A;  2Q4Z A;  2PIY A;  5F49 A;  2Z3M A;  3R9E A;  5HXD A;  2B5G A;  2CNM A;  2PR8 A;  2V8G A;  3B7I A;  1ZLI A;  3TX8 A;  1VGY A;  2FIA A;  1QSN A;  4B5P B;  1KUV A;  3FEC A;  3IU2 A;  1MJ9 A;  4B5O A;  5G1Z A;  1ZG7 A;  4CYP A;  1YVK A;  2B3V A;  4PXB A;  5JQ4 A;  1FNO A;  3MN8 A;  3SI0 A;  4LUA A;  3DGV A;  4M6H A;  4AG9 A;  4NJR A;  2JBK A;  4OAD A;  3ZZI A;  2G9D A;  1AMP A;  1KUX A;  4HKF A;  2P6G A;  1ZG9 A;  5AG6 A;  1CBX A;  2GAN A;  3B8G A;  4PXD A;  4UIB A;  1I12 A;  2PJ4 A;  3D7D A;  3IWE A;  3CXQ A;  3JUW A;  3TO7 A;  4CGO A;  1F2O A;  1M4L A;  3WC7 A;  2B4D A;  2PRQ A;  4JD6 A;  5CBM A;  3SJE A;  2PJ2 A;  5GCN A;  4F9U A;  5LRK A;  3CPA A;  4ONU A;  2OZH A;  1XIX A;  4GM5 A;  2JEW A;  5BWA B;  3MRU A;  3PRT A;  2Q51 A;  5I4M A;  3D3S A;  2ZEP A;  2WYR A;  3FYN A;  5HVF A;  4B14 A;  4JJX A;  4IAV A;  4MCS A;  2C1C A;  4YU9 A;  2ZEH A;  1Y7E A;  3IGR A;  4MHP A;  3PFO A;  4P4D A;  3BHX A;  3FX6 A;  3G8W A;  4NFR A;  2I00 A;  4RUH A;  4MFL A;  3FVL A;  4IF5 A;  2Y0M A;  2C6G A;  3V8I A;  2A4N A;  3SJX A;  4PK2 A;  4R76 A;  3GB0 A;  3K9T A;  1TF9 A;  5IB9 A;  4UFX A;  4B12 A;  4DJL A;  2FCK A;  3CXS A;  4B10 A;  1Y0R A;  1VHE A;  2B4B A;  2FXF A;  1LOK A;  4KOW A;  4KUA A;  1J4J A;  1Z8W A;  5DS0 A;  2I79 A;  4YFJ A;  3QNV A;  1DE4 C;  2HV2 A;  2ZEM A;  4ONW A;  3VH9 A;  1JWQ A;  2ATR A;  5F48 A;  4I49 A;  5HVG A;  1YLO A;  4KOT A;  5J8C A;  1XBU A;  2ZXV A;  3TCV A;  1RTQ A;  4X2T A;  3TO9 A;  3V38 A;  1YR0 A;  1I1D A;  2B5G B;  1S7K A;  4P4I A;  5D29 A;  1Z8T A;  4KUB A;  2QJ8 A;  1TF8 A;  4AXV A;  1N71 A;  2GIV A;  4FUU A;  1XEB A;  1KWM A;  2QEC A;  2PDO A;  3R1K A;  4NGN A;  1TKF A;  4CAV A;  1B6B A;  3W6S A;  4C68 A;  4MHD A;  5LYI A;  3H4Q A;  1IOI A;  3PB6 X;  4UF4 A;  1OZP A;  1VHS A;  2PCU A;  2PJ1 A;  2ZEO A;  3GUX A;  1YK3 A;  2QIR A;  3LOD A;  2BSW A;  2G3A A;  1M4I A;  1CG2 A;  2ABZ A;  4XPD C;  1ELL P;  1IB1 E;  7CPA A;  2R7H A;  2B3U A;  2B4D B;  2O4H A;  2WUU A;  3D7G A;  3H8E A;  4ORF A;  4PQA A;  4TWE A;  4IUS A;  2Z11 A;  3C26 A;  4H2K A;  4MCQ A;  3TOA A;  1R57 A;  4GS4 A;  4RI1 A;  1R3N A;  1Q7L A;  2RFH A;  3E0K A;  2AE6 A;  2BCO A;  3H8G A;  3NFZ A;  4HNY B;  2WPW A;  1TKJ A;  4HPS A;  3S6F A;  2OR4 A;  4PSX A;  4FAI A;  2V8H A;  5I0C A;  2QML A;  2OZG A;  2BUE A;  5FVJ A;  4NGT A;  2PJ8 A;  4XNH B;  2C27 A;  2ZW4 A;  3KAS A;  3IWW A;  4JXQ A;  1S3Z A;  2FS5 A;  1XMT A;  1R43 A;  2PJA A;  1XOV A;  3EY5 A;  3BJ7 A;  2CNS A;  3GIU A;  3WT4 A;  5AG4 A;  3D4U A;  2ZED A;  4CAX A;  4PXE A;  3TFY A;  1BAV A;  4DUK A;  3GKR A;  4UWI A;  3CZX A;  4R9M A;  2QYV A;  4HNX B;  4F6A A;  2PJ9 A;  4YGO A;  2Z3L A;  1IYK A;  1VIX A;  2BOA A;  3MGD A;  5A27 A;  5JGF A;  1YME A;  2GU2 A;  5LYD A;  1DTD A;  2AFO A;  2ZEL A;  5J1Q A;  3IU1 A;  3VWE A;  4A94 A;  4NF1 A;  2ZPA A;  4OME A;  3R96 A;  1VKC A;  4PXC A;  4FD5 A;  2JLM A;  3BLN A;  1LCP A;  3KHZ A;  2OOT A;  2CTC A;  3PB7 X;  5KTC A;  3DNS A;  1XF8 A;  3GYA A;  1PYT B;  1JQG A;  1ZO0 A;  2P6E A;  2PJ6 A;  3FED A;  4MY3 A;  3A9L A;  3DSB A;  1IID A;  3S6K A;  4MFP A;  3PEI A;  3T9Y A;  1UFH A;  4CAW A;  4AG7 A;  1YX0 A;  4CGN A;  2OH1 A;  3IFE A;  3PGP A;  2IMO A;  2WPX A;  3EFA A;  3RZA A;  2G3T A;  2O28 A;  2GRE A;  2G0B A;  2V8D A;  4R6T A;  2ZOF A;  1NMT A;  2YGW A;  2PJ5 A;  3KGQ A;  2EK9 A;  2GFQ A;  4KSI A;  3SXO A;  3KQZ A;  4CPA A;  5A28 A;  3CDX A;  2GLF A;  3CPX A;  1CPS A;  2J8R A;  3KR4 A; 
#chains in the Genus database with same CATH homology
 4F0X A;  3QAH A;  4Q38 A;  4Y49 C;  3OWC A;  5AG7 A;  1YLE A;  3NE7 A;  5DWN A;  2ZW5 A;  2YNC C;  2OB0 A;  4H6Z A;  3EXN A;  3R9F A;  3W91 A;  2FSR A;  5J8F A;  4A2Z A;  4OLL A;  3SHP A;  4C7H A;  4MFZ A;  4CYO A;  5KTA A;  4MFJ A;  3SXN A;  3D8P A;  3EO4 A;  3FNC A;  4JXR A;  2EVN A;  3H5Z A;  3F5B A;  1MJA A;  4CAF A;  4UWJ A;  4OAE A;  1K4J A;  4NEX A;  4AVA A;  2VZY A;  4FD6 A;  4KOX A;  3DR6 A;  2VEZ A;  2P0W A;  1KZF A;  1M44 A;  2R8V A;  1BO4 A;  4MY0 A;  3ZJ0 A;  4R3L A;  3I3G A;  1QSM A;  4E0A A;  2ZW7 A;  1Q2D A;  3JVN A;  4R87 A;  1TIQ A;  2CNT A;  3P2F A;  2Z3O A;  4UCM A;  4H89 A;  3LD2 A;  2Q04 A;  4YRH A;  5IX3 A;  4C7I A;  4ZBG A;  2BEI A;  4UA3 A;  2HUZ A;  2VZZ A;  4JLY A;  1I21 A;  1Y9W A;  1LRZ A;  2EUI A;  5AGE A;  2CXA A;  4PSW A;  2YNE A;  4K30 A;  4UCN A;  1B87 A;  4UFV A;  1Q2C A;  2H5M A;  2RC4 A;  1CJW A;  3TTH A;  4UCP A;  4CYQ A;  1M4D A;  4MBU A;  3UY5 A;  1P0H A;  1P4N A;  3FB3 A;  4CAE A;  4J3G A;  2B58 A;  1S60 A;  4NSQ A;  4CYN A;  3FRM A;  5CNP A;  3D2P A;  4Q36 A;  4QBJ A;  1S7N A;  4MJ8 A;  4X5K A;  4U5Y A;  5ISV A;  3DR8 A;  1Q2Y A;  5IV0 A;  4CGL A;  4M3S A;  4L8A A;  1WK4 A;  4CGP A;  3F0A A;  3R95 A;  5C88 A;  3R9G A;  4U9Y A;  2J8N A;  5HH1 A;  3IWG A;  3QB8 A;  4A30 A;  4FD4 A;  3TT2 A;  5G20 A;  3D2M A;  4A33 A;  2K5T A;  2Z0Z A;  1XE4 A;  5JPH A;  3DDD A;  2DXQ A;  1Z9U A;  2FL4 A;  2IL4 A;  2D4P A;  5E96 A;  2Z10 A;  3TOB A;  4E8O A;  5C82 A;  4B11 A;  2JDC A;  4C2Z A;  1RXT A;  4KSA A;  4QB9 A;  3KKW A;  4AVB A;  3F8K A;  1U6M A;  4Y49 B;  4E2A A;  2YND A;  2JDD A;  2VQY A;  1QST A;  4QVT A;  5IB0 A;  3N7Z A;  3FBU A;  2VI7 A;  2VBQ A;  5G21 A;  1ON0 A;  1KUY A;  5G22 A;  5AG5 A;  5H84 A;  3TO6 A;  3FIX A;  2BL1 A;  1MK4 A;  2ZW6 A;  1SQH A;  4C2X A;  3GY9 A;  2FE7 A;  4KLW A;  2Z3P A;  2HQY A;  1Z4E A;  3W6X A;  5H86 A;  5EC4 A;  3RYO A;  4QC6 A;  3PZJ A;  3S6G A;  1S7L A;  4KZT A;  2Q44 A;  3TE4 A;  4AVC A;  4KOY A;  2WSA A;  2CY2 A;  4UFW A;  4BMH A;  2Z3K A;  3FXT A;  2DPT A;  3K9U A;  2PR1 A;  2OU2 A;  1YGH A;  1PUA A;  2REF A;  2ARH A;  1M1D A;  2F5I A;  4KVM E;  2J8M A;  4UBR A;  4CS0 B;  1CM0 A;  2PQ8 A;  5HMN A;  4KOS A;  3G3S A;  2PSW A;  4PV6 A;  3T90 A;  2NMT A;  4II9 A;  1YRE A;  2R98 A;  1Y7R A;  2OZU A;  4CRY B;  4H6U A;  2PC1 A;  4AB7 A;  1IIC A;  2VXK A;  4PK3 A;  4RS2 A;  4XPD B;  5DWM A;  4KVO E;  2GE3 A;  4R3K A;  1GHE A;  2Q0Y A;  2KCW A;  1IYL A;  4B5P A;  1L0C A;  1Z4R A;  2Z3N A;  3I9S A;  1WWZ A;  2P6F A;  1QSR A;  4HNW B;  1V0C A;  2YNC A;  2X7B A;  2FIW A;  4MI4 A;  3JTK A;  4ZGY B;  5F46 A;  3VWD A;  4JWP A;  1PU9 A;  3BJ8 A;  3CXP A;  1QSO A;  2Q4Y A;  1S7F A;  5F47 A;  4A31 A;  4CGM A;  4LX9 A;  1Y9K A;  2PRB A;  4XNH C;  3S6H A;  4EVY A;  2JEV A;  4L89 A;  2Q4V A;  4XPL A;  4A95 A;  4U9Z A;  1BOB A;  4KLV A;  4MFK A;  5KTD A;  1NE9 A;  4KSF A;  4BBH A;  2FT0 A;  4A32 A;  4MFQ A;  4R57 A;  4DNC A;  4C2Y A;  1MJB A;  4KOU A;  4KVX A;  4QUS A;  4KOR A;  4XPK A;  3PP9 A;  4CRZ B;  1FY7 A;  2AJ6 A;  2Q7B A;  4NXY A;  3P2H A;  2REE A;  4NCZ A;  1NSL A;  4KOV A;  1YVO A;  5EBV A;  3WR7 A;  2DPS A;  4KS9 A;  2D4O A;  1M4G A;  3EC4 A;  4B13 A;  4M85 A;  2R1I A;  4FD7 A;  1S5K A;  4F0Y A;  1RO5 A;  5F49 A;  2Z3M A;  3R9E A;  2B5G A;  2CNM A;  2PR8 A;  2FIA A;  1QSN A;  4B5P B;  1KUV A;  3IU2 A;  1MJ9 A;  4B5O A;  5G1Z A;  4CYP A;  1YVK A;  2B3V A;  5JQ4 A;  4LUA A;  4AG9 A;  4OAD A;  3ZZI A;  1KUX A;  4HKF A;  2P6G A;  5AG6 A;  2GAN A;  3B8G A;  1I12 A;  3IWE A;  3JUW A;  3CXQ A;  3TO7 A;  4CGO A;  2B4D A;  4JD6 A;  5GCN A;  4ONU A;  2OZH A;  1XIX A;  5BWA B;  3D3S A;  4B14 A;  3FYN A;  4JJX A;  3IGR A;  3G8W A;  2I00 A;  4MFL A;  4IF5 A;  2Y0M A;  3V8I A;  2A4N A;  4PK2 A;  4UFX A;  4B12 A;  2FCK A;  3CXS A;  4B10 A;  2B4B A;  2FXF A;  4KOW A;  4KUA A;  1J4J A;  2I79 A;  2HV2 A;  2ATR A;  5F48 A;  4I49 A;  5J8C A;  4KOT A;  2ZXV A;  3TCV A;  3TO9 A;  1YR0 A;  1I1D A;  2B5G B;  1S7K A;  4KUB A;  1N71 A;  2GIV A;  1XEB A;  2QEC A;  4CAV A;  2PDO A;  3R1K A;  1B6B A;  3W6S A;  4C68 A;  4MHD A;  3H4Q A;  1OZP A;  1VHS A;  1YK3 A;  2QIR A;  3LOD A;  2BSW A;  2G3A A;  1M4I A;  4XPD C;  1IB1 E;  2R7H A;  2B3U A;  2B4D B;  4ORF A;  2WUU A;  4IUS A;  2Z11 A;  3C26 A;  3TOA A;  1R57 A;  4GS4 A;  4RI1 A;  3E0K A;  2AE6 A;  4HNY B;  2WPW A;  3S6F A;  4PSX A;  5I0C A;  2QML A;  2OZG A;  2BUE A;  5FVJ A;  4XNH B;  2C27 A;  2ZW4 A;  4JXQ A;  1S3Z A;  2FS5 A;  1XMT A;  3EY5 A;  3BJ7 A;  2CNS A;  5AG4 A;  4CAX A;  3TFY A;  3GKR A;  4UWI A;  4R9M A;  4HNX B;  4F6A A;  4YGO A;  2Z3L A;  1IYK A;  3MGD A;  5A27 A;  3IU1 A;  3VWE A;  4NF1 A;  2ZPA A;  3R96 A;  1VKC A;  4FD5 A;  2JLM A;  3BLN A;  5KTC A;  3DNS A;  3GYA A;  1XF8 A;  1ZO0 A;  2P6E A;  4MY3 A;  3A9L A;  3DSB A;  1IID A;  3S6K A;  4MFP A;  3T9Y A;  4CAW A;  1UFH A;  4CGN A;  4AG7 A;  1YX0 A;  4YFJ A;  2OH1 A;  3PGP A;  2WPX A;  3EFA A;  2G3T A;  2O28 A;  2G0B A;  1NMT A;  2YGW A;  3SXO A;  5A28 A;  2J8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...