1X10A

Structure of mutant pyrrolidone carboxyl peptidase (e192a) from a hyperthermophile, pyrococcus furiosus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMALEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 69
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1x10A00
1A2ZA 1IOFA 3GIUA 1AUGA 4HPSA 2DF5A 1Z8WA 3LACA 3RNZA 4GXHA 2EO8A 1IOIA 1Z8XA 2EBJA 3RO0A 1X10A 1X12A 1IU8A 1Z8TA
chains in the Genus database with same CATH superfamily
3S6FA 1IOFA 2Q0YA 4DUKA 1S7LA 3KGQA 4BINA 4KZTA 4CS0B 3BJ7A 1VHEA 4R76A 4H6UA 2P0WA 4CYNA 3CXSA 4UFXA 4Q38A 4NGQA 4Q7AA 2G0BA 4UEZA 2J8NA 5AG7A 3SI1A 2ANPA 4DJLA 5J8FA 3PB6X 4E8OA 2ZXVA 1BOBA 4MMOA 2PJ9A 3TO7A 4F8ZA 3FECA 4EWTA 4B12A 2PJBA 2ZEEA 1JQGA 2AFWA 2A4NA 2EK8A 2I3CA 4MCRA 4U9ZA 1QQ9A 2NMTA 4MRIA 4MBUA 4OC3A 3TOAA 1X12A 1AMPA 1HEEA 2J9AA 2OB0A 2Z11A 4FD5A 4BD9A 1N71A 1YGHA 2D4PA 2PJAA 4FWUA 4JWPA 1YK3A 2DXQA 4CRZB 1XF8A 1S5KA 2F7VA 5E96A 3QB8A 2GFQA 4KVOE 3KI9A 4KORA 1J4JA 4C2ZA 2C6CA 2FVGA 5LYLA 2G3TA 4R7MA 2AJ6A 2JEVA 3FEEA 5FVJA 5LYDA 4IAVA 5KTCA 1DE4C 1BPMA 2OZGA 3DDDA 4B11A 1M4LA 4H6ZA 4OC5A 4PQAA 2QIRA 1IICA 4Q36A 2FS5A 3SJXA 4AVAA 3F5BA 2BO9A 4C7HA 4HNYB 2X7BA 3PEIA 4CGLA 3LODA 4OAEA 3EY5A 3RZAA 3FIXA 2XEFA 4EMEA 4JXRA 5LRGA 2JLMA 2FCKA 3G3SA 3IEHA 3CXPA 4CAFA 3R96A 3K9TA 4MFLA 2REEA 4PK2A 4AB7A 1B6BA 2G9DA 1TF8A 3KHZA 2P6FA 3LWUA 2OZUA 2I00A 1S7KA 1PU9A 4A37A 2C6GA 4P4JA 5EBVA 2PJ8A 2GLFA 3FXTA 2PIZA 2FIWA 4MFJA 5A28A 2V77A 2ZW5A 3JTKA 4MHDA 5LRKA 2HQYA 3D7HA 4J3GA 4UEFA 5LRJA 4F0XA 1FY7A 3NFZA 2YNDA 4CYPA 4MFKA 3KZWA 3PP9A 2RB7A 3IWWA 3A9LA 4GS4A 3TC8A 2B5GA 3E0KA 1KUVA 3TE4A 2YNCA 2BSWA 5AG5A 5IV0A 4JYWA 1Z8TA 2GIVA 4R57A 4TNUA 1LAPA 4XPKA 3VATA 4JJXA 4A2ZA 4A31A 7CPAA 3IJ3A 3GIUA 5DWNA 5H84A 3ZZIA 1XIXA 4OP4A 1YREA 2C27A 1F57A 2V8GA 3D4UA 3D7DA 4PSXA 1CX8A 1YVKA 2B58A 3P2HA 4M6GA 8CPAA 2C1CA 5DS0A 5BWAB 1AYEA 4PSWA 4NCZA 4ZY1A 1UWYA 1YLEA 1WK4A 1Y9KA 3MN8A 2WPXA 2GANA 3PFOA 1Z4EA 3PRTA 4OIDA 4M85A 4OC0A 5DWMA 3T9YA 4NJRA 4CYOA 4NSQA 2PJ4A 1IIDA 2O28A 2VQYA 1SQHA 2Z10A 1S7NA 5K8PA 4P45A 4X8IA 2AFOA 3FRMA 4R3LA 2VXKA 3FEDA 2WSAA 2RFHA 2HC9A 2HV2A 4PK3A 4OLLA 4UF4A 3EFAA 4B10A 3KQZA 3NE7A 1Y0YA 4X5KA 3VWDA 3MGDA 4R9MA 4ZI6A 3W6XA 2POKA 1M4GA 2PDOA 4MHNA 2PJ3A 4MCSA 3JRUA 4ONWA 5F47A 1IB1E 2VBQA 4B5PA 2VEZA 5AGEA 1ARMA 4NJQA 4MY0A 4WWVA 1M4DA 2Z0ZA 2JBJA 4GXHA 1DTDA 4MCQA 3D7GA 4M6IA 4B13A 1YW4A 1H8LA 4IF5A 5K8MA 3PBBA 5D29A 2VL1A 1BPNA 2ZEOA 3CT9A 3GKRA 2QYVA 4H2KA 2Y0MA 2YGWA 3NA6A 4A94A 1ELLP 4AVCA 5THWA 3R1KA 5HXDA 1XJOA 1ON0A 5AG4A 1GHEA 2PE3A 3P2FA 1AUGA 1XFOA 4YFJA 4MCPA 3IO1A 1TIQA 4UFWA 4A95A 1EE3P 3WT4A 1ZLIA 3MRUA 2Z3KA 3IGRA 2PQ8A 3B7IA 4NGMA 4XPLA 4E2AA 4DNCA 3DLJA 2GE3A 3OWCA 4UWIA 2Q4ZA 4KUBA 4EVYA 2PRQA 1ZG9A 2ZOFA 4A32A 4P10A 3TO6A 4NXYA 1MK4A 4MHZA 3FB3A 1ZO0A 2PIYA 2R1IA 1P0HA 1YMEA 4HNXB 4W9YA 1QSTA 2ZW4A 1YR0A 1QSOA 1S60A 2ZW7A 3D67A 4CAXA 2Q7SA 2B4BA 2K5TA 2JBKA 3QAYA 4JXQA 2B5GB 4JZ0A 1VGYA 1IYLA 4UBRA 4B6ZA 3R95A 4RS2A 4K30A 1IGBA 4TWEA 2ZEGA 4OMEA 2V8HA 4KUAA 3SI2A 1XE4A 1Z8WA 2P6GA 3HUVA 2HUZA 4MFPA 4P4DA 2PJ1A 3VH9A 3VWEA 2FIAA 4R3KA 2PJ2A 1Y7EA 5H86A 1NSLA 2Q7BA 3FJUA 1TF9A 4KOWA 2B3UA 2ABZA 2PJCA 1UFHA 3K2KA 2C6PA 3CDXA 4XNHB 1TKHA 2WZNA 3BI1A 3JUWA 4PXDA 5JH9A 2DPTA 2B4DA 3BXMA 3KHXA 5ISVA 2ZENA 4HPSA 2KCWA 3FX6A 3GUXA 4CAVA 1RO5A 1Y0RA 4UCNA 1YLOA 2ARHA 2CY2A 3DSBA 2EWBA 3L2NA 3S6GA 3N5FA 2NSMA 1NMTA 4KLVA 4UA3A 1LAMA 4U9YA 1BLLE 3I9SA 5K8NA 1ZG8A 4KOXA 3LACA 4AVBA 4MHPA 5G20A 1Q2CA 1M1DA 1VHSA 3H8FA 4YU9A 3FMCA 4NGTA 3H5ZA 2AFMA 4B5PB 4ONUA 3DR6A 1XMTA 4CGPA 2Z3MA 1S3ZA 3TTHA 1QMUA 3D66A 4EFDA 2AE6A 2OOTA 1S7FA 2OH1A 1BAVA 3TCVA 2Q43A 1BO4A 4UIAA 3GYAA 3R9FA 2NYQA 1LCPA 3IC1A 1WWZA 1FT7A 1I12A 4KSFA 3B3WA 3D3SA 4U5YA 5CNPA 5CPAA 3D2MA 1YW6A 4BMHA 4Z65A 2IJZA 2XEGA 1YX0A 4JD6A 2DEAA 2IL4A 2ZW6A 3SHPA 4MXUA 2YNEA 1Z4RA 2O4HA 2P6EA 3H8GA 2Q4VA 3D2PA 4IK2A 4LQ6A 4OADA 3VARA 4YGOA 3K9UA 4I49A 4UCMA 2EBJA 3R9EA 4F6AA 3D68A 2BUEA 1Q2YA 1CP7A 1XBUA 1Z5RA 5F46A 2FXFA 3WABA 4M3SA 5JM6A 2HB6A 1RXTA 4OIWA 1JWQA 3DGVA 2DPSA 2DF5A 3GY9A 1F2OA 2GREA 4CGNA 2PJ7A 3KR4A 3V7ZA 5IX3A 1MJBA 2PC1A 2AFXA 1OBRA 2XEJA 4LX9A 5G22A 1CPXA 3PB9X 1IY7A 2ATRA 5HH1A 1M44A 1OZPA 4C7IA 4DYOA 1IYKA 2JDDA 3BJ8A 4R87A 3S6HA 3ZJ0A 3JVNA 3KL9A 2BL1A 1B87A 1TXRA 2Q04A 4P4EA 4A30A 1ZG7A 5LYIA 4FD7A 4RI1A 5IB9A 3B3SA 2H5MA 1TKJA 3DNSA 3DR8A 4CGOA 5K8OA 2R7HA 4FD4A 3PB4X 4UEEA 4P4BA 4FD6A 4X2TA 3CPXA 5EC4A 3CZXA 4YWYA 3S6KA 5D8NA 3WC5A 1IU8A 1CPSA 2PCUA 2QMLA 1U6MA 3EXNA 4KSIA 4F9VA 5A27A 3I1UA 2Z3NA 4QB9A 5C88A 3WC7A 3PZJA 4Y49B 3KASA 5J1QA 3F8KA 3T8WA 3B3TA 2EVNA 1V0CA 3H4QA 1CG2A 4A38A 2R98A 3QAHA 1Q2DA 4HKFA 2FE7A 3IIBA 4NGRA 2I79A 2PJ0A 2G3AA 3IU1A 2WYRA 3ISXA 3V38A 1HDQA 2V8VA 5C82A 4ZX9A 2ZEHA 3TO9A 4G1PA 1XMBA 2BEIA 2BCOA 2ZELA 4PXCA 1XOVA 4C2YA 4CAEA 1QSRA 1Y9WA 2PR8A 2PVVA 1LANA 3IWGA 2EO8A 1P4NA 2EK9A 2ZOGA 2ZPAA 1R57A 2CTCA 5F48A 4OC1A 5G1ZA 4P44A 3D8PA 4OC2A 2CXAA 3ISZA 4ZY0A 4MI4A 3IWEA 2D4OA 4PXBA 2AFSA 2WPWA 5CBMA 1YSJA 6CPAA 4UWJA 5JPHA 2FSRA 3NH5A 2B3VA 4CGMA 1PYTB 4OKOA 1XRYA 4M6HA 5F09A 4NF1A 3W91A 1PUAA 2CF4A 4QVTA 3S9LA 3PB8X 2FT0A 4Y49C 3GB0A 3TT2A 5ELYA 1MJ9A 2F5IA 4ZY2A 5I0CA 1ARLA 3H8EA 4NFRA 3RBUA 3PGPA 3B3VA 3LMSA 1Z8XA 2JDCA 4ZBGA 2Z3PA 5EMIA 3SI0A 1X10A 2CIJA 1TKFA 1NE9A 4B14A 2EUIA 1VIXA 2WUUA 1KUXA 3FYNA 3S9MA 1I21A 2QVPA 4PPZA 3W6SA 2O53A 4NEXA 4YRHA 4C2XA 4CYQA 2Z3OA 4CRYB 1VHOA 2CNTA 4PV6A 3CXQA 3QNVA 2ZEPA 1KZFA 3GLJA 4FBEA 3B8GA 4KLWA 3CPAA 4KS9A 2YNCC 3RNZA 2PJ5A 2F8HA 4JLYA 3KKWA 4F0YA 4A39A 4II9A 1R3NA 2V8DA 1FNOA 2REFA 2ZEDA 2GLJA 1Y7RA 2OU2A 4K3NA 3SJEA 4PXEA 4UFVA 4AG9A 4QBJA 4QC6A 2PR1A 3UY5A 4NGPA 1KUYA 2QECA 5G21A 3RYOA 4F9UA 3EC4A 4AG7A 4RN7A 3TFYA 3RAMA 3LD2A 3PBEA 2IMOA 3TOBA 1Q7LA 1A2ZA 1QSNA 3R9GA 2ZEFA 5F49A 5HVFA 3T90A 3BHXA 1ELMP 1I1DA 2VZZA 4XNHC 4HNWB 3FVLA 1PCAA 3FH4A 3PB7X 4KOSA 4P4IA 2XEIA 2GU2A 3N7ZA 4R6TA 4E0AA 4CAWA 1F2PA 4WJBA 2VI7A 3KR5A 1YVOA 1LRZA 2PJ6A 3NH8A 5KTDA 1CM0A 2QJ8A 2OZHA 5I4MA 2Z3LA 5GCNA 5J8CA 3EO4A 4MFQA 1K4JA 1KWMA 3WR7A 4XPDB 3SJGA 4ZYQA 2OR4A 2VZYA 4O23A 4KVME 5JQ4A 2CTBA 1ZLHA 1XEBA 3B3CA 4AXVA 4KOVA 5HVGA 4L89A 3D7FA 4H89A 4FUUA 4OC4A 4ZGYB 3IFEA 2J8MA 4LUAA 4X3RA 4IHMA 1NSAA 1M4IA 4NGNA 3KQXA 1R43A 4MHYA 2FL4A 4KSAA 4ZX8A 2Q51A 1CBXA 3FNCA 1CP6A 4UCPA 3C26A 4KOTA 4UIBA 4RUHA 4NGSA 1Z8LA 1GYTA 3SXOA 4QUSA 1LOKA 2ODFA 1RTQA 4L8AA 2CNSA 3SJFA 2AFZA 5LYFA 1L0CA 4A33A 3RO0A 4C68A 2RC4A 3HLPA 5KTAA 3NE8A 3FF3A 4IUSA 1Z9UA 4ORFA 1Z2LA 4XPDC 3V8IA 3G8WA 2JEWA 2BOAA 4P6YA 2PVWA 3BI0A 5HVHA 1YQEA 4MJ8A 5IB0A 2B4DB 3B2YA 5AG6A 2R8VA 3PFEA 2IQ6A 1VKCA 4MY3A 3S9NA 4GM5A 2Q4YA 1LFWA 3FBUA 1MJAA 2J8RA 3IU2A 4KOUA 4KVXA 3SXNA 3I3GA 2PSWA 2CNMA 4KOYA 5JGFA 3F0AA 4LQGA 4BBHA 1IOIA 5HMNA 3NH4A 3B35A 4FAIA 4B5OA 4MFZA 2PRBA 2Q44A 1QSMA 4R8FA 3BLNA 4CPAA 1HDUA 2AFUA 1CJWA 3TX8A 2ZEMA 4P4FA 3WC6A
chains in the Genus database with same CATH topology
1A2ZA 1IOFA 3GIUA 1AUGA 4HPSA 2DF5A 1Z8WA 3LACA 3RNZA 4GXHA 2EO8A 1IOIA 1Z8XA 2EBJA 3RO0A 1X10A 1X12A 1IU8A 1Z8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2Z A;  1IOF A;  3GIU A;  1AUG A;  4HPS A;  2DF5 A;  1Z8W A;  3LAC A;  3RNZ A;  4GXH A;  2EO8 A;  1IOI A;  1Z8X A;  2EBJ A;  3RO0 A;  1X10 A;  1X12 A;  1IU8 A;  1Z8T A; 
#chains in the Genus database with same CATH topology
 3S6F A;  1IOF A;  2Q0Y A;  4DUK A;  1S7L A;  3KGQ A;  4BIN A;  4KZT A;  4CS0 B;  3BJ7 A;  1VHE A;  4R76 A;  4H6U A;  2P0W A;  4CYN A;  3CXS A;  4UFX A;  4Q38 A;  4NGQ A;  4Q7A A;  2G0B A;  4UEZ A;  2J8N A;  5AG7 A;  3SI1 A;  2ANP A;  4DJL A;  5J8F A;  3PB6 X;  4E8O A;  2ZXV A;  1BOB A;  4MMO A;  2PJ9 A;  3TO7 A;  4F8Z A;  3FEC A;  4EWT A;  4B12 A;  2PJB A;  2ZEE A;  1JQG A;  2AFW A;  2A4N A;  2EK8 A;  2I3C A;  4MCR A;  4U9Z A;  1QQ9 A;  2NMT A;  4MRI A;  4MBU A;  4OC3 A;  3TOA A;  1X12 A;  1AMP A;  1HEE A;  2J9A A;  2OB0 A;  2Z11 A;  4FD5 A;  4BD9 A;  1N71 A;  1YGH A;  2D4P A;  2PJA A;  4FWU A;  4JWP A;  1YK3 A;  2DXQ A;  4CRZ B;  1XF8 A;  1S5K A;  2F7V A;  5E96 A;  3QB8 A;  2GFQ A;  4KVO E;  3KI9 A;  4KOR A;  1J4J A;  4C2Z A;  2C6C A;  2FVG A;  5LYL A;  2G3T A;  4R7M A;  2AJ6 A;  2JEV A;  3FEE A;  5FVJ A;  5LYD A;  4IAV A;  5KTC A;  1DE4 C;  1BPM A;  2OZG A;  3DDD A;  4B11 A;  1M4L A;  4H6Z A;  4OC5 A;  4PQA A;  2QIR A;  1IIC A;  4Q36 A;  2FS5 A;  3SJX A;  4AVA A;  3F5B A;  2BO9 A;  4C7H A;  4HNY B;  2X7B A;  3PEI A;  4CGL A;  3LOD A;  4OAE A;  3EY5 A;  3RZA A;  3FIX A;  2XEF A;  4EME A;  4JXR A;  5LRG A;  2JLM A;  2FCK A;  3G3S A;  3IEH A;  3CXP A;  4CAF A;  3R96 A;  3K9T A;  4MFL A;  2REE A;  4PK2 A;  4AB7 A;  1B6B A;  2G9D A;  1TF8 A;  3KHZ A;  2P6F A;  3LWU A;  2OZU A;  2I00 A;  1S7K A;  1PU9 A;  4A37 A;  2C6G A;  4P4J A;  5EBV A;  2PJ8 A;  2GLF A;  3FXT A;  2PIZ A;  2FIW A;  4MFJ A;  5A28 A;  2V77 A;  2ZW5 A;  3JTK A;  4MHD A;  5LRK A;  2HQY A;  3D7H A;  4J3G A;  4UEF A;  5LRJ A;  4F0X A;  1FY7 A;  3NFZ A;  2YND A;  4CYP A;  4MFK A;  3KZW A;  3PP9 A;  2RB7 A;  3IWW A;  3A9L A;  4GS4 A;  3TC8 A;  2B5G A;  3E0K A;  1KUV A;  3TE4 A;  2YNC A;  2BSW A;  5AG5 A;  5IV0 A;  4JYW A;  1Z8T A;  2GIV A;  4R57 A;  4TNU A;  1LAP A;  4XPK A;  3VAT A;  4JJX A;  4A2Z A;  4A31 A;  7CPA A;  3IJ3 A;  3GIU A;  5DWN A;  5H84 A;  3ZZI A;  1XIX A;  4OP4 A;  1YRE A;  2C27 A;  1F57 A;  2V8G A;  3D4U A;  3D7D A;  4PSX A;  1CX8 A;  1YVK A;  2B58 A;  3P2H A;  4M6G A;  8CPA A;  2C1C A;  5DS0 A;  5BWA B;  1AYE A;  4PSW A;  4NCZ A;  4ZY1 A;  1UWY A;  1YLE A;  1WK4 A;  1Y9K A;  3MN8 A;  2WPX A;  2GAN A;  3PFO A;  1Z4E A;  3PRT A;  4OID A;  4M85 A;  4OC0 A;  5DWM A;  3T9Y A;  4NJR A;  4CYO A;  4NSQ A;  2PJ4 A;  1IID A;  2O28 A;  2VQY A;  1SQH A;  2Z10 A;  1S7N A;  5K8P A;  4P45 A;  4X8I A;  2AFO A;  3FRM A;  4R3L A;  2VXK A;  3FED A;  2WSA A;  2RFH A;  2HC9 A;  2HV2 A;  4PK3 A;  4OLL A;  4UF4 A;  3EFA A;  4B10 A;  3KQZ A;  3NE7 A;  1Y0Y A;  4X5K A;  3VWD A;  3MGD A;  4R9M A;  4ZI6 A;  3W6X A;  2POK A;  1M4G A;  2PDO A;  4MHN A;  2PJ3 A;  4MCS A;  3JRU A;  4ONW A;  5F47 A;  1IB1 E;  2VBQ A;  4B5P A;  2VEZ A;  5AGE A;  1ARM A;  4NJQ A;  4MY0 A;  4WWV A;  1M4D A;  2Z0Z A;  2JBJ A;  4GXH A;  1DTD A;  4MCQ A;  3D7G A;  4M6I A;  4B13 A;  1YW4 A;  1H8L A;  4IF5 A;  5K8M A;  3PBB A;  5D29 A;  2VL1 A;  1BPN A;  2ZEO A;  3CT9 A;  3GKR A;  2QYV A;  4H2K A;  2Y0M A;  2YGW A;  3NA6 A;  4A94 A;  1ELL P;  4AVC A;  5THW A;  3R1K A;  5HXD A;  1XJO A;  1ON0 A;  5AG4 A;  1GHE A;  2PE3 A;  3P2F A;  1AUG A;  1XFO A;  4YFJ A;  4MCP A;  3IO1 A;  1TIQ A;  4UFW A;  4A95 A;  1EE3 P;  3WT4 A;  1ZLI A;  3MRU A;  2Z3K A;  3IGR A;  2PQ8 A;  3B7I A;  4NGM A;  4XPL A;  4E2A A;  4DNC A;  3DLJ A;  2GE3 A;  3OWC A;  4UWI A;  2Q4Z A;  4KUB A;  4EVY A;  2PRQ A;  1ZG9 A;  2ZOF A;  4A32 A;  4P10 A;  3TO6 A;  4NXY A;  1MK4 A;  4MHZ A;  3FB3 A;  1ZO0 A;  2PIY A;  2R1I A;  1P0H A;  1YME A;  4HNX B;  4W9Y A;  1QST A;  2ZW4 A;  1YR0 A;  1QSO A;  1S60 A;  2ZW7 A;  3D67 A;  4CAX A;  2Q7S A;  2B4B A;  2K5T A;  2JBK A;  3QAY A;  4JXQ A;  2B5G B;  4JZ0 A;  1VGY A;  1IYL A;  4UBR A;  4B6Z A;  3R95 A;  4RS2 A;  4K30 A;  1IGB A;  4TWE A;  2ZEG A;  4OME A;  2V8H A;  4KUA A;  3SI2 A;  1XE4 A;  1Z8W A;  2P6G A;  3HUV A;  2HUZ A;  4MFP A;  4P4D A;  2PJ1 A;  3VH9 A;  3VWE A;  2FIA A;  4R3K A;  2PJ2 A;  1Y7E A;  5H86 A;  1NSL A;  2Q7B A;  3FJU A;  1TF9 A;  4KOW A;  2B3U A;  2ABZ A;  2PJC A;  1UFH A;  3K2K A;  2C6P A;  3CDX A;  4XNH B;  1TKH A;  2WZN A;  3BI1 A;  3JUW A;  4PXD A;  5JH9 A;  2DPT A;  2B4D A;  3BXM A;  3KHX A;  5ISV A;  2ZEN A;  4HPS A;  2KCW A;  3FX6 A;  3GUX A;  4CAV A;  1RO5 A;  1Y0R A;  4UCN A;  1YLO A;  2ARH A;  2CY2 A;  3DSB A;  2EWB A;  3L2N A;  3S6G A;  3N5F A;  2NSM A;  1NMT A;  4KLV A;  4UA3 A;  1LAM A;  4U9Y A;  1BLL E;  3I9S A;  5K8N A;  1ZG8 A;  4KOX A;  3LAC A;  4AVB A;  4MHP A;  5G20 A;  1Q2C A;  1M1D A;  1VHS A;  3H8F A;  4YU9 A;  3FMC A;  4NGT A;  3H5Z A;  2AFM A;  4B5P B;  4ONU A;  3DR6 A;  1XMT A;  4CGP A;  2Z3M A;  1S3Z A;  3TTH A;  1QMU A;  3D66 A;  4EFD A;  2AE6 A;  2OOT A;  1S7F A;  2OH1 A;  1BAV A;  3TCV A;  2Q43 A;  1BO4 A;  4UIA A;  3GYA A;  3R9F A;  2NYQ A;  1LCP A;  3IC1 A;  1WWZ A;  1FT7 A;  1I12 A;  4KSF A;  3B3W A;  3D3S A;  4U5Y A;  5CNP A;  5CPA A;  3D2M A;  1YW6 A;  4BMH A;  4Z65 A;  2IJZ A;  2XEG A;  1YX0 A;  4JD6 A;  2DEA A;  2IL4 A;  2ZW6 A;  3SHP A;  4MXU A;  2YNE A;  1Z4R A;  2O4H A;  2P6E A;  3H8G A;  2Q4V A;  3D2P A;  4IK2 A;  4LQ6 A;  4OAD A;  3VAR A;  4YGO A;  3K9U A;  4I49 A;  4UCM A;  2EBJ A;  3R9E A;  4F6A A;  3D68 A;  2BUE A;  1Q2Y A;  1CP7 A;  1XBU A;  1Z5R A;  5F46 A;  2FXF A;  3WAB A;  4M3S A;  5JM6 A;  2HB6 A;  1RXT A;  4OIW A;  1JWQ A;  3DGV A;  2DPS A;  2DF5 A;  3GY9 A;  1F2O A;  2GRE A;  4CGN A;  2PJ7 A;  3KR4 A;  3V7Z A;  5IX3 A;  1MJB A;  2PC1 A;  2AFX A;  1OBR A;  2XEJ A;  4LX9 A;  5G22 A;  1CPX A;  3PB9 X;  1IY7 A;  2ATR A;  5HH1 A;  1M44 A;  1OZP A;  4C7I A;  4DYO A;  1IYK A;  2JDD A;  3BJ8 A;  4R87 A;  3S6H A;  3ZJ0 A;  3JVN A;  3KL9 A;  2BL1 A;  1B87 A;  1TXR A;  2Q04 A;  4P4E A;  4A30 A;  1ZG7 A;  5LYI A;  4FD7 A;  4RI1 A;  5IB9 A;  3B3S A;  2H5M A;  1TKJ A;  3DNS A;  3DR8 A;  4CGO A;  5K8O A;  2R7H A;  4FD4 A;  3PB4 X;  4UEE A;  4P4B A;  4FD6 A;  4X2T A;  3CPX A;  5EC4 A;  3CZX A;  4YWY A;  3S6K A;  5D8N A;  3WC5 A;  1IU8 A;  1CPS A;  2PCU A;  2QML A;  1U6M A;  3EXN A;  4KSI A;  4F9V A;  5A27 A;  3I1U A;  2Z3N A;  4QB9 A;  5C88 A;  3WC7 A;  3PZJ A;  4Y49 B;  3KAS A;  5J1Q A;  3F8K A;  3T8W A;  3B3T A;  2EVN A;  1V0C A;  3H4Q A;  1CG2 A;  4A38 A;  2R98 A;  3QAH A;  1Q2D A;  4HKF A;  2FE7 A;  3IIB A;  4NGR A;  2I79 A;  2PJ0 A;  2G3A A;  3IU1 A;  2WYR A;  3ISX A;  3V38 A;  1HDQ A;  2V8V A;  5C82 A;  4ZX9 A;  2ZEH A;  3TO9 A;  4G1P A;  1XMB A;  2BEI A;  2BCO A;  2ZEL A;  4PXC A;  1XOV A;  4C2Y A;  4CAE A;  1QSR A;  1Y9W A;  2PR8 A;  2PVV A;  1LAN A;  3IWG A;  2EO8 A;  1P4N A;  2EK9 A;  2ZOG A;  2ZPA A;  1R57 A;  2CTC A;  5F48 A;  4OC1 A;  5G1Z A;  4P44 A;  3D8P A;  4OC2 A;  2CXA A;  3ISZ A;  4ZY0 A;  4MI4 A;  3IWE A;  2D4O A;  4PXB A;  2AFS A;  2WPW A;  5CBM A;  1YSJ A;  6CPA A;  4UWJ A;  5JPH A;  2FSR A;  3NH5 A;  2B3V A;  4CGM A;  1PYT B;  4OKO A;  1XRY A;  4M6H A;  5F09 A;  4NF1 A;  3W91 A;  1PUA A;  2CF4 A;  4QVT A;  3S9L A;  3PB8 X;  2FT0 A;  4Y49 C;  3GB0 A;  3TT2 A;  5ELY A;  1MJ9 A;  2F5I A;  4ZY2 A;  5I0C A;  1ARL A;  3H8E A;  4NFR A;  3RBU A;  3PGP A;  3B3V A;  3LMS A;  1Z8X A;  2JDC A;  4ZBG A;  2Z3P A;  5EMI A;  3SI0 A;  1X10 A;  2CIJ A;  1TKF A;  1NE9 A;  4B14 A;  2EUI A;  1VIX A;  2WUU A;  1KUX A;  3FYN A;  3S9M A;  1I21 A;  2QVP A;  4PPZ A;  3W6S A;  2O53 A;  4NEX A;  4YRH A;  4C2X A;  4CYQ A;  2Z3O A;  4CRY B;  1VHO A;  2CNT A;  4PV6 A;  3CXQ A;  3QNV A;  2ZEP A;  1KZF A;  3GLJ A;  4FBE A;  3B8G A;  4KLW A;  3CPA A;  4KS9 A;  2YNC C;  3RNZ A;  2PJ5 A;  2F8H A;  4JLY A;  3KKW A;  4F0Y A;  4A39 A;  4II9 A;  1R3N A;  2V8D A;  1FNO A;  2REF A;  2ZED A;  2GLJ A;  1Y7R A;  2OU2 A;  4K3N A;  3SJE A;  4PXE A;  4UFV A;  4AG9 A;  4QBJ A;  4QC6 A;  2PR1 A;  3UY5 A;  4NGP A;  1KUY A;  2QEC A;  5G21 A;  3RYO A;  4F9U A;  3EC4 A;  4AG7 A;  4RN7 A;  3TFY A;  3RAM A;  3LD2 A;  3PBE A;  2IMO A;  3TOB A;  1Q7L A;  1A2Z A;  1QSN A;  3R9G A;  2ZEF A;  5F49 A;  5HVF A;  3T90 A;  3BHX A;  1ELM P;  1I1D A;  2VZZ A;  4XNH C;  4HNW B;  3FVL A;  1PCA A;  3FH4 A;  3PB7 X;  4KOS A;  4P4I A;  2XEI A;  2GU2 A;  3N7Z A;  4R6T A;  4E0A A;  4CAW A;  1F2P A;  4WJB A;  2VI7 A;  3KR5 A;  1YVO A;  1LRZ A;  2PJ6 A;  3NH8 A;  5KTD A;  1CM0 A;  2QJ8 A;  2OZH A;  5I4M A;  2Z3L A;  5GCN A;  5J8C A;  3EO4 A;  4MFQ A;  1K4J A;  1KWM A;  3WR7 A;  4XPD B;  3SJG A;  4ZYQ A;  2OR4 A;  2VZY A;  4O23 A;  4KVM E;  5JQ4 A;  2CTB A;  1ZLH A;  1XEB A;  3B3C A;  4AXV A;  4KOV A;  5HVG A;  4L89 A;  3D7F A;  4H89 A;  4FUU A;  4OC4 A;  4ZGY B;  3IFE A;  2J8M A;  4LUA A;  4X3R A;  4IHM A;  1NSA A;  1M4I A;  4NGN A;  3KQX A;  1R43 A;  4MHY A;  2FL4 A;  4KSA A;  4ZX8 A;  2Q51 A;  1CBX A;  3FNC A;  1CP6 A;  4UCP A;  3C26 A;  4KOT A;  4UIB A;  4RUH A;  4NGS A;  1Z8L A;  1GYT A;  3SXO A;  4QUS A;  1LOK A;  2ODF A;  1RTQ A;  4L8A A;  2CNS A;  3SJF A;  2AFZ A;  5LYF A;  1L0C A;  4A33 A;  3RO0 A;  4C68 A;  2RC4 A;  3HLP A;  5KTA A;  3NE8 A;  3FF3 A;  4IUS A;  1Z9U A;  4ORF A;  1Z2L A;  4XPD C;  3V8I A;  3G8W A;  2JEW A;  2BOA A;  4P6Y A;  2PVW A;  3BI0 A;  5HVH A;  1YQE A;  4MJ8 A;  5IB0 A;  2B4D B;  3B2Y A;  5AG6 A;  2R8V A;  3PFE A;  2IQ6 A;  1VKC A;  4MY3 A;  3S9N A;  4GM5 A;  2Q4Y A;  1LFW A;  3FBU A;  1MJA A;  2J8R A;  3IU2 A;  4KOU A;  4KVX A;  3SXN A;  3I3G A;  2PSW A;  2CNM A;  4KOY A;  5JGF A;  3F0A A;  4LQG A;  4BBH A;  1IOI A;  5HMN A;  3NH4 A;  3B35 A;  4FAI A;  4B5O A;  4MFZ A;  2PRB A;  2Q44 A;  1QSM A;  4R8F A;  3BLN A;  4CPA A;  1HDU A;  2AFU A;  1CJW A;  3TX8 A;  2ZEM A;  4P4F A;  3WC6 A; 
#chains in the Genus database with same CATH homology
 1A2Z A;  1IOF A;  3GIU A;  1AUG A;  4HPS A;  2DF5 A;  1Z8W A;  3LAC A;  3RNZ A;  4GXH A;  2EO8 A;  1IOI A;  1Z8X A;  2EBJ A;  3RO0 A;  1X10 A;  1X12 A;  1IU8 A;  1Z8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...