1X10A

Structure of mutant pyrrolidone carboxyl peptidase (e192a) from a hyperthermophile, pyrococcus furiosus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMALEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 69
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1x10A00
1IOIA 4HPSA 1AUGA 1Z8XA 2DF5A 1Z8WA 2EO8A 2EBJA 3LACA 1A2ZA 3GIUA 4GXHA 3RO0A 3RNZA 1IU8A 1X12A 1X10A 1IOFA 1Z8TA
chains in the Genus database with same CATH superfamily
3V8IA 4OP4A 4E0AA 3H8FA 3FEEA 3PGPA 4OC3A 2OR4A 2ZELA 3LODA 1YX0A 2PIYA 5EC4A 1FNOA 2HC9A 3SJFA 2CTCA 2Z3NA 4X2TA 5D29A 4E2AA 2G3TA 2X7BA 5DS0A 4CRYB 5ISVA 2AFMA 3DNSA 3D7DA 4P44A 2Z3OA 2C6CA 2P6GA 2R8VA 3GLJA 4NF1A 3TO6A 1UWYA 3BHXA 2ZEDA 2C6PA 4QVTA 3S6GA 3CXSA 3TT2A 3VARA 5K8NA 1JQGA 3LACA 4KOTA 3B35A 3S9LA 2Z3KA 4UWJA 2FIAA 3IEHA 2QECA 4II9A 4OADA 4P45A 1Y7EA 2PSWA 5LYIA 1S7NA 2PJ3A 2IL4A 4UCPA 4MCRA 5F47A 4YWYA 4UIAA 1R57A 3BXMA 4ZX8A 2CIJA 3B8GA 4UFWA 2J9AA 2P6FA 3CDXA 5AG7A 4ONWA 4BD9A 1IY7A 3KHZA 5A27A 2J8MA 2PJ8A 5D8NA 3SI1A 1KUXA 1KUVA 2ZPAA 1VHSA 2FIWA 4XPKA 4KORA 1Q2DA 2FSRA 2V8GA 3D2PA 2Q4YA 2WUUA 3D7HA 2GFQA 2Q0YA 2JLMA 1BPNA 2CNTA 5H84A 3IWGA 4ZYQA 2BL1A 4J3GA 1BO4A 1VIXA 2D4PA 4NCZA 4FAIA 2Q51A 3VATA 1CG2A 4P4FA 2PIZA 3CPAA 3ISXA 5K8OA 1AYEA 2PJ7A 1ZLIA 1LCPA 3BI1A 4CRZB 1HEEA 2QVPA 2ZEPA 4UA3A 1KWMA 3QB8A 4WJBA 2FXFA 5C82A 1XRYA 2V8DA 4FWUA 2POKA 3DDDA 2F7VA 4Y49C 1CM0A 2OZGA 4X5KA 2Q04A 3MRUA 3RAMA 4A38A 4Z65A 5J8FA 4UIBA 4R6TA 2R98A 3D8PA 4RS2A 4UEEA 3BJ7A 3P2FA 2XEJA 3KGQA 4A30A 3ISZA 5I4MA 3V7ZA 1OBRA 5JH9A 1YVKA 4HKFA 5KTDA 3D67A 3PBEA 2VI7A 4CGNA 3LMSA 4NJRA 4M3SA 3VWDA 2AFZA 2YNDA 4MY0A 3SI2A 2ZW4A 2BO9A 4OIDA 2CNMA 2VL1A 2PR8A 4CYNA 1QSMA 2XEFA 4MHNA 2PQ8A 5LYFA 4CPAA 4MXUA 4TWEA 4ZY2A 4OLLA 1IU8A 4MCSA 3WT4A 3FNCA 2CNSA 3D2MA 4EVYA 4U5YA 5AGEA 2CTBA 1VHEA 3IWWA 4UF4A 1DTDA 1BLLE 1LOKA 2C27A 3D68A 4MFZA 4CAFA 1MJAA 1CPXA 3W6SA 2FE7A 5THWA 3NH8A 1TKFA 3PB6X 4KOSA 1XMTA 2PC1A 3H8GA 4YGOA 3SXNA 3KQZA 3R9GA 2PJ5A 2C6GA 2B58A 2PVWA 4A95A 4MMOA 4GS4A 3SJEA 1LANA 1NMTA 1XBUA 1HDUA 2AFWA 2WPWA 5IX3A 3PEIA 4KLVA 2B5GA 1RO5A 3IIBA 3WC6A 4C2YA 2AFUA 3NE8A 3TX8A 3B7IA 3I3GA 2H5MA 2Z11A 4ZI6A 1N71A 5LRKA 1YLOA 3FBUA 3FH4A 2BUEA 1R43A 1YVOA 4AVAA 3RZAA 1QQ9A 1LRZA 1RTQA 2Y0MA 4XPLA 2DPSA 4HNXB 2XEIA 2QYVA 1L0CA 1XE4A 2P0WA 3IWEA 1ARLA 3VWEA 1ZG8A 4OC4A 3S6KA 3PRTA 1F2OA 1XIXA 5HMNA 1Y7RA 4A39A 1PYTB 4DYOA 1VHOA 2ZOGA 3CXQA 3G8WA 3R9FA 2WPXA 4B5OA 3D7GA 2VXKA 1YQEA 2Q4VA 5DWNA 1WK4A 5I0CA 3RBUA 1X12A 3LWUA 3EY5A 1QSNA 4JYWA 4XPDB 3QNVA 5HVGA 1CBXA 1Y9KA 3H4QA 2JEVA 4EFDA 4UWIA 3MGDA 1JWQA 3A9LA 2I79A 1QMUA 2EVNA 3R1KA 4A2ZA 2G9DA 5JQ4A 3TC8A 1NE9A 1Z8WA 1NSAA 2Q7SA 2CXAA 4OIWA 1NSLA 2ZEEA 4NGNA 2ATRA 2GE3A 5K8MA 5F46A 4F9VA 3NH4A 3H8EA 4A37A 4AG9A 4KUBA 3K2KA 4MY3A 2EUIA 3FMCA 2VBQA 4G1PA 1IGBA 2HB6A 2FCKA 4A31A 3FX6A 4NJQA 2REEA 2PJ4A 3PFEA 2PRQA 4FD7A 4KSAA 1F2PA 4CGOA 4MFQA 3L2NA 4W9YA 1HDQA 3FYNA 5AG4A 1Y9WA 4F8ZA 3KZWA 2ZW6A 3S6HA 4A94A 4RI1A 1M4GA 4DJLA 5A28A 2VZZA 2ZW5A 4MI4A 3B3TA 5BWAB 3S9NA 1YW6A 2A4NA 2ARHA 3IO1A 4LQGA 4U9ZA 3DLJA 4CAVA 3FIXA 2JDDA 4XNHB 4JD6A 4M6IA 3DSBA 5J8CA 3D66A 1AMPA 1P4NA 1ZG9A 4R76A 4KLWA 5JM6A 4LX9A 3TFYA 2ABZA 4K3NA 4OC2A 2PJ1A 1LFWA 2PR1A 3MN8A 4KZTA 2O53A 2XEGA 1WWZA 3TO9A 3GUXA 2ZW7A 2ZXVA 5JGFA 2F8HA 4RN7A 2RB7A 2WZNA 3N7ZA 4MRIA 5F09A 2Z3LA 3B3CA 3TO7A 4DNCA 2EK8A 4B12A 4AXVA 3IC1A 4MHPA 4I49A 1BAVA 3G3SA 4E8OA 4A32A 3WC5A 2FS5A 3FB3A 4MFPA 3BLNA 2B4DA 2ZEHA 4B10A 4MFJA 5GCNA 2IQ6A 3HUVA 3IU2A 3IU1A 4F0XA 3JRUA 4LUAA 4KUAA 2JBKA 4B6ZA 4OMEA 1TF8A 1YREA 4MHZA 2EO8A 2PJ0A 2PJAA 4IK2A 3TCVA 1ARMA 4PXDA 4ZY1A 2JDCA 2KCWA 4PPZA 2WSAA 4K30A 5H86A 3DR6A 2K5TA 3VH9A 5CBMA 4PXCA 2G0BA 4HNYB 1GYTA 1X10A 1XJOA 3S6FA 2J8RA 3KKWA 1YLEA 4UFXA 2V8VA 1M1DA 4U9YA 2DEAA 3KI9A 2PRBA 4MCPA 4R9MA 5LRJA 5KTAA 2Z0ZA 2OU2A 3PP9A 4KOVA 4CGMA 2B3UA 3F0AA 1ZG7A 2QIRA 1EE3P 3CXPA 4FD5A 4OC1A 5ELYA 3B3SA 5G21A 4MCQA 1ELLP 5CPAA 2Q44A 1MK4A 3D4UA 1QSRA 1P0HA 1QSOA 1ZO0A 4H89A 4QUSA 1ON0A 4UFVA 1S60A 1BPMA 4B11A 2EBJA 5AG6A 3NA6A 1TXRA 1YW4A 4LQ6A 4GXHA 4EMEA 4EWTA 4JXRA 4B5PA 2FVGA 1MJBA 4Q38A 2ZOFA 1MJ9A 2Q4ZA 3B3VA 4IAVA 4PSXA 4B14A 2Q43A 3GB0A 4NGPA 2PDOA 4KSIA 1RXTA 3FEDA 4QC6A 3WR7A 3DR8A 1Z8LA 4KS9A 3FVLA 1IOIA 1I1DA 5IB0A 2EWBA 4F6AA 2HUZA 1YK3A 3D3SA 2AFXA 4HPSA 4PV6A 2V8HA 1AUGA 1S7LA 2Z10A 1IYKA 1XOVA 2VEZA 3ZZIA 1Y0YA 2RFHA 4UEFA 5EMIA 3SJXA 3T90A 4NXYA 2HQYA 2ODFA 2YGWA 3PZJA 4MFKA 1IYLA 3TOAA 4CAWA 5EBVA 3F8KA 4R3LA 4YRHA 5HH1A 2OOTA 3PB7X 1IICA 3RO0A 2BCOA 4O23A 3RNZA 3EXNA 4CYQA 6CPAA 4JJXA 1B6BA 1M4LA 2EK9A 4P4EA 4PK2A 4TNUA 3K9TA 5G20A 3PB9X 4P6YA 2ZEMA 5C88A 2VZYA 1S3ZA 2YNCC 3NE7A 1XMBA 4UCMA 3DGVA 4CAXA 1ZLHA 2GU2A 2RC4A 2ZEFA 3PBBA 2R7HA 3EC4A 4FBEA 3FJUA 3JTKA 5IB9A 3CT9A 4P10A 2CF4A 2GANA 3R96A 4M6GA 1XFOA 2NYQA 2Z3PA 3ZJ0A 1Q2CA 1PUAA 2OH1A 1J4JA 3R9EA 4L8AA 1Z5RA 4NSQA 3BI0A 2Q7BA 5K8PA 1A2ZA 2J8NA 3GIUA 1F57A 4R7MA 4BMHA 4BINA 5HVHA 3GYAA 2I3CA 4NGMA 4Y49B 3IGRA 4R3KA 3EO4A 1KUYA 1M4DA 2ZEOA 2BSWA 2AE6A 3FF3A 4MBUA 1CP7A 3D7FA 4ZGYB 1Y0RA 4ONUA 4R57A 1XF8A 4MJ8A 3PB4X 1LAMA 2JEWA 4GM5A 2BOAA 3QAYA 2B4BA 4C7HA 1CX8A 3W91A 3T9YA 4C2ZA 3V38A 3GY9A 1K4JA 3NH5A 4OKOA 4KVOE 3K9UA 4UCNA 2PJ9A 2OZHA 2PVVA 3FRMA 4P4JA 4UBRA 2QMLA 4JZ0A 1BOBA 4PXBA 2B3VA 1IB1E 4A33A 7CPAA 3C26A 2V77A 2R1IA 3CZXA 2IJZA 5F48A 5JPHA 2P6EA 3OWCA 4B13A 1YSJA 4PQAA 1VGYA 2B4DB 3LD2A 5HVFA 4F9UA 4FD6A 3RYOA 3N5FA 2F5IA 4IF5A 4IUSA 1UFHA 4NFRA 4ZY0A 4AG7A 4Q36A 4CAEA 3GKRA 4IHMA 4XPDC 4CGLA 1Z8XA 3SXOA 2I00A 1B87A 1XEBA 4ZBGA 2WYRA 4YU9A 4AB7A 5LYDA 2DXQA 4CGPA 4QB9A 4KOWA 3HLPA 3KHXA 4PXEA 4WWVA 1U6MA 2GLJA 4PSWA 1CPSA 5AG5A 3TOBA 3S9MA 4MHYA 2HV2A 1I21A 2D4OA 3W6XA 4QBJA 3IJ3A 4NGQA 5HXDA 2DPTA 3SI0A 4P4BA 3EFAA 2Z3MA 1GHEA 1IOFA 3SJGA 2C1CA 3FXTA 1TKJA 1FT7A 1Z2LA 4PK3A 5F49A 2ZENA 2ZEGA 1Q2YA 1VKCA 4KOXA 3JVNA 3I9SA 4CYOA 1S7KA 4X8IA 2REFA 3KR5A 1ELMP 2DF5A 2O28A 2B5GB 4KOYA 4B5PB 2PCUA 1CJWA 2QJ8A 2IMOA 1YMEA 5FVJA 4MHDA 5IV0A 5LYLA 3UY5A 1TF9A 4H6UA 4MFLA 1I12A 4C68A 4KSFA 4JLYA 4NEXA 4KOUA 4KVME 1R3NA 4Q7AA 3PB8X 3B3WA 1PU9A 1QSTA 1YGHA 4XNHC 3F5BA 1FY7A 3B2YA 1SQHA 1Z9UA 2PJ6A 4NGTA 4R87A 3R95A 3WC7A 1PCAA 5E96A 2YNCA 2PJ2A 2PE3A 3BJ8A 3FECA 2GLFA 3QAHA 2NMTA 1KZFA 8CPAA 1Z4RA 4NGSA 2OB0A 3IFEA 4CYPA 5G22A 4P4IA 3CPXA 3T8WA 3I1UA 4FD4A 5LRGA 1YR0A 4C7IA 2NSMA 2PJCA 1Z4EA 1Q7LA 4JWPA 4FUUA 3WABA 2GREA 1M44A 4OC5A 3PFOA 1LAPA 2OZUA 3TTHA 1M4IA 4X3RA 4M85A 3TE4A 4C2XA 4H2KA 1Z8TA 4H6ZA 1H8LA 2PJBA 3NFZA 5G1ZA 3KASA 4CS0B 4ORFA 4AVBA 1IIDA 4L89A 1CP6A 2YNEA 4HNWB 1TKHA 1OZPA 2AFOA 2AFSA 4NGRA 1TIQA 2AJ6A 2JBJA 1S7FA 5DWMA 3KL9A 2FL4A 2ANPA 1DE4C 2G3AA 4BBHA 2GIVA 3E0KA 3H5ZA 2BEIA 3SHPA 4F0YA 4UEZA 3KR4A 4M6HA 2CY2A 3P2HA 5KTCA 2VQYA 5J1QA 4P4DA 1S5KA 1V0CA 4OAEA 3KQXA 4JXQA 4ZX9A 4OC0A 5CNPA 4R8FA 4AVCA 4DUKA 3JUWA 4RUHA 4YFJA 2O4HA 2FT0A 4KVXA
chains in the Genus database with same CATH topology
1IOIA 4HPSA 1AUGA 1Z8XA 2DF5A 1Z8WA 2EO8A 2EBJA 3LACA 1A2ZA 3GIUA 4GXHA 3RO0A 3RNZA 1IU8A 1X12A 1X10A 1IOFA 1Z8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOI A;  4HPS A;  1AUG A;  1Z8X A;  2DF5 A;  1Z8W A;  2EO8 A;  2EBJ A;  3LAC A;  1A2Z A;  3GIU A;  4GXH A;  3RO0 A;  3RNZ A;  1IU8 A;  1X12 A;  1X10 A;  1IOF A;  1Z8T A; 
#chains in the Genus database with same CATH topology
 3V8I A;  4OP4 A;  4E0A A;  3H8F A;  3FEE A;  3PGP A;  4OC3 A;  2OR4 A;  2ZEL A;  3LOD A;  1YX0 A;  2PIY A;  5EC4 A;  1FNO A;  2HC9 A;  3SJF A;  2CTC A;  2Z3N A;  4X2T A;  5D29 A;  4E2A A;  2G3T A;  2X7B A;  5DS0 A;  4CRY B;  5ISV A;  2AFM A;  3DNS A;  3D7D A;  4P44 A;  2Z3O A;  2C6C A;  2P6G A;  2R8V A;  3GLJ A;  4NF1 A;  3TO6 A;  1UWY A;  3BHX A;  2ZED A;  2C6P A;  4QVT A;  3S6G A;  3CXS A;  3TT2 A;  3VAR A;  5K8N A;  1JQG A;  3LAC A;  4KOT A;  3B35 A;  3S9L A;  2Z3K A;  4UWJ A;  2FIA A;  3IEH A;  2QEC A;  4II9 A;  4OAD A;  4P45 A;  1Y7E A;  2PSW A;  5LYI A;  1S7N A;  2PJ3 A;  2IL4 A;  4UCP A;  4MCR A;  5F47 A;  4YWY A;  4UIA A;  1R57 A;  3BXM A;  4ZX8 A;  2CIJ A;  3B8G A;  4UFW A;  2J9A A;  2P6F A;  3CDX A;  5AG7 A;  4ONW A;  4BD9 A;  1IY7 A;  3KHZ A;  5A27 A;  2J8M A;  2PJ8 A;  5D8N A;  3SI1 A;  1KUX A;  1KUV A;  2ZPA A;  1VHS A;  2FIW A;  4XPK A;  4KOR A;  1Q2D A;  2FSR A;  2V8G A;  3D2P A;  2Q4Y A;  2WUU A;  3D7H A;  2GFQ A;  2Q0Y A;  2JLM A;  1BPN A;  2CNT A;  5H84 A;  3IWG A;  4ZYQ A;  2BL1 A;  4J3G A;  1BO4 A;  1VIX A;  2D4P A;  4NCZ A;  4FAI A;  2Q51 A;  3VAT A;  1CG2 A;  4P4F A;  2PIZ A;  3CPA A;  3ISX A;  5K8O A;  1AYE A;  2PJ7 A;  1ZLI A;  1LCP A;  3BI1 A;  4CRZ B;  1HEE A;  2QVP A;  2ZEP A;  4UA3 A;  1KWM A;  3QB8 A;  4WJB A;  2FXF A;  5C82 A;  1XRY A;  2V8D A;  4FWU A;  2POK A;  3DDD A;  2F7V A;  4Y49 C;  1CM0 A;  2OZG A;  4X5K A;  2Q04 A;  3MRU A;  3RAM A;  4A38 A;  4Z65 A;  5J8F A;  4UIB A;  4R6T A;  2R98 A;  3D8P A;  4RS2 A;  4UEE A;  3BJ7 A;  3P2F A;  2XEJ A;  3KGQ A;  4A30 A;  3ISZ A;  5I4M A;  3V7Z A;  1OBR A;  5JH9 A;  1YVK A;  4HKF A;  5KTD A;  3D67 A;  3PBE A;  2VI7 A;  4CGN A;  3LMS A;  4NJR A;  4M3S A;  3VWD A;  2AFZ A;  2YND A;  4MY0 A;  3SI2 A;  2ZW4 A;  2BO9 A;  4OID A;  2CNM A;  2VL1 A;  2PR8 A;  4CYN A;  1QSM A;  2XEF A;  4MHN A;  2PQ8 A;  5LYF A;  4CPA A;  4MXU A;  4TWE A;  4ZY2 A;  4OLL A;  1IU8 A;  4MCS A;  3WT4 A;  3FNC A;  2CNS A;  3D2M A;  4EVY A;  4U5Y A;  5AGE A;  2CTB A;  1VHE A;  3IWW A;  4UF4 A;  1DTD A;  1BLL E;  1LOK A;  2C27 A;  3D68 A;  4MFZ A;  4CAF A;  1MJA A;  1CPX A;  3W6S A;  2FE7 A;  5THW A;  3NH8 A;  1TKF A;  3PB6 X;  4KOS A;  1XMT A;  2PC1 A;  3H8G A;  4YGO A;  3SXN A;  3KQZ A;  3R9G A;  2PJ5 A;  2C6G A;  2B58 A;  2PVW A;  4A95 A;  4MMO A;  4GS4 A;  3SJE A;  1LAN A;  1NMT A;  1XBU A;  1HDU A;  2AFW A;  2WPW A;  5IX3 A;  3PEI A;  4KLV A;  2B5G A;  1RO5 A;  3IIB A;  3WC6 A;  4C2Y A;  2AFU A;  3NE8 A;  3TX8 A;  3B7I A;  3I3G A;  2H5M A;  2Z11 A;  4ZI6 A;  1N71 A;  5LRK A;  1YLO A;  3FBU A;  3FH4 A;  2BUE A;  1R43 A;  1YVO A;  4AVA A;  3RZA A;  1QQ9 A;  1LRZ A;  1RTQ A;  2Y0M A;  4XPL A;  2DPS A;  4HNX B;  2XEI A;  2QYV A;  1L0C A;  1XE4 A;  2P0W A;  3IWE A;  1ARL A;  3VWE A;  1ZG8 A;  4OC4 A;  3S6K A;  3PRT A;  1F2O A;  1XIX A;  5HMN A;  1Y7R A;  4A39 A;  1PYT B;  4DYO A;  1VHO A;  2ZOG A;  3CXQ A;  3G8W A;  3R9F A;  2WPX A;  4B5O A;  3D7G A;  2VXK A;  1YQE A;  2Q4V A;  5DWN A;  1WK4 A;  5I0C A;  3RBU A;  1X12 A;  3LWU A;  3EY5 A;  1QSN A;  4JYW A;  4XPD B;  3QNV A;  5HVG A;  1CBX A;  1Y9K A;  3H4Q A;  2JEV A;  4EFD A;  4UWI A;  3MGD A;  1JWQ A;  3A9L A;  2I79 A;  1QMU A;  2EVN A;  3R1K A;  4A2Z A;  2G9D A;  5JQ4 A;  3TC8 A;  1NE9 A;  1Z8W A;  1NSA A;  2Q7S A;  2CXA A;  4OIW A;  1NSL A;  2ZEE A;  4NGN A;  2ATR A;  2GE3 A;  5K8M A;  5F46 A;  4F9V A;  3NH4 A;  3H8E A;  4A37 A;  4AG9 A;  4KUB A;  3K2K A;  4MY3 A;  2EUI A;  3FMC A;  2VBQ A;  4G1P A;  1IGB A;  2HB6 A;  2FCK A;  4A31 A;  3FX6 A;  4NJQ A;  2REE A;  2PJ4 A;  3PFE A;  2PRQ A;  4FD7 A;  4KSA A;  1F2P A;  4CGO A;  4MFQ A;  3L2N A;  4W9Y A;  1HDQ A;  3FYN A;  5AG4 A;  1Y9W A;  4F8Z A;  3KZW A;  2ZW6 A;  3S6H A;  4A94 A;  4RI1 A;  1M4G A;  4DJL A;  5A28 A;  2VZZ A;  2ZW5 A;  4MI4 A;  3B3T A;  5BWA B;  3S9N A;  1YW6 A;  2A4N A;  2ARH A;  3IO1 A;  4LQG A;  4U9Z A;  3DLJ A;  4CAV A;  3FIX A;  2JDD A;  4XNH B;  4JD6 A;  4M6I A;  3DSB A;  5J8C A;  3D66 A;  1AMP A;  1P4N A;  1ZG9 A;  4R76 A;  4KLW A;  5JM6 A;  4LX9 A;  3TFY A;  2ABZ A;  4K3N A;  4OC2 A;  2PJ1 A;  1LFW A;  2PR1 A;  3MN8 A;  4KZT A;  2O53 A;  2XEG A;  1WWZ A;  3TO9 A;  3GUX A;  2ZW7 A;  2ZXV A;  5JGF A;  2F8H A;  4RN7 A;  2RB7 A;  2WZN A;  3N7Z A;  4MRI A;  5F09 A;  2Z3L A;  3B3C A;  3TO7 A;  4DNC A;  2EK8 A;  4B12 A;  4AXV A;  3IC1 A;  4MHP A;  4I49 A;  1BAV A;  3G3S A;  4E8O A;  4A32 A;  3WC5 A;  2FS5 A;  3FB3 A;  4MFP A;  3BLN A;  2B4D A;  2ZEH A;  4B10 A;  4MFJ A;  5GCN A;  2IQ6 A;  3HUV A;  3IU2 A;  3IU1 A;  4F0X A;  3JRU A;  4LUA A;  4KUA A;  2JBK A;  4B6Z A;  4OME A;  1TF8 A;  1YRE A;  4MHZ A;  2EO8 A;  2PJ0 A;  2PJA A;  4IK2 A;  3TCV A;  1ARM A;  4PXD A;  4ZY1 A;  2JDC A;  2KCW A;  4PPZ A;  2WSA A;  4K30 A;  5H86 A;  3DR6 A;  2K5T A;  3VH9 A;  5CBM A;  4PXC A;  2G0B A;  4HNY B;  1GYT A;  1X10 A;  1XJO A;  3S6F A;  2J8R A;  3KKW A;  1YLE A;  4UFX A;  2V8V A;  1M1D A;  4U9Y A;  2DEA A;  3KI9 A;  2PRB A;  4MCP A;  4R9M A;  5LRJ A;  5KTA A;  2Z0Z A;  2OU2 A;  3PP9 A;  4KOV A;  4CGM A;  2B3U A;  3F0A A;  1ZG7 A;  2QIR A;  1EE3 P;  3CXP A;  4FD5 A;  4OC1 A;  5ELY A;  3B3S A;  5G21 A;  4MCQ A;  1ELL P;  5CPA A;  2Q44 A;  1MK4 A;  3D4U A;  1QSR A;  1P0H A;  1QSO A;  1ZO0 A;  4H89 A;  4QUS A;  1ON0 A;  4UFV A;  1S60 A;  1BPM A;  4B11 A;  2EBJ A;  5AG6 A;  3NA6 A;  1TXR A;  1YW4 A;  4LQ6 A;  4GXH A;  4EME A;  4EWT A;  4JXR A;  4B5P A;  2FVG A;  1MJB A;  4Q38 A;  2ZOF A;  1MJ9 A;  2Q4Z A;  3B3V A;  4IAV A;  4PSX A;  4B14 A;  2Q43 A;  3GB0 A;  4NGP A;  2PDO A;  4KSI A;  1RXT A;  3FED A;  4QC6 A;  3WR7 A;  3DR8 A;  1Z8L A;  4KS9 A;  3FVL A;  1IOI A;  1I1D A;  5IB0 A;  2EWB A;  4F6A A;  2HUZ A;  1YK3 A;  3D3S A;  2AFX A;  4HPS A;  4PV6 A;  2V8H A;  1AUG A;  1S7L A;  2Z10 A;  1IYK A;  1XOV A;  2VEZ A;  3ZZI A;  1Y0Y A;  2RFH A;  4UEF A;  5EMI A;  3SJX A;  3T90 A;  4NXY A;  2HQY A;  2ODF A;  2YGW A;  3PZJ A;  4MFK A;  1IYL A;  3TOA A;  4CAW A;  5EBV A;  3F8K A;  4R3L A;  4YRH A;  5HH1 A;  2OOT A;  3PB7 X;  1IIC A;  3RO0 A;  2BCO A;  4O23 A;  3RNZ A;  3EXN A;  4CYQ A;  6CPA A;  4JJX A;  1B6B A;  1M4L A;  2EK9 A;  4P4E A;  4PK2 A;  4TNU A;  3K9T A;  5G20 A;  3PB9 X;  4P6Y A;  2ZEM A;  5C88 A;  2VZY A;  1S3Z A;  2YNC C;  3NE7 A;  1XMB A;  4UCM A;  3DGV A;  4CAX A;  1ZLH A;  2GU2 A;  2RC4 A;  2ZEF A;  3PBB A;  2R7H A;  3EC4 A;  4FBE A;  3FJU A;  3JTK A;  5IB9 A;  3CT9 A;  4P10 A;  2CF4 A;  2GAN A;  3R96 A;  4M6G A;  1XFO A;  2NYQ A;  2Z3P A;  3ZJ0 A;  1Q2C A;  1PUA A;  2OH1 A;  1J4J A;  3R9E A;  4L8A A;  1Z5R A;  4NSQ A;  3BI0 A;  2Q7B A;  5K8P A;  1A2Z A;  2J8N A;  3GIU A;  1F57 A;  4R7M A;  4BMH A;  4BIN A;  5HVH A;  3GYA A;  2I3C A;  4NGM A;  4Y49 B;  3IGR A;  4R3K A;  3EO4 A;  1KUY A;  1M4D A;  2ZEO A;  2BSW A;  2AE6 A;  3FF3 A;  4MBU A;  1CP7 A;  3D7F A;  4ZGY B;  1Y0R A;  4ONU A;  4R57 A;  1XF8 A;  4MJ8 A;  3PB4 X;  1LAM A;  2JEW A;  4GM5 A;  2BOA A;  3QAY A;  2B4B A;  4C7H A;  1CX8 A;  3W91 A;  3T9Y A;  4C2Z A;  3V38 A;  3GY9 A;  1K4J A;  3NH5 A;  4OKO A;  4KVO E;  3K9U A;  4UCN A;  2PJ9 A;  2OZH A;  2PVV A;  3FRM A;  4P4J A;  4UBR A;  2QML A;  4JZ0 A;  1BOB A;  4PXB A;  2B3V A;  1IB1 E;  4A33 A;  7CPA A;  3C26 A;  2V77 A;  2R1I A;  3CZX A;  2IJZ A;  5F48 A;  5JPH A;  2P6E A;  3OWC A;  4B13 A;  1YSJ A;  4PQA A;  1VGY A;  2B4D B;  3LD2 A;  5HVF A;  4F9U A;  4FD6 A;  3RYO A;  3N5F A;  2F5I A;  4IF5 A;  4IUS A;  1UFH A;  4NFR A;  4ZY0 A;  4AG7 A;  4Q36 A;  4CAE A;  3GKR A;  4IHM A;  4XPD C;  4CGL A;  1Z8X A;  3SXO A;  2I00 A;  1B87 A;  1XEB A;  4ZBG A;  2WYR A;  4YU9 A;  4AB7 A;  5LYD A;  2DXQ A;  4CGP A;  4QB9 A;  4KOW A;  3HLP A;  3KHX A;  4PXE A;  4WWV A;  1U6M A;  2GLJ A;  4PSW A;  1CPS A;  5AG5 A;  3TOB A;  3S9M A;  4MHY A;  2HV2 A;  1I21 A;  2D4O A;  3W6X A;  4QBJ A;  3IJ3 A;  4NGQ A;  5HXD A;  2DPT A;  3SI0 A;  4P4B A;  3EFA A;  2Z3M A;  1GHE A;  1IOF A;  3SJG A;  2C1C A;  3FXT A;  1TKJ A;  1FT7 A;  1Z2L A;  4PK3 A;  5F49 A;  2ZEN A;  2ZEG A;  1Q2Y A;  1VKC A;  4KOX A;  3JVN A;  3I9S A;  4CYO A;  1S7K A;  4X8I A;  2REF A;  3KR5 A;  1ELM P;  2DF5 A;  2O28 A;  2B5G B;  4KOY A;  4B5P B;  2PCU A;  1CJW A;  2QJ8 A;  2IMO A;  1YME A;  5FVJ A;  4MHD A;  5IV0 A;  5LYL A;  3UY5 A;  1TF9 A;  4H6U A;  4MFL A;  1I12 A;  4C68 A;  4KSF A;  4JLY A;  4NEX A;  4KOU A;  4KVM E;  1R3N A;  4Q7A A;  3PB8 X;  3B3W A;  1PU9 A;  1QST A;  1YGH A;  4XNH C;  3F5B A;  1FY7 A;  3B2Y A;  1SQH A;  1Z9U A;  2PJ6 A;  4NGT A;  4R87 A;  3R95 A;  3WC7 A;  1PCA A;  5E96 A;  2YNC A;  2PJ2 A;  2PE3 A;  3BJ8 A;  3FEC A;  2GLF A;  3QAH A;  2NMT A;  1KZF A;  8CPA A;  1Z4R A;  4NGS A;  2OB0 A;  3IFE A;  4CYP A;  5G22 A;  4P4I A;  3CPX A;  3T8W A;  3I1U A;  4FD4 A;  5LRG A;  1YR0 A;  4C7I A;  2NSM A;  2PJC A;  1Z4E A;  1Q7L A;  4JWP A;  4FUU A;  3WAB A;  2GRE A;  1M44 A;  4OC5 A;  3PFO A;  1LAP A;  2OZU A;  3TTH A;  1M4I A;  4X3R A;  4M85 A;  3TE4 A;  4C2X A;  4H2K A;  1Z8T A;  4H6Z A;  1H8L A;  2PJB A;  3NFZ A;  5G1Z A;  3KAS A;  4CS0 B;  4ORF A;  4AVB A;  1IID A;  4L89 A;  1CP6 A;  2YNE A;  4HNW B;  1TKH A;  1OZP A;  2AFO A;  2AFS A;  4NGR A;  1TIQ A;  2AJ6 A;  2JBJ A;  1S7F A;  5DWM A;  3KL9 A;  2FL4 A;  2ANP A;  1DE4 C;  2G3A A;  4BBH A;  2GIV A;  3E0K A;  3H5Z A;  2BEI A;  3SHP A;  4F0Y A;  4UEZ A;  3KR4 A;  4M6H A;  2CY2 A;  3P2H A;  5KTC A;  2VQY A;  5J1Q A;  4P4D A;  1S5K A;  1V0C A;  4OAE A;  3KQX A;  4JXQ A;  4ZX9 A;  4OC0 A;  5CNP A;  4R8F A;  4AVC A;  4DUK A;  3JUW A;  4RUH A;  4YFJ A;  2O4H A;  2FT0 A;  4KVX A; 
#chains in the Genus database with same CATH homology
 1IOI A;  4HPS A;  1AUG A;  1Z8X A;  2DF5 A;  1Z8W A;  2EO8 A;  2EBJ A;  3LAC A;  1A2Z A;  3GIU A;  4GXH A;  3RO0 A;  3RNZ A;  1IU8 A;  1X12 A;  1X10 A;  1IOF A;  1Z8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...