2WPWA

Tandem gnat protein from the clavulanic acid biosynthesis pathway (without accoa)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
336
structure length
328
Chain Sequence
TAGELEFVPLAANDDETVGQWLDLMALAAETGPRAAPPCNVDMVGSLRFAPPATALDDWVVRSGGRVVGALRLALPDGAPTARVDQLLVHPGRRRRGIGRALWAHARELARKHDRTTLTATVVESLPSGPAQDPGPAAFAAAMGAHRSDIPAGTHQWLDLDRHDPLADGVPAVPAGYSLVTWGTITPDEYAVPVSELELRAAQEVRTSYARQFETMRVGRGRRAYHTGAVHDATGALAGYTSVSKTTGNPAYALQGMTVVHREHRGHALGTLLKLANLEYVLRHEPEVRLVETANAEDNHPMIAVNAALGFEPYDRWVFWTAEAGPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ORF14
publication title Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 85
structure length 328
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wpwA00
4OLLA 4KOVA 5E96A 4F6AA 2JLMA 2QIRA 1KUYA 1MJ9A 1BO4A 2D4OA 1K4JA 4CAXA 2PC1A 3CXPA 1XEBA 3I9SA 3S6FA 4KZTA 3WR7A 4U5YA 4H89A 1YLEA 4B5PA 2CNMA 4BMHA 2AE6A 4NXYA 1P0HA 1GHEA 2D4PA 3S6KA 4JLYA 1KUXA 4KOTA 5IB0A 2P6FA 2J8RA 2R98A 1QSMA 2Q4VA 4PK2A 1R57A 5ISVA 2R1IA 2OU2A 4QVTA 1IYKA 3DR6A 2FXFA 3FIXA 3NE7A 1IYLA 1OZPA 2CY2A 2Z10A 3F0AA 2J8NA 4XNHC 4JXRA 3GYAA 3EO4A 3R9GA 2FL4A 5IV0A 4MI4A 2Z11A 4U9YA 5C88A 4AG9A 2OB0A 1N71A 4OAEA 3T90A 2NMTA 3TTHA 4I49A 2OZUA 2B4DA 4YGOA 3ZZIA 4NSQA 3S6GA 4M3SA 3H4QA 3PZJA 3SHPA 1Z4EA 1I1DA 3TOBA 4UWJA 4FD5A 4KVME 3K9UA 2C27A 1TIQA 1NSLA 1IICA 1CJWA 1WK4A 2ZW6A 4IUSA 2VZYA 4E0AA 2AJ6A 3SXNA 5I0CA 4PSXA 2B5GA 5KTDA 5KTAA 3UY5A 3P2FA 1VHSA 3LD2A 3VWDA 4HNXB 5C82A 3EXNA 3FBUA 2G3AA 5DWNA 3W91A 4KOUA 4RS2A 4U9ZA 2GIVA 4HNWB 1S5KA 2R7HA 3F5BA 1YVOA 4R3KA 3FB3A 5J8CA 3TCVA 2QECA 4KUAA 1RXTA 1NE9A 2REFA 3G3SA 4YFJA 2GANA 3PP9A 4B5PB 5IX3A 1L0CA 2G0BA 2I79A 1IIDA 4HNYB 3FYNA 3LODA 2K5TA 4XPKA 1YR0A 4K30A 1YVKA 3D2PA 1UFHA 2QMLA 3JVNA 2PQ8A 4LX9A 4UBRA 4CAWA 4NF1A 1PUAA 1RO5A 2Z0ZA 2FT0A 1B6BA 2B4DB 4KUBA 1ON0A 2FSRA 4ZBGA 4JXQA 4KOWA 4B5OA 2GE3A 2HUZA 1XIXA 4AVCA 1XMTA 2VQYA 4E8OA 5HH1A 2CNSA 3RYOA 1VKCA 4MJ8A 3R9FA 3EY5A 3T9YA 4UWIA 4QB9A 3R1KA 4KLVA 3W6SA 4JD6A 4R9MA 3F8KA 4L8AA 5CNPA 1QSTA 1V0CA 1Z4RA 3BJ8A 4PK3A 3IWGA 1QSRA 3R96A 1S7LA 4UA3A 2B5GB 4AB7A 3TFYA 1QSNA 2ARHA 3TOAA 2Y0MA 3GY9A 1MJAA 3TO9A 3CXSA 2P0WA 3QAHA 1MJBA 4GS4A 3DDDA 4II9A 3S6HA 1M1DA 2JDCA 3D2MA 2OH1A 5EC4A 2F5IA 1Q2YA 2B3UA 4H6ZA 5F47A 4R57A 4KOXA 2ZXVA 2ZW4A 4ORFA 4R87A 2Q04A 2PR8A 2JEVA 4NCZA 4YRHA 4CRYB 4QBJA 4LUAA 3E0KA 2ATRA 5KTCA 4QUSA 2B3VA 4CAVA 2B4BA 2I00A 4X5KA 5FVJA 3G8WA 3FNCA 3FXTA 4ONUA 3C26A 1I12A 4AVBA 4J3GA 4XPLA 1YX0A 4JJXA 1WWZA 3VWEA 4AVAA 3FRMA 2FIAA 4OADA 1M4GA 2VI7A 4QC6A 3P2HA 2KCWA 1J4JA 4KLWA 1Y9WA 2BUEA 2H5MA 1XE4A 3KKWA 4HKFA 2BSWA 3CXQA 4CS0B 4FD7A 1NMTA 5J8FA 2G3TA 2ZW7A 3PGPA 1M4DA 3TT2A 5DWMA 1Y7RA 4PV6A 1S7NA 3TO6A 2VXKA 2EUIA 2FS5A 4M85A 3JUWA 3OWCA 2BEIA 3IGRA 3R9EA 3EC4A 4AG7A 2BL1A 5JQ4A 2ZW5A 4FD6A 2FCKA 2FIWA 4H6UA 3W6XA 2HV2A 2RC4A 4E2AA 5F49A 1Q2DA 2VBQA 3DSBA 2JDDA 1U6MA 3EFAA 2Q0YA 2P6GA 1SQHA 2WPWA 4CRZB 3R95A 2VZZA 4KOSA 1QSOA 5GCNA 3ZJ0A 2ZPAA 1FY7A 3TO7A 2OZGA 4Y49B 4KVXA 2EVNA 4XPDB 1KUVA 3BLNA 4FD4A 1BOBA 2R8VA 1S60A 1KZFA 1M4IA 2PR1A 4R3LA 4EVYA 4F0YA 2DXQA 2IL4A 2PSWA 3DNSA 4IF5A 3D8PA 4MBUA 2PDOA 2OZHA 3GKRA 1PU9A 1I21A 3V8IA 4L89A 5F48A 2O28A 2WPXA 4RI1A 2Q7BA 2REEA 5JPHA 4MY3A 2VEZA 5F46A 1IB1E 4NEXA 5HMNA 4KORA 1CM0A 1Y9KA 3BJ7A 4DNCA 1S7FA 2J8MA 4Y49C 4JWPA 1P4NA 2HQYA 4KOYA 1Z9UA 4XPDC 3QB8A 1MK4A 2CNTA 5H86A 1YGHA 1B87A 4MY0A 1S7KA 5H84A 3TE4A 1M44A 1LRZA 2PRBA 2X7BA 2B58A 1YREA 4PSWA 2FE7A 3SXOA 2Q4YA 3DR8A 1S3ZA 3B8GA 1YK3A 1XF8A 4XNHB 3I3GA 5EBVA 4MHDA 2Q44A 2P6EA 4KVOE 3D3SA 3N7ZA 3MGDA 1Q2CA 2A4NA
chains in the Genus database with same CATH superfamily
2AFZA 2PJ1A 4PXCA 3TC8A 5G1ZA 2AFOA 2HC9A 4OLLA 2BCOA 3GB0A 4KOVA 3V7ZA 5E96A 4F6AA 1Z8LA 2JLMA 3BXMA 4UCNA 2QIRA 1KUYA 3VATA 4PXBA 1CPXA 3FJUA 1MJ9A 3SI1A 4ZYQA 4Q36A 1BO4A 2D4OA 3KL9A 3HLPA 1K4JA 4NGTA 5A27A 4JZ0A 4P44A 4CAXA 2C6GA 2PC1A 4LQ6A 3SJFA 4JYWA 3CXPA 4P45A 1LOKA 1XEBA 2ZEOA 3I9SA 4GM5A 3RNZA 2WUUA 3S6FA 4KZTA 3WR7A 4F9UA 1Z8WA 3IEHA 3BI1A 4U5YA 4NGSA 5HVFA 4CAFA 2QJ8A 1YLEA 4H89A 5K8PA 1BLLE 3SJXA 4B5PA 5LYDA 1YW4A 1FT7A 2CNMA 4BMHA 2AE6A 4NXYA 1P0HA 2ZEEA 1GHEA 2D4PA 3S6KA 4JLYA 1KUXA 4KOTA 5IB0A 1TF8A 1FNOA 3B3SA 2ZOFA 2IJZA 2J8RA 2P6FA 2JBKA 3B3TA 4HPSA 2R98A 1QSMA 2Q4VA 1XOVA 3B2YA 4PK2A 1R57A 4R6TA 2R1IA 4CGLA 2F8HA 2GREA 2YNDA 2OU2A 3KI9A 4QVTA 2ZELA 2ZOGA 2O53A 3KZWA 4F8ZA 1IYKA 3DR6A 2FXFA 2ODFA 3FIXA 1IYLA 3NE7A 1OZPA 2CY2A 4P4BA 4UEFA 4C7HA 2Z10A 3CPXA 2ABZA 3F0AA 2J8NA 4XNHC 3WABA 3L2NA 2XEGA 4ZY2A 4JXRA 3GYAA 3EO4A 3NH8A 4A37A 3R9GA 2GLJA 2FL4A 2PJ0A 3FEDA 5IV0A 4A32A 4MI4A 3VH9A 2Z11A 4U9YA 5C88A 2POKA 3GUXA 2OB0A 4AG9A 2C6PA 5D8NA 4CAEA 1N71A 4NGPA 2DEAA 4OAEA 3T90A 2NMTA 3WC7A 2NSMA 3TTHA 4I49A 2OZUA 4OC5A 1F57A 2DPSA 1AYEA 2B4DA 1ZG7A 4YGOA 4MRIA 4NSQA 3S6GA 1H8LA 2RB7A 4M3SA 3ZZIA 4UIAA 3H4QA 4DUKA 4ZY0A 3PZJA 1DTDA 3KQXA 3SHPA 3SI2A 1Z4EA 1I1DA 3IO1A 3K2KA 2AFXA 3TOBA 4OC0A 4UWJA 4ZI6A 4FD5A 5HXDA 4KVME 3K9UA 4F9VA 2C27A 1TIQA 1NSLA 1OBRA 1IICA 3B3WA 1CJWA 3TX8A 1WK4A 2ZW6A 4IUSA 6CPAA 4OC4A 2VZYA 1ZG8A 4E0AA 2AJ6A 3SXNA 5I0CA 1PCAA 3PB7X 4CGOA 1IU8A 1ZLIA 2PJ5A 2PJ6A 1F2PA 4UFWA 5K8NA 4PSXA 1XBUA 1Z5RA 2B5GA 5KTDA 2PJAA 2NYQA 2PIZA 3CPAA 4AXVA 5KTAA 3IC1A 3UY5A 4C2YA 3P2FA 1VHSA 3LD2A 3VWDA 4HNXB 4CGMA 2WSAA 5C82A 3EXNA 3FBUA 2G3AA 1QQ9A 1QMUA 3DLJA 5DWNA 4C2XA 4UCMA 3W91A 4KOUA 4P4FA 4RS2A 4U9ZA 2GIVA 4PPZA 3S9MA 3D68A 1S5KA 4HNWB 4A33A 2R7HA 3NH4A 3F5BA 1YVOA 4BD9A 4R3KA 4MHYA 4FBEA 2YGWA 1Z2LA 3FB3A 4CYOA 3QAYA 1AUGA 5J8CA 3D7HA 3TCVA 2PIYA 1CP6A 2AFSA 2QECA 4Z65A 4IHMA 3NH5A 5AGEA 4KUAA 1RXTA 2XEFA 5HVGA 1NE9A 2REFA 3FX6A 3ISXA 3G3SA 3LACA 1R43A 2GANA 3MGDA 3IU2A 4YFJA 2PJ8A 4A30A 1LFWA 4BINA 1Y0RA 3PP9A 3N5FA 4B5PB 1IGBA 4TWEA 5IX3A 4NJQA 4KS9A 5LRGA 2YNEA 3ISZA 5LYFA 1L0CA 1HDQA 2G0BA 2I79A 3FECA 3NFZA 2YNCC 1IIDA 3GIUA 4MCQA 4HNYB 5CBMA 3FYNA 3KASA 3LODA 4NGRA 3SI0A 4A38A 1ARMA 4PQAA 2K5TA 4XPKA 1YR0A 4K30A 2ZEDA 4P4IA 1YVKA 5LRJA 3D2PA 4M6HA 2F7VA 1XMBA 1UFHA 4MFJA 3FMCA 1NSAA 3S9LA 4KSIA 5LYLA 4DJLA 1Z8XA 4OP4A 3QNVA 2EWBA 2QMLA 5ELYA 3JVNA 2PQ8A 4LX9A 4MHZA 1TKFA 4MHNA 5I4MA 4UBRA 3IFEA 1M4LA 1VHEA 5AG5A 2GLFA 4CAWA 4NF1A 1PUAA 1RO5A 4P10A 5JGFA 4OIDA 2CIJA 4B12A 4R8FA 2Z0ZA 2FT0A 1B6BA 2B4DB 2ZEHA 4RN7A 4KUBA 5G20A 1ON0A 2FSRA 4ZBGA 4JXQA 2ZEFA 4KOWA 4GXHA 3RBUA 4B5OA 3PFOA 1VGYA 2GE3A 2HUZA 1XIXA 4UEZA 1ZLHA 4X8IA 4AVCA 1XMTA 2AFUA 2PJ4A 2VQYA 4E8OA 5HH1A 2CNSA 3H8FA 1IOFA 3RYOA 1VKCA 2WZNA 4PXEA 4MJ8A 3R9FA 3EY5A 2OR4A 3T9YA 4O23A 4UWIA 4WJBA 4C7IA 4OKOA 4QB9A 3R1KA 1IY7A 4KLVA 4A2ZA 4DYOA 5K8OA 3W6SA 4JD6A 4NFRA 4R9MA 4P4DA 3IIBA 3F8KA 4L8AA 5CNPA 4MFZA 1QSTA 3IJ3A 1V0CA 1Z4RA 4C68A 3BJ8A 4PK3A 3IWGA 1QSRA 3R96A 1S7LA 1A2ZA 4UA3A 1TKHA 1TXRA 2B5GB 4FWUA 4AB7A 4IAVA 3TFYA 1RTQA 2Z3MA 1QSNA 2ARHA 4B13A 3TOAA 2Y0MA 4UFVA 5BWAB 3GY9A 1MJAA 2PJ7A 3B7IA 3TO9A 4B6ZA 3CXSA 1TKJA 2P0WA 3QAHA 5DS0A 4B10A 4MFLA 4B14A 1MJBA 4GS4A 3DDDA 4II9A 3D4UA 3S6HA 4M6IA 1M1DA 2JDCA 4TNUA 3D2MA 4UCPA 2OH1A 3GLJA 4A95A 4A31A 4MCPA 2Z3OA 2F5IA 5EC4A 1Q2YA 5CPAA 4KSAA 1YLOA 4R76A 2B3UA 3D7DA 4UEEA 4H6ZA 3PRTA 4KSFA 2ZEPA 5F47A 1AMPA 1GYTA 4KOXA 4R57A 1BPNA 4BBHA 2ZXVA 2ZW4A 5ISVA 4ORFA 4R87A 1Y0YA 4FUUA 2Q04A 2PR8A 2OOTA 1HDUA 1LANA 3B3CA 2JEVA 4NCZA 4YRHA 4CRYB 4EMEA 3IWEA 4LUAA 2ZEGA 4QBJA 5IB9A 2PJ3A 1YSJA 2JBJA 3E0KA 4YWYA 1LAPA 2ATRA 5AG4A 5THWA 5KTCA 4QUSA 2B3VA 1TF9A 4CAVA 1DE4C 2B4BA 2I00A 3H5ZA 4X5KA 5A28A 3RAMA 5FVJA 2EK8A 3G8WA 3FNCA 3S9NA 3FXTA 4PXDA 4NGQA 3KR4A 4ONUA 3CZXA 1UWYA 3C26A 1I12A 4AVBA 4J3GA 4NGNA 4XPLA 3V38A 1YX0A 1LAMA 5HVHA 4JJXA 1WWZA 3VWEA 4AVAA 2JEWA 3FRMA 2XEIA 2FIAA 3NE8A 2I3CA 4OADA 4X3RA 3PFEA 1M4GA 3PB8X 4G1PA 4NJRA 3T8WA 2VI7A 4QC6A 2PVWA 3B35A 2Z3PA 3P2HA 1Z8TA 2KCWA 1J4JA 1YW6A 4KLWA 3B3VA 3PB9X 2ANPA 1Y9WA 2BUEA 2DPTA 1IOIA 2GFQA 3A9LA 3FVLA 3H8GA 2H5MA 2XEJA 1XE4A 2AFWA 2Z3KA 3KKWA 3FH4A 3KR5A 4UFXA 3VARA 4MCSA 4CYPA 4Q7AA 4HKFA 2CTBA 2IMOA 3NA6A 2BSWA 3CXQA 2V8DA 4IK2A 4CS0B 4FD7A 1NMTA 4MXUA 5J8FA 5D29A 2WYRA 3LWUA 3IWWA 4ZX8A 2G3TA 2ZW7A 1Q7LA 3PGPA 1M4DA 3PBEA 4ZX9A 3BI0A 3TT2A 4MFPA 5DWMA 1Y7RA 4PV6A 1S7NA 3TO6A 2VXKA 2PE3A 4A39A 2EK9A 1XFOA 2EUIA 2FS5A 4M85A 4EWTA 1ARLA 2C1CA 2CF4A 1BPMA 1JWQA 3JUWA 3OWCA 2BEIA 3IGRA 2Q7SA 3R9EA 2FVGA 3D67A 3EC4A 3PB4X 4AG7A 4F0XA 2BL1A 5JQ4A 5K8MA 2EO8A 2ZW5A 4FD6A 2FCKA 1ZG9A 2FIWA 3WC5A 3JTKA 4ZY1A 3I1UA 4H6UA 4B11A 3W6XA 2HB6A 2HV2A 2RC4A 4MMOA 1X12A 4LQGA 4YU9A 4RUHA 4MCRA 1ELLP 4E2AA 3LMSA 5F49A 1Q2DA 2VBQA 3DSBA 3PEIA 2JDDA 2C6CA 3RO0A 7CPAA 2AFMA 4X2TA 3HUVA 4UIBA 1U6MA 3EFAA 2Q0YA 2P6GA 3KGQA 1SQHA 2WPWA 1JQGA 5EMIA 4CRZB 3R95A 1CG2A 2VZZA 4KOSA 1QSOA 1CBXA 2J9AA 5GCNA 2Q51A 3JRUA 3ZJ0A 2V8VA 2ZPAA 1FY7A 1HEEA 3D7FA 4A94A 3TO7A 2OZGA 4Y49B 4MFQA 4KVXA 2EVNA 4XPDB 3CDXA 4ONWA 1KUVA 4OC1A 4CYQA 3BLNA 3IU1A 4P4JA 4FD4A 2Z3NA 2BOAA 4MHPA 4CGPA 1BOBA 2PJ2A 2GU2A 2R8VA 3DGVA 2VL1A 1S60A 1XRYA 1KZFA 1M4IA 2PJBA 2PR1A 2PJCA 1CPSA 3SJGA 3D7GA 4OIWA 2PRQA 4R3LA 4EVYA 4R7MA 1R3NA 1PYTB 2DXQA 3MRUA 4F0YA 5J1QA 2IL4A 2PVVA 2Z3LA 3H8EA 2CTCA 2PSWA 2ZEMA 3KQZA 4OC3A 4P6YA 1BAVA 3DNSA 4IF5A 3D8PA 3TE4A 1Y7EA 5G21A 3K9TA 2PDOA 4MBUA 3WC6A 4C2ZA 2OZHA 3GKRA 4NGMA 1PU9A 3MN8A 1I21A 2PJ9A 3V8IA 4L89A 3KHZA 5F48A 2O28A 2WPXA 4P4EA 2V8GA 4RI1A 2IQ6A 4MFKA 2Q7BA 2REEA 3D66A 3FEEA 5JPHA 4MY3A 2Q4ZA 2VEZA 2ZENA 1IB1E 5F46A 2EBJA 5JH9A 1EE3P 3PBBA 1VHOA 4NEXA 2G9DA 4Q38A 2PCUA 4KORA 5HMNA 1CM0A 1XJOA 2Q43A 1Y9KA 1ZO0A 3BJ7A 5F09A 5JM6A 4DNCA 1S7FA 4OC2A 2CXAA 2J8MA 4Y49C 4JWPA 1ELMP 4OMEA 1P4NA 2HQYA 4K3NA 4KOYA 4XPDC 3QB8A 8CPAA 1MK4A 3SJEA 2CNTA 5H86A 1YGHA 1B87A 4MY0A 4H2KA 1LCPA 1S7KA 1CX8A 3KHXA 5AG7A 5H84A 5LYIA 1M44A 1CP7A 2QVPA 2QYVA 5LRKA 1YQEA 1LRZA 3BHXA 2PRBA 3RZAA 2X7BA 2B58A 1YREA 2RFHA 2YNCA 3FF3A 4PSWA 2FE7A 3SXOA 3CT9A 2O4HA 2Q4YA 4M6GA 5G22A 4CPAA 3DR8A 2V77A 4FAIA 1S3ZA 2DF5A 3B8GA 5AG6A 4ZGYB 1F2OA 2V8HA 1YK3A 1X10A 4WWVA 1YMEA 1KWMA 1VIXA 2BO9A 3PB6X 1XF8A 4XNHB 3I3GA 5EBVA 4MHDA 4UF4A 4W9YA 2Q44A 3WT4A 4CGNA 4EFDA 2P6EA 4KVOE 3D3SA 3N7ZA 1Z9UA 1Q2CA 2A4NA 4CYNA
chains in the Genus database with same CATH topology
5G1ZA 4OLLA 4KOVA 5E96A 4F6AA 2JLMA 4UCNA 2QIRA 1KUYA 1MJ9A 4Q36A 1BO4A 2D4OA 1K4JA 5A27A 4CAXA 2PC1A 3CXPA 1XEBA 3I9SA 2WUUA 3S6FA 4KZTA 3WR7A 4U5YA 4CAFA 4H89A 1YLEA 4B5PA 2CNMA 4BMHA 2AE6A 4NXYA 1P0HA 1GHEA 2D4PA 3S6KA 4JLYA 1KUXA 4KOTA 5IB0A 2P6FA 2J8RA 2R98A 1QSMA 2Q4VA 4PK2A 1R57A 5ISVA 2R1IA 4CGLA 2YNDA 2OU2A 4QVTA 1IYKA 3DR6A 2FXFA 3FIXA 3NE7A 1IYLA 1OZPA 2CY2A 4C7HA 2Z10A 3F0AA 2J8NA 4XNHC 4JXRA 3GYAA 3EO4A 3R9GA 2FL4A 5IV0A 4A32A 4MI4A 2Z11A 4U9YA 5C88A 4AG9A 2OB0A 4CAEA 1N71A 4OAEA 3T90A 2NMTA 3TTHA 4I49A 2OZUA 2DPSA 2B4DA 4YGOA 3ZZIA 4NSQA 3S6GA 4M3SA 3H4QA 3PZJA 3SHPA 1Z4EA 1I1DA 3TOBA 4UWJA 4FD5A 4KVME 3K9UA 2C27A 1TIQA 1NSLA 1IICA 1CJWA 1WK4A 2ZW6A 4IUSA 2VZYA 4E0AA 2AJ6A 3SXNA 5I0CA 4CGOA 4UFWA 4PSXA 2B5GA 5KTDA 5KTAA 3UY5A 4C2YA 3P2FA 1VHSA 3LD2A 3VWDA 4HNXB 4CGMA 2WSAA 5C82A 3EXNA 3FBUA 2G3AA 5DWNA 4C2XA 4UCMA 3W91A 4KOUA 4RS2A 4U9ZA 2GIVA 4HNWB 1S5KA 4A33A 2R7HA 3F5BA 1YVOA 4R3KA 2YGWA 3FB3A 5J8CA 4CYOA 3TCVA 2QECA 5AGEA 4KUAA 1RXTA 1NE9A 2REFA 3G3SA 4YFJA 2GANA 3IU2A 4A30A 3PP9A 4B5PB 5IX3A 4KS9A 2YNEA 1L0CA 2G0BA 2I79A 2YNCC 1IIDA 4HNYB 3FYNA 3LODA 2K5TA 4XPKA 1YR0A 4K30A 1YVKA 3D2PA 4MFJA 1UFHA 2QMLA 3JVNA 2PQ8A 4LX9A 4UBRA 5AG5A 4CAWA 4NF1A 1PUAA 1RO5A 4B12A 2Z0ZA 2FT0A 1B6BA 2B4DB 4KUBA 5G20A 1ON0A 2FSRA 4ZBGA 4JXQA 4KOWA 4B5OA 2GE3A 2HUZA 1XIXA 4AVCA 1XMTA 2VQYA 4E8OA 5HH1A 2CNSA 3RYOA 1VKCA 4MJ8A 3R9FA 3EY5A 3T9YA 4UWIA 4C7IA 4QB9A 3R1KA 4KLVA 4A2ZA 3W6SA 4JD6A 4R9MA 3F8KA 4L8AA 5CNPA 4MFZA 1QSTA 4C68A 1V0CA 1Z4RA 3BJ8A 4PK3A 3IWGA 1QSRA 3R96A 1S7LA 4UA3A 2B5GB 4AB7A 3TFYA 2Z3MA 1QSNA 2ARHA 4B13A 3TOAA 2Y0MA 4UFVA 5BWAB 3GY9A 1MJAA 3TO9A 3CXSA 2P0WA 3QAHA 4B10A 4B14A 4MFLA 1MJBA 4GS4A 3DDDA 4II9A 3S6HA 1M1DA 2JDCA 3D2MA 4UCPA 2OH1A 4A95A 4A31A 2Z3OA 2F5IA 5EC4A 1Q2YA 4KSAA 2B3UA 4H6ZA 4KSFA 5F47A 4R57A 4KOXA 4BBHA 2ZXVA 2ZW4A 4ORFA 4R87A 2Q04A 2PR8A 2JEVA 4NCZA 4YRHA 4CRYB 3IWEA 4LUAA 4QBJA 3E0KA 2ATRA 5AG4A 5KTCA 4QUSA 2B3VA 4CAVA 2B4BA 2I00A 3H5ZA 4X5KA 5A28A 5FVJA 3G8WA 3FNCA 3FXTA 4ONUA 3C26A 1I12A 4AVBA 4J3GA 4XPLA 1YX0A 4JJXA 1WWZA 3VWEA 4AVAA 3FRMA 2FIAA 4OADA 1M4GA 2VI7A 4QC6A 2Z3PA 3P2HA 2KCWA 1J4JA 4KLWA 1Y9WA 2BUEA 2DPTA 3A9LA 2H5MA 1XE4A 2Z3KA 3KKWA 4UFXA 4CYPA 4HKFA 2BSWA 3CXQA 4CS0B 4FD7A 1NMTA 5J8FA 2G3TA 2ZW7A 3PGPA 1M4DA 3TT2A 4MFPA 5DWMA 1Y7RA 4PV6A 1S7NA 3TO6A 2VXKA 2EUIA 2FS5A 4M85A 3JUWA 3OWCA 2BEIA 3IGRA 3R9EA 3EC4A 4F0XA 4AG7A 2BL1A 5JQ4A 2ZW5A 4FD6A 2FCKA 2FIWA 3JTKA 4B11A 4H6UA 3W6XA 2HV2A 2RC4A 4E2AA 5F49A 1Q2DA 2VBQA 3DSBA 2JDDA 1U6MA 3EFAA 2Q0YA 2P6GA 1SQHA 2WPWA 4CRZB 3R95A 2VZZA 4KOSA 1QSOA 5GCNA 3ZJ0A 2ZPAA 1FY7A 3TO7A 2OZGA 4Y49B 4MFQA 4KVXA 2EVNA 4XPDB 1KUVA 4CYQA 3BLNA 3IU1A 4FD4A 2Z3NA 4CGPA 1BOBA 2R8VA 1S60A 1KZFA 1M4IA 2PR1A 4R3LA 4EVYA 4F0YA 2DXQA 2IL4A 2Z3LA 2PSWA 3DNSA 4IF5A 3D8PA 5G21A 4MBUA 2PDOA 4C2ZA 2OZHA 3GKRA 1PU9A 1I21A 3V8IA 4L89A 5F48A 2O28A 2WPXA 4RI1A 4MFKA 2Q7BA 2REEA 5JPHA 4MY3A 2VEZA 5F46A 1IB1E 4NEXA 4Q38A 5HMNA 4KORA 1CM0A 1Y9KA 1ZO0A 3BJ7A 4DNCA 1S7FA 2CXAA 2J8MA 4Y49C 4JWPA 1P4NA 2HQYA 1Z9UA 4KOYA 4XPDC 3QB8A 1MK4A 2CNTA 5H86A 1YGHA 1B87A 4MY0A 1S7KA 5H84A 5AG7A 3TE4A 1M44A 1LRZA 2PRBA 2X7BA 2B58A 1YREA 2YNCA 4PSWA 2FE7A 3SXOA 2Q4YA 5G22A 3DR8A 1S3ZA 3B8GA 5AG6A 4ZGYB 1YK3A 1XF8A 4XNHB 3I3GA 5EBVA 4MHDA 2Q44A 4CGNA 2P6EA 4KVOE 3D3SA 3N7ZA 3MGDA 1Q2CA 2A4NA 4CYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLL A;  4KOV A;  5E96 A;  4F6A A;  2JLM A;  2QIR A;  1KUY A;  1MJ9 A;  1BO4 A;  2D4O A;  1K4J A;  4CAX A;  2PC1 A;  3CXP A;  1XEB A;  3I9S A;  3S6F A;  4KZT A;  3WR7 A;  4U5Y A;  4H89 A;  1YLE A;  4B5P A;  2CNM A;  4BMH A;  2AE6 A;  4NXY A;  1P0H A;  1GHE A;  2D4P A;  3S6K A;  4JLY A;  1KUX A;  4KOT A;  5IB0 A;  2P6F A;  2J8R A;  2R98 A;  1QSM A;  2Q4V A;  4PK2 A;  1R57 A;  5ISV A;  2R1I A;  2OU2 A;  4QVT A;  1IYK A;  3DR6 A;  2FXF A;  3FIX A;  3NE7 A;  1IYL A;  1OZP A;  2CY2 A;  2Z10 A;  3F0A A;  2J8N A;  4XNH C;  4JXR A;  3GYA A;  3EO4 A;  3R9G A;  2FL4 A;  5IV0 A;  4MI4 A;  2Z11 A;  4U9Y A;  5C88 A;  4AG9 A;  2OB0 A;  1N71 A;  4OAE A;  3T90 A;  2NMT A;  3TTH A;  4I49 A;  2OZU A;  2B4D A;  4YGO A;  3ZZI A;  4NSQ A;  3S6G A;  4M3S A;  3H4Q A;  3PZJ A;  3SHP A;  1Z4E A;  1I1D A;  3TOB A;  4UWJ A;  4FD5 A;  4KVM E;  3K9U A;  2C27 A;  1TIQ A;  1NSL A;  1IIC A;  1CJW A;  1WK4 A;  2ZW6 A;  4IUS A;  2VZY A;  4E0A A;  2AJ6 A;  3SXN A;  5I0C A;  4PSX A;  2B5G A;  5KTD A;  5KTA A;  3UY5 A;  3P2F A;  1VHS A;  3LD2 A;  3VWD A;  4HNX B;  5C82 A;  3EXN A;  3FBU A;  2G3A A;  5DWN A;  3W91 A;  4KOU A;  4RS2 A;  4U9Z A;  2GIV A;  4HNW B;  1S5K A;  2R7H A;  3F5B A;  1YVO A;  4R3K A;  3FB3 A;  5J8C A;  3TCV A;  2QEC A;  4KUA A;  1RXT A;  1NE9 A;  2REF A;  3G3S A;  4YFJ A;  2GAN A;  3PP9 A;  4B5P B;  5IX3 A;  1L0C A;  2G0B A;  2I79 A;  1IID A;  4HNY B;  3FYN A;  3LOD A;  2K5T A;  4XPK A;  1YR0 A;  4K30 A;  1YVK A;  3D2P A;  1UFH A;  2QML A;  3JVN A;  2PQ8 A;  4LX9 A;  4UBR A;  4CAW A;  4NF1 A;  1PUA A;  1RO5 A;  2Z0Z A;  2FT0 A;  1B6B A;  2B4D B;  4KUB A;  1ON0 A;  2FSR A;  4ZBG A;  4JXQ A;  4KOW A;  4B5O A;  2GE3 A;  2HUZ A;  1XIX A;  4AVC A;  1XMT A;  2VQY A;  4E8O A;  5HH1 A;  2CNS A;  3RYO A;  1VKC A;  4MJ8 A;  3R9F A;  3EY5 A;  3T9Y A;  4UWI A;  4QB9 A;  3R1K A;  4KLV A;  3W6S A;  4JD6 A;  4R9M A;  3F8K A;  4L8A A;  5CNP A;  1QST A;  1V0C A;  1Z4R A;  3BJ8 A;  4PK3 A;  3IWG A;  1QSR A;  3R96 A;  1S7L A;  4UA3 A;  2B5G B;  4AB7 A;  3TFY A;  1QSN A;  2ARH A;  3TOA A;  2Y0M A;  3GY9 A;  1MJA A;  3TO9 A;  3CXS A;  2P0W A;  3QAH A;  1MJB A;  4GS4 A;  3DDD A;  4II9 A;  3S6H A;  1M1D A;  2JDC A;  3D2M A;  2OH1 A;  5EC4 A;  2F5I A;  1Q2Y A;  2B3U A;  4H6Z A;  5F47 A;  4R57 A;  4KOX A;  2ZXV A;  2ZW4 A;  4ORF A;  4R87 A;  2Q04 A;  2PR8 A;  2JEV A;  4NCZ A;  4YRH A;  4CRY B;  4QBJ A;  4LUA A;  3E0K A;  2ATR A;  5KTC A;  4QUS A;  2B3V A;  4CAV A;  2B4B A;  2I00 A;  4X5K A;  5FVJ A;  3G8W A;  3FNC A;  3FXT A;  4ONU A;  3C26 A;  1I12 A;  4AVB A;  4J3G A;  4XPL A;  1YX0 A;  4JJX A;  1WWZ A;  3VWE A;  4AVA A;  3FRM A;  2FIA A;  4OAD A;  1M4G A;  2VI7 A;  4QC6 A;  3P2H A;  2KCW A;  1J4J A;  4KLW A;  1Y9W A;  2BUE A;  2H5M A;  1XE4 A;  3KKW A;  4HKF A;  2BSW A;  3CXQ A;  4CS0 B;  4FD7 A;  1NMT A;  5J8F A;  2G3T A;  2ZW7 A;  3PGP A;  1M4D A;  3TT2 A;  5DWM A;  1Y7R A;  4PV6 A;  1S7N A;  3TO6 A;  2VXK A;  2EUI A;  2FS5 A;  4M85 A;  3JUW A;  3OWC A;  2BEI A;  3IGR A;  3R9E A;  3EC4 A;  4AG7 A;  2BL1 A;  5JQ4 A;  2ZW5 A;  4FD6 A;  2FCK A;  2FIW A;  4H6U A;  3W6X A;  2HV2 A;  2RC4 A;  4E2A A;  5F49 A;  1Q2D A;  2VBQ A;  3DSB A;  2JDD A;  1U6M A;  3EFA A;  2Q0Y A;  2P6G A;  1SQH A;  2WPW A;  4CRZ B;  3R95 A;  2VZZ A;  4KOS A;  1QSO A;  5GCN A;  3ZJ0 A;  2ZPA A;  1FY7 A;  3TO7 A;  2OZG A;  4Y49 B;  4KVX A;  2EVN A;  4XPD B;  1KUV A;  3BLN A;  4FD4 A;  1BOB A;  2R8V A;  1S60 A;  1KZF A;  1M4I A;  2PR1 A;  4R3L A;  4EVY A;  4F0Y A;  2DXQ A;  2IL4 A;  2PSW A;  3DNS A;  4IF5 A;  3D8P A;  4MBU A;  2PDO A;  2OZH A;  3GKR A;  1PU9 A;  1I21 A;  3V8I A;  4L89 A;  5F48 A;  2O28 A;  2WPX A;  4RI1 A;  2Q7B A;  2REE A;  5JPH A;  4MY3 A;  2VEZ A;  5F46 A;  1IB1 E;  4NEX A;  5HMN A;  4KOR A;  1CM0 A;  1Y9K A;  3BJ7 A;  4DNC A;  1S7F A;  2J8M A;  4Y49 C;  4JWP A;  1P4N A;  2HQY A;  4KOY A;  1Z9U A;  4XPD C;  3QB8 A;  1MK4 A;  2CNT A;  5H86 A;  1YGH A;  1B87 A;  4MY0 A;  1S7K A;  5H84 A;  3TE4 A;  1M44 A;  1LRZ A;  2PRB A;  2X7B A;  2B58 A;  1YRE A;  4PSW A;  2FE7 A;  3SXO A;  2Q4Y A;  3DR8 A;  1S3Z A;  3B8G A;  1YK3 A;  1XF8 A;  4XNH B;  3I3G A;  5EBV A;  4MHD A;  2Q44 A;  2P6E A;  4KVO E;  3D3S A;  3N7Z A;  3MGD A;  1Q2C A;  2A4N A; 
#chains in the Genus database with same CATH topology
 2AFZ A;  2PJ1 A;  4PXC A;  3TC8 A;  5G1Z A;  2AFO A;  2HC9 A;  4OLL A;  2BCO A;  3GB0 A;  4KOV A;  3V7Z A;  5E96 A;  4F6A A;  1Z8L A;  2JLM A;  3BXM A;  4UCN A;  2QIR A;  1KUY A;  3VAT A;  4PXB A;  1CPX A;  3FJU A;  1MJ9 A;  3SI1 A;  4ZYQ A;  4Q36 A;  1BO4 A;  2D4O A;  3KL9 A;  3HLP A;  1K4J A;  4NGT A;  5A27 A;  4JZ0 A;  4P44 A;  4CAX A;  2C6G A;  2PC1 A;  4LQ6 A;  3SJF A;  4JYW A;  3CXP A;  4P45 A;  1LOK A;  1XEB A;  2ZEO A;  3I9S A;  4GM5 A;  3RNZ A;  2WUU A;  3S6F A;  4KZT A;  3WR7 A;  4F9U A;  1Z8W A;  3IEH A;  3BI1 A;  4U5Y A;  4NGS A;  5HVF A;  4CAF A;  2QJ8 A;  1YLE A;  4H89 A;  5K8P A;  1BLL E;  3SJX A;  4B5P A;  5LYD A;  1YW4 A;  1FT7 A;  2CNM A;  4BMH A;  2AE6 A;  4NXY A;  1P0H A;  2ZEE A;  1GHE A;  2D4P A;  3S6K A;  4JLY A;  1KUX A;  4KOT A;  5IB0 A;  1TF8 A;  1FNO A;  3B3S A;  2ZOF A;  2IJZ A;  2J8R A;  2P6F A;  2JBK A;  3B3T A;  4HPS A;  2R98 A;  1QSM A;  2Q4V A;  1XOV A;  3B2Y A;  4PK2 A;  1R57 A;  4R6T A;  2R1I A;  4CGL A;  2F8H A;  2GRE A;  2YND A;  2OU2 A;  3KI9 A;  4QVT A;  2ZEL A;  2ZOG A;  2O53 A;  3KZW A;  4F8Z A;  1IYK A;  3DR6 A;  2FXF A;  2ODF A;  3FIX A;  1IYL A;  3NE7 A;  1OZP A;  2CY2 A;  4P4B A;  4UEF A;  4C7H A;  2Z10 A;  3CPX A;  2ABZ A;  3F0A A;  2J8N A;  4XNH C;  3WAB A;  3L2N A;  2XEG A;  4ZY2 A;  4JXR A;  3GYA A;  3EO4 A;  3NH8 A;  4A37 A;  3R9G A;  2GLJ A;  2FL4 A;  2PJ0 A;  3FED A;  5IV0 A;  4A32 A;  4MI4 A;  3VH9 A;  2Z11 A;  4U9Y A;  5C88 A;  2POK A;  3GUX A;  2OB0 A;  4AG9 A;  2C6P A;  5D8N A;  4CAE A;  1N71 A;  4NGP A;  2DEA A;  4OAE A;  3T90 A;  2NMT A;  3WC7 A;  2NSM A;  3TTH A;  4I49 A;  2OZU A;  4OC5 A;  1F57 A;  2DPS A;  1AYE A;  2B4D A;  1ZG7 A;  4YGO A;  4MRI A;  4NSQ A;  3S6G A;  1H8L A;  2RB7 A;  4M3S A;  3ZZI A;  4UIA A;  3H4Q A;  4DUK A;  4ZY0 A;  3PZJ A;  1DTD A;  3KQX A;  3SHP A;  3SI2 A;  1Z4E A;  1I1D A;  3IO1 A;  3K2K A;  2AFX A;  3TOB A;  4OC0 A;  4UWJ A;  4ZI6 A;  4FD5 A;  5HXD A;  4KVM E;  3K9U A;  4F9V A;  2C27 A;  1TIQ A;  1NSL A;  1OBR A;  1IIC A;  3B3W A;  1CJW A;  3TX8 A;  1WK4 A;  2ZW6 A;  4IUS A;  6CPA A;  4OC4 A;  2VZY A;  1ZG8 A;  4E0A A;  2AJ6 A;  3SXN A;  5I0C A;  1PCA A;  3PB7 X;  4CGO A;  1IU8 A;  1ZLI A;  2PJ5 A;  2PJ6 A;  1F2P A;  4UFW A;  5K8N A;  4PSX A;  1XBU A;  1Z5R A;  2B5G A;  5KTD A;  2PJA A;  2NYQ A;  2PIZ A;  3CPA A;  4AXV A;  5KTA A;  3IC1 A;  3UY5 A;  4C2Y A;  3P2F A;  1VHS A;  3LD2 A;  3VWD A;  4HNX B;  4CGM A;  2WSA A;  5C82 A;  3EXN A;  3FBU A;  2G3A A;  1QQ9 A;  1QMU A;  3DLJ A;  5DWN A;  4C2X A;  4UCM A;  3W91 A;  4KOU A;  4P4F A;  4RS2 A;  4U9Z A;  2GIV A;  4PPZ A;  3S9M A;  3D68 A;  1S5K A;  4HNW B;  4A33 A;  2R7H A;  3NH4 A;  3F5B A;  1YVO A;  4BD9 A;  4R3K A;  4MHY A;  4FBE A;  2YGW A;  1Z2L A;  3FB3 A;  4CYO A;  3QAY A;  1AUG A;  5J8C A;  3D7H A;  3TCV A;  2PIY A;  1CP6 A;  2AFS A;  2QEC A;  4Z65 A;  4IHM A;  3NH5 A;  5AGE A;  4KUA A;  1RXT A;  2XEF A;  5HVG A;  1NE9 A;  2REF A;  3FX6 A;  3ISX A;  3G3S A;  3LAC A;  1R43 A;  2GAN A;  3MGD A;  3IU2 A;  4YFJ A;  2PJ8 A;  4A30 A;  1LFW A;  4BIN A;  1Y0R A;  3PP9 A;  3N5F A;  4B5P B;  1IGB A;  4TWE A;  5IX3 A;  4NJQ A;  4KS9 A;  5LRG A;  2YNE A;  3ISZ A;  5LYF A;  1L0C A;  1HDQ A;  2G0B A;  2I79 A;  3FEC A;  3NFZ A;  2YNC C;  1IID A;  3GIU A;  4MCQ A;  4HNY B;  5CBM A;  3FYN A;  3KAS A;  3LOD A;  4NGR A;  3SI0 A;  4A38 A;  1ARM A;  4PQA A;  2K5T A;  4XPK A;  1YR0 A;  4K30 A;  2ZED A;  4P4I A;  1YVK A;  5LRJ A;  3D2P A;  4M6H A;  2F7V A;  1XMB A;  1UFH A;  4MFJ A;  3FMC A;  1NSA A;  3S9L A;  4KSI A;  5LYL A;  4DJL A;  1Z8X A;  4OP4 A;  3QNV A;  2EWB A;  2QML A;  5ELY A;  3JVN A;  2PQ8 A;  4LX9 A;  4MHZ A;  1TKF A;  4MHN A;  5I4M A;  4UBR A;  3IFE A;  1M4L A;  1VHE A;  5AG5 A;  2GLF A;  4CAW A;  4NF1 A;  1PUA A;  1RO5 A;  4P10 A;  5JGF A;  4OID A;  2CIJ A;  4B12 A;  4R8F A;  2Z0Z A;  2FT0 A;  1B6B A;  2B4D B;  2ZEH A;  4RN7 A;  4KUB A;  5G20 A;  1ON0 A;  2FSR A;  4ZBG A;  4JXQ A;  2ZEF A;  4KOW A;  4GXH A;  3RBU A;  4B5O A;  3PFO A;  1VGY A;  2GE3 A;  2HUZ A;  1XIX A;  4UEZ A;  1ZLH A;  4X8I A;  4AVC A;  1XMT A;  2AFU A;  2PJ4 A;  2VQY A;  4E8O A;  5HH1 A;  2CNS A;  3H8F A;  1IOF A;  3RYO A;  1VKC A;  2WZN A;  4PXE A;  4MJ8 A;  3R9F A;  3EY5 A;  2OR4 A;  3T9Y A;  4O23 A;  4UWI A;  4WJB A;  4C7I A;  4OKO A;  4QB9 A;  3R1K A;  1IY7 A;  4KLV A;  4A2Z A;  4DYO A;  5K8O A;  3W6S A;  4JD6 A;  4NFR A;  4R9M A;  4P4D A;  3IIB A;  3F8K A;  4L8A A;  5CNP A;  4MFZ A;  1QST A;  3IJ3 A;  1V0C A;  1Z4R A;  4C68 A;  3BJ8 A;  4PK3 A;  3IWG A;  1QSR A;  3R96 A;  1S7L A;  1A2Z A;  4UA3 A;  1TKH A;  1TXR A;  2B5G B;  4FWU A;  4AB7 A;  4IAV A;  3TFY A;  1RTQ A;  2Z3M A;  1QSN A;  2ARH A;  4B13 A;  3TOA A;  2Y0M A;  4UFV A;  5BWA B;  3GY9 A;  1MJA A;  2PJ7 A;  3B7I A;  3TO9 A;  4B6Z A;  3CXS A;  1TKJ A;  2P0W A;  3QAH A;  5DS0 A;  4B10 A;  4MFL A;  4B14 A;  1MJB A;  4GS4 A;  3DDD A;  4II9 A;  3D4U A;  3S6H A;  4M6I A;  1M1D A;  2JDC A;  4TNU A;  3D2M A;  4UCP A;  2OH1 A;  3GLJ A;  4A95 A;  4A31 A;  4MCP A;  2Z3O A;  2F5I A;  5EC4 A;  1Q2Y A;  5CPA A;  4KSA A;  1YLO A;  4R76 A;  2B3U A;  3D7D A;  4UEE A;  4H6Z A;  3PRT A;  4KSF A;  2ZEP A;  5F47 A;  1AMP A;  1GYT A;  4KOX A;  4R57 A;  1BPN A;  4BBH A;  2ZXV A;  2ZW4 A;  5ISV A;  4ORF A;  4R87 A;  1Y0Y A;  4FUU A;  2Q04 A;  2PR8 A;  2OOT A;  1HDU A;  1LAN A;  3B3C A;  2JEV A;  4NCZ A;  4YRH A;  4CRY B;  4EME A;  3IWE A;  4LUA A;  2ZEG A;  4QBJ A;  5IB9 A;  2PJ3 A;  1YSJ A;  2JBJ A;  3E0K A;  4YWY A;  1LAP A;  2ATR A;  5AG4 A;  5THW A;  5KTC A;  4QUS A;  2B3V A;  1TF9 A;  4CAV A;  1DE4 C;  2B4B A;  2I00 A;  3H5Z A;  4X5K A;  5A28 A;  3RAM A;  5FVJ A;  2EK8 A;  3G8W A;  3FNC A;  3S9N A;  3FXT A;  4PXD A;  4NGQ A;  3KR4 A;  4ONU A;  3CZX A;  1UWY A;  3C26 A;  1I12 A;  4AVB A;  4J3G A;  4NGN A;  4XPL A;  3V38 A;  1YX0 A;  1LAM A;  5HVH A;  4JJX A;  1WWZ A;  3VWE A;  4AVA A;  2JEW A;  3FRM A;  2XEI A;  2FIA A;  3NE8 A;  2I3C A;  4OAD A;  4X3R A;  3PFE A;  1M4G A;  3PB8 X;  4G1P A;  4NJR A;  3T8W A;  2VI7 A;  4QC6 A;  2PVW A;  3B35 A;  2Z3P A;  3P2H A;  1Z8T A;  2KCW A;  1J4J A;  1YW6 A;  4KLW A;  3B3V A;  3PB9 X;  2ANP A;  1Y9W A;  2BUE A;  2DPT A;  1IOI A;  2GFQ A;  3A9L A;  3FVL A;  3H8G A;  2H5M A;  2XEJ A;  1XE4 A;  2AFW A;  2Z3K A;  3KKW A;  3FH4 A;  3KR5 A;  4UFX A;  3VAR A;  4MCS A;  4CYP A;  4Q7A A;  4HKF A;  2CTB A;  2IMO A;  3NA6 A;  2BSW A;  3CXQ A;  2V8D A;  4IK2 A;  4CS0 B;  4FD7 A;  1NMT A;  4MXU A;  5J8F A;  5D29 A;  2WYR A;  3LWU A;  3IWW A;  4ZX8 A;  2G3T A;  2ZW7 A;  1Q7L A;  3PGP A;  1M4D A;  3PBE A;  4ZX9 A;  3BI0 A;  3TT2 A;  4MFP A;  5DWM A;  1Y7R A;  4PV6 A;  1S7N A;  3TO6 A;  2VXK A;  2PE3 A;  4A39 A;  2EK9 A;  1XFO A;  2EUI A;  2FS5 A;  4M85 A;  4EWT A;  1ARL A;  2C1C A;  2CF4 A;  1BPM A;  1JWQ A;  3JUW A;  3OWC A;  2BEI A;  3IGR A;  2Q7S A;  3R9E A;  2FVG A;  3D67 A;  3EC4 A;  3PB4 X;  4AG7 A;  4F0X A;  2BL1 A;  5JQ4 A;  5K8M A;  2EO8 A;  2ZW5 A;  4FD6 A;  2FCK A;  1ZG9 A;  2FIW A;  3WC5 A;  3JTK A;  4ZY1 A;  3I1U A;  4H6U A;  4B11 A;  3W6X A;  2HB6 A;  2HV2 A;  2RC4 A;  4MMO A;  1X12 A;  4LQG A;  4YU9 A;  4RUH A;  4MCR A;  1ELL P;  4E2A A;  3LMS A;  5F49 A;  1Q2D A;  2VBQ A;  3DSB A;  3PEI A;  2JDD A;  2C6C A;  3RO0 A;  7CPA A;  2AFM A;  4X2T A;  3HUV A;  4UIB A;  1U6M A;  3EFA A;  2Q0Y A;  2P6G A;  3KGQ A;  1SQH A;  2WPW A;  1JQG A;  5EMI A;  4CRZ B;  3R95 A;  1CG2 A;  2VZZ A;  4KOS A;  1QSO A;  1CBX A;  2J9A A;  5GCN A;  2Q51 A;  3JRU A;  3ZJ0 A;  2V8V A;  2ZPA A;  1FY7 A;  1HEE A;  3D7F A;  4A94 A;  3TO7 A;  2OZG A;  4Y49 B;  4MFQ A;  4KVX A;  2EVN A;  4XPD B;  3CDX A;  4ONW A;  1KUV A;  4OC1 A;  4CYQ A;  3BLN A;  3IU1 A;  4P4J A;  4FD4 A;  2Z3N A;  2BOA A;  4MHP A;  4CGP A;  1BOB A;  2PJ2 A;  2GU2 A;  2R8V A;  3DGV A;  2VL1 A;  1S60 A;  1XRY A;  1KZF A;  1M4I A;  2PJB A;  2PR1 A;  2PJC A;  1CPS A;  3SJG A;  3D7G A;  4OIW A;  2PRQ A;  4R3L A;  4EVY A;  4R7M A;  1R3N A;  1PYT B;  2DXQ A;  3MRU A;  4F0Y A;  5J1Q A;  2IL4 A;  2PVV A;  2Z3L A;  3H8E A;  2CTC A;  2PSW A;  2ZEM A;  3KQZ A;  4OC3 A;  4P6Y A;  1BAV A;  3DNS A;  4IF5 A;  3D8P A;  3TE4 A;  1Y7E A;  5G21 A;  3K9T A;  2PDO A;  4MBU A;  3WC6 A;  4C2Z A;  2OZH A;  3GKR A;  4NGM A;  1PU9 A;  3MN8 A;  1I21 A;  2PJ9 A;  3V8I A;  4L89 A;  3KHZ A;  5F48 A;  2O28 A;  2WPX A;  4P4E A;  2V8G A;  4RI1 A;  2IQ6 A;  4MFK A;  2Q7B A;  2REE A;  3D66 A;  3FEE A;  5JPH A;  4MY3 A;  2Q4Z A;  2VEZ A;  2ZEN A;  1IB1 E;  5F46 A;  2EBJ A;  5JH9 A;  1EE3 P;  3PBB A;  1VHO A;  4NEX A;  2G9D A;  4Q38 A;  2PCU A;  4KOR A;  5HMN A;  1CM0 A;  1XJO A;  2Q43 A;  1Y9K A;  1ZO0 A;  3BJ7 A;  5F09 A;  5JM6 A;  4DNC A;  1S7F A;  4OC2 A;  2CXA A;  2J8M A;  4Y49 C;  4JWP A;  1ELM P;  4OME A;  1P4N A;  2HQY A;  4K3N A;  4KOY A;  4XPD C;  3QB8 A;  8CPA A;  1MK4 A;  3SJE A;  2CNT A;  5H86 A;  1YGH A;  1B87 A;  4MY0 A;  4H2K A;  1LCP A;  1S7K A;  1CX8 A;  3KHX A;  5AG7 A;  5H84 A;  5LYI A;  1M44 A;  1CP7 A;  2QVP A;  2QYV A;  5LRK A;  1YQE A;  1LRZ A;  3BHX A;  2PRB A;  3RZA A;  2X7B A;  2B58 A;  1YRE A;  2RFH A;  2YNC A;  3FF3 A;  4PSW A;  2FE7 A;  3SXO A;  3CT9 A;  2O4H A;  2Q4Y A;  4M6G A;  5G22 A;  4CPA A;  3DR8 A;  2V77 A;  4FAI A;  1S3Z A;  2DF5 A;  3B8G A;  5AG6 A;  4ZGY B;  1F2O A;  2V8H A;  1YK3 A;  1X10 A;  4WWV A;  1YME A;  1KWM A;  1VIX A;  2BO9 A;  3PB6 X;  1XF8 A;  4XNH B;  3I3G A;  5EBV A;  4MHD A;  4UF4 A;  4W9Y A;  2Q44 A;  3WT4 A;  4CGN A;  4EFD A;  2P6E A;  4KVO E;  3D3S A;  3N7Z A;  1Z9U A;  1Q2C A;  2A4N A;  4CYN A; 
#chains in the Genus database with same CATH homology
 5G1Z A;  4OLL A;  4KOV A;  5E96 A;  4F6A A;  2JLM A;  4UCN A;  2QIR A;  1KUY A;  1MJ9 A;  4Q36 A;  1BO4 A;  2D4O A;  1K4J A;  5A27 A;  4CAX A;  2PC1 A;  3CXP A;  1XEB A;  3I9S A;  2WUU A;  3S6F A;  4KZT A;  3WR7 A;  4U5Y A;  4CAF A;  4H89 A;  1YLE A;  4B5P A;  2CNM A;  4BMH A;  2AE6 A;  4NXY A;  1P0H A;  1GHE A;  2D4P A;  3S6K A;  4JLY A;  1KUX A;  4KOT A;  5IB0 A;  2P6F A;  2J8R A;  2R98 A;  1QSM A;  2Q4V A;  4PK2 A;  1R57 A;  5ISV A;  2R1I A;  4CGL A;  2YND A;  2OU2 A;  4QVT A;  1IYK A;  3DR6 A;  2FXF A;  3FIX A;  3NE7 A;  1IYL A;  1OZP A;  2CY2 A;  4C7H A;  2Z10 A;  3F0A A;  2J8N A;  4XNH C;  4JXR A;  3GYA A;  3EO4 A;  3R9G A;  2FL4 A;  5IV0 A;  4A32 A;  4MI4 A;  2Z11 A;  4U9Y A;  5C88 A;  4AG9 A;  2OB0 A;  4CAE A;  1N71 A;  4OAE A;  3T90 A;  2NMT A;  3TTH A;  4I49 A;  2OZU A;  2DPS A;  2B4D A;  4YGO A;  3ZZI A;  4NSQ A;  3S6G A;  4M3S A;  3H4Q A;  3PZJ A;  3SHP A;  1Z4E A;  1I1D A;  3TOB A;  4UWJ A;  4FD5 A;  4KVM E;  3K9U A;  2C27 A;  1TIQ A;  1NSL A;  1IIC A;  1CJW A;  1WK4 A;  2ZW6 A;  4IUS A;  2VZY A;  4E0A A;  2AJ6 A;  3SXN A;  5I0C A;  4CGO A;  4UFW A;  4PSX A;  2B5G A;  5KTD A;  5KTA A;  3UY5 A;  4C2Y A;  3P2F A;  1VHS A;  3LD2 A;  3VWD A;  4HNX B;  4CGM A;  2WSA A;  5C82 A;  3EXN A;  3FBU A;  2G3A A;  5DWN A;  4C2X A;  4UCM A;  3W91 A;  4KOU A;  4RS2 A;  4U9Z A;  2GIV A;  4HNW B;  1S5K A;  4A33 A;  2R7H A;  3F5B A;  1YVO A;  4R3K A;  2YGW A;  3FB3 A;  5J8C A;  4CYO A;  3TCV A;  2QEC A;  5AGE A;  4KUA A;  1RXT A;  1NE9 A;  2REF A;  3G3S A;  4YFJ A;  2GAN A;  3IU2 A;  4A30 A;  3PP9 A;  4B5P B;  5IX3 A;  4KS9 A;  2YNE A;  1L0C A;  2G0B A;  2I79 A;  2YNC C;  1IID A;  4HNY B;  3FYN A;  3LOD A;  2K5T A;  4XPK A;  1YR0 A;  4K30 A;  1YVK A;  3D2P A;  4MFJ A;  1UFH A;  2QML A;  3JVN A;  2PQ8 A;  4LX9 A;  4UBR A;  5AG5 A;  4CAW A;  4NF1 A;  1PUA A;  1RO5 A;  4B12 A;  2Z0Z A;  2FT0 A;  1B6B A;  2B4D B;  4KUB A;  5G20 A;  1ON0 A;  2FSR A;  4ZBG A;  4JXQ A;  4KOW A;  4B5O A;  2GE3 A;  2HUZ A;  1XIX A;  4AVC A;  1XMT A;  2VQY A;  4E8O A;  5HH1 A;  2CNS A;  3RYO A;  1VKC A;  4MJ8 A;  3R9F A;  3EY5 A;  3T9Y A;  4UWI A;  4C7I A;  4QB9 A;  3R1K A;  4KLV A;  4A2Z A;  3W6S A;  4JD6 A;  4R9M A;  3F8K A;  4L8A A;  5CNP A;  4MFZ A;  1QST A;  4C68 A;  1V0C A;  1Z4R A;  3BJ8 A;  4PK3 A;  3IWG A;  1QSR A;  3R96 A;  1S7L A;  4UA3 A;  2B5G B;  4AB7 A;  3TFY A;  2Z3M A;  1QSN A;  2ARH A;  4B13 A;  3TOA A;  2Y0M A;  4UFV A;  5BWA B;  3GY9 A;  1MJA A;  3TO9 A;  3CXS A;  2P0W A;  3QAH A;  4B10 A;  4B14 A;  4MFL A;  1MJB A;  4GS4 A;  3DDD A;  4II9 A;  3S6H A;  1M1D A;  2JDC A;  3D2M A;  4UCP A;  2OH1 A;  4A95 A;  4A31 A;  2Z3O A;  2F5I A;  5EC4 A;  1Q2Y A;  4KSA A;  2B3U A;  4H6Z A;  4KSF A;  5F47 A;  4R57 A;  4KOX A;  4BBH A;  2ZXV A;  2ZW4 A;  4ORF A;  4R87 A;  2Q04 A;  2PR8 A;  2JEV A;  4NCZ A;  4YRH A;  4CRY B;  3IWE A;  4LUA A;  4QBJ A;  3E0K A;  2ATR A;  5AG4 A;  5KTC A;  4QUS A;  2B3V A;  4CAV A;  2B4B A;  2I00 A;  3H5Z A;  4X5K A;  5A28 A;  5FVJ A;  3G8W A;  3FNC A;  3FXT A;  4ONU A;  3C26 A;  1I12 A;  4AVB A;  4J3G A;  4XPL A;  1YX0 A;  4JJX A;  1WWZ A;  3VWE A;  4AVA A;  3FRM A;  2FIA A;  4OAD A;  1M4G A;  2VI7 A;  4QC6 A;  2Z3P A;  3P2H A;  2KCW A;  1J4J A;  4KLW A;  1Y9W A;  2BUE A;  2DPT A;  3A9L A;  2H5M A;  1XE4 A;  2Z3K A;  3KKW A;  4UFX A;  4CYP A;  4HKF A;  2BSW A;  3CXQ A;  4CS0 B;  4FD7 A;  1NMT A;  5J8F A;  2G3T A;  2ZW7 A;  3PGP A;  1M4D A;  3TT2 A;  4MFP A;  5DWM A;  1Y7R A;  4PV6 A;  1S7N A;  3TO6 A;  2VXK A;  2EUI A;  2FS5 A;  4M85 A;  3JUW A;  3OWC A;  2BEI A;  3IGR A;  3R9E A;  3EC4 A;  4F0X A;  4AG7 A;  2BL1 A;  5JQ4 A;  2ZW5 A;  4FD6 A;  2FCK A;  2FIW A;  3JTK A;  4B11 A;  4H6U A;  3W6X A;  2HV2 A;  2RC4 A;  4E2A A;  5F49 A;  1Q2D A;  2VBQ A;  3DSB A;  2JDD A;  1U6M A;  3EFA A;  2Q0Y A;  2P6G A;  1SQH A;  2WPW A;  4CRZ B;  3R95 A;  2VZZ A;  4KOS A;  1QSO A;  5GCN A;  3ZJ0 A;  2ZPA A;  1FY7 A;  3TO7 A;  2OZG A;  4Y49 B;  4MFQ A;  4KVX A;  2EVN A;  4XPD B;  1KUV A;  4CYQ A;  3BLN A;  3IU1 A;  4FD4 A;  2Z3N A;  4CGP A;  1BOB A;  2R8V A;  1S60 A;  1KZF A;  1M4I A;  2PR1 A;  4R3L A;  4EVY A;  4F0Y A;  2DXQ A;  2IL4 A;  2Z3L A;  2PSW A;  3DNS A;  4IF5 A;  3D8P A;  5G21 A;  4MBU A;  2PDO A;  4C2Z A;  2OZH A;  3GKR A;  1PU9 A;  1I21 A;  3V8I A;  4L89 A;  5F48 A;  2O28 A;  2WPX A;  4RI1 A;  4MFK A;  2Q7B A;  2REE A;  5JPH A;  4MY3 A;  2VEZ A;  5F46 A;  1IB1 E;  4NEX A;  4Q38 A;  5HMN A;  4KOR A;  1CM0 A;  1Y9K A;  1ZO0 A;  3BJ7 A;  4DNC A;  1S7F A;  2CXA A;  2J8M A;  4Y49 C;  4JWP A;  1P4N A;  2HQY A;  1Z9U A;  4KOY A;  4XPD C;  3QB8 A;  1MK4 A;  2CNT A;  5H86 A;  1YGH A;  1B87 A;  4MY0 A;  1S7K A;  5H84 A;  5AG7 A;  3TE4 A;  1M44 A;  1LRZ A;  2PRB A;  2X7B A;  2B58 A;  1YRE A;  2YNC A;  4PSW A;  2FE7 A;  3SXO A;  2Q4Y A;  5G22 A;  3DR8 A;  1S3Z A;  3B8G A;  5AG6 A;  4ZGY B;  1YK3 A;  1XF8 A;  4XNH B;  3I3G A;  5EBV A;  4MHD A;  2Q44 A;  4CGN A;  2P6E A;  4KVO E;  3D3S A;  3N7Z A;  3MGD A;  1Q2C A;  2A4N A;  4CYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...