2WPWA

Tandem gnat protein from the clavulanic acid biosynthesis pathway (without accoa)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
336
structure length
328
Chain Sequence
TAGELEFVPLAANDDETVGQWLDLMALAAETGPRAAPPCNVDMVGSLRFAPPATALDDWVVRSGGRVVGALRLALPDGAPTARVDQLLVHPGRRRRGIGRALWAHARELARKHDRTTLTATVVESLPSGPAQDPGPAAFAAAMGAHRSDIPAGTHQWLDLDRHDPLADGVPAVPAGYSLVTWGTITPDEYAVPVSELELRAAQEVRTSYARQFETMRVGRGRRAYHTGAVHDATGALAGYTSVSKTTGNPAYALQGMTVVHREHRGHALGTLLKLANLEYVLRHEPEVRLVETANAEDNHPMIAVNAALGFEPYDRWVFWTAEAGPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF14
publication title Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 85
structure length 328
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wpwA00
2OZUA 2Q4YA 1V0CA 4Y49C 2BEIA 5J8CA 3TO6A 2DXQA 1KZFA 2FCKA 1NSLA 2P6FA 3T90A 4CRZB 2AE6A 1B6BA 3P2FA 2WPWA 4II9A 1KUXA 3EXNA 4AB7A 2A4NA 4I49A 3IWGA 5F46A 1WWZA 4NSQA 3D2MA 2JLMA 4XPDC 4U5YA 3EC4A 4JJXA 4YRHA 1Y7RA 2B58A 3W6SA 4QBJA 4PV6A 2ZW5A 4KOTA 5HH1A 1IYLA 1VKCA 2FXFA 3EO4A 2FS5A 2G0BA 4NF1A 2EVNA 2B4DA 3ZZIA 2B3UA 2G3AA 1S7FA 3D2PA 1Q2CA 3R9EA 2ZXVA 3S6FA 3TFYA 4AVAA 2J8MA 2OZHA 4UA3A 4KLWA 1S60A 4LX9A 2Y0MA 3K9UA 4U9ZA 4RS2A 4JXRA 4KVME 3FB3A 3TOAA 2CNMA 3DR8A 1FY7A 2OB0A 2VQYA 5FVJA 5I0CA 5CNPA 2AJ6A 2X7BA 2R98A 4XNHC 4HNWB 2D4OA 1NE9A 5F48A 4IF5A 2OZGA 5KTAA 1NMTA 2QECA 2BL1A 5KTDA 4KOYA 4H89A 3I9SA 3FNCA 3DSBA 3FBUA 4YFJA 5ISVA 3DDDA 2PRBA 3E0KA 4X5KA 3D3SA 2FSRA 5C82A 2JDDA 4KOXA 2Q0YA 2G3TA 4IUSA 3JUWA 1QSTA 2I79A 2BSWA 3CXQA 4HNXB 1J4JA 2VBQA 3R1KA 3DNSA 4JLYA 3T9YA 4FD7A 2F5IA 1OZPA 3EY5A 2P6EA 3CXPA 1S3ZA 5J8FA 4UBRA 3GYAA 4ZBGA 2NMTA 2B5GA 4XPKA 1XEBA 3S6GA 4F0YA 4KOWA 4CAWA 4PSWA 1Q2DA 4RI1A 1ON0A 2Q04A 2PR1A 2J8NA 5H84A 2WPXA 2Q44A 3W91A 3TOBA 2H5MA 1S7NA 3S6HA 3VWDA 3FXTA 5GCNA 5E96A 4BMHA 1M4GA 2CNSA 2JDCA 1L0CA 2PR8A 3G8WA 3TCVA 1YGHA 5DWNA 1U6MA 5F49A 4ORFA 2P6GA 1S7KA 1Z4RA 3TO9A 4PK2A 1B87A 1IIDA 4UWIA 1MJ9A 4OADA 5EC4A 2B4DB 1K4JA 4M3SA 2GANA 3SHPA 1MJBA 1M4DA 1YX0A 2IL4A 2B3VA 3PZJA 3GKRA 4MI4A 1R57A 2VXKA 2FL4A 1M4IA 2QMLA 4B5PA 4L89A 2PQ8A 1CM0A 4KORA 1YVOA 2JEVA 4KOSA 3LD2A 2ZW6A 3TTHA 3GY9A 3G3SA 3JVNA 1LRZA 2FIWA 4MJ8A 4KOUA 1QSNA 3F0AA 5F47A 3CXSA 2OU2A 4NCZA 3UY5A 1XMTA 1MJAA 2J8RA 1S5KA 2OH1A 2I00A 5C88A 3BLNA 4KVOE 1I21A 3LODA 4AG9A 1WK4A 5H86A 3TE4A 4NXYA 4H6UA 2RC4A 4R57A 1QSMA 1XIXA 4UWJA 3C26A 3I3GA 4Y49B 1KUVA 3OWCA 1TIQA 1XF8A 2EUIA 4QC6A 1YR0A 4AVBA 4KLVA 1S7LA 2CNTA 4R3LA 1YLEA 2O28A 2QIRA 3BJ8A 5EBVA 2Q4VA 2VZYA 1I12A 3DR6A 4QUSA 4MBUA 1YVKA 1IB1E 4KUBA 1Q2YA 4L8AA 3FRMA 4XPDB 2HUZA 3H4QA 2B5GB 3R9GA 2C27A 3B8GA 3SXOA 4AG7A 5IX3A 4U9YA 2CY2A 5DWMA 4FD6A 1CJWA 2Z0ZA 4HKFA 4FD4A 4GS4A 3IGRA 1QSRA 3R95A 4R9MA 4HNYB 4OLLA 2HV2A 2P0WA 3FIXA 4PSXA 1UFHA 5IV0A 1Y9KA 1N71A 2R1IA 2Q7BA 1XE4A 4MY0A 2BUEA 1IICA 4E0AA 5HMNA 4FD5A 2FIAA 4PK3A 2ZW7A 4E8OA 4DNCA 4K30A 3RYOA 4QVTA 2PSWA 4XPLA 2VZZA 3R9FA 2HQYA 2K5TA 2PC1A 4JXQA 4KZTA 4J3GA 3N7ZA 4XNHB 4QB9A 2REFA 2D4PA 3BJ7A 2ZPAA 1QSOA 4KUAA 1GHEA 2ARHA 3TO7A 2REEA 1KUYA 3W6XA 3TT2A 2Z11A 1IYKA 4B5PB 1M1DA 4R3KA 3S6KA 3PGPA 4B5OA 3F8KA 4CAXA 1Z9UA 2FT0A 4MHDA 1BOBA 4OAEA 4R87A 2ATRA 1I1DA 3PP9A 5JQ4A 1YK3A 2FE7A 3FYNA 4CAVA 4EVYA 3KKWA 2R8VA 1SQHA 3V8IA 3R96A 1Y9WA 4LUAA 2VEZA 3QB8A 4H6ZA 1M44A 4E2AA 1Z4EA 2B4BA 2GIVA 4CRYB 3MGDA 2R7HA 4KVXA 1P0HA 4YGOA 3P2HA 3EFAA 3QAHA 2KCWA 2GE3A 1VHSA 5IB0A 1RXTA 1RO5A 4KOVA 4AVCA 4F6AA 1PUAA 1YREA 2Z10A 3D8PA 4M85A 5KTCA 1MK4A 4JWPA 5JPHA 4MY3A 2VI7A 1PU9A 3WR7A 1P4NA 4ONUA 4JD6A 2ZW4A 3F5BA 1BO4A 4CS0B 2PDOA 3ZJ0A 3SXNA 3VWEA 3NE7A 4NEXA
chains in the Genus database with same CATH superfamily
5HVFA 3PBEA 2CTCA 2OZUA 2Q4YA 4P4IA 3FMCA 1XFOA 1V0CA 1IY7A 2ZEFA 4Y49C 2PJ7A 4MMOA 4X8IA 4B14A 4UCPA 3GIUA 4OC4A 1A2ZA 2BEIA 3D66A 4UFWA 5J8CA 3TO6A 2DXQA 2ZOFA 2PVVA 1KZFA 2FCKA 2JBKA 1NSLA 3SJXA 3D7DA 2P6FA 3T90A 4OC3A 4A33A 4CRZB 2GU2A 1JQGA 3ISXA 3PFOA 2AE6A 1B6BA 3P2FA 3D7HA 2WPWA 1H8LA 5DS0A 4II9A 2CF4A 3IFEA 1KUXA 3EXNA 4P10A 4AB7A 2A4NA 4I49A 2XEGA 3IWGA 1TXRA 5F46A 1WWZA 4NSQA 4FAIA 2EWBA 4BBHA 3D2MA 2ZEOA 2CIJA 3PB4X 3KR4A 2EBJA 2JLMA 4XPDC 4U5YA 2QJ8A 3FX6A 3EC4A 4OC0A 4UFXA 4WWVA 4JJXA 4YRHA 1Y7RA 2B58A 1GYTA 3W6SA 4EWTA 4QBJA 4PV6A 2ZW5A 2ZEHA 2WUUA 1BPNA 4KOTA 4MCSA 4C7HA 4TWEA 4IK2A 4JYWA 4UEFA 5HH1A 3V7ZA 1YW6A 1F57A 5AG4A 1IYLA 2Q4ZA 3IO1A 4KSFA 1VKCA 4UCMA 3D7GA 2FXFA 3FJUA 3IEHA 3D67A 1ZG7A 3EO4A 2FS5A 2G0BA 4NF1A 4A2ZA 2EVNA 2B4DA 3ZZIA 2B3UA 4B12A 2G3AA 5K8MA 3LMSA 4YWYA 1S7FA 3D2PA 1Q2CA 1R43A 3SI2A 1M4LA 4UF4A 3NH8A 3R9EA 4DUKA 1ZLHA 2ZXVA 3S6FA 4ZX8A 4AVAA 3TFYA 2Z3NA 2JBJA 2J8MA 2OZHA 4UA3A 3VARA 4R8FA 2Z3OA 2V8GA 2XEIA 2Z3LA 4KLWA 1S60A 1KWMA 4W9YA 4LX9A 4ZX9A 3IJ3A 5LYIA 2Y0MA 3K9UA 5F09A 4U9ZA 4RS2A 4ZI6A 4BINA 3A9LA 2AFZA 4JXRA 4KSAA 4OC5A 1IOFA 4KVME 3FB3A 4H2KA 3TOAA 2CNMA 3DR8A 4PXCA 1FY7A 2OB0A 2VQYA 5FVJA 5I0CA 5CNPA 2AJ6A 2X7BA 2R98A 2ANPA 4XNHC 5G1ZA 4HNWB 3RBUA 2D4OA 1CP6A 3V38A 1NE9A 2ZEMA 3GLJA 5D29A 2BCOA 4IF5A 5F48A 2OZGA 4PXBA 4B11A 4FBEA 3IWEA 1NMTA 2QECA 5KTAA 3TC8A 2BL1A 5KTDA 3I9SA 4H89A 4KOYA 3FNCA 4CAFA 3DSBA 3FBUA 2YNDA 4YFJA 5AGEA 3VATA 5ISVA 3DDDA 2PRBA 3FVLA 2PJ2A 3H5ZA 3E0KA 3IU1A 3D3SA 4X5KA 3ISZA 2NYQA 2FSRA 5LYLA 5C82A 2QYVA 2JDDA 4GXHA 4A39A 4KOXA 3IU2A 2Q0YA 2G3TA 4IUSA 3WT4A 4OP4A 2Z3MA 3JUWA 3PB6X 1PYTB 1QSTA 2V8VA 2C6CA 1UWYA 2I79A 2BSWA 3CXQA 4A95A 2DPSA 2V8DA 2XEFA 4HNXB 2PIZA 4MCRA 1J4JA 1IGBA 2VBQA 3R1KA 3DNSA 2PJ3A 4JLYA 3B3VA 3PB8X 3T9YA 4FD7A 2F5IA 1OZPA 3DLJA 3D4UA 3EY5A 3FF3A 2P6EA 3NE8A 3CXPA 4CGNA 1S3ZA 5J8FA 2QVPA 2ZOGA 3S9MA 4UBRA 3GYAA 3NA6A 5AG7A 3VH9A 2GREA 4ZBGA 4R7MA 2J9AA 2NMTA 2B5GA 4XPKA 5G21A 1XEBA 3S6GA 4CGLA 4F0YA 5J1QA 3D7FA 3IWWA 4KOWA 4CAWA 5IB9A 4MHYA 4PSWA 1Q2DA 3RNZA 4A31A 3CZXA 4F9VA 5A28A 3HUVA 4PPZA 4RI1A 1ON0A 4R6TA 4C2ZA 2V77A 2ZENA 2Q04A 3NH4A 2PR1A 2J8NA 1FT7A 1DTDA 4UFVA 5H84A 4MCPA 2WPXA 4NGTA 4EMEA 2Q44A 1CPSA 3W91A 1VIXA 3TOBA 2H5MA 1S7NA 5AG5A 3S6HA 2OR4A 2AFXA 1DE4C 3PB7X 3VWDA 2ZEDA 3FXTA 2IJZA 1TF9A 4UEZA 4TNUA 1JWQA 2AFUA 7CPAA 1HDQA 1R3NA 5GCNA 1XBUA 5E96A 4M6IA 1M4GA 4A37A 4BMHA 3WC5A 4P44A 4MXUA 1VHEA 2CNSA 2JDCA 1XOVA 3LACA 1L0CA 1XJOA 2PR8A 3G8WA 4IAVA 4Q38A 3TCVA 4ZY0A 1YGHA 5DWNA 1U6MA 5F49A 3I1UA 4A32A 4ORFA 3SJGA 2P6GA 5HVGA 1S7KA 2PE3A 1FNOA 1Z4RA 3TO9A 2DPTA 2PJCA 3TX8A 4PK2A 1B87A 1IIDA 4RN7A 3K9TA 4MRIA 4UWIA 1MJ9A 4OADA 1TKJA 2ZEEA 4R76A 4P4FA 5EC4A 2B4DB 1K4JA 4OIWA 4M3SA 4NGNA 2GANA 3WABA 3RZAA 3SHPA 5JM6A 1MJBA 4OC1A 5AG6A 1M4DA 1YX0A 4P4JA 2IL4A 2B3VA 4ZY1A 3PZJA 2F8HA 4CPAA 3GKRA 4MI4A 1PCAA 1R57A 2VXKA 2FL4A 2CXAA 3B35A 1M4IA 2PIYA 3B3TA 1LANA 5BWAB 2QMLA 3S9NA 4P4BA 2O53A 4B5PA 4BD9A 1Y0YA 4L89A 6CPAA 2PQ8A 4AXVA 2ZELA 4WJBA 1Z8TA 1CM0A 3FECA 4KORA 5D8NA 1YVOA 1ZG9A 2HB6A 2JEVA 4KOSA 3LD2A 2ZW6A 3KHZA 3TTHA 2IMOA 3GY9A 1X10A 3G3SA 3JVNA 1LRZA 2FIWA 4MJ8A 4KOUA 4NJRA 1QSNA 3F0AA 5F47A 1TF8A 2OU2A 3CXSA 4NCZA 3UY5A 1XMTA 2PJ1A 1MJAA 4ONWA 2J8RA 2C6GA 1S5KA 2RB7A 2OH1A 4NGRA 4DJLA 2I00A 5C88A 1VGYA 1XMBA 1F2PA 3BLNA 5JGFA 4KVOE 1I21A 3LODA 4LQGA 4MHZA 4AG9A 1WK4A 5H86A 4B10A 4F9UA 3TE4A 2XEJA 4NXYA 3PEIA 5CPAA 5LRGA 2PRQA 1CPXA 4H6UA 2RC4A 2BO9A 3QNVA 4CYOA 4R57A 8CPAA 3FEEA 4G1PA 1QSMA 1XIXA 4UWJA 2AFMA 3C26A 2OOTA 3I3GA 1ARMA 3BHXA 3GUXA 1X12A 2PCUA 4C2XA 4Y49B 1KUVA 1ZO0A 3OWCA 1TIQA 1F2OA 1XF8A 1EE3P 1LCPA 2EUIA 4C2YA 3SJEA 4QC6A 1YR0A 3IIBA 4AVBA 4KLVA 1S7LA 4PSXA 2ODFA 2CNTA 2JEWA 4R3LA 4F8ZA 5LYDA 1YLEA 2O28A 2QIRA 3BJ8A 3BI0A 3IC1A 2Q4VA 3JTKA 5EBVA 4UCNA 4ZY2A 2VZYA 4UEEA 3T8WA 2POKA 4NGSA 3L2NA 1I12A 3DR6A 2PJ6A 4QUSA 2G9DA 1LOKA 2V8HA 2Z3KA 4PXEA 4MFZA 4MBUA 4Q36A 5JH9A 1YVKA 1IB1E 4A38A 4KUBA 1Q2YA 4L8AA 3FRMA 3B7IA 3H8EA 3KGQA 4XPDB 2HUZA 3H4QA 2B5GB 3MRUA 3R9GA 3QAYA 5LRKA 3PFEA 2C27A 1BLLE 3H8FA 4P4DA 1AUGA 3B8GA 4B6ZA 5G20A 3SXOA 1YSJA 4A30A 1LFWA 4OIDA 4U9YA 1HEEA 4AG7A 1TKFA 5IX3A 2CY2A 1XRYA 4FUUA 4IHMA 4NGMA 3CPAA 5DWMA 3KQXA 4FD6A 4A94A 1CX8A 1CJWA 2Z0ZA 1Y0RA 2YNEA 3H8GA 2YNCC 2WZNA 4C7IA 2DF5A 4HKFA 4FD4A 4Z65A 4F0XA 4GS4A 3IGRA 4P4EA 1QSRA 4MFLA 5G22A 3B3CA 1VHOA 3R95A 4R9MA 4RUHA 4ZGYB 1QMUA 2PJ8A 4HNYB 3BI1A 2HV2A 2P0WA 3D68A 3FIXA 1UFHA 2VL1A 3B2YA 1Y9KA 4OLLA 4O23A 4UIBA 5HXDA 5IV0A 2ZEGA 1N71A 5K8PA 2AFOA 3WC6A 2R1IA 2PJ4A 2PJAA 3CPXA 2Q7BA 2HC9A 1XE4A 4MY0A 4PXDA 2BUEA 1ZG8A 2PJ9A 1IICA 4E0AA 5HMNA 4FD5A 4X2TA 2FIAA 4PK3A 3KASA 1BPMA 3KL9A 2ZW7A 2RFHA 3KI9A 3DGVA 4K3NA 5EMIA 4B13A 4E8OA 5ELYA 1YW4A 4DNCA 4K30A 4CGOA 4YU9A 4NJQA 3RYOA 1NSAA 5LRJA 4LQ6A 4QVTA 2IQ6A 1Z8XA 2PSWA 4HPSA 2F7VA 2PJ0A 2PVWA 4NGQA 4XPLA 2VZZA 3R9FA 2HQYA 3KHXA 2K5TA 3SI1A 2YGWA 3N5FA 4ZYQA 2PC1A 1AMPA 4JXQA 4KZTA 4M6HA 4CYQA 1ELMP 2I3CA 2Z3PA 3KQZA 3N7ZA 4J3GA 4XNHB 4QB9A 4PQAA 2REFA 4MHNA 2D4PA 4OMEA 1AYEA 2GLFA 3BJ7A 2C6PA 2ZPAA 3SI0A 1TKHA 2C1CA 1QSOA 4KUAA 1GHEA 2ARHA 3TO7A 4CYNA 1ZLIA 5CBMA 2PJBA 4FWUA 2REEA 1KUYA 3W6XA 2CTBA 4MFJA 3TT2A 1YQEA 3NFZA 2Z11A 1IYKA 3CT9A 4KSIA 4B5PB 4MCQA 3S9LA 4MFQA 5LYFA 1M1DA 4P6YA 4R3KA 1IOIA 3S6KA 2PJ5A 3PGPA 1YLOA 3NH5A 1Q7LA 3RAMA 4B5OA 3PBBA 4EFDA 5K8NA 2Q51A 1Z5RA 4OKOA 1OBRA 3B3SA 3F8KA 4CAXA 4CGMA 2ZEPA 1Z9UA 3LWUA 4JZ0A 2EO8A 2FT0A 2FVGA 1BOBA 4MHDA 4OAEA 1RTQA 4R87A 5HVHA 2GFQA 2ATRA 1I1DA 2GLJA 3PP9A 2NSMA 3SJFA 4KS9A 3KR5A 5JQ4A 1YK3A 2FE7A 3JRUA 1Z2LA 2AFWA 3FYNA 4CGPA 4NFRA 4CAVA 4EVYA 3HLPA 3KKWA 2R8VA 1SQHA 3V8IA 1Y7EA 3R96A 3CDXA 1Y9WA 4UIAA 2EK8A 1Z8WA 4LUAA 2VEZA 1YMEA 3QB8A 4H6ZA 1M44A 5A27A 5I4MA 4E2AA 3WC7A 1Z4EA 2B4BA 1CP7A 2GIVA 4CYPA 4CRYB 3MGDA 4MFKA 2R7HA 4KVXA 1P0HA 1BAVA 3FH4A 1LAPA 2AFSA 4X3RA 4YGOA 5THWA 3P2HA 2BOAA 4MFPA 3EFAA 3KZWA 4MHPA 4GM5A 1CBXA 4C68A 3QAHA 2KCWA 2WYRA 1LAMA 2GE3A 3FEDA 1VHSA 5IB0A 1RXTA 1Z8LA 1RO5A 4KOVA 3PB9X 3PRTA 4AVCA 4F6AA 1PUAA 2WSAA 1YREA 2Z10A 2ABZA 3B3WA 4M6GA 3RO0A 3D8PA 4M85A 1ELLP 3GB0A 5KTCA 1MK4A 4JWPA 5JPHA 2YNCA 2O4HA 1IU8A 4MY3A 2VI7A 3BXMA 1PU9A 4NGPA 3WR7A 1P4NA 2EK9A 4ONUA 4JD6A 3K2KA 2ZW4A 2Q43A 4P45A 3F5BA 5K8OA 1BO4A 3MN8A 4OC2A 4CS0B 2PDOA 3ZJ0A 3SXNA 4CAEA 2Q7SA 1QQ9A 4DYOA 3VWEA 1HDUA 3NE7A 1ARLA 2DEAA 4NEXA 1CG2A 4Q7AA
chains in the Genus database with same CATH topology
2OZUA 2Q4YA 1V0CA 4Y49C 4B14A 4UCPA 2BEIA 4UFWA 5J8CA 3TO6A 2DXQA 1KZFA 2FCKA 1NSLA 2P6FA 3T90A 4CRZB 4A33A 2AE6A 1B6BA 3P2FA 2WPWA 4II9A 1KUXA 3EXNA 4AB7A 2A4NA 4I49A 3IWGA 5F46A 1WWZA 4NSQA 4BBHA 3D2MA 2JLMA 4XPDC 4U5YA 3EC4A 4UFXA 4JJXA 4YRHA 1Y7RA 2B58A 3W6SA 4QBJA 4PV6A 2ZW5A 2WUUA 4KOTA 4C7HA 5HH1A 5AG4A 1IYLA 4KSFA 1VKCA 4UCMA 2FXFA 3EO4A 2FS5A 2G0BA 4NF1A 4A2ZA 2EVNA 2B4DA 3ZZIA 2B3UA 4B12A 2G3AA 1S7FA 3D2PA 1Q2CA 3R9EA 2ZXVA 3S6FA 3TFYA 4AVAA 2Z3NA 2J8MA 2OZHA 4UA3A 2Z3OA 4KLWA 2Z3LA 1S60A 4LX9A 2Y0MA 3K9UA 4U9ZA 4RS2A 3A9LA 4JXRA 4KSAA 4KVME 3FB3A 3TOAA 2CNMA 3DR8A 1FY7A 2OB0A 2VQYA 5FVJA 5I0CA 5CNPA 2AJ6A 2X7BA 2R98A 4XNHC 5G1ZA 4HNWB 2D4OA 1NE9A 5F48A 4IF5A 2OZGA 4B11A 3IWEA 1NMTA 2QECA 5KTAA 2BL1A 5KTDA 4H89A 3I9SA 4KOYA 3FNCA 4CAFA 3DSBA 3FBUA 2YNDA 4YFJA 5AGEA 5ISVA 3DDDA 2PRBA 3IU1A 3H5ZA 3E0KA 4X5KA 3D3SA 2FSRA 5C82A 2JDDA 4KOXA 3IU2A 2Q0YA 2G3TA 4IUSA 2Z3MA 3JUWA 1QSTA 4A95A 2I79A 2BSWA 3CXQA 2DPSA 4HNXB 1J4JA 2VBQA 3R1KA 3DNSA 4JLYA 3T9YA 4FD7A 2F5IA 1OZPA 3EY5A 2P6EA 3CXPA 4CGNA 1S3ZA 5J8FA 4UBRA 3GYAA 5AG7A 4ZBGA 2NMTA 2B5GA 4XPKA 5G21A 1XEBA 3S6GA 4CGLA 4F0YA 4KOWA 4CAWA 4PSWA 1Q2DA 4A31A 5A28A 4RI1A 1ON0A 4C2ZA 2Q04A 2PR1A 2J8NA 4UFVA 5H84A 2WPXA 2Q44A 3W91A 3TOBA 2H5MA 1S7NA 5AG5A 3S6HA 3VWDA 3FXTA 5GCNA 5E96A 4BMHA 1M4GA 2CNSA 2JDCA 1L0CA 2PR8A 3G8WA 4Q38A 3TCVA 1YGHA 5DWNA 1U6MA 5F49A 4A32A 4ORFA 2P6GA 1S7KA 1Z4RA 3TO9A 2DPTA 4PK2A 1B87A 1IIDA 4UWIA 1MJ9A 4OADA 5EC4A 2B4DB 1K4JA 4M3SA 2GANA 3SHPA 1MJBA 5AG6A 1M4DA 1YX0A 2IL4A 2B3VA 3PZJA 3GKRA 4MI4A 1R57A 2VXKA 2FL4A 2CXAA 1M4IA 5BWAB 2QMLA 4B5PA 4L89A 2PQ8A 1CM0A 4KORA 1YVOA 2JEVA 4KOSA 3LD2A 2ZW6A 3TTHA 3GY9A 3G3SA 3JVNA 1LRZA 2FIWA 4MJ8A 4KOUA 1QSNA 3F0AA 5F47A 3CXSA 2OU2A 4NCZA 3UY5A 1XMTA 1MJAA 2J8RA 1S5KA 2OH1A 2I00A 5C88A 3BLNA 4KVOE 1I21A 3LODA 4AG9A 1WK4A 5H86A 4B10A 3TE4A 4NXYA 4H6UA 2RC4A 4CYOA 4R57A 1QSMA 1XIXA 4UWJA 3C26A 3I3GA 4C2XA 4Y49B 1KUVA 1ZO0A 3OWCA 1TIQA 1XF8A 2EUIA 4C2YA 4QC6A 1YR0A 4AVBA 4KLVA 1S7LA 2CNTA 4R3LA 1YLEA 2O28A 2QIRA 3BJ8A 3JTKA 5EBVA 2Q4VA 4UCNA 2VZYA 1I12A 3DR6A 4QUSA 2Z3KA 4MFZA 4MBUA 4Q36A 1YVKA 1IB1E 4KUBA 1Q2YA 4L8AA 3FRMA 4XPDB 2HUZA 3H4QA 2B5GB 3R9GA 2C27A 3B8GA 5G20A 3SXOA 4A30A 4AG7A 5IX3A 4U9YA 2CY2A 5DWMA 4FD6A 1CJWA 2Z0ZA 2YNEA 2YNCC 4C7IA 4HKFA 4FD4A 4F0XA 4GS4A 3IGRA 1QSRA 4MFLA 5G22A 3R95A 4R9MA 4ZGYB 4HNYB 4OLLA 2HV2A 2P0WA 3FIXA 4PSXA 1UFHA 5IV0A 1Y9KA 1N71A 2R1IA 2Q7BA 1XE4A 4MY0A 2BUEA 1IICA 4E0AA 5HMNA 4FD5A 2FIAA 4PK3A 2ZW7A 4B13A 4E8OA 4DNCA 4K30A 4CGOA 3RYOA 4QVTA 2PSWA 4XPLA 2VZZA 3R9FA 2HQYA 2K5TA 2YGWA 2PC1A 4JXQA 4KZTA 4CYQA 2Z3PA 4J3GA 3N7ZA 4XNHB 4QB9A 2REFA 2D4PA 3BJ7A 2ZPAA 1QSOA 4KUAA 1GHEA 2ARHA 3TO7A 4CYNA 2REEA 1KUYA 3W6XA 4MFJA 3TT2A 2Z11A 1IYKA 4B5PB 4MFQA 1M1DA 4R3KA 3S6KA 3PGPA 4B5OA 3F8KA 4CAXA 4CGMA 1Z9UA 2FT0A 4MHDA 1BOBA 4OAEA 4R87A 2ATRA 1I1DA 3PP9A 4KS9A 5JQ4A 1YK3A 2FE7A 3FYNA 4CGPA 4CAVA 4EVYA 3KKWA 2R8VA 1SQHA 3V8IA 3R96A 1Y9WA 4LUAA 2VEZA 3QB8A 4H6ZA 1M44A 5A27A 4E2AA 1Z4EA 2B4BA 4CYPA 2GIVA 4CRYB 3MGDA 4MFKA 2R7HA 4KVXA 1P0HA 4YGOA 3P2HA 4MFPA 3EFAA 4C68A 3QAHA 2KCWA 2GE3A 1VHSA 5IB0A 1RXTA 1RO5A 4KOVA 4AVCA 4F6AA 1PUAA 2WSAA 1YREA 2Z10A 3D8PA 4M85A 5KTCA 1MK4A 4JWPA 5JPHA 2YNCA 4MY3A 2VI7A 1PU9A 3WR7A 1P4NA 4ONUA 4JD6A 2ZW4A 3F5BA 1BO4A 4CS0B 2PDOA 3ZJ0A 3SXNA 4CAEA 3VWEA 3NE7A 4NEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZU A;  2Q4Y A;  1V0C A;  4Y49 C;  2BEI A;  5J8C A;  3TO6 A;  2DXQ A;  1KZF A;  2FCK A;  1NSL A;  2P6F A;  3T90 A;  4CRZ B;  2AE6 A;  1B6B A;  3P2F A;  2WPW A;  4II9 A;  1KUX A;  3EXN A;  4AB7 A;  2A4N A;  4I49 A;  3IWG A;  5F46 A;  1WWZ A;  4NSQ A;  3D2M A;  2JLM A;  4XPD C;  4U5Y A;  3EC4 A;  4JJX A;  4YRH A;  1Y7R A;  2B58 A;  3W6S A;  4QBJ A;  4PV6 A;  2ZW5 A;  4KOT A;  5HH1 A;  1IYL A;  1VKC A;  2FXF A;  3EO4 A;  2FS5 A;  2G0B A;  4NF1 A;  2EVN A;  2B4D A;  3ZZI A;  2B3U A;  2G3A A;  1S7F A;  3D2P A;  1Q2C A;  3R9E A;  2ZXV A;  3S6F A;  3TFY A;  4AVA A;  2J8M A;  2OZH A;  4UA3 A;  4KLW A;  1S60 A;  4LX9 A;  2Y0M A;  3K9U A;  4U9Z A;  4RS2 A;  4JXR A;  4KVM E;  3FB3 A;  3TOA A;  2CNM A;  3DR8 A;  1FY7 A;  2OB0 A;  2VQY A;  5FVJ A;  5I0C A;  5CNP A;  2AJ6 A;  2X7B A;  2R98 A;  4XNH C;  4HNW B;  2D4O A;  1NE9 A;  5F48 A;  4IF5 A;  2OZG A;  5KTA A;  1NMT A;  2QEC A;  2BL1 A;  5KTD A;  4KOY A;  4H89 A;  3I9S A;  3FNC A;  3DSB A;  3FBU A;  4YFJ A;  5ISV A;  3DDD A;  2PRB A;  3E0K A;  4X5K A;  3D3S A;  2FSR A;  5C82 A;  2JDD A;  4KOX A;  2Q0Y A;  2G3T A;  4IUS A;  3JUW A;  1QST A;  2I79 A;  2BSW A;  3CXQ A;  4HNX B;  1J4J A;  2VBQ A;  3R1K A;  3DNS A;  4JLY A;  3T9Y A;  4FD7 A;  2F5I A;  1OZP A;  3EY5 A;  2P6E A;  3CXP A;  1S3Z A;  5J8F A;  4UBR A;  3GYA A;  4ZBG A;  2NMT A;  2B5G A;  4XPK A;  1XEB A;  3S6G A;  4F0Y A;  4KOW A;  4CAW A;  4PSW A;  1Q2D A;  4RI1 A;  1ON0 A;  2Q04 A;  2PR1 A;  2J8N A;  5H84 A;  2WPX A;  2Q44 A;  3W91 A;  3TOB A;  2H5M A;  1S7N A;  3S6H A;  3VWD A;  3FXT A;  5GCN A;  5E96 A;  4BMH A;  1M4G A;  2CNS A;  2JDC A;  1L0C A;  2PR8 A;  3G8W A;  3TCV A;  1YGH A;  5DWN A;  1U6M A;  5F49 A;  4ORF A;  2P6G A;  1S7K A;  1Z4R A;  3TO9 A;  4PK2 A;  1B87 A;  1IID A;  4UWI A;  1MJ9 A;  4OAD A;  5EC4 A;  2B4D B;  1K4J A;  4M3S A;  2GAN A;  3SHP A;  1MJB A;  1M4D A;  1YX0 A;  2IL4 A;  2B3V A;  3PZJ A;  3GKR A;  4MI4 A;  1R57 A;  2VXK A;  2FL4 A;  1M4I A;  2QML A;  4B5P A;  4L89 A;  2PQ8 A;  1CM0 A;  4KOR A;  1YVO A;  2JEV A;  4KOS A;  3LD2 A;  2ZW6 A;  3TTH A;  3GY9 A;  3G3S A;  3JVN A;  1LRZ A;  2FIW A;  4MJ8 A;  4KOU A;  1QSN A;  3F0A A;  5F47 A;  3CXS A;  2OU2 A;  4NCZ A;  3UY5 A;  1XMT A;  1MJA A;  2J8R A;  1S5K A;  2OH1 A;  2I00 A;  5C88 A;  3BLN A;  4KVO E;  1I21 A;  3LOD A;  4AG9 A;  1WK4 A;  5H86 A;  3TE4 A;  4NXY A;  4H6U A;  2RC4 A;  4R57 A;  1QSM A;  1XIX A;  4UWJ A;  3C26 A;  3I3G A;  4Y49 B;  1KUV A;  3OWC A;  1TIQ A;  1XF8 A;  2EUI A;  4QC6 A;  1YR0 A;  4AVB A;  4KLV A;  1S7L A;  2CNT A;  4R3L A;  1YLE A;  2O28 A;  2QIR A;  3BJ8 A;  5EBV A;  2Q4V A;  2VZY A;  1I12 A;  3DR6 A;  4QUS A;  4MBU A;  1YVK A;  1IB1 E;  4KUB A;  1Q2Y A;  4L8A A;  3FRM A;  4XPD B;  2HUZ A;  3H4Q A;  2B5G B;  3R9G A;  2C27 A;  3B8G A;  3SXO A;  4AG7 A;  5IX3 A;  4U9Y A;  2CY2 A;  5DWM A;  4FD6 A;  1CJW A;  2Z0Z A;  4HKF A;  4FD4 A;  4GS4 A;  3IGR A;  1QSR A;  3R95 A;  4R9M A;  4HNY B;  4OLL A;  2HV2 A;  2P0W A;  3FIX A;  4PSX A;  1UFH A;  5IV0 A;  1Y9K A;  1N71 A;  2R1I A;  2Q7B A;  1XE4 A;  4MY0 A;  2BUE A;  1IIC A;  4E0A A;  5HMN A;  4FD5 A;  2FIA A;  4PK3 A;  2ZW7 A;  4E8O A;  4DNC A;  4K30 A;  3RYO A;  4QVT A;  2PSW A;  4XPL A;  2VZZ A;  3R9F A;  2HQY A;  2K5T A;  2PC1 A;  4JXQ A;  4KZT A;  4J3G A;  3N7Z A;  4XNH B;  4QB9 A;  2REF A;  2D4P A;  3BJ7 A;  2ZPA A;  1QSO A;  4KUA A;  1GHE A;  2ARH A;  3TO7 A;  2REE A;  1KUY A;  3W6X A;  3TT2 A;  2Z11 A;  1IYK A;  4B5P B;  1M1D A;  4R3K A;  3S6K A;  3PGP A;  4B5O A;  3F8K A;  4CAX A;  1Z9U A;  2FT0 A;  4MHD A;  1BOB A;  4OAE A;  4R87 A;  2ATR A;  1I1D A;  3PP9 A;  5JQ4 A;  1YK3 A;  2FE7 A;  3FYN A;  4CAV A;  4EVY A;  3KKW A;  2R8V A;  1SQH A;  3V8I A;  3R96 A;  1Y9W A;  4LUA A;  2VEZ A;  3QB8 A;  4H6Z A;  1M44 A;  4E2A A;  1Z4E A;  2B4B A;  2GIV A;  4CRY B;  3MGD A;  2R7H A;  4KVX A;  1P0H A;  4YGO A;  3P2H A;  3EFA A;  3QAH A;  2KCW A;  2GE3 A;  1VHS A;  5IB0 A;  1RXT A;  1RO5 A;  4KOV A;  4AVC A;  4F6A A;  1PUA A;  1YRE A;  2Z10 A;  3D8P A;  4M85 A;  5KTC A;  1MK4 A;  4JWP A;  5JPH A;  4MY3 A;  2VI7 A;  1PU9 A;  3WR7 A;  1P4N A;  4ONU A;  4JD6 A;  2ZW4 A;  3F5B A;  1BO4 A;  4CS0 B;  2PDO A;  3ZJ0 A;  3SXN A;  3VWE A;  3NE7 A;  4NEX A; 
#chains in the Genus database with same CATH topology
 5HVF A;  3PBE A;  2CTC A;  2OZU A;  2Q4Y A;  4P4I A;  3FMC A;  1XFO A;  1V0C A;  1IY7 A;  2ZEF A;  4Y49 C;  2PJ7 A;  4MMO A;  4X8I A;  4B14 A;  4UCP A;  3GIU A;  4OC4 A;  1A2Z A;  2BEI A;  3D66 A;  4UFW A;  5J8C A;  3TO6 A;  2DXQ A;  2ZOF A;  2PVV A;  1KZF A;  2FCK A;  2JBK A;  1NSL A;  3SJX A;  3D7D A;  2P6F A;  3T90 A;  4OC3 A;  4A33 A;  4CRZ B;  2GU2 A;  1JQG A;  3ISX A;  3PFO A;  2AE6 A;  1B6B A;  3P2F A;  3D7H A;  2WPW A;  1H8L A;  5DS0 A;  4II9 A;  2CF4 A;  3IFE A;  1KUX A;  3EXN A;  4P10 A;  4AB7 A;  2A4N A;  4I49 A;  2XEG A;  3IWG A;  1TXR A;  5F46 A;  1WWZ A;  4NSQ A;  4FAI A;  2EWB A;  4BBH A;  3D2M A;  2ZEO A;  2CIJ A;  3PB4 X;  3KR4 A;  2EBJ A;  2JLM A;  4XPD C;  4U5Y A;  2QJ8 A;  3FX6 A;  3EC4 A;  4OC0 A;  4UFX A;  4WWV A;  4JJX A;  4YRH A;  1Y7R A;  2B58 A;  1GYT A;  3W6S A;  4EWT A;  4QBJ A;  4PV6 A;  2ZW5 A;  2ZEH A;  2WUU A;  1BPN A;  4KOT A;  4MCS A;  4C7H A;  4TWE A;  4IK2 A;  4JYW A;  4UEF A;  5HH1 A;  3V7Z A;  1YW6 A;  1F57 A;  5AG4 A;  1IYL A;  2Q4Z A;  3IO1 A;  4KSF A;  1VKC A;  4UCM A;  3D7G A;  2FXF A;  3FJU A;  3IEH A;  3D67 A;  1ZG7 A;  3EO4 A;  2FS5 A;  2G0B A;  4NF1 A;  4A2Z A;  2EVN A;  2B4D A;  3ZZI A;  2B3U A;  4B12 A;  2G3A A;  5K8M A;  3LMS A;  4YWY A;  1S7F A;  3D2P A;  1Q2C A;  1R43 A;  3SI2 A;  1M4L A;  4UF4 A;  3NH8 A;  3R9E A;  4DUK A;  1ZLH A;  2ZXV A;  3S6F A;  4ZX8 A;  4AVA A;  3TFY A;  2Z3N A;  2JBJ A;  2J8M A;  2OZH A;  4UA3 A;  3VAR A;  4R8F A;  2Z3O A;  2V8G A;  2XEI A;  2Z3L A;  4KLW A;  1S60 A;  1KWM A;  4W9Y A;  4LX9 A;  4ZX9 A;  3IJ3 A;  5LYI A;  2Y0M A;  3K9U A;  5F09 A;  4U9Z A;  4RS2 A;  4ZI6 A;  4BIN A;  3A9L A;  2AFZ A;  4JXR A;  4KSA A;  4OC5 A;  1IOF A;  4KVM E;  3FB3 A;  4H2K A;  3TOA A;  2CNM A;  3DR8 A;  4PXC A;  1FY7 A;  2OB0 A;  2VQY A;  5FVJ A;  5I0C A;  5CNP A;  2AJ6 A;  2X7B A;  2R98 A;  2ANP A;  4XNH C;  5G1Z A;  4HNW B;  3RBU A;  2D4O A;  1CP6 A;  3V38 A;  1NE9 A;  2ZEM A;  3GLJ A;  5D29 A;  2BCO A;  4IF5 A;  5F48 A;  2OZG A;  4PXB A;  4B11 A;  4FBE A;  3IWE A;  1NMT A;  2QEC A;  5KTA A;  3TC8 A;  2BL1 A;  5KTD A;  3I9S A;  4H89 A;  4KOY A;  3FNC A;  4CAF A;  3DSB A;  3FBU A;  2YND A;  4YFJ A;  5AGE A;  3VAT A;  5ISV A;  3DDD A;  2PRB A;  3FVL A;  2PJ2 A;  3H5Z A;  3E0K A;  3IU1 A;  3D3S A;  4X5K A;  3ISZ A;  2NYQ A;  2FSR A;  5LYL A;  5C82 A;  2QYV A;  2JDD A;  4GXH A;  4A39 A;  4KOX A;  3IU2 A;  2Q0Y A;  2G3T A;  4IUS A;  3WT4 A;  4OP4 A;  2Z3M A;  3JUW A;  3PB6 X;  1PYT B;  1QST A;  2V8V A;  2C6C A;  1UWY A;  2I79 A;  2BSW A;  3CXQ A;  4A95 A;  2DPS A;  2V8D A;  2XEF A;  4HNX B;  2PIZ A;  4MCR A;  1J4J A;  1IGB A;  2VBQ A;  3R1K A;  3DNS A;  2PJ3 A;  4JLY A;  3B3V A;  3PB8 X;  3T9Y A;  4FD7 A;  2F5I A;  1OZP A;  3DLJ A;  3D4U A;  3EY5 A;  3FF3 A;  2P6E A;  3NE8 A;  3CXP A;  4CGN A;  1S3Z A;  5J8F A;  2QVP A;  2ZOG A;  3S9M A;  4UBR A;  3GYA A;  3NA6 A;  5AG7 A;  3VH9 A;  2GRE A;  4ZBG A;  4R7M A;  2J9A A;  2NMT A;  2B5G A;  4XPK A;  5G21 A;  1XEB A;  3S6G A;  4CGL A;  4F0Y A;  5J1Q A;  3D7F A;  3IWW A;  4KOW A;  4CAW A;  5IB9 A;  4MHY A;  4PSW A;  1Q2D A;  3RNZ A;  4A31 A;  3CZX A;  4F9V A;  5A28 A;  3HUV A;  4PPZ A;  4RI1 A;  1ON0 A;  4R6T A;  4C2Z A;  2V77 A;  2ZEN A;  2Q04 A;  3NH4 A;  2PR1 A;  2J8N A;  1FT7 A;  1DTD A;  4UFV A;  5H84 A;  4MCP A;  2WPX A;  4NGT A;  4EME A;  2Q44 A;  1CPS A;  3W91 A;  1VIX A;  3TOB A;  2H5M A;  1S7N A;  5AG5 A;  3S6H A;  2OR4 A;  2AFX A;  1DE4 C;  3PB7 X;  3VWD A;  2ZED A;  3FXT A;  2IJZ A;  1TF9 A;  4UEZ A;  4TNU A;  1JWQ A;  2AFU A;  7CPA A;  1HDQ A;  1R3N A;  5GCN A;  1XBU A;  5E96 A;  4M6I A;  1M4G A;  4A37 A;  4BMH A;  3WC5 A;  4P44 A;  4MXU A;  1VHE A;  2CNS A;  2JDC A;  1XOV A;  3LAC A;  1L0C A;  1XJO A;  2PR8 A;  3G8W A;  4IAV A;  4Q38 A;  3TCV A;  4ZY0 A;  1YGH A;  5DWN A;  1U6M A;  5F49 A;  3I1U A;  4A32 A;  4ORF A;  3SJG A;  2P6G A;  5HVG A;  1S7K A;  2PE3 A;  1FNO A;  1Z4R A;  3TO9 A;  2DPT A;  2PJC A;  3TX8 A;  4PK2 A;  1B87 A;  1IID A;  4RN7 A;  3K9T A;  4MRI A;  4UWI A;  1MJ9 A;  4OAD A;  1TKJ A;  2ZEE A;  4R76 A;  4P4F A;  5EC4 A;  2B4D B;  1K4J A;  4OIW A;  4M3S A;  4NGN A;  2GAN A;  3WAB A;  3RZA A;  3SHP A;  5JM6 A;  1MJB A;  4OC1 A;  5AG6 A;  1M4D A;  1YX0 A;  4P4J A;  2IL4 A;  2B3V A;  4ZY1 A;  3PZJ A;  2F8H A;  4CPA A;  3GKR A;  4MI4 A;  1PCA A;  1R57 A;  2VXK A;  2FL4 A;  2CXA A;  3B35 A;  1M4I A;  2PIY A;  3B3T A;  1LAN A;  5BWA B;  2QML A;  3S9N A;  4P4B A;  2O53 A;  4B5P A;  4BD9 A;  1Y0Y A;  4L89 A;  6CPA A;  2PQ8 A;  4AXV A;  2ZEL A;  4WJB A;  1Z8T A;  1CM0 A;  3FEC A;  4KOR A;  5D8N A;  1YVO A;  1ZG9 A;  2HB6 A;  2JEV A;  4KOS A;  3LD2 A;  2ZW6 A;  3KHZ A;  3TTH A;  2IMO A;  3GY9 A;  1X10 A;  3G3S A;  3JVN A;  1LRZ A;  2FIW A;  4MJ8 A;  4KOU A;  4NJR A;  1QSN A;  3F0A A;  5F47 A;  1TF8 A;  2OU2 A;  3CXS A;  4NCZ A;  3UY5 A;  1XMT A;  2PJ1 A;  1MJA A;  4ONW A;  2J8R A;  2C6G A;  1S5K A;  2RB7 A;  2OH1 A;  4NGR A;  4DJL A;  2I00 A;  5C88 A;  1VGY A;  1XMB A;  1F2P A;  3BLN A;  5JGF A;  4KVO E;  1I21 A;  3LOD A;  4LQG A;  4MHZ A;  4AG9 A;  1WK4 A;  5H86 A;  4B10 A;  4F9U A;  3TE4 A;  2XEJ A;  4NXY A;  3PEI A;  5CPA A;  5LRG A;  2PRQ A;  1CPX A;  4H6U A;  2RC4 A;  2BO9 A;  3QNV A;  4CYO A;  4R57 A;  8CPA A;  3FEE A;  4G1P A;  1QSM A;  1XIX A;  4UWJ A;  2AFM A;  3C26 A;  2OOT A;  3I3G A;  1ARM A;  3BHX A;  3GUX A;  1X12 A;  2PCU A;  4C2X A;  4Y49 B;  1KUV A;  1ZO0 A;  3OWC A;  1TIQ A;  1F2O A;  1XF8 A;  1EE3 P;  1LCP A;  2EUI A;  4C2Y A;  3SJE A;  4QC6 A;  1YR0 A;  3IIB A;  4AVB A;  4KLV A;  1S7L A;  4PSX A;  2ODF A;  2CNT A;  2JEW A;  4R3L A;  4F8Z A;  5LYD A;  1YLE A;  2O28 A;  2QIR A;  3BJ8 A;  3BI0 A;  3IC1 A;  2Q4V A;  3JTK A;  5EBV A;  4UCN A;  4ZY2 A;  2VZY A;  4UEE A;  3T8W A;  2POK A;  4NGS A;  3L2N A;  1I12 A;  3DR6 A;  2PJ6 A;  4QUS A;  2G9D A;  1LOK A;  2V8H A;  2Z3K A;  4PXE A;  4MFZ A;  4MBU A;  4Q36 A;  5JH9 A;  1YVK A;  1IB1 E;  4A38 A;  4KUB A;  1Q2Y A;  4L8A A;  3FRM A;  3B7I A;  3H8E A;  3KGQ A;  4XPD B;  2HUZ A;  3H4Q A;  2B5G B;  3MRU A;  3R9G A;  3QAY A;  5LRK A;  3PFE A;  2C27 A;  1BLL E;  3H8F A;  4P4D A;  1AUG A;  3B8G A;  4B6Z A;  5G20 A;  3SXO A;  1YSJ A;  4A30 A;  1LFW A;  4OID A;  4U9Y A;  1HEE A;  4AG7 A;  1TKF A;  5IX3 A;  2CY2 A;  1XRY A;  4FUU A;  4IHM A;  4NGM A;  3CPA A;  5DWM A;  3KQX A;  4FD6 A;  4A94 A;  1CX8 A;  1CJW A;  2Z0Z A;  1Y0R A;  2YNE A;  3H8G A;  2YNC C;  2WZN A;  4C7I A;  2DF5 A;  4HKF A;  4FD4 A;  4Z65 A;  4F0X A;  4GS4 A;  3IGR A;  4P4E A;  1QSR A;  4MFL A;  5G22 A;  3B3C A;  1VHO A;  3R95 A;  4R9M A;  4RUH A;  4ZGY B;  1QMU A;  2PJ8 A;  4HNY B;  3BI1 A;  2HV2 A;  2P0W A;  3D68 A;  3FIX A;  1UFH A;  2VL1 A;  3B2Y A;  1Y9K A;  4OLL A;  4O23 A;  4UIB A;  5HXD A;  5IV0 A;  2ZEG A;  1N71 A;  5K8P A;  2AFO A;  3WC6 A;  2R1I A;  2PJ4 A;  2PJA A;  3CPX A;  2Q7B A;  2HC9 A;  1XE4 A;  4MY0 A;  4PXD A;  2BUE A;  1ZG8 A;  2PJ9 A;  1IIC A;  4E0A A;  5HMN A;  4FD5 A;  4X2T A;  2FIA A;  4PK3 A;  3KAS A;  1BPM A;  3KL9 A;  2ZW7 A;  2RFH A;  3KI9 A;  3DGV A;  4K3N A;  5EMI A;  4B13 A;  4E8O A;  5ELY A;  1YW4 A;  4DNC A;  4K30 A;  4CGO A;  4YU9 A;  4NJQ A;  3RYO A;  1NSA A;  5LRJ A;  4LQ6 A;  4QVT A;  2IQ6 A;  1Z8X A;  2PSW A;  4HPS A;  2F7V A;  2PJ0 A;  2PVW A;  4NGQ A;  4XPL A;  2VZZ A;  3R9F A;  2HQY A;  3KHX A;  2K5T A;  3SI1 A;  2YGW A;  3N5F A;  4ZYQ A;  2PC1 A;  1AMP A;  4JXQ A;  4KZT A;  4M6H A;  4CYQ A;  1ELM P;  2I3C A;  2Z3P A;  3KQZ A;  3N7Z A;  4J3G A;  4XNH B;  4QB9 A;  4PQA A;  2REF A;  4MHN A;  2D4P A;  4OME A;  1AYE A;  2GLF A;  3BJ7 A;  2C6P A;  2ZPA A;  3SI0 A;  1TKH A;  2C1C A;  1QSO A;  4KUA A;  1GHE A;  2ARH A;  3TO7 A;  4CYN A;  1ZLI A;  5CBM A;  2PJB A;  4FWU A;  2REE A;  1KUY A;  3W6X A;  2CTB A;  4MFJ A;  3TT2 A;  1YQE A;  3NFZ A;  2Z11 A;  1IYK A;  3CT9 A;  4KSI A;  4B5P B;  4MCQ A;  3S9L A;  4MFQ A;  5LYF A;  1M1D A;  4P6Y A;  4R3K A;  1IOI A;  3S6K A;  2PJ5 A;  3PGP A;  1YLO A;  3NH5 A;  1Q7L A;  3RAM A;  4B5O A;  3PBB A;  4EFD A;  5K8N A;  2Q51 A;  1Z5R A;  4OKO A;  1OBR A;  3B3S A;  3F8K A;  4CAX A;  4CGM A;  2ZEP A;  1Z9U A;  3LWU A;  4JZ0 A;  2EO8 A;  2FT0 A;  2FVG A;  1BOB A;  4MHD A;  4OAE A;  1RTQ A;  4R87 A;  5HVH A;  2GFQ A;  2ATR A;  1I1D A;  2GLJ A;  3PP9 A;  2NSM A;  3SJF A;  4KS9 A;  3KR5 A;  5JQ4 A;  1YK3 A;  2FE7 A;  3JRU A;  1Z2L A;  2AFW A;  3FYN A;  4CGP A;  4NFR A;  4CAV A;  4EVY A;  3HLP A;  3KKW A;  2R8V A;  1SQH A;  3V8I A;  1Y7E A;  3R96 A;  3CDX A;  1Y9W A;  4UIA A;  2EK8 A;  1Z8W A;  4LUA A;  2VEZ A;  1YME A;  3QB8 A;  4H6Z A;  1M44 A;  5A27 A;  5I4M A;  4E2A A;  3WC7 A;  1Z4E A;  2B4B A;  1CP7 A;  2GIV A;  4CYP A;  4CRY B;  3MGD A;  4MFK A;  2R7H A;  4KVX A;  1P0H A;  1BAV A;  3FH4 A;  1LAP A;  2AFS A;  4X3R A;  4YGO A;  5THW A;  3P2H A;  2BOA A;  4MFP A;  3EFA A;  3KZW A;  4MHP A;  4GM5 A;  1CBX A;  4C68 A;  3QAH A;  2KCW A;  2WYR A;  1LAM A;  2GE3 A;  3FED A;  1VHS A;  5IB0 A;  1RXT A;  1Z8L A;  1RO5 A;  4KOV A;  3PB9 X;  3PRT A;  4AVC A;  4F6A A;  1PUA A;  2WSA A;  1YRE A;  2Z10 A;  2ABZ A;  3B3W A;  4M6G A;  3RO0 A;  3D8P A;  4M85 A;  1ELL P;  3GB0 A;  5KTC A;  1MK4 A;  4JWP A;  5JPH A;  2YNC A;  2O4H A;  1IU8 A;  4MY3 A;  2VI7 A;  3BXM A;  1PU9 A;  4NGP A;  3WR7 A;  1P4N A;  2EK9 A;  4ONU A;  4JD6 A;  3K2K A;  2ZW4 A;  2Q43 A;  4P45 A;  3F5B A;  5K8O A;  1BO4 A;  3MN8 A;  4OC2 A;  4CS0 B;  2PDO A;  3ZJ0 A;  3SXN A;  4CAE A;  2Q7S A;  1QQ9 A;  4DYO A;  3VWE A;  1HDU A;  3NE7 A;  1ARL A;  2DEA A;  4NEX A;  1CG2 A;  4Q7A A; 
#chains in the Genus database with same CATH homology
 2OZU A;  2Q4Y A;  1V0C A;  4Y49 C;  4B14 A;  4UCP A;  2BEI A;  4UFW A;  5J8C A;  3TO6 A;  2DXQ A;  1KZF A;  2FCK A;  1NSL A;  2P6F A;  3T90 A;  4CRZ B;  4A33 A;  2AE6 A;  1B6B A;  3P2F A;  2WPW A;  4II9 A;  1KUX A;  3EXN A;  4AB7 A;  2A4N A;  4I49 A;  3IWG A;  5F46 A;  1WWZ A;  4NSQ A;  4BBH A;  3D2M A;  2JLM A;  4XPD C;  4U5Y A;  3EC4 A;  4UFX A;  4JJX A;  4YRH A;  1Y7R A;  2B58 A;  3W6S A;  4QBJ A;  4PV6 A;  2ZW5 A;  2WUU A;  4KOT A;  4C7H A;  5HH1 A;  5AG4 A;  1IYL A;  4KSF A;  1VKC A;  4UCM A;  2FXF A;  3EO4 A;  2FS5 A;  2G0B A;  4NF1 A;  4A2Z A;  2EVN A;  2B4D A;  3ZZI A;  2B3U A;  4B12 A;  2G3A A;  1S7F A;  3D2P A;  1Q2C A;  3R9E A;  2ZXV A;  3S6F A;  3TFY A;  4AVA A;  2Z3N A;  2J8M A;  2OZH A;  4UA3 A;  2Z3O A;  4KLW A;  2Z3L A;  1S60 A;  4LX9 A;  2Y0M A;  3K9U A;  4U9Z A;  4RS2 A;  3A9L A;  4JXR A;  4KSA A;  4KVM E;  3FB3 A;  3TOA A;  2CNM A;  3DR8 A;  1FY7 A;  2OB0 A;  2VQY A;  5FVJ A;  5I0C A;  5CNP A;  2AJ6 A;  2X7B A;  2R98 A;  4XNH C;  5G1Z A;  4HNW B;  2D4O A;  1NE9 A;  5F48 A;  4IF5 A;  2OZG A;  4B11 A;  3IWE A;  1NMT A;  2QEC A;  5KTA A;  2BL1 A;  5KTD A;  4H89 A;  3I9S A;  4KOY A;  3FNC A;  4CAF A;  3DSB A;  3FBU A;  2YND A;  4YFJ A;  5AGE A;  5ISV A;  3DDD A;  2PRB A;  3IU1 A;  3H5Z A;  3E0K A;  4X5K A;  3D3S A;  2FSR A;  5C82 A;  2JDD A;  4KOX A;  3IU2 A;  2Q0Y A;  2G3T A;  4IUS A;  2Z3M A;  3JUW A;  1QST A;  4A95 A;  2I79 A;  2BSW A;  3CXQ A;  2DPS A;  4HNX B;  1J4J A;  2VBQ A;  3R1K A;  3DNS A;  4JLY A;  3T9Y A;  4FD7 A;  2F5I A;  1OZP A;  3EY5 A;  2P6E A;  3CXP A;  4CGN A;  1S3Z A;  5J8F A;  4UBR A;  3GYA A;  5AG7 A;  4ZBG A;  2NMT A;  2B5G A;  4XPK A;  5G21 A;  1XEB A;  3S6G A;  4CGL A;  4F0Y A;  4KOW A;  4CAW A;  4PSW A;  1Q2D A;  4A31 A;  5A28 A;  4RI1 A;  1ON0 A;  4C2Z A;  2Q04 A;  2PR1 A;  2J8N A;  4UFV A;  5H84 A;  2WPX A;  2Q44 A;  3W91 A;  3TOB A;  2H5M A;  1S7N A;  5AG5 A;  3S6H A;  3VWD A;  3FXT A;  5GCN A;  5E96 A;  4BMH A;  1M4G A;  2CNS A;  2JDC A;  1L0C A;  2PR8 A;  3G8W A;  4Q38 A;  3TCV A;  1YGH A;  5DWN A;  1U6M A;  5F49 A;  4A32 A;  4ORF A;  2P6G A;  1S7K A;  1Z4R A;  3TO9 A;  2DPT A;  4PK2 A;  1B87 A;  1IID A;  4UWI A;  1MJ9 A;  4OAD A;  5EC4 A;  2B4D B;  1K4J A;  4M3S A;  2GAN A;  3SHP A;  1MJB A;  5AG6 A;  1M4D A;  1YX0 A;  2IL4 A;  2B3V A;  3PZJ A;  3GKR A;  4MI4 A;  1R57 A;  2VXK A;  2FL4 A;  2CXA A;  1M4I A;  5BWA B;  2QML A;  4B5P A;  4L89 A;  2PQ8 A;  1CM0 A;  4KOR A;  1YVO A;  2JEV A;  4KOS A;  3LD2 A;  2ZW6 A;  3TTH A;  3GY9 A;  3G3S A;  3JVN A;  1LRZ A;  2FIW A;  4MJ8 A;  4KOU A;  1QSN A;  3F0A A;  5F47 A;  3CXS A;  2OU2 A;  4NCZ A;  3UY5 A;  1XMT A;  1MJA A;  2J8R A;  1S5K A;  2OH1 A;  2I00 A;  5C88 A;  3BLN A;  4KVO E;  1I21 A;  3LOD A;  4AG9 A;  1WK4 A;  5H86 A;  4B10 A;  3TE4 A;  4NXY A;  4H6U A;  2RC4 A;  4CYO A;  4R57 A;  1QSM A;  1XIX A;  4UWJ A;  3C26 A;  3I3G A;  4C2X A;  4Y49 B;  1KUV A;  1ZO0 A;  3OWC A;  1TIQ A;  1XF8 A;  2EUI A;  4C2Y A;  4QC6 A;  1YR0 A;  4AVB A;  4KLV A;  1S7L A;  2CNT A;  4R3L A;  1YLE A;  2O28 A;  2QIR A;  3BJ8 A;  3JTK A;  5EBV A;  2Q4V A;  4UCN A;  2VZY A;  1I12 A;  3DR6 A;  4QUS A;  2Z3K A;  4MFZ A;  4MBU A;  4Q36 A;  1YVK A;  1IB1 E;  4KUB A;  1Q2Y A;  4L8A A;  3FRM A;  4XPD B;  2HUZ A;  3H4Q A;  2B5G B;  3R9G A;  2C27 A;  3B8G A;  5G20 A;  3SXO A;  4A30 A;  4AG7 A;  5IX3 A;  4U9Y A;  2CY2 A;  5DWM A;  4FD6 A;  1CJW A;  2Z0Z A;  2YNE A;  2YNC C;  4C7I A;  4HKF A;  4FD4 A;  4F0X A;  4GS4 A;  3IGR A;  1QSR A;  4MFL A;  5G22 A;  3R95 A;  4R9M A;  4ZGY B;  4HNY B;  4OLL A;  2HV2 A;  2P0W A;  3FIX A;  4PSX A;  1UFH A;  5IV0 A;  1Y9K A;  1N71 A;  2R1I A;  2Q7B A;  1XE4 A;  4MY0 A;  2BUE A;  1IIC A;  4E0A A;  5HMN A;  4FD5 A;  2FIA A;  4PK3 A;  2ZW7 A;  4B13 A;  4E8O A;  4DNC A;  4K30 A;  4CGO A;  3RYO A;  4QVT A;  2PSW A;  4XPL A;  2VZZ A;  3R9F A;  2HQY A;  2K5T A;  2YGW A;  2PC1 A;  4JXQ A;  4KZT A;  4CYQ A;  2Z3P A;  4J3G A;  3N7Z A;  4XNH B;  4QB9 A;  2REF A;  2D4P A;  3BJ7 A;  2ZPA A;  1QSO A;  4KUA A;  1GHE A;  2ARH A;  3TO7 A;  4CYN A;  2REE A;  1KUY A;  3W6X A;  4MFJ A;  3TT2 A;  2Z11 A;  1IYK A;  4B5P B;  4MFQ A;  1M1D A;  4R3K A;  3S6K A;  3PGP A;  4B5O A;  3F8K A;  4CAX A;  4CGM A;  1Z9U A;  2FT0 A;  4MHD A;  1BOB A;  4OAE A;  4R87 A;  2ATR A;  1I1D A;  3PP9 A;  4KS9 A;  5JQ4 A;  1YK3 A;  2FE7 A;  3FYN A;  4CGP A;  4CAV A;  4EVY A;  3KKW A;  2R8V A;  1SQH A;  3V8I A;  3R96 A;  1Y9W A;  4LUA A;  2VEZ A;  3QB8 A;  4H6Z A;  1M44 A;  5A27 A;  4E2A A;  1Z4E A;  2B4B A;  4CYP A;  2GIV A;  4CRY B;  3MGD A;  4MFK A;  2R7H A;  4KVX A;  1P0H A;  4YGO A;  3P2H A;  4MFP A;  3EFA A;  4C68 A;  3QAH A;  2KCW A;  2GE3 A;  1VHS A;  5IB0 A;  1RXT A;  1RO5 A;  4KOV A;  4AVC A;  4F6A A;  1PUA A;  2WSA A;  1YRE A;  2Z10 A;  3D8P A;  4M85 A;  5KTC A;  1MK4 A;  4JWP A;  5JPH A;  2YNC A;  4MY3 A;  2VI7 A;  1PU9 A;  3WR7 A;  1P4N A;  4ONU A;  4JD6 A;  2ZW4 A;  3F5B A;  1BO4 A;  4CS0 B;  2PDO A;  3ZJ0 A;  3SXN A;  4CAE A;  3VWE A;  3NE7 A;  4NEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...