2WPWA

Tandem gnat protein from the clavulanic acid biosynthesis pathway (without accoa)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
336
structure length
328
Chain Sequence
b'TAGELEFVPLAANDDETVGQWLDLMALAAETGPRAAPPCNVDMVGSLRFAPPATALDDWVVRSGGRVVGALRLALPDGAPTARVDQLLVHPGRRRRGIGRALWAHARELARKHDRTTLTATVVESLPSGPAQDPGPAAFAAAMGAHRSDIPAGTHQWLDLDRHDPLADGVPAVPAGYSLVTWGTITPDEYAVPVSELELRAAQEVRTSYARQFETMRVGRGRRAYHTGAVHDATGALAGYTSVSKTTGNPAYALQGMTVVHREHRGHALGTLLKLANLEYVLRHEPEVRLVETANAEDNHPMIAVNAALGFEPYDRWVFWTAEAGPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF14
publication title Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 85
structure length 328
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wpwA00
4H6UA 1V0CA 3TT2A 2ARHA 4KOXA 2Q7BA 4ONUA 4KVXA 2B5GB 4QC6A 3W6XA 2B3UA 2OZUA 4XPDC 5JQ4A 1QSMA 1P4NA 4YRHA 5I0CA 3W6SA 1YVOA 2Z10A 3OWCA 2DXQA 1PUAA 2VEZA 1YGHA 3P2FA 2CNSA 3N7ZA 1N71A 4NXYA 2R7HA 4CAVA 2PR1A 4UBRA 4KOVA 4HNXB 2GE3A 2WPWA 4KVOE 3VWDA 1Z4EA 4PSWA 4MHDA 1Q2CA 3FB3A 1KUXA 1IB1E 2VI7A 1UFHA 1GHEA 4CS0B 5C82A 1IICA 1Y9KA 5H84A 2GIVA 4XPLA 3R9EA 1Q2YA 4MJ8A 4U9YA 2R1IA 4Y49B 5H86A 4KZTA 4QVTA 4JXQA 2B4BA 1Q2DA 2EVNA 4KOSA 1OZPA 3RYOA 2AE6A 2JEVA 4R87A 4XPKA 4HKFA 1VKCA 3BJ8A 4LX9A 4PV6A 5HH1A 2QIRA 2OU2A 3LODA 5FVJA 3EY5A 3S6HA 4FD6A 2QMLA 1S60A 4FD5A 2ZW4A 3PGPA 5J8CA 1TIQA 1LRZA 2G0BA 4KVME 2BL1A 3E0KA 4JD6A 4JLYA 2JDDA 3TE4A 3G8WA 2B5GA 3DR8A 1S7LA 2BSWA 3TTHA 2C27A 2J8NA 4RI1A 2K5TA 4L89A 2B58A 3DDDA 3P2HA 2P6EA 2HUZA 1XEBA 3KKWA 4QBJA 3DNSA 2BEIA 2G3TA 2WPXA 2FL4A 2P6GA 3R1KA 2D4PA 3MGDA 5KTDA 1S3ZA 2IL4A 2KCWA 5F46A 4AB7A 4II9A 3B8GA 1YX0A 2I79A 4H6ZA 1YREA 2GANA 2OB0A 2CY2A 2Q04A 4FD4A 3IWGA 4OAEA 5DWMA 4AG9A 4CRYB 3DR6A 2FIWA 2VZYA 1MJ9A 1NSLA 4NF1A 4NCZA 2ZW7A 1XIXA 4MI4A 2BUEA 4M3SA 1S7NA 3R95A 3TO9A 3PP9A 3TO7A 1R57A 3FBUA 1YK3A 2FS5A 4KOTA 3BJ7A 1IIDA 4Y49C 4XNHB 2J8MA 2ZW5A 4J3GA 2Q44A 4E8OA 4KLWA 1M44A 5EC4A 1WK4A 2F5IA 1B87A 2RC4A 1K4JA 1IYKA 4K30A 4KOWA 4OADA 1YR0A 2JLMA 1VHSA 4RS2A 4KUBA 3TCVA 3F0AA 1B6BA 4E0AA 2FCKA 1PU9A 2R98A 2VBQA 4KLVA 1L0CA 4B5PA 3EFAA 4YFJA 1MK4A 2P6FA 4HNYB 2VQYA 4JXRA 3CXSA 2VZZA 2OH1A 1ON0A 4YGOA 2PC1A 2Z0ZA 1WWZA 4GS4A 3F5BA 4B5OA 1S7KA 2J8RA 1CJWA 2X7BA 3QAHA 4CAWA 4MBUA 4QUSA 4PSXA 4UWJA 2ZXVA 1XF8A 1FY7A 2R8VA 4MY3A 1CM0A 4R3LA 3JVNA 2H5MA 1J4JA 4AG7A 2ZPAA 4JJXA 4U5YA 3SXNA 3GY9A 4PK3A 3EXNA 5ISVA 3DSBA 2Q0YA 1I12A 3WR7A 1M1DA 2D4OA 3TFYA 5J8FA 4PK2A 1KUVA 4M85A 4KOUA 1IYLA 3FIXA 3TO6A 4H89A 2B4DA 2REFA 4B5PB 2FXFA 3R96A 4AVBA 3CXQA 2QECA 5C88A 3VWEA 1RO5A 2PR8A 2P0WA 3FRMA 2FIAA 3EO4A 5JPHA 2OZHA 4NSQA 4JWPA 3D3SA 2VXKA 2ZW6A 2ATRA 1NE9A 1YVKA 3T90A 2FT0A 4F6AA 4R3KA 4XNHC 3FYNA 1M4DA 3CXPA 2O28A 1KUYA 4AVCA 3UY5A 1U6MA 5F49A 3SHPA 3IGRA 3C26A 1NMTA 1Y9WA 3PZJA 3W91A 2Y0MA 1QSNA 5F48A 3F8KA 1BOBA 5CNPA 2B4DB 1I21A 2Q4YA 2EUIA 3S6KA 5HMNA 5IV0A 1BO4A 4CAXA 4XPDB 4F0YA 2G3AA 4X5KA 1M4IA 3GKRA 2Z11A 2A4NA 4I49A 3BLNA 3QB8A 4ORFA 1P0HA 4FD7A 4IUSA 4U9ZA 3D2PA 3D8PA 4NEXA 5GCNA 2OZGA 5EBVA 5IB0A 3K9UA 2PRBA 3JUWA 4MY0A 5IX3A 3I9SA 4E2AA 5F47A 1QSTA 4LUAA 3TOAA 4QB9A 2CNTA 4R9MA 4UWIA 2JDCA 3G3SA 4KORA 1XE4A 3ZZIA 1KZFA 1SQHA 2AJ6A 2HQYA 3EC4A 2FE7A 3V8IA 4IF5A 4HNWB 1YLEA 2CNMA 3GYAA 2PDOA 2B3VA 4DNCA 3T9YA 3H4QA 4UA3A 3R9GA 4KUAA 1S5KA 4OLLA 1QSRA 3NE7A 4AVAA 2PQ8A 3FXTA 1QSOA 4ZBGA 1Z9UA 4BMHA 1Z4RA 1MJBA 3D2MA 2I00A 1XMTA 3LD2A 4R57A 2NMTA 3TOBA 1I1DA 1Y7RA 5E96A 2PSWA 2Q4VA 1MJAA 3I3GA 3S6GA 1S7FA 4CRZB 5KTCA 3S6FA 2REEA 2HV2A 2FSRA 5KTAA 4EVYA 1RXTA 3SXOA 4L8AA 3ZJ0A 5DWNA 1M4GA 3R9FA 3FNCA 4KOYA
chains in the Genus database with same CATH superfamily
5LRKA 3PBEA 4P6YA 4C2XA 4H6UA 1V0CA 3NH8A 3TT2A 2ARHA 1HEEA 3KQXA 3SJXA 3V7ZA 4KOXA 2Q7BA 3CZXA 4ONUA 4KVXA 3QNVA 4PXBA 2BO9A 2B5GB 2PJ2A 4QC6A 2B3UA 2OZUA 4MFQA 1TF8A 4XPDC 3W6XA 5JQ4A 1QSMA 4EMEA 1P4NA 1LFWA 4YRHA 5I0CA 3W6SA 4DJLA 5IB9A 4ONWA 1ZG8A 1YVOA 1Z8LA 2CXAA 3KL9A 3T8WA 4DYOA 2Z10A 2PJ9A 5CPAA 1TF9A 1JQGA 3OWCA 2DXQA 4WJBA 5G20A 2ZOGA 2ZEDA 1PUAA 2VEZA 4A30A 2Z3NA 1YGHA 3P2FA 2CNSA 3N7ZA 4UIAA 5THWA 1ELLP 1N71A 4P4FA 4NXYA 2R7HA 2Q7SA 2PVVA 4NGPA 3NA6A 2PR1A 4CAVA 1Z8WA 2NSMA 2PJ6A 1X12A 4KOVA 4UBRA 1A2ZA 2POKA 2GE3A 2WPWA 4HNXB 4KVOE 2RB7A 4LQ6A 1Z4EA 3VWDA 4PSWA 4MHDA 1Q2CA 2WZNA 4PXDA 3JRUA 3WABA 3FB3A 2ZENA 1KUXA 5LYDA 1IB1E 2PJ8A 2VI7A 1UFHA 2F7VA 5G21A 1GHEA 2C6PA 4CS0B 5C82A 4UEZA 2I3CA 1IICA 2GU2A 3IEHA 1Y9KA 5H84A 2WYRA 2EWBA 3B3CA 2GIVA 4XPLA 3R9EA 1Q2YA 4MJ8A 4U9YA 4AXVA 3JTKA 4A39A 1QQ9A 3RZAA 1OBRA 4OC1A 2R1IA 1BPNA 4Y49B 5H86A 1CP7A 4KZTA 4QVTA 4JXQA 2B4BA 1CG2A 1Q2DA 2EVNA 4KOSA 3IJ3A 4UCMA 1OZPA 2OOTA 3RYOA 5K8OA 2O4HA 1IOFA 4ZGYB 2AE6A 3SJGA 2JEVA 1ZO0A 4R87A 4XPKA 4MMOA 5K8NA 4HKFA 1VKCA 3BJ8A 2YGWA 4ZY2A 1AYEA 4LX9A 4PV6A 5HVFA 3H8GA 5HH1A 5HVGA 4B11A 4ZX9A 1IU8A 2OU2A 2PJCA 2QIRA 4ZYQA 5JH9A 3WC5A 3LODA 5FVJA 3N5FA 3EY5A 3S6HA 4FD6A 2QMLA 4CYQA 1S60A 2PRQA 4FD5A 1Z8TA 4X2TA 2ZW4A 3PGPA 5J8CA 1NSAA 1XFOA 1TIQA 4C2YA 5BWAB 1ZG9A 1VHEA 7CPAA 2GFQA 1LRZA 3FX6A 2G0BA 2BCOA 4KVME 8CPAA 2BL1A 4A37A 3E0KA 4OIWA 1LOKA 2PJ0A 4JD6A 1XJOA 1AMPA 5ELYA 2PJ7A 1TKFA 4JLYA 4MCRA 4F9UA 1HDUA 2JDDA 3TE4A 1ZLHA 1IGBA 3G8WA 2B5GA 3CPAA 3DR8A 4R7MA 3PB8X 3TX8A 3A9LA 4UCPA 1F2PA 4NGMA 1S7LA 4NGQA 2BSWA 4HPSA 2C27A 2J8NA 3TTHA 4RI1A 4OC3A 4UEFA 1QMUA 3BI1A 2K5TA 2DPTA 4L89A 2Z3MA 2B58A 2ZEOA 3DDDA 3P2HA 2J9AA 3KHXA 1Y0YA 3LMSA 1LAPA 4CGPA 2HC9A 1M4LA 2FVGA 3D7GA 2P6EA 2HUZA 2JEWA 1XEBA 3KKWA 4QBJA 3S9MA 3DNSA 4OC2A 2BEIA 1TXRA 1CP6A 2G3TA 2WPXA 2ANPA 2FL4A 2P6GA 4YU9A 3R1KA 2D4PA 3MGDA 5KTDA 2RFHA 1S3ZA 2EK9A 2IL4A 3CDXA 4FAIA 2KCWA 5F46A 4IK2A 1Q7LA 4CGMA 4AB7A 3IC1A 4II9A 5AGEA 4F0XA 2YNCC 3B8GA 1PCAA 1YX0A 2I79A 4H6ZA 3B3SA 3TFYA 1YREA 4P10A 2GANA 5LYIA 2Q43A 3SI1A 2ZOFA 2V8VA 2OB0A 1RTQA 3BXMA 3H8FA 2CY2A 2Q04A 3NH4A 3HLPA 4FD4A 4M6HA 3IWGA 1ARMA 4OAEA 4OIDA 5DWMA 4A2ZA 1BPMA 1DE4C 2C6CA 4AG9A 4CRYB 1LAMA 3DR6A 4W9YA 3DGVA 5LRJA 4OC4A 2FIWA 2VZYA 1ELMP 1LCPA 1MJ9A 3KR5A 2WSAA 1NSLA 2ZEPA 4NF1A 4NCZA 2ZW7A 4P4BA 1XIXA 4UFXA 4MI4A 2BUEA 2WUUA 4M3SA 1XRYA 2XEFA 1S7NA 1BAVA 5A28A 3R95A 3TO9A 2PJBA 3PP9A 1AUGA 2PJ1A 2PIYA 1R57A 3TO7A 4P4DA 4NFRA 3FBUA 4FBEA 1YK3A 2FS5A 2G9DA 1CPXA 1KWMA 3FEEA 4KOTA 4NGRA 3BJ7A 1IIDA 4CAFA 4Y49C 4XNHB 4R8FA 1TKHA 2J8MA 3KGQA 2ZW5A 5AG6A 4B12A 1BLLE 4J3GA 2Q44A 4E8OA 2V77A 2Q4ZA 4KLWA 1CBXA 5LYLA 1M44A 3D4UA 2AFOA 5EC4A 4Z65A 1WK4A 3PB6X 4O23A 3CPXA 2F5IA 4C7IA 1B87A 2Z3KA 2RC4A 3GIUA 3IU1A 4GM5A 3RO0A 4NJRA 1K4JA 1IYKA 2C1CA 3IWEA 4K30A 4KOWA 2BOAA 4OADA 1YR0A 4CGOA 2Q51A 1ARLA 4BD9A 4CYOA 2JLMA 3FNCA 4KSAA 1VHSA 4RS2A 3VARA 4KUBA 1F57A 2PVWA 2YNEA 4CYNA 1GYTA 2IJZA 4FWUA 3PB9X 3IWWA 3TCVA 3F0AA 4UEEA 5A27A 3FVLA 4G1PA 3ISZA 2AFWA 2ODFA 4A32A 5LRGA 1B6BA 2XEJA 4E0AA 2FCKA 5AG4A 3BI0A 1PU9A 2R98A 1YQEA 4LQGA 3VATA 4A94A 3KQZA 2VBQA 1ZLIA 2PJAA 4KLVA 3D66A 3LACA 1L0CA 4UFWA 4MHNA 4B5PA 4K3NA 2PCUA 3EFAA 4YFJA 3LWUA 1MK4A 5G1ZA 2P6FA 4HNYB 2QJ8A 2QYVA 4CPAA 1DTDA 2VQYA 4JXRA 3CXSA 4CGNA 3D7DA 2VZZA 2OH1A 1Z8XA 1ON0A 2CF4A 2GLJA 2PC1A 4YGOA 3PEIA 3NH5A 3SJFA 1Z2LA 4B14A 4A38A 2Z0ZA 1WWZA 2CTBA 2CIJA 4GS4A 3B3TA 4C2ZA 3F5BA 4B5OA 1S7KA 4R76A 2J8RA 1CJWA 5K8PA 4JYWA 4P45A 2X7BA 2AFUA 3QAHA 4CAWA 2V8HA 4MBUA 4QUSA 4PSXA 4UWJA 2O53A 2ZXVA 3PB4X 4OP4A 4Q7AA 1XF8A 1FY7A 4BINA 3PFOA 2R8VA 2ZEFA 4MY3A 1CM0A 5DS0A 3IFEA 4FUUA 4R3LA 1XMBA 3JVNA 4F9VA 3CT9A 2H5MA 3GUXA 2HB6A 4TNUA 5LYFA 1J4JA 4AG7A 2ZEHA 2ZPAA 4JJXA 4U5YA 2DEAA 3GY9A 4PK3A 2IQ6A 3SXNA 3EXNA 5ISVA 2PJ5A 3DSBA 2Q0YA 1I12A 3WR7A 1M1DA 2D4OA 2AFMA 2JBJA 2V8DA 2XEIA 3DLJA 2F8HA 4PK2A 1KUVA 2DPSA 4M85A 5J8FA 4JZ0A 1X10A 4KOUA 1IYLA 1YW6A 3FIXA 4Q38A 3TO6A 3PB7X 4H89A 2B4DA 2REFA 4B5PB 4MHZA 4MFLA 2FXFA 3R96A 4AVBA 3CXQA 2PE3A 2QECA 3RAMA 5C88A 3VWEA 4X3RA 1RO5A 4PXCA 1CX8A 2PR8A 4PXEA 4R6TA 5EMIA 2NYQA 2P0WA 2ZEMA 3FRMA 5K8MA 1IY7A 2FIAA 3H8EA 4UF4A 3EO4A 5JPHA 2OZHA 4NSQA 1Y0RA 1TKJA 4JWPA 3NFZA 2AFSA 2OR4A 2C6GA 3D3SA 2DF5A 1H8LA 2VXKA 4MCSA 3FF3A 2ZW6A 2ATRA 3QAYA 4MFJA 3FMCA 1VHOA 1NE9A 3KR4A 1YVKA 3MRUA 4C7HA 3D7HA 3T90A 2PJ3A 1PYTB 4A31A 3B35A 3KI9A 2FT0A 4MFZA 5D8NA 3D7FA 5CBMA 4F6AA 4OKOA 4R3KA 3KASA 4XNHC 5AG5A 3FYNA 1M4DA 3IO1A 4YWYA 3IU2A 1Y7EA 3CXPA 4CAEA 2O28A 1KUYA 2ZEGA 3UY5A 1U6MA 4PPZA 4AVCA 2EBJA 4MFPA 5AG7A 5F49A 3PRTA 3PFEA 3IGRA 3SHPA 4CYPA 2VL1A 3C26A 4X8IA 1NMTA 2AFXA 4M6GA 3B2YA 5HXDA 1Y9WA 3PZJA 3W91A 4C68A 3S9NA 4P4IA 2Y0MA 1QSNA 3FH4A 5F48A 3L2NA 1EE3P 4ZI6A 5I4MA 3GB0A 3F8KA 3SJEA 3B3VA 1BOBA 3WC7A 4F8ZA 3B3WA 5CNPA 1UWYA 2ABZA 2B4DB 1I21A 4H2KA 4A95A 2Q4YA 2EUIA 5F09A 3S6KA 4OC0A 5HMNA 5JGFA 5IV0A 4A33A 2AFZA 1BO4A 4CAXA 4XPDB 4WWVA 3D67A 4F0YA 4M6IA 2G3AA 4X5KA 1M4IA 4KSIA 4MRIA 4PQAA 3GKRA 2Z11A 1Z5RA 1HDQA 1R43A 2A4NA 4EWTA 3RBUA 4I49A 4NGNA 3BLNA 5D29A 3KHZA 4MXUA 3QB8A 4ORFA 1P0HA 2EO8A 4FD7A 4IUSA 4U9ZA 3D2PA 3D8PA 4NEXA 5J1QA 3SI0A 5GCNA 1F2OA 2V8GA 2OZGA 5EBVA 5IB0A 3FEDA 2EK8A 4NGSA 2GREA 5JM6A 3K9UA 3K9TA 4NGTA 3K2KA 2PRBA 4BBHA 3JUWA 4MY0A 4IAVA 3IIBA 4TWEA 3WC6A 5IX3A 1FNOA 3I9SA 2PJ4A 4UFVA 1R3NA 4E2AA 5F47A 1QSTA 4LUAA 1YSJA 4P4JA 1JWQA 3MN8A 4MCPA 2Z3PA 5HVHA 4IHMA 4MHYA 6CPAA 1IOIA 4MFKA 3TC8A 1CPSA 3TOAA 4DUKA 4P44A 4QB9A 2CNTA 4R9MA 4UWIA 4B10A 3RNZA 2JDCA 3G3SA 4KORA 1XE4A 2PIZA 3WT4A 1KZFA 3ZZIA 1SQHA 4NJQA 2AJ6A 2HQYA 3EC4A 2FE7A 5G22A 4IF5A 4HNWB 4ZX8A 1YLEA 3V8IA 3SI2A 4GXHA 1YLOA 2CNMA 3GYAA 1YW4A 4Q36A 2PDOA 2B3VA 3KZWA 4UCNA 4DNCA 3T9YA 3H4QA 4UA3A 3R9GA 4KUAA 2Z3LA 3FECA 1S5KA 3I1UA 4OLLA 4RUHA 4RN7A 1QSRA 1VGYA 3NE7A 4AVAA 2JBKA 2PQ8A 3FXTA 2Z3OA 2YNCA 1QSOA 3B7IA 4ZBGA 1Z9UA 4BMHA 1Z4RA 1MJBA 2CTCA 3D2MA 3GLJA 3H5ZA 2XEGA 2QVPA 4B13A 2I00A 3HUVA 3S9LA 3FJUA 2IMOA 1XMTA 3LD2A 3PBBA 4R57A 1YMEA 4EFDA 2NMTA 1XBUA 3TOBA 1I1DA 1Y7RA 5E96A 4MCQA 3VH9A 2PSWA 2Q4VA 1MJAA 3I3GA 3D68A 1VIXA 3S6GA 1FT7A 2YNDA 1S7FA 4KSFA 4MHPA 4OMEA 4B6ZA 4P4EA 3S6FA 4CRZB 4ZY1A 2REEA 2HV2A 5KTCA 4ZY0A 3NE8A 2GLFA 3BHXA 3ISXA 2FSRA 5KTAA 4CGLA 4EVYA 4KS9A 1RXTA 3SXOA 4L8AA 2ZELA 3V38A 4UIBA 3ZJ0A 5DWNA 4OC5A 1M4GA 2ZEEA 3R9FA 1ZG7A 1LANA 1XOVA 4KOYA
chains in the Genus database with same CATH topology
4C2XA 4H6UA 1V0CA 3TT2A 2ARHA 4KOXA 2Q7BA 4ONUA 4KVXA 2B5GB 4QC6A 3W6XA 2B3UA 2OZUA 4MFQA 4XPDC 5JQ4A 1QSMA 1P4NA 4YRHA 5I0CA 3W6SA 1YVOA 2CXAA 2Z10A 3OWCA 2DXQA 5G20A 1PUAA 2VEZA 4A30A 2Z3NA 1YGHA 3P2FA 2CNSA 3N7ZA 1N71A 4NXYA 2R7HA 4CAVA 2PR1A 4UBRA 4KOVA 4HNXB 2GE3A 2WPWA 4KVOE 3VWDA 1Z4EA 4PSWA 4MHDA 1Q2CA 3FB3A 1KUXA 1IB1E 2VI7A 1UFHA 5G21A 1GHEA 4CS0B 5C82A 1IICA 1Y9KA 5H84A 4BBHA 2GIVA 4XPLA 3R9EA 1Q2YA 4MJ8A 4U9YA 3JTKA 2R1IA 4Y49B 5H86A 4KZTA 4QVTA 4JXQA 2B4BA 1Q2DA 2EVNA 4KOSA 4UCMA 1OZPA 3RYOA 4ZGYB 2AE6A 2JEVA 1ZO0A 4R87A 4XPKA 4HKFA 1VKCA 3BJ8A 2YGWA 4LX9A 4PV6A 5HH1A 4B11A 2QIRA 2OU2A 3LODA 5FVJA 3EY5A 3S6HA 4FD6A 2QMLA 4CYQA 1S60A 4FD5A 2ZW4A 3PGPA 5J8CA 4C2YA 1TIQA 5BWAB 1LRZA 2G0BA 4KVME 2BL1A 3E0KA 4JD6A 4JLYA 2JDDA 3TE4A 3G8WA 2B5GA 3DR8A 3A9LA 4UCPA 1S7LA 2BSWA 3TTHA 2C27A 2J8NA 4RI1A 2K5TA 2DPTA 4L89A 2Z3MA 2B58A 3DDDA 3P2HA 4CGPA 2P6EA 2HUZA 1XEBA 3KKWA 4QBJA 3DNSA 2BEIA 2G3TA 2WPXA 2FL4A 2P6GA 3R1KA 2D4PA 3MGDA 5KTDA 1S3ZA 2IL4A 2KCWA 5F46A 4CGMA 4AB7A 4II9A 5AGEA 4F0XA 2YNCC 3B8GA 1YX0A 2I79A 4H6ZA 1YREA 2GANA 2OB0A 2CY2A 2Q04A 4FD4A 3IWGA 4OAEA 4A2ZA 5DWMA 4AG9A 4CRYB 3DR6A 2FIWA 2VZYA 1MJ9A 2WSAA 1NSLA 4NF1A 4NCZA 2ZW7A 1XIXA 4UFXA 4MI4A 2BUEA 2WUUA 4M3SA 1S7NA 5A28A 3R95A 3TO9A 3PP9A 3TO7A 1R57A 3FBUA 1YK3A 2FS5A 4KOTA 3BJ7A 1IIDA 4CAFA 4Y49C 4XNHB 2J8MA 2ZW5A 5AG6A 4B12A 4J3GA 2Q44A 4E8OA 4KLWA 1M44A 5EC4A 1WK4A 2F5IA 4C7IA 1B87A 2Z3KA 2RC4A 3IU1A 1K4JA 1IYKA 3IWEA 4K30A 4KOWA 4OADA 1YR0A 4CGOA 4CYOA 2JLMA 4KSAA 1VHSA 4RS2A 4KUBA 2YNEA 4CYNA 3TCVA 3F0AA 5A27A 4A32A 1B6BA 4E0AA 2FCKA 5AG4A 1PU9A 2R98A 2VBQA 4KLVA 1L0CA 4UFWA 4B5PA 3EFAA 4YFJA 1MK4A 5G1ZA 2P6FA 4HNYB 2VQYA 4JXRA 3CXSA 4CGNA 2VZZA 2OH1A 1ON0A 4YGOA 2PC1A 4B14A 2Z0ZA 1WWZA 4GS4A 4C2ZA 3F5BA 4B5OA 1S7KA 2J8RA 1CJWA 2X7BA 3QAHA 4CAWA 4MBUA 4QUSA 4PSXA 4UWJA 2ZXVA 1XF8A 1FY7A 2R8VA 4MY3A 1CM0A 4R3LA 3JVNA 2H5MA 1J4JA 4AG7A 2ZPAA 4JJXA 4U5YA 3SXNA 3GY9A 4PK3A 3EXNA 5ISVA 3DSBA 2Q0YA 1I12A 3WR7A 1M1DA 2D4OA 3TFYA 5J8FA 4PK2A 1KUVA 2DPSA 4M85A 4KOUA 1IYLA 3FIXA 4Q38A 3TO6A 4H89A 2B4DA 2REFA 4B5PB 4MFLA 2FXFA 3R96A 4AVBA 3CXQA 2QECA 5C88A 3VWEA 1RO5A 2PR8A 2P0WA 3FRMA 2FIAA 3EO4A 5JPHA 2OZHA 4NSQA 4JWPA 3D3SA 2VXKA 4MFJA 2ZW6A 2ATRA 1NE9A 1YVKA 4C7HA 3T90A 4A31A 2FT0A 4MFZA 4F6AA 4R3KA 4XNHC 5AG5A 3FYNA 1M4DA 3IU2A 3CXPA 4CAEA 2O28A 1KUYA 4AVCA 3UY5A 1U6MA 4MFPA 5AG7A 5F49A 3SHPA 3IGRA 4CYPA 3C26A 1NMTA 1Y9WA 3PZJA 3W91A 4C68A 2Y0MA 1QSNA 5F48A 3F8KA 1BOBA 5CNPA 2B4DB 4A95A 1I21A 2Q4YA 2EUIA 3S6KA 5HMNA 5IV0A 4A33A 1BO4A 4CAXA 4XPDB 4F0YA 2G3AA 4X5KA 1M4IA 3GKRA 2Z11A 2A4NA 4I49A 3BLNA 3QB8A 4ORFA 1P0HA 4FD7A 4IUSA 4U9ZA 3D2PA 3D8PA 4NEXA 5GCNA 2OZGA 5EBVA 5IB0A 3K9UA 2PRBA 3JUWA 4MY0A 5IX3A 3I9SA 4UFVA 4E2AA 5F47A 1QSTA 4LUAA 2Z3PA 4MFKA 3TOAA 4QB9A 2CNTA 4R9MA 4UWIA 4B10A 2JDCA 3G3SA 4KORA 1XE4A 3ZZIA 1KZFA 1SQHA 2AJ6A 2HQYA 3EC4A 2FE7A 5G22A 4IF5A 4HNWB 3V8IA 1YLEA 2CNMA 3GYAA 4Q36A 2PDOA 2B3VA 4UCNA 4DNCA 3T9YA 3H4QA 4UA3A 3R9GA 4KUAA 2Z3LA 1S5KA 4OLLA 1QSRA 3NE7A 4AVAA 2PQ8A 3FXTA 2Z3OA 2YNCA 1QSOA 4ZBGA 1Z9UA 4BMHA 1Z4RA 1MJBA 3D2MA 3H5ZA 4B13A 2I00A 1XMTA 3LD2A 4R57A 2NMTA 3TOBA 1I1DA 1Y7RA 5E96A 2PSWA 2Q4VA 1MJAA 3I3GA 3S6GA 2YNDA 1S7FA 4KSFA 4CRZB 5KTCA 3S6FA 2REEA 2HV2A 2FSRA 5KTAA 4CGLA 4EVYA 4KS9A 1RXTA 3SXOA 4L8AA 3ZJ0A 5DWNA 1M4GA 3R9FA 3FNCA 4KOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6U A;  1V0C A;  3TT2 A;  2ARH A;  4KOX A;  2Q7B A;  4ONU A;  4KVX A;  2B5G B;  4QC6 A;  3W6X A;  2B3U A;  2OZU A;  4XPD C;  5JQ4 A;  1QSM A;  1P4N A;  4YRH A;  5I0C A;  3W6S A;  1YVO A;  2Z10 A;  3OWC A;  2DXQ A;  1PUA A;  2VEZ A;  1YGH A;  3P2F A;  2CNS A;  3N7Z A;  1N71 A;  4NXY A;  2R7H A;  4CAV A;  2PR1 A;  4UBR A;  4KOV A;  4HNX B;  2GE3 A;  2WPW A;  4KVO E;  3VWD A;  1Z4E A;  4PSW A;  4MHD A;  1Q2C A;  3FB3 A;  1KUX A;  1IB1 E;  2VI7 A;  1UFH A;  1GHE A;  4CS0 B;  5C82 A;  1IIC A;  1Y9K A;  5H84 A;  2GIV A;  4XPL A;  3R9E A;  1Q2Y A;  4MJ8 A;  4U9Y A;  2R1I A;  4Y49 B;  5H86 A;  4KZT A;  4QVT A;  4JXQ A;  2B4B A;  1Q2D A;  2EVN A;  4KOS A;  1OZP A;  3RYO A;  2AE6 A;  2JEV A;  4R87 A;  4XPK A;  4HKF A;  1VKC A;  3BJ8 A;  4LX9 A;  4PV6 A;  5HH1 A;  2QIR A;  2OU2 A;  3LOD A;  5FVJ A;  3EY5 A;  3S6H A;  4FD6 A;  2QML A;  1S60 A;  4FD5 A;  2ZW4 A;  3PGP A;  5J8C A;  1TIQ A;  1LRZ A;  2G0B A;  4KVM E;  2BL1 A;  3E0K A;  4JD6 A;  4JLY A;  2JDD A;  3TE4 A;  3G8W A;  2B5G A;  3DR8 A;  1S7L A;  2BSW A;  3TTH A;  2C27 A;  2J8N A;  4RI1 A;  2K5T A;  4L89 A;  2B58 A;  3DDD A;  3P2H A;  2P6E A;  2HUZ A;  1XEB A;  3KKW A;  4QBJ A;  3DNS A;  2BEI A;  2G3T A;  2WPX A;  2FL4 A;  2P6G A;  3R1K A;  2D4P A;  3MGD A;  5KTD A;  1S3Z A;  2IL4 A;  2KCW A;  5F46 A;  4AB7 A;  4II9 A;  3B8G A;  1YX0 A;  2I79 A;  4H6Z A;  1YRE A;  2GAN A;  2OB0 A;  2CY2 A;  2Q04 A;  4FD4 A;  3IWG A;  4OAE A;  5DWM A;  4AG9 A;  4CRY B;  3DR6 A;  2FIW A;  2VZY A;  1MJ9 A;  1NSL A;  4NF1 A;  4NCZ A;  2ZW7 A;  1XIX A;  4MI4 A;  2BUE A;  4M3S A;  1S7N A;  3R95 A;  3TO9 A;  3PP9 A;  3TO7 A;  1R57 A;  3FBU A;  1YK3 A;  2FS5 A;  4KOT A;  3BJ7 A;  1IID A;  4Y49 C;  4XNH B;  2J8M A;  2ZW5 A;  4J3G A;  2Q44 A;  4E8O A;  4KLW A;  1M44 A;  5EC4 A;  1WK4 A;  2F5I A;  1B87 A;  2RC4 A;  1K4J A;  1IYK A;  4K30 A;  4KOW A;  4OAD A;  1YR0 A;  2JLM A;  1VHS A;  4RS2 A;  4KUB A;  3TCV A;  3F0A A;  1B6B A;  4E0A A;  2FCK A;  1PU9 A;  2R98 A;  2VBQ A;  4KLV A;  1L0C A;  4B5P A;  3EFA A;  4YFJ A;  1MK4 A;  2P6F A;  4HNY B;  2VQY A;  4JXR A;  3CXS A;  2VZZ A;  2OH1 A;  1ON0 A;  4YGO A;  2PC1 A;  2Z0Z A;  1WWZ A;  4GS4 A;  3F5B A;  4B5O A;  1S7K A;  2J8R A;  1CJW A;  2X7B A;  3QAH A;  4CAW A;  4MBU A;  4QUS A;  4PSX A;  4UWJ A;  2ZXV A;  1XF8 A;  1FY7 A;  2R8V A;  4MY3 A;  1CM0 A;  4R3L A;  3JVN A;  2H5M A;  1J4J A;  4AG7 A;  2ZPA A;  4JJX A;  4U5Y A;  3SXN A;  3GY9 A;  4PK3 A;  3EXN A;  5ISV A;  3DSB A;  2Q0Y A;  1I12 A;  3WR7 A;  1M1D A;  2D4O A;  3TFY A;  5J8F A;  4PK2 A;  1KUV A;  4M85 A;  4KOU A;  1IYL A;  3FIX A;  3TO6 A;  4H89 A;  2B4D A;  2REF A;  4B5P B;  2FXF A;  3R96 A;  4AVB A;  3CXQ A;  2QEC A;  5C88 A;  3VWE A;  1RO5 A;  2PR8 A;  2P0W A;  3FRM A;  2FIA A;  3EO4 A;  5JPH A;  2OZH A;  4NSQ A;  4JWP A;  3D3S A;  2VXK A;  2ZW6 A;  2ATR A;  1NE9 A;  1YVK A;  3T90 A;  2FT0 A;  4F6A A;  4R3K A;  4XNH C;  3FYN A;  1M4D A;  3CXP A;  2O28 A;  1KUY A;  4AVC A;  3UY5 A;  1U6M A;  5F49 A;  3SHP A;  3IGR A;  3C26 A;  1NMT A;  1Y9W A;  3PZJ A;  3W91 A;  2Y0M A;  1QSN A;  5F48 A;  3F8K A;  1BOB A;  5CNP A;  2B4D B;  1I21 A;  2Q4Y A;  2EUI A;  3S6K A;  5HMN A;  5IV0 A;  1BO4 A;  4CAX A;  4XPD B;  4F0Y A;  2G3A A;  4X5K A;  1M4I A;  3GKR A;  2Z11 A;  2A4N A;  4I49 A;  3BLN A;  3QB8 A;  4ORF A;  1P0H A;  4FD7 A;  4IUS A;  4U9Z A;  3D2P A;  3D8P A;  4NEX A;  5GCN A;  2OZG A;  5EBV A;  5IB0 A;  3K9U A;  2PRB A;  3JUW A;  4MY0 A;  5IX3 A;  3I9S A;  4E2A A;  5F47 A;  1QST A;  4LUA A;  3TOA A;  4QB9 A;  2CNT A;  4R9M A;  4UWI A;  2JDC A;  3G3S A;  4KOR A;  1XE4 A;  3ZZI A;  1KZF A;  1SQH A;  2AJ6 A;  2HQY A;  3EC4 A;  2FE7 A;  3V8I A;  4IF5 A;  4HNW B;  1YLE A;  2CNM A;  3GYA A;  2PDO A;  2B3V A;  4DNC A;  3T9Y A;  3H4Q A;  4UA3 A;  3R9G A;  4KUA A;  1S5K A;  4OLL A;  1QSR A;  3NE7 A;  4AVA A;  2PQ8 A;  3FXT A;  1QSO A;  4ZBG A;  1Z9U A;  4BMH A;  1Z4R A;  1MJB A;  3D2M A;  2I00 A;  1XMT A;  3LD2 A;  4R57 A;  2NMT A;  3TOB A;  1I1D A;  1Y7R A;  5E96 A;  2PSW A;  2Q4V A;  1MJA A;  3I3G A;  3S6G A;  1S7F A;  4CRZ B;  5KTC A;  3S6F A;  2REE A;  2HV2 A;  2FSR A;  5KTA A;  4EVY A;  1RXT A;  3SXO A;  4L8A A;  3ZJ0 A;  5DWN A;  1M4G A;  3R9F A;  3FNC A;  4KOY A; 
#chains in the Genus database with same CATH topology
 5LRK A;  3PBE A;  4P6Y A;  4C2X A;  4H6U A;  1V0C A;  3NH8 A;  3TT2 A;  2ARH A;  1HEE A;  3KQX A;  3SJX A;  3V7Z A;  4KOX A;  2Q7B A;  3CZX A;  4ONU A;  4KVX A;  3QNV A;  4PXB A;  2BO9 A;  2B5G B;  2PJ2 A;  4QC6 A;  2B3U A;  2OZU A;  4MFQ A;  1TF8 A;  4XPD C;  3W6X A;  5JQ4 A;  1QSM A;  4EME A;  1P4N A;  1LFW A;  4YRH A;  5I0C A;  3W6S A;  4DJL A;  5IB9 A;  4ONW A;  1ZG8 A;  1YVO A;  1Z8L A;  2CXA A;  3KL9 A;  3T8W A;  4DYO A;  2Z10 A;  2PJ9 A;  5CPA A;  1TF9 A;  1JQG A;  3OWC A;  2DXQ A;  4WJB A;  5G20 A;  2ZOG A;  2ZED A;  1PUA A;  2VEZ A;  4A30 A;  2Z3N A;  1YGH A;  3P2F A;  2CNS A;  3N7Z A;  4UIA A;  5THW A;  1ELL P;  1N71 A;  4P4F A;  4NXY A;  2R7H A;  2Q7S A;  2PVV A;  4NGP A;  3NA6 A;  2PR1 A;  4CAV A;  1Z8W A;  2NSM A;  2PJ6 A;  1X12 A;  4KOV A;  4UBR A;  1A2Z A;  2POK A;  2GE3 A;  2WPW A;  4HNX B;  4KVO E;  2RB7 A;  4LQ6 A;  1Z4E A;  3VWD A;  4PSW A;  4MHD A;  1Q2C A;  2WZN A;  4PXD A;  3JRU A;  3WAB A;  3FB3 A;  2ZEN A;  1KUX A;  5LYD A;  1IB1 E;  2PJ8 A;  2VI7 A;  1UFH A;  2F7V A;  5G21 A;  1GHE A;  2C6P A;  4CS0 B;  5C82 A;  4UEZ A;  2I3C A;  1IIC A;  2GU2 A;  3IEH A;  1Y9K A;  5H84 A;  2WYR A;  2EWB A;  3B3C A;  2GIV A;  4XPL A;  3R9E A;  1Q2Y A;  4MJ8 A;  4U9Y A;  4AXV A;  3JTK A;  4A39 A;  1QQ9 A;  3RZA A;  1OBR A;  4OC1 A;  2R1I A;  1BPN A;  4Y49 B;  5H86 A;  1CP7 A;  4KZT A;  4QVT A;  4JXQ A;  2B4B A;  1CG2 A;  1Q2D A;  2EVN A;  4KOS A;  3IJ3 A;  4UCM A;  1OZP A;  2OOT A;  3RYO A;  5K8O A;  2O4H A;  1IOF A;  4ZGY B;  2AE6 A;  3SJG A;  2JEV A;  1ZO0 A;  4R87 A;  4XPK A;  4MMO A;  5K8N A;  4HKF A;  1VKC A;  3BJ8 A;  2YGW A;  4ZY2 A;  1AYE A;  4LX9 A;  4PV6 A;  5HVF A;  3H8G A;  5HH1 A;  5HVG A;  4B11 A;  4ZX9 A;  1IU8 A;  2OU2 A;  2PJC A;  2QIR A;  4ZYQ A;  5JH9 A;  3WC5 A;  3LOD A;  5FVJ A;  3N5F A;  3EY5 A;  3S6H A;  4FD6 A;  2QML A;  4CYQ A;  1S60 A;  2PRQ A;  4FD5 A;  1Z8T A;  4X2T A;  2ZW4 A;  3PGP A;  5J8C A;  1NSA A;  1XFO A;  1TIQ A;  4C2Y A;  5BWA B;  1ZG9 A;  1VHE A;  7CPA A;  2GFQ A;  1LRZ A;  3FX6 A;  2G0B A;  2BCO A;  4KVM E;  8CPA A;  2BL1 A;  4A37 A;  3E0K A;  4OIW A;  1LOK A;  2PJ0 A;  4JD6 A;  1XJO A;  1AMP A;  5ELY A;  2PJ7 A;  1TKF A;  4JLY A;  4MCR A;  4F9U A;  1HDU A;  2JDD A;  3TE4 A;  1ZLH A;  1IGB A;  3G8W A;  2B5G A;  3CPA A;  3DR8 A;  4R7M A;  3PB8 X;  3TX8 A;  3A9L A;  4UCP A;  1F2P A;  4NGM A;  1S7L A;  4NGQ A;  2BSW A;  4HPS A;  2C27 A;  2J8N A;  3TTH A;  4RI1 A;  4OC3 A;  4UEF A;  1QMU A;  3BI1 A;  2K5T A;  2DPT A;  4L89 A;  2Z3M A;  2B58 A;  2ZEO A;  3DDD A;  3P2H A;  2J9A A;  3KHX A;  1Y0Y A;  3LMS A;  1LAP A;  4CGP A;  2HC9 A;  1M4L A;  2FVG A;  3D7G A;  2P6E A;  2HUZ A;  2JEW A;  1XEB A;  3KKW A;  4QBJ A;  3S9M A;  3DNS A;  4OC2 A;  2BEI A;  1TXR A;  1CP6 A;  2G3T A;  2WPX A;  2ANP A;  2FL4 A;  2P6G A;  4YU9 A;  3R1K A;  2D4P A;  3MGD A;  5KTD A;  2RFH A;  1S3Z A;  2EK9 A;  2IL4 A;  3CDX A;  4FAI A;  2KCW A;  5F46 A;  4IK2 A;  1Q7L A;  4CGM A;  4AB7 A;  3IC1 A;  4II9 A;  5AGE A;  4F0X A;  2YNC C;  3B8G A;  1PCA A;  1YX0 A;  2I79 A;  4H6Z A;  3B3S A;  3TFY A;  1YRE A;  4P10 A;  2GAN A;  5LYI A;  2Q43 A;  3SI1 A;  2ZOF A;  2V8V A;  2OB0 A;  1RTQ A;  3BXM A;  3H8F A;  2CY2 A;  2Q04 A;  3NH4 A;  3HLP A;  4FD4 A;  4M6H A;  3IWG A;  1ARM A;  4OAE A;  4OID A;  5DWM A;  4A2Z A;  1BPM A;  1DE4 C;  2C6C A;  4AG9 A;  4CRY B;  1LAM A;  3DR6 A;  4W9Y A;  3DGV A;  5LRJ A;  4OC4 A;  2FIW A;  2VZY A;  1ELM P;  1LCP A;  1MJ9 A;  3KR5 A;  2WSA A;  1NSL A;  2ZEP A;  4NF1 A;  4NCZ A;  2ZW7 A;  4P4B A;  1XIX A;  4UFX A;  4MI4 A;  2BUE A;  2WUU A;  4M3S A;  1XRY A;  2XEF A;  1S7N A;  1BAV A;  5A28 A;  3R95 A;  3TO9 A;  2PJB A;  3PP9 A;  1AUG A;  2PJ1 A;  2PIY A;  1R57 A;  3TO7 A;  4P4D A;  4NFR A;  3FBU A;  4FBE A;  1YK3 A;  2FS5 A;  2G9D A;  1CPX A;  1KWM A;  3FEE A;  4KOT A;  4NGR A;  3BJ7 A;  1IID A;  4CAF A;  4Y49 C;  4XNH B;  4R8F A;  1TKH A;  2J8M A;  3KGQ A;  2ZW5 A;  5AG6 A;  4B12 A;  1BLL E;  4J3G A;  2Q44 A;  4E8O A;  2V77 A;  2Q4Z A;  4KLW A;  1CBX A;  5LYL A;  1M44 A;  3D4U A;  2AFO A;  5EC4 A;  4Z65 A;  1WK4 A;  3PB6 X;  4O23 A;  3CPX A;  2F5I A;  4C7I A;  1B87 A;  2Z3K A;  2RC4 A;  3GIU A;  3IU1 A;  4GM5 A;  3RO0 A;  4NJR A;  1K4J A;  1IYK A;  2C1C A;  3IWE A;  4K30 A;  4KOW A;  2BOA A;  4OAD A;  1YR0 A;  4CGO A;  2Q51 A;  1ARL A;  4BD9 A;  4CYO A;  2JLM A;  3FNC A;  4KSA A;  1VHS A;  4RS2 A;  3VAR A;  4KUB A;  1F57 A;  2PVW A;  2YNE A;  4CYN A;  1GYT A;  2IJZ A;  4FWU A;  3PB9 X;  3IWW A;  3TCV A;  3F0A A;  4UEE A;  5A27 A;  3FVL A;  4G1P A;  3ISZ A;  2AFW A;  2ODF A;  4A32 A;  5LRG A;  1B6B A;  2XEJ A;  4E0A A;  2FCK A;  5AG4 A;  3BI0 A;  1PU9 A;  2R98 A;  1YQE A;  4LQG A;  3VAT A;  4A94 A;  3KQZ A;  2VBQ A;  1ZLI A;  2PJA A;  4KLV A;  3D66 A;  3LAC A;  1L0C A;  4UFW A;  4MHN A;  4B5P A;  4K3N A;  2PCU A;  3EFA A;  4YFJ A;  3LWU A;  1MK4 A;  5G1Z A;  2P6F A;  4HNY B;  2QJ8 A;  2QYV A;  4CPA A;  1DTD A;  2VQY A;  4JXR A;  3CXS A;  4CGN A;  3D7D A;  2VZZ A;  2OH1 A;  1Z8X A;  1ON0 A;  2CF4 A;  2GLJ A;  2PC1 A;  4YGO A;  3PEI A;  3NH5 A;  3SJF A;  1Z2L A;  4B14 A;  4A38 A;  2Z0Z A;  1WWZ A;  2CTB A;  2CIJ A;  4GS4 A;  3B3T A;  4C2Z A;  3F5B A;  4B5O A;  1S7K A;  4R76 A;  2J8R A;  1CJW A;  5K8P A;  4JYW A;  4P45 A;  2X7B A;  2AFU A;  3QAH A;  4CAW A;  2V8H A;  4MBU A;  4QUS A;  4PSX A;  4UWJ A;  2O53 A;  2ZXV A;  3PB4 X;  4OP4 A;  4Q7A A;  1XF8 A;  1FY7 A;  4BIN A;  3PFO A;  2R8V A;  2ZEF A;  4MY3 A;  1CM0 A;  5DS0 A;  3IFE A;  4FUU A;  4R3L A;  1XMB A;  3JVN A;  4F9V A;  3CT9 A;  2H5M A;  3GUX A;  2HB6 A;  4TNU A;  5LYF A;  1J4J A;  4AG7 A;  2ZEH A;  2ZPA A;  4JJX A;  4U5Y A;  2DEA A;  3GY9 A;  4PK3 A;  2IQ6 A;  3SXN A;  3EXN A;  5ISV A;  2PJ5 A;  3DSB A;  2Q0Y A;  1I12 A;  3WR7 A;  1M1D A;  2D4O A;  2AFM A;  2JBJ A;  2V8D A;  2XEI A;  3DLJ A;  2F8H A;  4PK2 A;  1KUV A;  2DPS A;  4M85 A;  5J8F A;  4JZ0 A;  1X10 A;  4KOU A;  1IYL A;  1YW6 A;  3FIX A;  4Q38 A;  3TO6 A;  3PB7 X;  4H89 A;  2B4D A;  2REF A;  4B5P B;  4MHZ A;  4MFL A;  2FXF A;  3R96 A;  4AVB A;  3CXQ A;  2PE3 A;  2QEC A;  3RAM A;  5C88 A;  3VWE A;  4X3R A;  1RO5 A;  4PXC A;  1CX8 A;  2PR8 A;  4PXE A;  4R6T A;  5EMI A;  2NYQ A;  2P0W A;  2ZEM A;  3FRM A;  5K8M A;  1IY7 A;  2FIA A;  3H8E A;  4UF4 A;  3EO4 A;  5JPH A;  2OZH A;  4NSQ A;  1Y0R A;  1TKJ A;  4JWP A;  3NFZ A;  2AFS A;  2OR4 A;  2C6G A;  3D3S A;  2DF5 A;  1H8L A;  2VXK A;  4MCS A;  3FF3 A;  2ZW6 A;  2ATR A;  3QAY A;  4MFJ A;  3FMC A;  1VHO A;  1NE9 A;  3KR4 A;  1YVK A;  3MRU A;  4C7H A;  3D7H A;  3T90 A;  2PJ3 A;  1PYT B;  4A31 A;  3B35 A;  3KI9 A;  2FT0 A;  4MFZ A;  5D8N A;  3D7F A;  5CBM A;  4F6A A;  4OKO A;  4R3K A;  3KAS A;  4XNH C;  5AG5 A;  3FYN A;  1M4D A;  3IO1 A;  4YWY A;  3IU2 A;  1Y7E A;  3CXP A;  4CAE A;  2O28 A;  1KUY A;  2ZEG A;  3UY5 A;  1U6M A;  4PPZ A;  4AVC A;  2EBJ A;  4MFP A;  5AG7 A;  5F49 A;  3PRT A;  3PFE A;  3IGR A;  3SHP A;  4CYP A;  2VL1 A;  3C26 A;  4X8I A;  1NMT A;  2AFX A;  4M6G A;  3B2Y A;  5HXD A;  1Y9W A;  3PZJ A;  3W91 A;  4C68 A;  3S9N A;  4P4I A;  2Y0M A;  1QSN A;  3FH4 A;  5F48 A;  3L2N A;  1EE3 P;  4ZI6 A;  5I4M A;  3GB0 A;  3F8K A;  3SJE A;  3B3V A;  1BOB A;  3WC7 A;  4F8Z A;  3B3W A;  5CNP A;  1UWY A;  2ABZ A;  2B4D B;  1I21 A;  4H2K A;  4A95 A;  2Q4Y A;  2EUI A;  5F09 A;  3S6K A;  4OC0 A;  5HMN A;  5JGF A;  5IV0 A;  4A33 A;  2AFZ A;  1BO4 A;  4CAX A;  4XPD B;  4WWV A;  3D67 A;  4F0Y A;  4M6I A;  2G3A A;  4X5K A;  1M4I A;  4KSI A;  4MRI A;  4PQA A;  3GKR A;  2Z11 A;  1Z5R A;  1HDQ A;  1R43 A;  2A4N A;  4EWT A;  3RBU A;  4I49 A;  4NGN A;  3BLN A;  5D29 A;  3KHZ A;  4MXU A;  3QB8 A;  4ORF A;  1P0H A;  2EO8 A;  4FD7 A;  4IUS A;  4U9Z A;  3D2P A;  3D8P A;  4NEX A;  5J1Q A;  3SI0 A;  5GCN A;  1F2O A;  2V8G A;  2OZG A;  5EBV A;  5IB0 A;  3FED A;  2EK8 A;  4NGS A;  2GRE A;  5JM6 A;  3K9U A;  3K9T A;  4NGT A;  3K2K A;  2PRB A;  4BBH A;  3JUW A;  4MY0 A;  4IAV A;  3IIB A;  4TWE A;  3WC6 A;  5IX3 A;  1FNO A;  3I9S A;  2PJ4 A;  4UFV A;  1R3N A;  4E2A A;  5F47 A;  1QST A;  4LUA A;  1YSJ A;  4P4J A;  1JWQ A;  3MN8 A;  4MCP A;  2Z3P A;  5HVH A;  4IHM A;  4MHY A;  6CPA A;  1IOI A;  4MFK A;  3TC8 A;  1CPS A;  3TOA A;  4DUK A;  4P44 A;  4QB9 A;  2CNT A;  4R9M A;  4UWI A;  4B10 A;  3RNZ A;  2JDC A;  3G3S A;  4KOR A;  1XE4 A;  2PIZ A;  3WT4 A;  1KZF A;  3ZZI A;  1SQH A;  4NJQ A;  2AJ6 A;  2HQY A;  3EC4 A;  2FE7 A;  5G22 A;  4IF5 A;  4HNW B;  4ZX8 A;  1YLE A;  3V8I A;  3SI2 A;  4GXH A;  1YLO A;  2CNM A;  3GYA A;  1YW4 A;  4Q36 A;  2PDO A;  2B3V A;  3KZW A;  4UCN A;  4DNC A;  3T9Y A;  3H4Q A;  4UA3 A;  3R9G A;  4KUA A;  2Z3L A;  3FEC A;  1S5K A;  3I1U A;  4OLL A;  4RUH A;  4RN7 A;  1QSR A;  1VGY A;  3NE7 A;  4AVA A;  2JBK A;  2PQ8 A;  3FXT A;  2Z3O A;  2YNC A;  1QSO A;  3B7I A;  4ZBG A;  1Z9U A;  4BMH A;  1Z4R A;  1MJB A;  2CTC A;  3D2M A;  3GLJ A;  3H5Z A;  2XEG A;  2QVP A;  4B13 A;  2I00 A;  3HUV A;  3S9L A;  3FJU A;  2IMO A;  1XMT A;  3LD2 A;  3PBB A;  4R57 A;  1YME A;  4EFD A;  2NMT A;  1XBU A;  3TOB A;  1I1D A;  1Y7R A;  5E96 A;  4MCQ A;  3VH9 A;  2PSW A;  2Q4V A;  1MJA A;  3I3G A;  3D68 A;  1VIX A;  3S6G A;  1FT7 A;  2YND A;  1S7F A;  4KSF A;  4MHP A;  4OME A;  4B6Z A;  4P4E A;  3S6F A;  4CRZ B;  4ZY1 A;  2REE A;  2HV2 A;  5KTC A;  4ZY0 A;  3NE8 A;  2GLF A;  3BHX A;  3ISX A;  2FSR A;  5KTA A;  4CGL A;  4EVY A;  4KS9 A;  1RXT A;  3SXO A;  4L8A A;  2ZEL A;  3V38 A;  4UIB A;  3ZJ0 A;  5DWN A;  4OC5 A;  1M4G A;  2ZEE A;  3R9F A;  1ZG7 A;  1LAN A;  1XOV A;  4KOY A; 
#chains in the Genus database with same CATH homology
 4C2X A;  4H6U A;  1V0C A;  3TT2 A;  2ARH A;  4KOX A;  2Q7B A;  4ONU A;  4KVX A;  2B5G B;  4QC6 A;  3W6X A;  2B3U A;  2OZU A;  4MFQ A;  4XPD C;  5JQ4 A;  1QSM A;  1P4N A;  4YRH A;  5I0C A;  3W6S A;  1YVO A;  2CXA A;  2Z10 A;  3OWC A;  2DXQ A;  5G20 A;  1PUA A;  2VEZ A;  4A30 A;  2Z3N A;  1YGH A;  3P2F A;  2CNS A;  3N7Z A;  1N71 A;  4NXY A;  2R7H A;  4CAV A;  2PR1 A;  4UBR A;  4KOV A;  4HNX B;  2GE3 A;  2WPW A;  4KVO E;  3VWD A;  1Z4E A;  4PSW A;  4MHD A;  1Q2C A;  3FB3 A;  1KUX A;  1IB1 E;  2VI7 A;  1UFH A;  5G21 A;  1GHE A;  4CS0 B;  5C82 A;  1IIC A;  1Y9K A;  5H84 A;  4BBH A;  2GIV A;  4XPL A;  3R9E A;  1Q2Y A;  4MJ8 A;  4U9Y A;  3JTK A;  2R1I A;  4Y49 B;  5H86 A;  4KZT A;  4QVT A;  4JXQ A;  2B4B A;  1Q2D A;  2EVN A;  4KOS A;  4UCM A;  1OZP A;  3RYO A;  4ZGY B;  2AE6 A;  2JEV A;  1ZO0 A;  4R87 A;  4XPK A;  4HKF A;  1VKC A;  3BJ8 A;  2YGW A;  4LX9 A;  4PV6 A;  5HH1 A;  4B11 A;  2QIR A;  2OU2 A;  3LOD A;  5FVJ A;  3EY5 A;  3S6H A;  4FD6 A;  2QML A;  4CYQ A;  1S60 A;  4FD5 A;  2ZW4 A;  3PGP A;  5J8C A;  4C2Y A;  1TIQ A;  5BWA B;  1LRZ A;  2G0B A;  4KVM E;  2BL1 A;  3E0K A;  4JD6 A;  4JLY A;  2JDD A;  3TE4 A;  3G8W A;  2B5G A;  3DR8 A;  3A9L A;  4UCP A;  1S7L A;  2BSW A;  3TTH A;  2C27 A;  2J8N A;  4RI1 A;  2K5T A;  2DPT A;  4L89 A;  2Z3M A;  2B58 A;  3DDD A;  3P2H A;  4CGP A;  2P6E A;  2HUZ A;  1XEB A;  3KKW A;  4QBJ A;  3DNS A;  2BEI A;  2G3T A;  2WPX A;  2FL4 A;  2P6G A;  3R1K A;  2D4P A;  3MGD A;  5KTD A;  1S3Z A;  2IL4 A;  2KCW A;  5F46 A;  4CGM A;  4AB7 A;  4II9 A;  5AGE A;  4F0X A;  2YNC C;  3B8G A;  1YX0 A;  2I79 A;  4H6Z A;  1YRE A;  2GAN A;  2OB0 A;  2CY2 A;  2Q04 A;  4FD4 A;  3IWG A;  4OAE A;  4A2Z A;  5DWM A;  4AG9 A;  4CRY B;  3DR6 A;  2FIW A;  2VZY A;  1MJ9 A;  2WSA A;  1NSL A;  4NF1 A;  4NCZ A;  2ZW7 A;  1XIX A;  4UFX A;  4MI4 A;  2BUE A;  2WUU A;  4M3S A;  1S7N A;  5A28 A;  3R95 A;  3TO9 A;  3PP9 A;  3TO7 A;  1R57 A;  3FBU A;  1YK3 A;  2FS5 A;  4KOT A;  3BJ7 A;  1IID A;  4CAF A;  4Y49 C;  4XNH B;  2J8M A;  2ZW5 A;  5AG6 A;  4B12 A;  4J3G A;  2Q44 A;  4E8O A;  4KLW A;  1M44 A;  5EC4 A;  1WK4 A;  2F5I A;  4C7I A;  1B87 A;  2Z3K A;  2RC4 A;  3IU1 A;  1K4J A;  1IYK A;  3IWE A;  4K30 A;  4KOW A;  4OAD A;  1YR0 A;  4CGO A;  4CYO A;  2JLM A;  4KSA A;  1VHS A;  4RS2 A;  4KUB A;  2YNE A;  4CYN A;  3TCV A;  3F0A A;  5A27 A;  4A32 A;  1B6B A;  4E0A A;  2FCK A;  5AG4 A;  1PU9 A;  2R98 A;  2VBQ A;  4KLV A;  1L0C A;  4UFW A;  4B5P A;  3EFA A;  4YFJ A;  1MK4 A;  5G1Z A;  2P6F A;  4HNY B;  2VQY A;  4JXR A;  3CXS A;  4CGN A;  2VZZ A;  2OH1 A;  1ON0 A;  4YGO A;  2PC1 A;  4B14 A;  2Z0Z A;  1WWZ A;  4GS4 A;  4C2Z A;  3F5B A;  4B5O A;  1S7K A;  2J8R A;  1CJW A;  2X7B A;  3QAH A;  4CAW A;  4MBU A;  4QUS A;  4PSX A;  4UWJ A;  2ZXV A;  1XF8 A;  1FY7 A;  2R8V A;  4MY3 A;  1CM0 A;  4R3L A;  3JVN A;  2H5M A;  1J4J A;  4AG7 A;  2ZPA A;  4JJX A;  4U5Y A;  3SXN A;  3GY9 A;  4PK3 A;  3EXN A;  5ISV A;  3DSB A;  2Q0Y A;  1I12 A;  3WR7 A;  1M1D A;  2D4O A;  3TFY A;  5J8F A;  4PK2 A;  1KUV A;  2DPS A;  4M85 A;  4KOU A;  1IYL A;  3FIX A;  4Q38 A;  3TO6 A;  4H89 A;  2B4D A;  2REF A;  4B5P B;  4MFL A;  2FXF A;  3R96 A;  4AVB A;  3CXQ A;  2QEC A;  5C88 A;  3VWE A;  1RO5 A;  2PR8 A;  2P0W A;  3FRM A;  2FIA A;  3EO4 A;  5JPH A;  2OZH A;  4NSQ A;  4JWP A;  3D3S A;  2VXK A;  4MFJ A;  2ZW6 A;  2ATR A;  1NE9 A;  1YVK A;  4C7H A;  3T90 A;  4A31 A;  2FT0 A;  4MFZ A;  4F6A A;  4R3K A;  4XNH C;  5AG5 A;  3FYN A;  1M4D A;  3IU2 A;  3CXP A;  4CAE A;  2O28 A;  1KUY A;  4AVC A;  3UY5 A;  1U6M A;  4MFP A;  5AG7 A;  5F49 A;  3SHP A;  3IGR A;  4CYP A;  3C26 A;  1NMT A;  1Y9W A;  3PZJ A;  3W91 A;  4C68 A;  2Y0M A;  1QSN A;  5F48 A;  3F8K A;  1BOB A;  5CNP A;  2B4D B;  4A95 A;  1I21 A;  2Q4Y A;  2EUI A;  3S6K A;  5HMN A;  5IV0 A;  4A33 A;  1BO4 A;  4CAX A;  4XPD B;  4F0Y A;  2G3A A;  4X5K A;  1M4I A;  3GKR A;  2Z11 A;  2A4N A;  4I49 A;  3BLN A;  3QB8 A;  4ORF A;  1P0H A;  4FD7 A;  4IUS A;  4U9Z A;  3D2P A;  3D8P A;  4NEX A;  5GCN A;  2OZG A;  5EBV A;  5IB0 A;  3K9U A;  2PRB A;  3JUW A;  4MY0 A;  5IX3 A;  3I9S A;  4UFV A;  4E2A A;  5F47 A;  1QST A;  4LUA A;  2Z3P A;  4MFK A;  3TOA A;  4QB9 A;  2CNT A;  4R9M A;  4UWI A;  4B10 A;  2JDC A;  3G3S A;  4KOR A;  1XE4 A;  3ZZI A;  1KZF A;  1SQH A;  2AJ6 A;  2HQY A;  3EC4 A;  2FE7 A;  5G22 A;  4IF5 A;  4HNW B;  3V8I A;  1YLE A;  2CNM A;  3GYA A;  4Q36 A;  2PDO A;  2B3V A;  4UCN A;  4DNC A;  3T9Y A;  3H4Q A;  4UA3 A;  3R9G A;  4KUA A;  2Z3L A;  1S5K A;  4OLL A;  1QSR A;  3NE7 A;  4AVA A;  2PQ8 A;  3FXT A;  2Z3O A;  2YNC A;  1QSO A;  4ZBG A;  1Z9U A;  4BMH A;  1Z4R A;  1MJB A;  3D2M A;  3H5Z A;  4B13 A;  2I00 A;  1XMT A;  3LD2 A;  4R57 A;  2NMT A;  3TOB A;  1I1D A;  1Y7R A;  5E96 A;  2PSW A;  2Q4V A;  1MJA A;  3I3G A;  3S6G A;  2YND A;  1S7F A;  4KSF A;  4CRZ B;  5KTC A;  3S6F A;  2REE A;  2HV2 A;  2FSR A;  5KTA A;  4CGL A;  4EVY A;  4KS9 A;  1RXT A;  3SXO A;  4L8A A;  3ZJ0 A;  5DWN A;  1M4G A;  3R9F A;  3FNC A;  4KOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...