2ZXVA

Crystal structure of putative acetyltransferase from t. thermophilus hb8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
187
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA1799
publication title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 39
structure length 187
sequence length 188
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2zxvA00
4PK3A 3EXNA 1Z4EA 4R57A 3FXTA 4BMHA 2CNMA 2B4DA 5F49A 2PRBA 4B5PA 4ZBGA 4AVBA 3EO4A 1IB1E 5CNPA 1UFHA 4NXYA 1YVKA 4AG9A 3TTHA 4M3SA 1M44A 3CXSA 3CXPA 3QB8A 5GCNA 4UBRA 4H6ZA 1RXTA 4MHDA 3BLNA 2CNSA 2PR1A 2JEVA 3DR8A 2G0BA 2GE3A 3R9GA 4FD7A 1S7FA 2PDOA 2VEZA 3S6GA 5ISVA 2OH1A 2FXFA 3D8PA 2FL4A 1U6MA 4KOVA 3T90A 5C88A 2OB0A 2ZXVA 3TFYA 1I21A 4KOTA 1Q2DA 2QIRA 2Z0ZA 4YRHA 2CY2A 4JWPA 2REFA 4UWJA 2Z11A 2B3VA 1Q2CA 4MI4A 3G3SA 4HNYB 5F46A 3IWGA 2ZPAA 4KUAA 1OZPA 4M85A 3W6SA 3GKRA 2G3AA 2B3UA 5H86A 3W6XA 4Y49B 2HQYA 5H84A 4JLYA 4AG7A 5HMNA 1Y9WA 4XPDB 4MY3A 2FCKA 4CS0B 5J8FA 3EFAA 4KVME 3SHPA 1FY7A 1NMTA 4AVCA 2P6EA 1KUVA 3PP9A 4R3KA 2ZW5A 5FVJA 4H6UA 1P0HA 4H89A 1IIDA 3PZJA 4JD6A 3LD2A 5F47A 4FD5A 4IUSA 2BL1A 4R9MA 4KOUA 3SXNA 3C26A 5DWNA 3W91A 3DSBA 3GYAA 1NSLA 2B5GA 2VI7A 4CAWA 1IYKA 4KORA 3TOAA 2OZGA 1XE4A 4OLLA 2ZW7A 4U5YA 3RYOA 5E96A 4UA3A 3D2MA 2BUEA 5F48A 2A4NA 4J3GA 4JXQA 4E8OA 4II9A 4CRZB 2B58A 1V0CA 1S3ZA 4PK2A 3G8WA 2P6FA 3WR7A 2RC4A 2OU2A 2OZUA 3P2FA 1CJWA 2P6GA 3LODA 2HV2A 3FBUA 4KZTA 2D4PA 1S60A 3JUWA 4B5PB 2Q04A 4L8AA 1QSRA 2O28A 2NMTA 2I00A 2IL4A 3B8GA 4AVAA 4L89A 5KTDA 2FIAA 3R9FA 2R8VA 2Y0MA 4XNHB 2GANA 2KCWA 1QSTA 1KUXA 3BJ8A 3T9YA 1I12A 3FIXA 4QC6A 1LRZA 3V8IA 3P2HA 1KZFA 3R9EA 1Y9KA 1GHEA 1RO5A 1WWZA 2PC1A 2WPWA 5C82A 4YFJA 2Q44A 2ATRA 2P0WA 1ON0A 2Q4VA 4F0YA 2VZZA 4JJXA 1YX0A 4QBJA 1PU9A 4AB7A 1N71A 1IICA 4F6AA 2DXQA 4NSQA 1CM0A 1PUAA 4R87A 4NEXA 1S7NA 2QECA 3S6HA 4NF1A 3D3SA 4E0AA 1L0CA 4RI1A 2BSWA 3BJ7A 4QUSA 1R57A 1NE9A 5EC4A 2HUZA 4B5OA 2PR8A 4R3LA 3I9SA 3GY9A 1S7KA 4OADA 4ONUA 3QAHA 1BOBA 1QSMA 2VBQA 2FS5A 4JXRA 4QVTA 4UWIA 3TCVA 2OZHA 4MBUA 3TO7A 1YREA 4PSWA 5DWMA 2JDCA 1YVOA 3VWEA 4XPLA 2CNTA 5HH1A 4ORFA 1XIXA 4I49A 4U9ZA 4XPKA 2X7BA 4LX9A 1S5KA 4KUBA 3VWDA 2B5GB 5KTCA 1YR0A 1K4JA 1VKCA 2D4OA 4PV6A 1Z4RA 4RS2A 1BO4A 2J8RA 1YK3A 3CXQA 2J8NA 2FIWA 1Y7RA 2EVNA 3R96A 2Q4YA 3NE7A 4PSXA 3F5BA 2Q7BA 3UY5A 2ARHA 4MY0A 4CRYB 2B4DB 1B6BA 2R7HA 1TIQA 2ZW4A 2R98A 4XNHC 1XF8A 3TO6A 4K30A 1VHSA 2VXKA 1WK4A 2FSRA 2F5IA 2VQYA 4KOSA 4X5KA 3S6KA 1B87A 3F8KA 4YGOA 3KKWA 3E0KA 1MJ9A 2K5TA 4QB9A 1QSOA 4E2AA 1XEBA 1S7LA 1M4GA 2WPXA 4KLWA 5KTAA 2Q0YA 3DDDA 2FE7A 4EVYA 4DNCA 1M1DA 4LUAA 3FNCA 3FB3A 5IB0A 3I3GA 5I0CA 1SQHA 1Q2YA 4Y49C 5J8CA 4KOYA 2Z10A 2C27A 1IYLA 1MK4A 1XMTA 3JVNA 4XPDC 4KOWA 2REEA 1YLEA 3OWCA 2FT0A 3TT2A 3H4QA 1QSNA 3TO9A 2G3TA 4MJ8A 1Z9UA 2H5MA 3F0AA 1M4DA 4KLVA 3FYNA 3D2PA 4HNXB 2I79A 3DR6A 2JDDA 3MGDA 4KOXA 5EBVA 4IF5A 2PSWA 3R95A 5JPHA 5IX3A 3ZZIA 2AE6A 4CAVA 4HKFA 2PQ8A 3TOBA 4GS4A 4CAXA 2J8MA 2AJ6A 4FD4A 2EUIA 4KVXA 2R1IA 2ZW6A 2B4BA 1YGHA 3DNSA 3S6FA 3N7ZA 5JQ4A 1I1DA 4HNWB 3IGRA 3PGPA 3TE4A 3SXOA 1MJAA 2JLMA 1MJBA 1KUYA 2GIVA 3EY5A 1M4IA 5IV0A 3K9UA 4U9YA 1J4JA 3ZJ0A 4FD6A 4NCZA 3EC4A 2BEIA 2VZYA 4OAEA 3R1KA 1P4NA 2QMLA 3FRMA 4KVOE
chains in the Genus database with same CATH superfamily
4PK3A 2PIYA 3WABA 1LAMA 2XEIA 2ZELA 2Q7SA 3EXNA 2BO9A 2O53A 3IFEA 4LQGA 4LQ6A 1VGYA 1Z4EA 3B7IA 4ZY2A 2JBJA 1BLLE 4R57A 2PJ1A 1CP7A 3FXTA 4BMHA 2CNMA 2B4DA 2PJ2A 2PRBA 5F49A 4ZBGA 4UFVA 4B5PA 3KGQA 4NGRA 4MFZA 3EO4A 4AVBA 1IB1E 3B2YA 5CNPA 2QVPA 1UFHA 3D66A 4NXYA 1YVKA 4AG9A 2AFOA 2CF4A 2PJ6A 4M3SA 3TTHA 1M44A 3CXSA 1VHEA 1OBRA 3CXPA 3QB8A 3KI9A 5GCNA 2F7VA 2BOAA 4UBRA 1LCPA 3H8EA 1RXTA 4H6ZA 4MHDA 5AG6A 3IU2A 3BLNA 3BXMA 2POKA 1Z8LA 2CNSA 2PJCA 4GM5A 2PR1A 5K8NA 2PIZA 2PJ9A 2JEVA 3DR8A 2G0BA 2GE3A 4P4BA 1Z2LA 3R9GA 4FD7A 1S7FA 2PDOA 2RB7A 4BD9A 1PYTB 2VEZA 1AYEA 3S6GA 3D68A 5ISVA 2OH1A 4M6GA 1AMPA 4DYOA 2FXFA 4OC2A 3KR4A 3D8PA 5K8PA 2FL4A 1U6MA 2PRQA 4BBHA 4KOVA 3K9TA 5LYFA 3T90A 4IHMA 4YU9A 1CBXA 2OB0A 2ZXVA 5C88A 3TFYA 2C6PA 1I21A 5LYLA 3IIBA 4A94A 2V8DA 1Z8XA 4KOTA 1Q2DA 2QIRA 5G1ZA 2Z0ZA 3BI1A 4MHYA 1NSAA 2CY2A 4YRHA 2PCUA 5D29A 3SI2A 4MHZA 4JWPA 4UCPA 2REFA 4PXDA 3D67A 4UWJA 1FNOA 3GIUA 2Z11A 2B3VA 2PJ0A 1Q2CA 1QQ9A 1R43A 1YW6A 4MI4A 3G3SA 1Z8TA 4HNYB 4R76A 5F46A 3IWGA 5CBMA 2ZPAA 2GLJA 1CG2A 1BPNA 1OZPA 4KUAA 5D8NA 4M85A 3VARA 3W6SA 4F9UA 3GKRA 2G3AA 2B3UA 4MFPA 3B35A 5H86A 7CPAA 3W6XA 4Y49B 4M6IA 2HQYA 5H84A 4JLYA 4NJQA 5HVFA 3VATA 2V8HA 4R7MA 4AG7A 5HMNA 2BCOA 4A2ZA 2GU2A 4A38A 1Y9WA 2GLFA 4XPDB 4MY3A 2FCKA 5AG5A 4CS0B 2AFXA 1VIXA 3S9MA 1ZG9A 4A31A 2GREA 5J8FA 2XEJA 3FX6A 3EFAA 5JGFA 3GLJA 4KVME 4P4DA 2YGWA 3SHPA 4ZGYB 4WWVA 4G1PA 2ZEEA 3MN8A 1FY7A 4CGOA 1NMTA 2DPSA 3B3TA 4Q38A 4IAVA 2OOTA 4AVCA 5HXDA 2P6EA 4DUKA 2RFHA 4ZI6A 1KUVA 3PP9A 3LACA 4R3KA 2PVVA 2ZW5A 5FVJA 4H6UA 1XMBA 2O4HA 1F2PA 1P0HA 4H89A 1IIDA 1PCAA 1TKFA 2PE3A 3PZJA 3A9LA 4JD6A 4RUHA 3LD2A 3PBBA 3WC5A 5F47A 3NE8A 4EMEA 5K8OA 1VHOA 3I1UA 4PPZA 4Q7AA 4X2TA 5JM6A 4FD5A 4IUSA 2BL1A 4R9MA 4KOUA 3IWEA 3SXNA 3QNVA 4UFXA 3C26A 2F8HA 5DWNA 4OC0A 3W91A 3DSBA 3GYAA 1XRYA 1NSLA 1R3NA 4GXHA 2B5GA 2VI7A 3IEHA 4CAWA 1IYKA 3PB6X 1LAPA 2PJ5A 4MFLA 1XFOA 1YSJA 4KORA 3TOAA 1X12A 2IQ6A 2OZGA 2Z3KA 1XE4A 2XEGA 2EBJA 4OLLA 2JBKA 2ZW7A 3D7FA 4P4IA 4U5YA 4W9YA 5E96A 4UA3A 3RYOA 4ZY0A 2EWBA 3D2MA 1XOVA 2BUEA 1TKJA 2PJBA 1DE4C 3SJGA 3ISXA 4A95A 3BI0A 4C2ZA 5F48A 2A4NA 2PJ3A 4J3GA 4JXQA 1YMEA 4E8OA 4II9A 4CRZB 4FBEA 2IJZA 2WUUA 5K8MA 1QMUA 2CTBA 3PFOA 2B58A 1V0CA 1S3ZA 3JTKA 4PK2A 1F2OA 3G8WA 2P6FA 3WR7A 2RC4A 2OU2A 2OZUA 2YNDA 3P2FA 1CJWA 1CP6A 2P6GA 3KR5A 3LODA 2HV2A 5IB9A 3FBUA 4KZTA 4F8ZA 2D4PA 4C2YA 1IOIA 1S60A 3JUWA 4PXBA 5F09A 2AFZA 4B5PB 2Q04A 4L8AA 5G20A 4UEFA 1QSRA 2O28A 1UWYA 2NMTA 2YNEA 2I00A 2ANPA 2IL4A 3FEEA 3B8GA 3RBUA 5J1QA 3NH5A 3VH9A 3KHXA 4AVAA 4L89A 5KTDA 2FIAA 4MFKA 1XBUA 1Z8WA 5A28A 1F57A 3R9FA 4E0AA 3PBEA 2QYVA 2CIJA 2R8VA 2Y0MA 3D7GA 4XNHB 4Q36A 2AFMA 3H8FA 2GANA 2KCWA 1QSTA 1KUXA 2AFUA 3BJ8A 4NGNA 4P4JA 5CPAA 2V8VA 3T9YA 2DF5A 3B3CA 1I12A 3FIXA 2AFWA 4P10A 4QC6A 4A33A 4CYOA 3IWWA 1LRZA 3V8IA 2DEAA 3P2HA 2EO8A 3HLPA 3SI0A 1A2ZA 1KZFA 3R9EA 1Y9KA 2EK8A 1GHEA 1RO5A 1WWZA 2PC1A 2PJ7A 2WPWA 2ZOFA 3FMCA 4NGTA 2Q44A 4OP4A 4B6ZA 4YFJA 5C82A 6CPAA 2ATRA 4CAEA 1HEEA 3IU1A 1BPMA 2P0WA 3KQXA 1ON0A 1Q7LA 2NSMA 2Q4VA 3IJ3A 4UEEA 4F0YA 2VZZA 4JJXA 4OMEA 1YX0A 4QBJA 4KSFA 1PU9A 4AB7A 1N71A 1IICA 3KL9A 3FH4A 4F6AA 2DXQA 4NSQA 1CM0A 1PUAA 4R87A 2ZOGA 4NEXA 1H8LA 1S7NA 2QECA 3S6HA 4NF1A 4B10A 3D3SA 1KWMA 3SJXA 1L0CA 4RI1A 2BSWA 3BJ7A 4MHPA 2C6GA 4QUSA 2EK9A 4MRIA 1R57A 1NE9A 5EC4A 4OC3A 3S9NA 2ZEPA 3DLJA 2C6CA 4ONWA 1TF9A 4MHNA 2HUZA 3IO1A 3KHZA 3PB4X 4B5OA 2V77A 2PR8A 4PXCA 4R3LA 5THWA 4CPAA 2Z3LA 3I9SA 3K2KA 2Q4ZA 3GY9A 1S7KA 1XJOA 4OADA 4ONUA 3QAHA 1BOBA 1QSMA 4MMOA 4NFRA 2VBQA 1AUGA 1IU8A 2FS5A 4JXRA 4NJRA 4FAIA 3T8WA 4ZYQA 3H5ZA 4Z65A 4QVTA 4UWIA 2HC9A 3TCVA 2OZHA 4MBUA 3TO7A 1YREA 4CAFA 4NGSA 2Z3MA 4PSWA 5DWMA 2JDCA 1YVOA 3RZAA 1ZG8A 3HUVA 1IOFA 4F9VA 3B3VA 4ZX9A 3RO0A 3VWEA 4DJLA 4XPLA 2CNTA 5HH1A 4ORFA 1XIXA 5A27A 5JH9A 4I49A 1Y7EA 1YW4A 2CTCA 3PEIA 3RAMA 2G9DA 3SI1A 4U9ZA 4A32A 4XPKA 5ELYA 2X7BA 4LX9A 1S5KA 4KUBA 3VWDA 2ZEHA 2ABZA 2B5GB 4JZ0A 4OIWA 2ZEFA 4MCPA 4K3NA 2PVWA 3WC7A 1YR0A 1K4JA 5KTCA 4TNUA 1VKCA 2D4OA 4PV6A 4KSAA 1Z4RA 2FVGA 4RS2A 1BO4A 2J8RA 1YK3A 3CXQA 3CZXA 3D7HA 4M6HA 2J8NA 4WJBA 1JQGA 2FIWA 4NGMA 4C2XA 5G21A 1TKHA 1Y7RA 5AG7A 3CDXA 3D4UA 5I4MA 2EVNA 2ODFA 3R96A 4B11A 4X3RA 2PJ4A 4FWUA 2Q4YA 3NE7A 1Y0RA 3QAYA 4PSXA 5HVHA 3CPXA 3F5BA 2Q7BA 3UY5A 2HB6A 5LRGA 2ARHA 4MY0A 3ISZA 4C68A 5HVGA 4CRYB 1ELLP 2ZENA 4ZY1A 2B4DB 1B6BA 2R7HA 3DGVA 1TIQA 2Z3PA 4MXUA 2ZW4A 1HDUA 2V8GA 2R98A 4XNHC 1XF8A 3TO6A 4K30A 1ZLIA 4RN7A 2QJ8A 2GFQA 2JEWA 1VHSA 2VXKA 1WK4A 2FSRA 2F5IA 2VQYA 4P45A 5AGEA 4KOSA 4X5KA 4CGPA 2WSAA 3S6KA 4X8IA 4C7IA 1B87A 3F8KA 4YGOA 2YNCC 3FJUA 5BWAB 3KKWA 3E0KA 4UF4A 4BINA 1MJ9A 2K5TA 4QB9A 1QSOA 4IK2A 4E2AA 1XEBA 4FUUA 1S7LA 1M4GA 1HDQA 4P44A 4F0XA 2WPXA 4KLWA 1DTDA 2ZEGA 4B14A 5KTAA 2IMOA 2Q0YA 1FT7A 2ZEOA 1Y0YA 3PB9X 3DDDA 4CGLA 5AG4A 4A37A 4P6YA 2FE7A 4P4EA 2WZNA 4B12A 3LWUA 1LOKA 3BHXA 3FEDA 1X10A 4EVYA 1CX8A 4CYQA 3FF3A 3CT9A 4DNCA 2CXAA 1M1DA 2C1CA 3WT4A 3D7DA 2VL1A 3IC1A 4LUAA 1TF8A 2DPTA 3FNCA 4JYWA 4O23A 2YNCA 3SJFA 3FB3A 5IB0A 2Z3NA 3GB0A 3L2NA 3I3GA 3LMSA 4EWTA 5I0CA 1SQHA 1Q2YA 4Y49C 5J8CA 4KOYA 2Z10A 3TC8A 2C27A 3WC6A 1IYLA 1GYTA 1MK4A 2NYQA 3NH8A 3PB8X 1XMTA 3JVNA 4XPDC 1IY7A 4CGMA 5LYIA 4KOWA 2REEA 1YLEA 2ZEDA 2J9AA 4OC4A 1ZO0A 4CYNA 3OWCA 3PRTA 2FT0A 3B3WA 3TT2A 3H4QA 4KSIA 5LRJA 4UEZA 1QSNA 2OR4A 4NGQA 3TO9A 2G3TA 4MJ8A 1Z9UA 2PJAA 4AXVA 2H5MA 1LANA 3F0AA 1M4DA 4KLVA 1YQEA 3FYNA 4ZX8A 2I3CA 3D2PA 4HNXB 4TWEA 1IGBA 2I79A 3PFEA 3DR6A 3KASA 2JDDA 3MGDA 4KOXA 5EBVA 4OIDA 1LFWA 4P4FA 3SJEA 3KQZA 3TX8A 4OC5A 3NFZA 2AFSA 3KZWA 1BAVA 4IF5A 2PSWA 1YLOA 1ZG7A 4UCMA 3R95A 2PJ8A 2ZEMA 4YWYA 4MFQA 5JPHA 4CYPA 5IX3A 3ZZIA 2AE6A 4CAVA 3GUXA 4MFJA 2Q43A 4HKFA 2PQ8A 3TOBA 4GS4A 3V38A 4PQAA 4CAXA 2J8MA 1ELMP 2Z3OA 2AJ6A 4EFDA 4UFWA 5DS0A 4HPSA 3FECA 4C7HA 2WYRA 3MRUA 4FD4A 5LYDA 3N5FA 4OKOA 2EUIA 4KVXA 3S9LA 4H2KA 2R1IA 3CPAA 2ZW6A 4UCNA 2B4BA 2XEFA 5EMIA 4MCRA 3JRUA 1YGHA 3DNSA 4KS9A 5G22A 1RTQA 3S6FA 1CPXA 3N7ZA 3NH4A 5JQ4A 1I1DA 1TXRA 4HNWB 3IGRA 1M4LA 5LRKA 3FVLA 3PGPA 4B13A 4A30A 1JWQA 3SXOA 1MJAA 3TE4A 4R8FA 3RNZA 2JLMA 1MJBA 2Q51A 1KUYA 2GIVA 3EY5A 4UIBA 4UIAA 4NGPA 1M4IA 4R6TA 5IV0A 1Z5RA 3K9UA 3B3SA 4PXEA 4U9YA 1J4JA 1EE3P 3ZJ0A 8CPAA 4FD6A 4NCZA 4A39A 3EC4A 1ARMA 1ARLA 3PB7X 1ZLHA 2BEIA 2VZYA 4OAEA 3H8GA 4MCQA 3R1KA 4CGNA 1P4NA 1CPSA 2QMLA 3V7ZA 3FRMA 4KVOE 3NA6A 4OC1A 4MCSA
chains in the Genus database with same CATH topology
4PK3A 3EXNA 1Z4EA 4R57A 3FXTA 4BMHA 2CNMA 2B4DA 5F49A 2PRBA 4B5PA 4ZBGA 4UFVA 4MFZA 3EO4A 4AVBA 1IB1E 5CNPA 1UFHA 4NXYA 1YVKA 4AG9A 3TTHA 4M3SA 1M44A 3CXSA 3CXPA 3QB8A 5GCNA 4UBRA 4H6ZA 5AG6A 1RXTA 4MHDA 3IU2A 3BLNA 2CNSA 2PR1A 2JEVA 3DR8A 2G0BA 2GE3A 3R9GA 4FD7A 1S7FA 2PDOA 2VEZA 3S6GA 5ISVA 2OH1A 2FXFA 3D8PA 2FL4A 1U6MA 4BBHA 4KOVA 3T90A 5C88A 2OB0A 2ZXVA 3TFYA 1I21A 4KOTA 1Q2DA 2QIRA 5G1ZA 2Z0ZA 4YRHA 2CY2A 4JWPA 4UCPA 2REFA 4UWJA 2Z11A 2B3VA 1Q2CA 4MI4A 3G3SA 4HNYB 5F46A 3IWGA 2ZPAA 4KUAA 1OZPA 4M85A 3W6SA 3GKRA 2G3AA 2B3UA 4MFPA 5H86A 3W6XA 4Y49B 2HQYA 5H84A 4JLYA 4AG7A 5HMNA 4A2ZA 1Y9WA 4XPDB 4MY3A 2FCKA 5AG5A 4CS0B 4A31A 5J8FA 3EFAA 4KVME 2YGWA 3SHPA 4ZGYB 1FY7A 4CGOA 1NMTA 2DPSA 4Q38A 4AVCA 2P6EA 1KUVA 3PP9A 4R3KA 2ZW5A 5FVJA 4H6UA 1P0HA 4H89A 1IIDA 3PZJA 4JD6A 3A9LA 3LD2A 5F47A 4FD5A 4IUSA 2BL1A 4R9MA 4KOUA 3IWEA 3SXNA 4UFXA 3C26A 5DWNA 3W91A 3DSBA 3GYAA 1NSLA 2B5GA 2VI7A 4CAWA 1IYKA 4MFLA 4KORA 3TOAA 2OZGA 2Z3KA 1XE4A 4OLLA 2ZW7A 4U5YA 3RYOA 5E96A 4UA3A 3D2MA 2BUEA 4A95A 4C2ZA 5F48A 2A4NA 4J3GA 4JXQA 4E8OA 4II9A 4CRZB 2WUUA 2B58A 1V0CA 1S3ZA 3JTKA 4PK2A 3G8WA 2P6FA 3WR7A 2RC4A 2OU2A 2OZUA 2YNDA 3P2FA 1CJWA 2P6GA 3LODA 2HV2A 3FBUA 4KZTA 2D4PA 4C2YA 1S60A 3JUWA 4B5PB 2Q04A 4L8AA 5G20A 1QSRA 2O28A 2NMTA 2YNEA 2I00A 2IL4A 3B8GA 4AVAA 4L89A 5KTDA 2FIAA 4MFKA 5A28A 3R9FA 2R8VA 2Y0MA 4XNHB 4Q36A 2GANA 2KCWA 1QSTA 1KUXA 3BJ8A 3T9YA 1I12A 3FIXA 4CYOA 4A33A 4QC6A 1LRZA 3V8IA 3P2HA 1KZFA 3R9EA 1Y9KA 1GHEA 1RO5A 1WWZA 2PC1A 2WPWA 5C82A 4YFJA 2Q44A 2ATRA 4CAEA 3IU1A 2P0WA 1ON0A 2Q4VA 4F0YA 2VZZA 4JJXA 1YX0A 4QBJA 4KSFA 1PU9A 4AB7A 1N71A 1IICA 4F6AA 2DXQA 4NSQA 1CM0A 1PUAA 4R87A 4NEXA 1S7NA 2QECA 3S6HA 4NF1A 4B10A 3D3SA 4E0AA 1L0CA 4RI1A 2BSWA 3BJ7A 4QUSA 1R57A 1NE9A 5EC4A 2HUZA 4B5OA 2PR8A 4R3LA 2Z3LA 3I9SA 3GY9A 1S7KA 4OADA 4ONUA 3QAHA 1BOBA 1QSMA 2VBQA 2FS5A 4JXRA 3H5ZA 4QVTA 4UWIA 3TCVA 2OZHA 4MBUA 3TO7A 1YREA 4CAFA 2Z3MA 4PSWA 5DWMA 2JDCA 1YVOA 3VWEA 4XPLA 2CNTA 5HH1A 4ORFA 1XIXA 5A27A 4I49A 4U9ZA 4A32A 4XPKA 2X7BA 4LX9A 1S5KA 4KUBA 3VWDA 2B5GB 5KTCA 1YR0A 1K4JA 1VKCA 2D4OA 4PV6A 4KSAA 1Z4RA 4RS2A 1BO4A 2J8RA 1YK3A 3CXQA 2J8NA 2FIWA 4C2XA 5G21A 1Y7RA 5AG7A 2EVNA 3R96A 4B11A 2Q4YA 3NE7A 4PSXA 3F5BA 2Q7BA 3UY5A 2ARHA 4MY0A 4C68A 4CRYB 2B4DB 1B6BA 2R7HA 1TIQA 2Z3PA 2ZW4A 2R98A 4XNHC 1XF8A 3TO6A 4K30A 1VHSA 2VXKA 1WK4A 2FSRA 2F5IA 2VQYA 5AGEA 4KOSA 4X5KA 4CGPA 2WSAA 3S6KA 4C7IA 1B87A 3F8KA 4YGOA 2YNCC 5BWAB 3KKWA 3E0KA 1MJ9A 2K5TA 4QB9A 1QSOA 4E2AA 1XEBA 1S7LA 1M4GA 4F0XA 2WPXA 4KLWA 4B14A 5KTAA 2Q0YA 3DDDA 4CGLA 5AG4A 2FE7A 4B12A 4EVYA 4CYQA 4DNCA 2CXAA 1M1DA 4LUAA 2DPTA 3FNCA 2YNCA 3FB3A 5IB0A 2Z3NA 3I3GA 5I0CA 1SQHA 1Q2YA 4Y49C 5J8CA 4KOYA 2Z10A 2C27A 1IYLA 1MK4A 1XMTA 3JVNA 4XPDC 4CGMA 4KOWA 2REEA 1YLEA 1ZO0A 4CYNA 3OWCA 2FT0A 3TT2A 3H4QA 1QSNA 3TO9A 2G3TA 4MJ8A 1Z9UA 2H5MA 3F0AA 1M4DA 4KLVA 3FYNA 3D2PA 4HNXB 2I79A 3DR6A 2JDDA 3MGDA 4KOXA 5EBVA 4IF5A 2PSWA 3R95A 4UCMA 4MFQA 5JPHA 4CYPA 5IX3A 3ZZIA 2AE6A 4CAVA 4MFJA 4HKFA 2PQ8A 3TOBA 4GS4A 4CAXA 2J8MA 2Z3OA 2AJ6A 4UFWA 4C7HA 4FD4A 2EUIA 4KVXA 2R1IA 2ZW6A 4UCNA 2B4BA 1YGHA 3DNSA 4KS9A 5G22A 3S6FA 3N7ZA 5JQ4A 1I1DA 4HNWB 3IGRA 3PGPA 4B13A 4A30A 3TE4A 3SXOA 1MJAA 2JLMA 1MJBA 1KUYA 2GIVA 3EY5A 1M4IA 5IV0A 3K9UA 4U9YA 1J4JA 3ZJ0A 4FD6A 4NCZA 3EC4A 2BEIA 2VZYA 4OAEA 4CGNA 3R1KA 1P4NA 2QMLA 3FRMA 4KVOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PK3 A;  3EXN A;  1Z4E A;  4R57 A;  3FXT A;  4BMH A;  2CNM A;  2B4D A;  5F49 A;  2PRB A;  4B5P A;  4ZBG A;  4AVB A;  3EO4 A;  1IB1 E;  5CNP A;  1UFH A;  4NXY A;  1YVK A;  4AG9 A;  3TTH A;  4M3S A;  1M44 A;  3CXS A;  3CXP A;  3QB8 A;  5GCN A;  4UBR A;  4H6Z A;  1RXT A;  4MHD A;  3BLN A;  2CNS A;  2PR1 A;  2JEV A;  3DR8 A;  2G0B A;  2GE3 A;  3R9G A;  4FD7 A;  1S7F A;  2PDO A;  2VEZ A;  3S6G A;  5ISV A;  2OH1 A;  2FXF A;  3D8P A;  2FL4 A;  1U6M A;  4KOV A;  3T90 A;  5C88 A;  2OB0 A;  2ZXV A;  3TFY A;  1I21 A;  4KOT A;  1Q2D A;  2QIR A;  2Z0Z A;  4YRH A;  2CY2 A;  4JWP A;  2REF A;  4UWJ A;  2Z11 A;  2B3V A;  1Q2C A;  4MI4 A;  3G3S A;  4HNY B;  5F46 A;  3IWG A;  2ZPA A;  4KUA A;  1OZP A;  4M85 A;  3W6S A;  3GKR A;  2G3A A;  2B3U A;  5H86 A;  3W6X A;  4Y49 B;  2HQY A;  5H84 A;  4JLY A;  4AG7 A;  5HMN A;  1Y9W A;  4XPD B;  4MY3 A;  2FCK A;  4CS0 B;  5J8F A;  3EFA A;  4KVM E;  3SHP A;  1FY7 A;  1NMT A;  4AVC A;  2P6E A;  1KUV A;  3PP9 A;  4R3K A;  2ZW5 A;  5FVJ A;  4H6U A;  1P0H A;  4H89 A;  1IID A;  3PZJ A;  4JD6 A;  3LD2 A;  5F47 A;  4FD5 A;  4IUS A;  2BL1 A;  4R9M A;  4KOU A;  3SXN A;  3C26 A;  5DWN A;  3W91 A;  3DSB A;  3GYA A;  1NSL A;  2B5G A;  2VI7 A;  4CAW A;  1IYK A;  4KOR A;  3TOA A;  2OZG A;  1XE4 A;  4OLL A;  2ZW7 A;  4U5Y A;  3RYO A;  5E96 A;  4UA3 A;  3D2M A;  2BUE A;  5F48 A;  2A4N A;  4J3G A;  4JXQ A;  4E8O A;  4II9 A;  4CRZ B;  2B58 A;  1V0C A;  1S3Z A;  4PK2 A;  3G8W A;  2P6F A;  3WR7 A;  2RC4 A;  2OU2 A;  2OZU A;  3P2F A;  1CJW A;  2P6G A;  3LOD A;  2HV2 A;  3FBU A;  4KZT A;  2D4P A;  1S60 A;  3JUW A;  4B5P B;  2Q04 A;  4L8A A;  1QSR A;  2O28 A;  2NMT A;  2I00 A;  2IL4 A;  3B8G A;  4AVA A;  4L89 A;  5KTD A;  2FIA A;  3R9F A;  2R8V A;  2Y0M A;  4XNH B;  2GAN A;  2KCW A;  1QST A;  1KUX A;  3BJ8 A;  3T9Y A;  1I12 A;  3FIX A;  4QC6 A;  1LRZ A;  3V8I A;  3P2H A;  1KZF A;  3R9E A;  1Y9K A;  1GHE A;  1RO5 A;  1WWZ A;  2PC1 A;  2WPW A;  5C82 A;  4YFJ A;  2Q44 A;  2ATR A;  2P0W A;  1ON0 A;  2Q4V A;  4F0Y A;  2VZZ A;  4JJX A;  1YX0 A;  4QBJ A;  1PU9 A;  4AB7 A;  1N71 A;  1IIC A;  4F6A A;  2DXQ A;  4NSQ A;  1CM0 A;  1PUA A;  4R87 A;  4NEX A;  1S7N A;  2QEC A;  3S6H A;  4NF1 A;  3D3S A;  4E0A A;  1L0C A;  4RI1 A;  2BSW A;  3BJ7 A;  4QUS A;  1R57 A;  1NE9 A;  5EC4 A;  2HUZ A;  4B5O A;  2PR8 A;  4R3L A;  3I9S A;  3GY9 A;  1S7K A;  4OAD A;  4ONU A;  3QAH A;  1BOB A;  1QSM A;  2VBQ A;  2FS5 A;  4JXR A;  4QVT A;  4UWI A;  3TCV A;  2OZH A;  4MBU A;  3TO7 A;  1YRE A;  4PSW A;  5DWM A;  2JDC A;  1YVO A;  3VWE A;  4XPL A;  2CNT A;  5HH1 A;  4ORF A;  1XIX A;  4I49 A;  4U9Z A;  4XPK A;  2X7B A;  4LX9 A;  1S5K A;  4KUB A;  3VWD A;  2B5G B;  5KTC A;  1YR0 A;  1K4J A;  1VKC A;  2D4O A;  4PV6 A;  1Z4R A;  4RS2 A;  1BO4 A;  2J8R A;  1YK3 A;  3CXQ A;  2J8N A;  2FIW A;  1Y7R A;  2EVN A;  3R96 A;  2Q4Y A;  3NE7 A;  4PSX A;  3F5B A;  2Q7B A;  3UY5 A;  2ARH A;  4MY0 A;  4CRY B;  2B4D B;  1B6B A;  2R7H A;  1TIQ A;  2ZW4 A;  2R98 A;  4XNH C;  1XF8 A;  3TO6 A;  4K30 A;  1VHS A;  2VXK A;  1WK4 A;  2FSR A;  2F5I A;  2VQY A;  4KOS A;  4X5K A;  3S6K A;  1B87 A;  3F8K A;  4YGO A;  3KKW A;  3E0K A;  1MJ9 A;  2K5T A;  4QB9 A;  1QSO A;  4E2A A;  1XEB A;  1S7L A;  1M4G A;  2WPX A;  4KLW A;  5KTA A;  2Q0Y A;  3DDD A;  2FE7 A;  4EVY A;  4DNC A;  1M1D A;  4LUA A;  3FNC A;  3FB3 A;  5IB0 A;  3I3G A;  5I0C A;  1SQH A;  1Q2Y A;  4Y49 C;  5J8C A;  4KOY A;  2Z10 A;  2C27 A;  1IYL A;  1MK4 A;  1XMT A;  3JVN A;  4XPD C;  4KOW A;  2REE A;  1YLE A;  3OWC A;  2FT0 A;  3TT2 A;  3H4Q A;  1QSN A;  3TO9 A;  2G3T A;  4MJ8 A;  1Z9U A;  2H5M A;  3F0A A;  1M4D A;  4KLV A;  3FYN A;  3D2P A;  4HNX B;  2I79 A;  3DR6 A;  2JDD A;  3MGD A;  4KOX A;  5EBV A;  4IF5 A;  2PSW A;  3R95 A;  5JPH A;  5IX3 A;  3ZZI A;  2AE6 A;  4CAV A;  4HKF A;  2PQ8 A;  3TOB A;  4GS4 A;  4CAX A;  2J8M A;  2AJ6 A;  4FD4 A;  2EUI A;  4KVX A;  2R1I A;  2ZW6 A;  2B4B A;  1YGH A;  3DNS A;  3S6F A;  3N7Z A;  5JQ4 A;  1I1D A;  4HNW B;  3IGR A;  3PGP A;  3TE4 A;  3SXO A;  1MJA A;  2JLM A;  1MJB A;  1KUY A;  2GIV A;  3EY5 A;  1M4I A;  5IV0 A;  3K9U A;  4U9Y A;  1J4J A;  3ZJ0 A;  4FD6 A;  4NCZ A;  3EC4 A;  2BEI A;  2VZY A;  4OAE A;  3R1K A;  1P4N A;  2QML A;  3FRM A;  4KVO E; 
#chains in the Genus database with same CATH topology
 4PK3 A;  2PIY A;  3WAB A;  1LAM A;  2XEI A;  2ZEL A;  2Q7S A;  3EXN A;  2BO9 A;  2O53 A;  3IFE A;  4LQG A;  4LQ6 A;  1VGY A;  1Z4E A;  3B7I A;  4ZY2 A;  2JBJ A;  1BLL E;  4R57 A;  2PJ1 A;  1CP7 A;  3FXT A;  4BMH A;  2CNM A;  2B4D A;  2PJ2 A;  2PRB A;  5F49 A;  4ZBG A;  4UFV A;  4B5P A;  3KGQ A;  4NGR A;  4MFZ A;  3EO4 A;  4AVB A;  1IB1 E;  3B2Y A;  5CNP A;  2QVP A;  1UFH A;  3D66 A;  4NXY A;  1YVK A;  4AG9 A;  2AFO A;  2CF4 A;  2PJ6 A;  4M3S A;  3TTH A;  1M44 A;  3CXS A;  1VHE A;  1OBR A;  3CXP A;  3QB8 A;  3KI9 A;  5GCN A;  2F7V A;  2BOA A;  4UBR A;  1LCP A;  3H8E A;  1RXT A;  4H6Z A;  4MHD A;  5AG6 A;  3IU2 A;  3BLN A;  3BXM A;  2POK A;  1Z8L A;  2CNS A;  2PJC A;  4GM5 A;  2PR1 A;  5K8N A;  2PIZ A;  2PJ9 A;  2JEV A;  3DR8 A;  2G0B A;  2GE3 A;  4P4B A;  1Z2L A;  3R9G A;  4FD7 A;  1S7F A;  2PDO A;  2RB7 A;  4BD9 A;  1PYT B;  2VEZ A;  1AYE A;  3S6G A;  3D68 A;  5ISV A;  2OH1 A;  4M6G A;  1AMP A;  4DYO A;  2FXF A;  4OC2 A;  3KR4 A;  3D8P A;  5K8P A;  2FL4 A;  1U6M A;  2PRQ A;  4BBH A;  4KOV A;  3K9T A;  5LYF A;  3T90 A;  4IHM A;  4YU9 A;  1CBX A;  2OB0 A;  2ZXV A;  5C88 A;  3TFY A;  2C6P A;  1I21 A;  5LYL A;  3IIB A;  4A94 A;  2V8D A;  1Z8X A;  4KOT A;  1Q2D A;  2QIR A;  5G1Z A;  2Z0Z A;  3BI1 A;  4MHY A;  1NSA A;  2CY2 A;  4YRH A;  2PCU A;  5D29 A;  3SI2 A;  4MHZ A;  4JWP A;  4UCP A;  2REF A;  4PXD A;  3D67 A;  4UWJ A;  1FNO A;  3GIU A;  2Z11 A;  2B3V A;  2PJ0 A;  1Q2C A;  1QQ9 A;  1R43 A;  1YW6 A;  4MI4 A;  3G3S A;  1Z8T A;  4HNY B;  4R76 A;  5F46 A;  3IWG A;  5CBM A;  2ZPA A;  2GLJ A;  1CG2 A;  1BPN A;  1OZP A;  4KUA A;  5D8N A;  4M85 A;  3VAR A;  3W6S A;  4F9U A;  3GKR A;  2G3A A;  2B3U A;  4MFP A;  3B35 A;  5H86 A;  7CPA A;  3W6X A;  4Y49 B;  4M6I A;  2HQY A;  5H84 A;  4JLY A;  4NJQ A;  5HVF A;  3VAT A;  2V8H A;  4R7M A;  4AG7 A;  5HMN A;  2BCO A;  4A2Z A;  2GU2 A;  4A38 A;  1Y9W A;  2GLF A;  4XPD B;  4MY3 A;  2FCK A;  5AG5 A;  4CS0 B;  2AFX A;  1VIX A;  3S9M A;  1ZG9 A;  4A31 A;  2GRE A;  5J8F A;  2XEJ A;  3FX6 A;  3EFA A;  5JGF A;  3GLJ A;  4KVM E;  4P4D A;  2YGW A;  3SHP A;  4ZGY B;  4WWV A;  4G1P A;  2ZEE A;  3MN8 A;  1FY7 A;  4CGO A;  1NMT A;  2DPS A;  3B3T A;  4Q38 A;  4IAV A;  2OOT A;  4AVC A;  5HXD A;  2P6E A;  4DUK A;  2RFH A;  4ZI6 A;  1KUV A;  3PP9 A;  3LAC A;  4R3K A;  2PVV A;  2ZW5 A;  5FVJ A;  4H6U A;  1XMB A;  2O4H A;  1F2P A;  1P0H A;  4H89 A;  1IID A;  1PCA A;  1TKF A;  2PE3 A;  3PZJ A;  3A9L A;  4JD6 A;  4RUH A;  3LD2 A;  3PBB A;  3WC5 A;  5F47 A;  3NE8 A;  4EME A;  5K8O A;  1VHO A;  3I1U A;  4PPZ A;  4Q7A A;  4X2T A;  5JM6 A;  4FD5 A;  4IUS A;  2BL1 A;  4R9M A;  4KOU A;  3IWE A;  3SXN A;  3QNV A;  4UFX A;  3C26 A;  2F8H A;  5DWN A;  4OC0 A;  3W91 A;  3DSB A;  3GYA A;  1XRY A;  1NSL A;  1R3N A;  4GXH A;  2B5G A;  2VI7 A;  3IEH A;  4CAW A;  1IYK A;  3PB6 X;  1LAP A;  2PJ5 A;  4MFL A;  1XFO A;  1YSJ A;  4KOR A;  3TOA A;  1X12 A;  2IQ6 A;  2OZG A;  2Z3K A;  1XE4 A;  2XEG A;  2EBJ A;  4OLL A;  2JBK A;  2ZW7 A;  3D7F A;  4P4I A;  4U5Y A;  4W9Y A;  5E96 A;  4UA3 A;  3RYO A;  4ZY0 A;  2EWB A;  3D2M A;  1XOV A;  2BUE A;  1TKJ A;  2PJB A;  1DE4 C;  3SJG A;  3ISX A;  4A95 A;  3BI0 A;  4C2Z A;  5F48 A;  2A4N A;  2PJ3 A;  4J3G A;  4JXQ A;  1YME A;  4E8O A;  4II9 A;  4CRZ B;  4FBE A;  2IJZ A;  2WUU A;  5K8M A;  1QMU A;  2CTB A;  3PFO A;  2B58 A;  1V0C A;  1S3Z A;  3JTK A;  4PK2 A;  1F2O A;  3G8W A;  2P6F A;  3WR7 A;  2RC4 A;  2OU2 A;  2OZU A;  2YND A;  3P2F A;  1CJW A;  1CP6 A;  2P6G A;  3KR5 A;  3LOD A;  2HV2 A;  5IB9 A;  3FBU A;  4KZT A;  4F8Z A;  2D4P A;  4C2Y A;  1IOI A;  1S60 A;  3JUW A;  4PXB A;  5F09 A;  2AFZ A;  4B5P B;  2Q04 A;  4L8A A;  5G20 A;  4UEF A;  1QSR A;  2O28 A;  1UWY A;  2NMT A;  2YNE A;  2I00 A;  2ANP A;  2IL4 A;  3FEE A;  3B8G A;  3RBU A;  5J1Q A;  3NH5 A;  3VH9 A;  3KHX A;  4AVA A;  4L89 A;  5KTD A;  2FIA A;  4MFK A;  1XBU A;  1Z8W A;  5A28 A;  1F57 A;  3R9F A;  4E0A A;  3PBE A;  2QYV A;  2CIJ A;  2R8V A;  2Y0M A;  3D7G A;  4XNH B;  4Q36 A;  2AFM A;  3H8F A;  2GAN A;  2KCW A;  1QST A;  1KUX A;  2AFU A;  3BJ8 A;  4NGN A;  4P4J A;  5CPA A;  2V8V A;  3T9Y A;  2DF5 A;  3B3C A;  1I12 A;  3FIX A;  2AFW A;  4P10 A;  4QC6 A;  4A33 A;  4CYO A;  3IWW A;  1LRZ A;  3V8I A;  2DEA A;  3P2H A;  2EO8 A;  3HLP A;  3SI0 A;  1A2Z A;  1KZF A;  3R9E A;  1Y9K A;  2EK8 A;  1GHE A;  1RO5 A;  1WWZ A;  2PC1 A;  2PJ7 A;  2WPW A;  2ZOF A;  3FMC A;  4NGT A;  2Q44 A;  4OP4 A;  4B6Z A;  4YFJ A;  5C82 A;  6CPA A;  2ATR A;  4CAE A;  1HEE A;  3IU1 A;  1BPM A;  2P0W A;  3KQX A;  1ON0 A;  1Q7L A;  2NSM A;  2Q4V A;  3IJ3 A;  4UEE A;  4F0Y A;  2VZZ A;  4JJX A;  4OME A;  1YX0 A;  4QBJ A;  4KSF A;  1PU9 A;  4AB7 A;  1N71 A;  1IIC A;  3KL9 A;  3FH4 A;  4F6A A;  2DXQ A;  4NSQ A;  1CM0 A;  1PUA A;  4R87 A;  2ZOG A;  4NEX A;  1H8L A;  1S7N A;  2QEC A;  3S6H A;  4NF1 A;  4B10 A;  3D3S A;  1KWM A;  3SJX A;  1L0C A;  4RI1 A;  2BSW A;  3BJ7 A;  4MHP A;  2C6G A;  4QUS A;  2EK9 A;  4MRI A;  1R57 A;  1NE9 A;  5EC4 A;  4OC3 A;  3S9N A;  2ZEP A;  3DLJ A;  2C6C A;  4ONW A;  1TF9 A;  4MHN A;  2HUZ A;  3IO1 A;  3KHZ A;  3PB4 X;  4B5O A;  2V77 A;  2PR8 A;  4PXC A;  4R3L A;  5THW A;  4CPA A;  2Z3L A;  3I9S A;  3K2K A;  2Q4Z A;  3GY9 A;  1S7K A;  1XJO A;  4OAD A;  4ONU A;  3QAH A;  1BOB A;  1QSM A;  4MMO A;  4NFR A;  2VBQ A;  1AUG A;  1IU8 A;  2FS5 A;  4JXR A;  4NJR A;  4FAI A;  3T8W A;  4ZYQ A;  3H5Z A;  4Z65 A;  4QVT A;  4UWI A;  2HC9 A;  3TCV A;  2OZH A;  4MBU A;  3TO7 A;  1YRE A;  4CAF A;  4NGS A;  2Z3M A;  4PSW A;  5DWM A;  2JDC A;  1YVO A;  3RZA A;  1ZG8 A;  3HUV A;  1IOF A;  4F9V A;  3B3V A;  4ZX9 A;  3RO0 A;  3VWE A;  4DJL A;  4XPL A;  2CNT A;  5HH1 A;  4ORF A;  1XIX A;  5A27 A;  5JH9 A;  4I49 A;  1Y7E A;  1YW4 A;  2CTC A;  3PEI A;  3RAM A;  2G9D A;  3SI1 A;  4U9Z A;  4A32 A;  4XPK A;  5ELY A;  2X7B A;  4LX9 A;  1S5K A;  4KUB A;  3VWD A;  2ZEH A;  2ABZ A;  2B5G B;  4JZ0 A;  4OIW A;  2ZEF A;  4MCP A;  4K3N A;  2PVW A;  3WC7 A;  1YR0 A;  1K4J A;  5KTC A;  4TNU A;  1VKC A;  2D4O A;  4PV6 A;  4KSA A;  1Z4R A;  2FVG A;  4RS2 A;  1BO4 A;  2J8R A;  1YK3 A;  3CXQ A;  3CZX A;  3D7H A;  4M6H A;  2J8N A;  4WJB A;  1JQG A;  2FIW A;  4NGM A;  4C2X A;  5G21 A;  1TKH A;  1Y7R A;  5AG7 A;  3CDX A;  3D4U A;  5I4M A;  2EVN A;  2ODF A;  3R96 A;  4B11 A;  4X3R A;  2PJ4 A;  4FWU A;  2Q4Y A;  3NE7 A;  1Y0R A;  3QAY A;  4PSX A;  5HVH A;  3CPX A;  3F5B A;  2Q7B A;  3UY5 A;  2HB6 A;  5LRG A;  2ARH A;  4MY0 A;  3ISZ A;  4C68 A;  5HVG A;  4CRY B;  1ELL P;  2ZEN A;  4ZY1 A;  2B4D B;  1B6B A;  2R7H A;  3DGV A;  1TIQ A;  2Z3P A;  4MXU A;  2ZW4 A;  1HDU A;  2V8G A;  2R98 A;  4XNH C;  1XF8 A;  3TO6 A;  4K30 A;  1ZLI A;  4RN7 A;  2QJ8 A;  2GFQ A;  2JEW A;  1VHS A;  2VXK A;  1WK4 A;  2FSR A;  2F5I A;  2VQY A;  4P45 A;  5AGE A;  4KOS A;  4X5K A;  4CGP A;  2WSA A;  3S6K A;  4X8I A;  4C7I A;  1B87 A;  3F8K A;  4YGO A;  2YNC C;  3FJU A;  5BWA B;  3KKW A;  3E0K A;  4UF4 A;  4BIN A;  1MJ9 A;  2K5T A;  4QB9 A;  1QSO A;  4IK2 A;  4E2A A;  1XEB A;  4FUU A;  1S7L A;  1M4G A;  1HDQ A;  4P44 A;  4F0X A;  2WPX A;  4KLW A;  1DTD A;  2ZEG A;  4B14 A;  5KTA A;  2IMO A;  2Q0Y A;  1FT7 A;  2ZEO A;  1Y0Y A;  3PB9 X;  3DDD A;  4CGL A;  5AG4 A;  4A37 A;  4P6Y A;  2FE7 A;  4P4E A;  2WZN A;  4B12 A;  3LWU A;  1LOK A;  3BHX A;  3FED A;  1X10 A;  4EVY A;  1CX8 A;  4CYQ A;  3FF3 A;  3CT9 A;  4DNC A;  2CXA A;  1M1D A;  2C1C A;  3WT4 A;  3D7D A;  2VL1 A;  3IC1 A;  4LUA A;  1TF8 A;  2DPT A;  3FNC A;  4JYW A;  4O23 A;  2YNC A;  3SJF A;  3FB3 A;  5IB0 A;  2Z3N A;  3GB0 A;  3L2N A;  3I3G A;  3LMS A;  4EWT A;  5I0C A;  1SQH A;  1Q2Y A;  4Y49 C;  5J8C A;  4KOY A;  2Z10 A;  3TC8 A;  2C27 A;  3WC6 A;  1IYL A;  1GYT A;  1MK4 A;  2NYQ A;  3NH8 A;  3PB8 X;  1XMT A;  3JVN A;  4XPD C;  1IY7 A;  4CGM A;  5LYI A;  4KOW A;  2REE A;  1YLE A;  2ZED A;  2J9A A;  4OC4 A;  1ZO0 A;  4CYN A;  3OWC A;  3PRT A;  2FT0 A;  3B3W A;  3TT2 A;  3H4Q A;  4KSI A;  5LRJ A;  4UEZ A;  1QSN A;  2OR4 A;  4NGQ A;  3TO9 A;  2G3T A;  4MJ8 A;  1Z9U A;  2PJA A;  4AXV A;  2H5M A;  1LAN A;  3F0A A;  1M4D A;  4KLV A;  1YQE A;  3FYN A;  4ZX8 A;  2I3C A;  3D2P A;  4HNX B;  4TWE A;  1IGB A;  2I79 A;  3PFE A;  3DR6 A;  3KAS A;  2JDD A;  3MGD A;  4KOX A;  5EBV A;  4OID A;  1LFW A;  4P4F A;  3SJE A;  3KQZ A;  3TX8 A;  4OC5 A;  3NFZ A;  2AFS A;  3KZW A;  1BAV A;  4IF5 A;  2PSW A;  1YLO A;  1ZG7 A;  4UCM A;  3R95 A;  2PJ8 A;  2ZEM A;  4YWY A;  4MFQ A;  5JPH A;  4CYP A;  5IX3 A;  3ZZI A;  2AE6 A;  4CAV A;  3GUX A;  4MFJ A;  2Q43 A;  4HKF A;  2PQ8 A;  3TOB A;  4GS4 A;  3V38 A;  4PQA A;  4CAX A;  2J8M A;  1ELM P;  2Z3O A;  2AJ6 A;  4EFD A;  4UFW A;  5DS0 A;  4HPS A;  3FEC A;  4C7H A;  2WYR A;  3MRU A;  4FD4 A;  5LYD A;  3N5F A;  4OKO A;  2EUI A;  4KVX A;  3S9L A;  4H2K A;  2R1I A;  3CPA A;  2ZW6 A;  4UCN A;  2B4B A;  2XEF A;  5EMI A;  4MCR A;  3JRU A;  1YGH A;  3DNS A;  4KS9 A;  5G22 A;  1RTQ A;  3S6F A;  1CPX A;  3N7Z A;  3NH4 A;  5JQ4 A;  1I1D A;  1TXR A;  4HNW B;  3IGR A;  1M4L A;  5LRK A;  3FVL A;  3PGP A;  4B13 A;  4A30 A;  1JWQ A;  3SXO A;  1MJA A;  3TE4 A;  4R8F A;  3RNZ A;  2JLM A;  1MJB A;  2Q51 A;  1KUY A;  2GIV A;  3EY5 A;  4UIB A;  4UIA A;  4NGP A;  1M4I A;  4R6T A;  5IV0 A;  1Z5R A;  3K9U A;  3B3S A;  4PXE A;  4U9Y A;  1J4J A;  1EE3 P;  3ZJ0 A;  8CPA A;  4FD6 A;  4NCZ A;  4A39 A;  3EC4 A;  1ARM A;  1ARL A;  3PB7 X;  1ZLH A;  2BEI A;  2VZY A;  4OAE A;  3H8G A;  4MCQ A;  3R1K A;  4CGN A;  1P4N A;  1CPS A;  2QML A;  3V7Z A;  3FRM A;  4KVO E;  3NA6 A;  4OC1 A;  4MCS A; 
#chains in the Genus database with same CATH homology
 4PK3 A;  3EXN A;  1Z4E A;  4R57 A;  3FXT A;  4BMH A;  2CNM A;  2B4D A;  5F49 A;  2PRB A;  4B5P A;  4ZBG A;  4UFV A;  4MFZ A;  3EO4 A;  4AVB A;  1IB1 E;  5CNP A;  1UFH A;  4NXY A;  1YVK A;  4AG9 A;  3TTH A;  4M3S A;  1M44 A;  3CXS A;  3CXP A;  3QB8 A;  5GCN A;  4UBR A;  4H6Z A;  5AG6 A;  1RXT A;  4MHD A;  3IU2 A;  3BLN A;  2CNS A;  2PR1 A;  2JEV A;  3DR8 A;  2G0B A;  2GE3 A;  3R9G A;  4FD7 A;  1S7F A;  2PDO A;  2VEZ A;  3S6G A;  5ISV A;  2OH1 A;  2FXF A;  3D8P A;  2FL4 A;  1U6M A;  4BBH A;  4KOV A;  3T90 A;  5C88 A;  2OB0 A;  2ZXV A;  3TFY A;  1I21 A;  4KOT A;  1Q2D A;  2QIR A;  5G1Z A;  2Z0Z A;  4YRH A;  2CY2 A;  4JWP A;  4UCP A;  2REF A;  4UWJ A;  2Z11 A;  2B3V A;  1Q2C A;  4MI4 A;  3G3S A;  4HNY B;  5F46 A;  3IWG A;  2ZPA A;  4KUA A;  1OZP A;  4M85 A;  3W6S A;  3GKR A;  2G3A A;  2B3U A;  4MFP A;  5H86 A;  3W6X A;  4Y49 B;  2HQY A;  5H84 A;  4JLY A;  4AG7 A;  5HMN A;  4A2Z A;  1Y9W A;  4XPD B;  4MY3 A;  2FCK A;  5AG5 A;  4CS0 B;  4A31 A;  5J8F A;  3EFA A;  4KVM E;  2YGW A;  3SHP A;  4ZGY B;  1FY7 A;  4CGO A;  1NMT A;  2DPS A;  4Q38 A;  4AVC A;  2P6E A;  1KUV A;  3PP9 A;  4R3K A;  2ZW5 A;  5FVJ A;  4H6U A;  1P0H A;  4H89 A;  1IID A;  3PZJ A;  4JD6 A;  3A9L A;  3LD2 A;  5F47 A;  4FD5 A;  4IUS A;  2BL1 A;  4R9M A;  4KOU A;  3IWE A;  3SXN A;  4UFX A;  3C26 A;  5DWN A;  3W91 A;  3DSB A;  3GYA A;  1NSL A;  2B5G A;  2VI7 A;  4CAW A;  1IYK A;  4MFL A;  4KOR A;  3TOA A;  2OZG A;  2Z3K A;  1XE4 A;  4OLL A;  2ZW7 A;  4U5Y A;  3RYO A;  5E96 A;  4UA3 A;  3D2M A;  2BUE A;  4A95 A;  4C2Z A;  5F48 A;  2A4N A;  4J3G A;  4JXQ A;  4E8O A;  4II9 A;  4CRZ B;  2WUU A;  2B58 A;  1V0C A;  1S3Z A;  3JTK A;  4PK2 A;  3G8W A;  2P6F A;  3WR7 A;  2RC4 A;  2OU2 A;  2OZU A;  2YND A;  3P2F A;  1CJW A;  2P6G A;  3LOD A;  2HV2 A;  3FBU A;  4KZT A;  2D4P A;  4C2Y A;  1S60 A;  3JUW A;  4B5P B;  2Q04 A;  4L8A A;  5G20 A;  1QSR A;  2O28 A;  2NMT A;  2YNE A;  2I00 A;  2IL4 A;  3B8G A;  4AVA A;  4L89 A;  5KTD A;  2FIA A;  4MFK A;  5A28 A;  3R9F A;  2R8V A;  2Y0M A;  4XNH B;  4Q36 A;  2GAN A;  2KCW A;  1QST A;  1KUX A;  3BJ8 A;  3T9Y A;  1I12 A;  3FIX A;  4CYO A;  4A33 A;  4QC6 A;  1LRZ A;  3V8I A;  3P2H A;  1KZF A;  3R9E A;  1Y9K A;  1GHE A;  1RO5 A;  1WWZ A;  2PC1 A;  2WPW A;  5C82 A;  4YFJ A;  2Q44 A;  2ATR A;  4CAE A;  3IU1 A;  2P0W A;  1ON0 A;  2Q4V A;  4F0Y A;  2VZZ A;  4JJX A;  1YX0 A;  4QBJ A;  4KSF A;  1PU9 A;  4AB7 A;  1N71 A;  1IIC A;  4F6A A;  2DXQ A;  4NSQ A;  1CM0 A;  1PUA A;  4R87 A;  4NEX A;  1S7N A;  2QEC A;  3S6H A;  4NF1 A;  4B10 A;  3D3S A;  4E0A A;  1L0C A;  4RI1 A;  2BSW A;  3BJ7 A;  4QUS A;  1R57 A;  1NE9 A;  5EC4 A;  2HUZ A;  4B5O A;  2PR8 A;  4R3L A;  2Z3L A;  3I9S A;  3GY9 A;  1S7K A;  4OAD A;  4ONU A;  3QAH A;  1BOB A;  1QSM A;  2VBQ A;  2FS5 A;  4JXR A;  3H5Z A;  4QVT A;  4UWI A;  3TCV A;  2OZH A;  4MBU A;  3TO7 A;  1YRE A;  4CAF A;  2Z3M A;  4PSW A;  5DWM A;  2JDC A;  1YVO A;  3VWE A;  4XPL A;  2CNT A;  5HH1 A;  4ORF A;  1XIX A;  5A27 A;  4I49 A;  4U9Z A;  4A32 A;  4XPK A;  2X7B A;  4LX9 A;  1S5K A;  4KUB A;  3VWD A;  2B5G B;  5KTC A;  1YR0 A;  1K4J A;  1VKC A;  2D4O A;  4PV6 A;  4KSA A;  1Z4R A;  4RS2 A;  1BO4 A;  2J8R A;  1YK3 A;  3CXQ A;  2J8N A;  2FIW A;  4C2X A;  5G21 A;  1Y7R A;  5AG7 A;  2EVN A;  3R96 A;  4B11 A;  2Q4Y A;  3NE7 A;  4PSX A;  3F5B A;  2Q7B A;  3UY5 A;  2ARH A;  4MY0 A;  4C68 A;  4CRY B;  2B4D B;  1B6B A;  2R7H A;  1TIQ A;  2Z3P A;  2ZW4 A;  2R98 A;  4XNH C;  1XF8 A;  3TO6 A;  4K30 A;  1VHS A;  2VXK A;  1WK4 A;  2FSR A;  2F5I A;  2VQY A;  5AGE A;  4KOS A;  4X5K A;  4CGP A;  2WSA A;  3S6K A;  4C7I A;  1B87 A;  3F8K A;  4YGO A;  2YNC C;  5BWA B;  3KKW A;  3E0K A;  1MJ9 A;  2K5T A;  4QB9 A;  1QSO A;  4E2A A;  1XEB A;  1S7L A;  1M4G A;  4F0X A;  2WPX A;  4KLW A;  4B14 A;  5KTA A;  2Q0Y A;  3DDD A;  4CGL A;  5AG4 A;  2FE7 A;  4B12 A;  4EVY A;  4CYQ A;  4DNC A;  2CXA A;  1M1D A;  4LUA A;  2DPT A;  3FNC A;  2YNC A;  3FB3 A;  5IB0 A;  2Z3N A;  3I3G A;  5I0C A;  1SQH A;  1Q2Y A;  4Y49 C;  5J8C A;  4KOY A;  2Z10 A;  2C27 A;  1IYL A;  1MK4 A;  1XMT A;  3JVN A;  4XPD C;  4CGM A;  4KOW A;  2REE A;  1YLE A;  1ZO0 A;  4CYN A;  3OWC A;  2FT0 A;  3TT2 A;  3H4Q A;  1QSN A;  3TO9 A;  2G3T A;  4MJ8 A;  1Z9U A;  2H5M A;  3F0A A;  1M4D A;  4KLV A;  3FYN A;  3D2P A;  4HNX B;  2I79 A;  3DR6 A;  2JDD A;  3MGD A;  4KOX A;  5EBV A;  4IF5 A;  2PSW A;  3R95 A;  4UCM A;  4MFQ A;  5JPH A;  4CYP A;  5IX3 A;  3ZZI A;  2AE6 A;  4CAV A;  4MFJ A;  4HKF A;  2PQ8 A;  3TOB A;  4GS4 A;  4CAX A;  2J8M A;  2Z3O A;  2AJ6 A;  4UFW A;  4C7H A;  4FD4 A;  2EUI A;  4KVX A;  2R1I A;  2ZW6 A;  4UCN A;  2B4B A;  1YGH A;  3DNS A;  4KS9 A;  5G22 A;  3S6F A;  3N7Z A;  5JQ4 A;  1I1D A;  4HNW B;  3IGR A;  3PGP A;  4B13 A;  4A30 A;  3TE4 A;  3SXO A;  1MJA A;  2JLM A;  1MJB A;  1KUY A;  2GIV A;  3EY5 A;  1M4I A;  5IV0 A;  3K9U A;  4U9Y A;  1J4J A;  3ZJ0 A;  4FD6 A;  4NCZ A;  3EC4 A;  2BEI A;  2VZY A;  4OAE A;  4CGN A;  3R1K A;  1P4N A;  2QML A;  3FRM A;  4KVO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...