2ZXVA

Crystal structure of putative acetyltransferase from t. thermophilus hb8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
187
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative uncharacterized protein TTHA1799
publication title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography
pubmed doi rcsb
source organism Thermus thermophilus
total genus 39
structure length 187
sequence length 188
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2zxvA00
3TO6A 1XIXA 1I1DA 2EUIA 2VBQA 2BL1A 2PC1A 3SXNA 3S6GA 2G3TA 2WPXA 1B87A 3NE7A 4K30A 4F6AA 2PR8A 5F49A 2R7HA 1S7FA 3GKRA 2HV2A 4CAVA 1VKCA 4L8AA 1YX0A 4CRYB 3GY9A 2JDDA 2IL4A 4M85A 2CNSA 1S60A 3FNCA 3C26A 2PR1A 2Z10A 4E2AA 3MGDA 3RYOA 3TCVA 1U6MA 2REFA 1WK4A 2FT0A 4JXRA 3IWGA 4PK3A 4KOVA 2K5TA 3QB8A 2VI7A 1QSOA 2X7BA 4Y49B 2PQ8A 4QB9A 2GIVA 4X5KA 4QVTA 3GYAA 2FIAA 2B3UA 2ZW4A 2ZW5A 1QSRA 1NMTA 2VZYA 4E8OA 3EC4A 1MJ9A 2OZHA 1YVKA 4Y49C 3TE4A 2H5MA 2OU2A 4MJ8A 2A4NA 1RXTA 2GANA 4KOTA 1MK4A 3T90A 2FCKA 4JXQA 1YGHA 3D2MA 4FD5A 4HNWB 3FB3A 2B4DA 1Z9UA 5E96A 5I0CA 5J8CA 1XF8A 1XEBA 4UA3A 2ZW6A 1Z4EA 4AB7A 2D4OA 4FD4A 3P2FA 3OWCA 1YVOA 4JJXA 4LX9A 1R57A 5FVJA 4XPKA 3E0KA 2QECA 1CM0A 3CXQA 2B4BA 1S5KA 1M44A 2Q0YA 4QBJA 1KZFA 3CXSA 4KVOE 4NSQA 2CNTA 1CJWA 4FD7A 2P6EA 3WR7A 1PUAA 4MY3A 1B6BA 3EO4A 4KOSA 5EC4A 2FL4A 1K4JA 3F8KA 1Y9KA 2VZZA 5JPHA 3FBUA 2PRBA 4KLWA 3TT2A 2B3VA 5DWNA 2B5GB 3BJ8A 3K9UA 4CAWA 4E0AA 5ISVA 2QMLA 2HQYA 4KVXA 3FRMA 4ONUA 2AE6A 1LRZA 5IV0A 1TIQA 2RC4A 3F0AA 3SXOA 4R9MA 4UWJA 2J8RA 2I79A 3DDDA 4XNHB 1Q2YA 1RO5A 1GHEA 4LUAA 5KTCA 2R98A 2OZUA 4GS4A 4JWPA 2JEVA 3DNSA 1Q2DA 3LODA 4U9YA 4OADA 3G3SA 1SQHA 4PK2A 4JLYA 1S3ZA 2FXFA 4XNHC 1QSTA 4AVCA 1M4GA 1V0CA 1YR0A 3VWEA 4KOWA 4YRHA 2NMTA 1YREA 4YGOA 4ORFA 1P4NA 2PDOA 4DNCA 3W6SA 3EFAA 4B5OA 1XE4A 4PSXA 3R96A 4KORA 1NSLA 3PZJA 5IX3A 1IIDA 2Z11A 1M4DA 3TFYA 1MJAA 4NCZA 2Q7BA 1I12A 2JLMA 4IF5A 3S6KA 2Z0ZA 2VQYA 1L0CA 1ON0A 3CXPA 4MBUA 1FY7A 4BMHA 3ZZIA 2D4PA 2QIRA 1N71A 3BJ7A 2G3AA 1OZPA 4MI4A 5KTDA 4OAEA 1S7KA 4PV6A 3R95A 2AJ6A 4II9A 2DXQA 3TO9A 4XPDB 3VWDA 3FIXA 5JQ4A 1WWZA 2GE3A 2WPWA 4R3KA 3IGRA 5KTAA 3QAHA 3D2PA 1YK3A 2B5GA 4XPDC 2F5IA 2JDCA 4M3SA 2P6GA 4KUBA 5F46A 4NXYA 4CAXA 2Q44A 2VXKA 4UBRA 4FD6A 5HH1A 1MJBA 2FE7A 2G0BA 4J3GA 3V8IA 2BSWA 4B5PB 1IICA 2PSWA 2R1IA 4R3LA 5C82A 4KVME 2OB0A 2Y0MA 4H6ZA 4AVAA 3H4QA 4U5YA 4HKFA 2ZPAA 3R9FA 2Q4VA 4EVYA 3LD2A 4MY0A 3KKWA 3TOAA 4KUAA 2OH1A 3G8WA 1KUYA 3DR8A 4KOUA 3W91A 4AG9A 3JUWA 2BEIA 1YLEA 4R87A 4CS0B 3PP9A 4CRZB 1S7LA 5HMNA 2P0WA 3I3GA 4AVBA 1P0HA 3BLNA 4I49A 5F48A 2REEA 5H84A 2FIWA 3FXTA 4ZBGA 5CNPA 4U9ZA 1Y7RA 5C88A 2R8VA 2ZW7A 2KCWA 5EBVA 4UWIA 4KOXA 1IYKA 1S7NA 1Z4RA 1UFHA 3W6XA 4PSWA 3TO7A 1KUXA 2OZGA 3EY5A 3D3SA 3B8GA 4MHDA 4IUSA 3R9EA 4KZTA 2C27A 4HNYB 2FS5A 1I21A 2ARHA 2CNMA 3I9SA 3S6FA 1QSNA 4NF1A 5GCNA 4RS2A 3PGPA 1M4IA 5F47A 2CY2A 5DWMA 2BUEA 3S6HA 3TTHA 4R57A 1QSMA 4XPLA 5J8FA 2Q04A 3D8PA 3UY5A 4B5PA 4OLLA 1BO4A 4H89A 2J8NA 2J8MA 3T9YA 4F0YA 1IB1E 2ATRA 2I00A 3P2HA 5H86A 3F5BA 3TOBA 3EXNA 2P6FA 4RI1A 2B4DB 5IB0A 2EVNA 3DR6A 1BOBA 3R9GA 3N7ZA 1IYLA 4HNXB 4YFJA 1KUVA 4KLVA 3ZJ0A 1J4JA 1VHSA 4L89A 1Q2CA 1XMTA 1M1DA 2O28A 2B58A 4QC6A 3SHPA 2HUZA 2FSRA 4H6UA 3JVNA 3R1KA 4QUSA 4JD6A 3DSBA 2VEZA 2Q4YA 1PU9A 3FYNA 1Y9WA 4KOYA 4AG7A 2ZXVA 1NE9A 4NEXA
chains in the Genus database with same CATH superfamily
4A31A 3TO6A 1XIXA 1I1DA 4OP4A 1QQ9A 1YMEA 2EUIA 1IU8A 2VBQA 4P10A 2BL1A 4PXEA 2PC1A 2OR4A 3LWUA 4OC3A 3S6GA 3SXNA 2G3TA 2WPXA 1B87A 1LCPA 1BLLE 3NE7A 4K30A 4F6AA 4Q7AA 2PR8A 4P45A 5F49A 5HVGA 2GU2A 2R7HA 1S7FA 3PBBA 4ZGYB 1CX8A 4CYOA 5F09A 3GKRA 1CBXA 2HV2A 1YQEA 4CAVA 1VKCA 2ZEDA 4L8AA 3GB0A 2DF5A 3PB9X 5LRKA 1M4LA 3PB8X 1YX0A 3D7FA 3KR5A 4CRYB 3GY9A 2JDDA 2AFXA 2IL4A 4M85A 2CNSA 4CGMA 1S60A 5G22A 3FNCA 3C26A 2PR1A 5AG7A 2ZOFA 4W9YA 2Z10A 3D7DA 3MGDA 3RYOA 4E2AA 3TCVA 3WC6A 3CT9A 1U6MA 2REFA 1WK4A 4C2XA 2FT0A 2J9AA 1EE3P 1TKHA 3IWGA 4JXRA 4FUUA 2BO9A 2K5TA 3QB8A 2VI7A 4KOVA 4R76A 5G21A 2JBJA 1QSOA 2CTCA 2X7BA 4Y49B 2DPTA 3QNVA 4OKOA 2PJ0A 2PQ8A 3L2NA 4KSIA 4QB9A 2GIVA 4X5KA 5LYDA 1PYTB 4QVTA 4YU9A 2WUUA 3GYAA 4PK3A 4MFZA 4MCSA 2FIAA 3TC8A 2Z3NA 1XBUA 2B3UA 2ZW4A 2ZW5A 3B7IA 5AG5A 2HC9A 4RN7A 1IY7A 1QSRA 1NMTA 3D66A 2VZYA 4E8OA 3EC4A 1MJ9A 2OZHA 2ZEHA 1YVKA 2GLFA 1CG2A 4Y49C 1TF8A 5AGEA 4BINA 4B10A 3TE4A 2YNDA 1ARMA 1DTDA 2AFOA 3FX6A 4RUHA 2H5MA 2OU2A 4MJ8A 1TF9A 2A4NA 2V8VA 1RXTA 4F0XA 2GANA 4KOTA 5A28A 2C6PA 1HEEA 2XEGA 4P4EA 1MK4A 1Y7EA 2ODFA 3T90A 4PQAA 2FCKA 4JXQA 3RBUA 1YGHA 3IJ3A 2F8HA 3D2MA 4A32A 2GREA 2Z3LA 3D67A 4FD5A 4HNWB 3FB3A 2PVVA 2B4DA 2ZEOA 2IQ6A 3S9MA 1Z9UA 5E96A 5I0CA 2V8GA 2NSMA 1ELLP 5J8CA 4NGPA 3WC5A 1XF8A 2CTBA 1XEBA 1Z8TA 2ZEPA 1Y0YA 2PJBA 4UA3A 2ZW6A 1Z4EA 4IK2A 1IGBA 2D4OA 4AB7A 1VHEA 4FD4A 3NFZA 3FH4A 3P2FA 3PBEA 3OWCA 3JTKA 1YVOA 4JJXA 1JQGA 4LX9A 4FAIA 4P44A 1F57A 1R57A 5FVJA 2BOAA 4XPKA 5LYLA 2PJ8A 3H8GA 3E0KA 4MCRA 2QECA 1CM0A 3CXQA 2B4BA 4P4FA 3KQZA 1S5KA 1M44A 8CPAA 2Q0YA 4OC4A 1YSJA 2EO8A 4Q38A 4C7IA 4QBJA 1KZFA 2DPSA 3CXSA 3IU2A 3IWWA 3KR4A 4KVOE 4NSQA 2PE3A 2CNTA 4F8ZA 1CJWA 4FD7A 3B3VA 2P6EA 4GM5A 1PUAA 4LQGA 2YGWA 4MY3A 3WR7A 5DS0A 1B6BA 2WSAA 3KI9A 3EO4A 4KOSA 2AFMA 3I1UA 5EC4A 2FL4A 4P4BA 1K4JA 3F8KA 3VARA 2AFUA 1Y9KA 4CGNA 2JEWA 2VZZA 5JPHA 5HVHA 1YW4A 2G9DA 3FBUA 3GLJA 2PRBA 3H8FA 3PB6X 4KLWA 3TT2A 5BWAB 4OC5A 3K2KA 1BAVA 3RNZA 2B3VA 4R8FA 5DWNA 5ELYA 4NGTA 4NJQA 3SJFA 3PFEA 2YNCC 2B5GB 3BJ8A 2Q7SA 3K9UA 3BHXA 4CAWA 3NE8A 4E0AA 3D4UA 4BD9A 5ISVA 3ISXA 1TKJA 2QMLA 4NJRA 4EFDA 3S9LA 2HQYA 4KVXA 4P4DA 2ZEFA 3FRMA 3QAYA 4UIAA 2QJ8A 2AE6A 2O4HA 1LRZA 4ONUA 5IV0A 1TIQA 4A37A 2RC4A 3F0AA 4IAVA 3SXOA 3ISZA 4R9MA 4UWJA 4CGLA 1KWMA 4OIDA 2J8RA 4KSAA 4F9UA 4OC1A 4KS9A 2ZENA 2I79A 3DDDA 4XNHB 1Q2YA 1RO5A 1HDUA 4A33A 1GHEA 1UWYA 4OMEA 1CPSA 2DEAA 4LUAA 4DJLA 2EK9A 5KTCA 4MCQA 2EK8A 2AFZA 2R98A 4P6YA 2OZUA 4GS4A 4JWPA 2JEVA 4NGSA 3DNSA 1Q2DA 3LODA 4U9YA 4DUKA 4OADA 3G3SA 4UFXA 4A39A 3PFOA 1SQHA 4PK2A 2Z3MA 4PXBA 4JLYA 3SI2A 1S3ZA 4X3RA 2FXFA 4XNHC 1QSTA 4IHMA 4AVCA 1M4GA 1V0CA 1YR0A 3VWEA 1HDQA 4KOWA 4YRHA 4YWYA 1FNOA 2NMTA 1YREA 4OIWA 4YGOA 4ORFA 2GFQA 1P4NA 3NH8A 4A94A 2PDOA 1CP6A 2Z3KA 4UEEA 4UIBA 4DNCA 3W6SA 3EFAA 4MHYA 4B5OA 1XE4A 1IOFA 3WT4A 3LACA 4PSXA 4MFLA 3A9LA 1DE4C 3GUXA 1XJOA 3R96A 3IO1A 1RTQA 3B3SA 2C6CA 4KORA 1NSLA 3PZJA 2Q51A 5IX3A 1IIDA 1FT7A 2Z11A 1M4DA 1LANA 3WC7A 4CPAA 4P4JA 3TFYA 1MJAA 4NCZA 2Q7BA 2VL1A 1I12A 2JLMA 3MN8A 4IF5A 1TXRA 2AFSA 1ZG8A 3S6KA 2Z0ZA 2VQYA 4LQ6A 1L0CA 1Z2LA 4UCMA 1ON0A 1ZLHA 3CXPA 4MBUA 3VATA 1FY7A 3KASA 5HXDA 5CBMA 4NGRA 4BMHA 3ZZIA 2D4PA 4UEFA 2QIRA 1N71A 3KHXA 4NGQA 3WABA 4KSFA 3BJ7A 2IJZA 2G3AA 1OZPA 4B11A 4K3NA 4MI4A 7CPAA 2POKA 4OAEA 5KTDA 1S7KA 3NA6A 4G1PA 4PV6A 1JWQA 5JM6A 3R95A 4OC0A 4TWEA 4ONWA 4P4IA 2V77A 2AJ6A 4II9A 1H8LA 2DXQA 2BCOA 2EWBA 3NH4A 2YNCA 3TO9A 4C2YA 1CPXA 5LRJA 4XPDB 3D7HA 1X10A 3FIXA 3VWDA 4B13A 5JQ4A 1WWZA 2GE3A 3SJGA 1Z8WA 1GYTA 2WPWA 4R3KA 5D29A 2PJ9A 3H8EA 3IGRA 4MHZA 1ZO0A 3N5FA 5LYIA 5KTAA 4OC2A 2PIYA 4FBEA 3QAHA 3D2PA 2RB7A 2XEIA 1YK3A 3DGVA 2B5GA 4MFKA 2F5IA 4XPDC 3RAMA 2JDCA 3SI0A 4M3SA 2P6GA 4KUBA 5F46A 4CAEA 4NXYA 4CAXA 2Q44A 2VXKA 4UBRA 2PJ7A 3GIUA 2PIZA 4FD6A 5HH1A 1MJBA 2Z3PA 4MFQA 2FE7A 2G0BA 4J3GA 3FVLA 5G1ZA 5AG6A 3V8IA 1VGYA 2OOTA 4UCNA 3HUVA 2BSWA 4B5PB 1IICA 1Q7LA 2ZOGA 2PCUA 2PSWA 2R1IA 4R3LA 1YLOA 5C82A 5D8NA 4KVME 2OB0A 2Y0MA 4H6ZA 3CZXA 4AVAA 1XRYA 3H4QA 5LYFA 1F2OA 4HKFA 4U5YA 2RFHA 2ZPAA 3R9FA 2ZEEA 2Q4VA 2PJAA 4FWUA 4X8IA 4EVYA 5J1QA 2XEJA 3KHZA 3LD2A 3H5ZA 2JBKA 2GLJA 4MY0A 3KKWA 1Z8XA 1R43A 4JYWA 4UF4A 5K8NA 5I4MA 3KGQA 4ZYQA 1R3NA 1Z5RA 4M6GA 4MMOA 3TOAA 4B6ZA 3LMSA 4KUAA 2OH1A 3G8WA 1KUYA 2XEFA 3DR8A 4WJBA 5G20A 3SI1A 4ZY1A 4HPSA 1ZG9A 4KOUA 4M6HA 2C1CA 4NGMA 3JUWA 3W91A 4AG9A 2YNEA 3SJXA 1LFWA 2BEIA 1YLEA 1AYEA 4R7MA 2Z3OA 4R6TA 4R87A 1LAMA 4AXVA 4CS0B 4M6IA 4ZY2A 1VIXA 3PP9A 4CRZB 1S7LA 1XMBA 4ZX9A 5HMNA 1QMUA 2P0WA 3I3GA 1BPNA 4AVBA 1P0HA 3CPAA 4PXDA 4C68A 5K8MA 3K9TA 5K8PA 3BLNA 4I49A 4NFRA 6CPAA 1AMPA 5F48A 1A2ZA 2REEA 3B35A 2WYRA 3T8WA 2V8DA 3B2YA 4MFJA 5H84A 1ELMP 1OBRA 2ABZA 3FF3A 2FIWA 3BI1A 3FXTA 3JRUA 4PXCA 2PJ2A 4ZBGA 5CNPA 1IOIA 4F9VA 3CDXA 4Z65A 4ZI6A 4CYPA 3PEIA 2O53A 4UFWA 1ARLA 4U9ZA 2C6GA 3KL9A 2PRQA 1Y7RA 5C88A 4MXUA 4MHPA 2R8VA 3IFEA 2ZEMA 5LRGA 2CXAA 2ZW7A 2PJ1A 5JH9A 3HLPA 1PCAA 2KCWA 5EBVA 1NSAA 4UWIA 4KOXA 2ANPA 2PJCA 4EWTA 1IYKA 1S7NA 1Z4RA 1UFHA 2CF4A 3W6XA 1BPMA 4B14A 1Z8LA 3IIBA 4PSWA 4UCPA 3KQXA 3TO7A 4O23A 1KUXA 2OZGA 3EY5A 3D3SA 4C7HA 3B8GA 4MHNA 4A2ZA 4MHDA 5IB9A 4IUSA 3R9EA 4KZTA 2C27A 4CGPA 4HNYB 4ZX8A 3IWEA 4CGOA 1YW6A 4PPZA 2FS5A 1I21A 2ARHA 2CNMA 3I9SA 2I3CA 3S6FA 3V38A 1QSNA 1CP7A 4GXHA 3CPXA 4NF1A 4Q36A 3B3TA 2EBJA 3IC1A 4TNUA 5GCNA 3DLJA 3VH9A 2Q4ZA 3B3WA 3MRUA 3PGPA 4H2KA 4RS2A 3D68A 4UFVA 1AUGA 1M4IA 3D7GA 2F7VA 4MFPA 5F47A 5A27A 3RO0A 3BXMA 4C2ZA 2CY2A 2PJ3A 1TKFA 3FECA 5DWMA 2BUEA 3S6HA 3TTHA 4R57A 2ZEGA 2ZELA 3KZWA 1QSMA 1F2PA 3FMCA 4XPLA 2Q04A 3NH5A 5J8FA 4UEZA 4BBHA 2QYVA 3D8PA 3UY5A 4A30A 3B3CA 4B5PA 1XOVA 2CIJA 4JZ0A 3TX8A 4OLLA 4B12A 1BO4A 2FVGA 3FEEA 4H89A 3IU1A 2J8NA 1XFOA 3PRTA 2J8MA 5EMIA 3IEHA 2WZNA 5HVFA 2HB6A 3T9YA 3V7ZA 4F0YA 1IB1E 2ATRA 2I00A 3P2HA 3RZAA 5AG4A 4WWVA 5JGFA 5H86A 3F5BA 3PB4X 1Y0RA 3EXNA 2P6FA 3TOBA 4RI1A 4CAFA 2B4DB 5IB0A 2EVNA 3BI0A 3DR6A 1BOBA 1VHOA 3N7ZA 3R9GA 2V8HA 1IYLA 2PJ4A 4HNXB 4NGNA 3FJUA 4A95A 4YFJA 1KUVA 4ZY0A 5K8OA 4CYNA 5CPAA 1LOKA 4MCPA 4CYQA 4KLVA 3ZJ0A 1J4JA 1VHSA 4L89A 1Q2CA 1X12A 2PJ5A 1XMTA 1M1DA 2O28A 2AFWA 2B58A 4QC6A 4A38A 3SJEA 3PB7X 2PJ6A 1ZG7A 3SHPA 2Q43A 3S9NA 2HUZA 2FSRA 3FEDA 4H6UA 3JVNA 3R1KA 4QUSA 2PVWA 4JD6A 2NYQA 3DSBA 2QVPA 2Q4YA 2VEZA 4EMEA 5THWA 1PU9A 3FYNA 4MRIA 1Y9WA 4KOYA 4AG7A 2ZXVA 1NE9A 1ZLIA 4X2TA 4DYOA 1LAPA 2IMOA 4NEXA
chains in the Genus database with same CATH topology
4A31A 3TO6A 1XIXA 1I1DA 2EUIA 2VBQA 2BL1A 2PC1A 3SXNA 3S6GA 2G3TA 2WPXA 1B87A 3NE7A 4K30A 4F6AA 2PR8A 5F49A 2R7HA 1S7FA 4ZGYB 4CYOA 3GKRA 2HV2A 4CAVA 1VKCA 4L8AA 1YX0A 4CRYB 3GY9A 2JDDA 2IL4A 4M85A 2CNSA 4CGMA 1S60A 5G22A 3FNCA 3C26A 2PR1A 5AG7A 2Z10A 4E2AA 3MGDA 3RYOA 3TCVA 1U6MA 2REFA 1WK4A 4C2XA 2FT0A 4JXRA 3IWGA 4PK3A 5G21A 4KOVA 2K5TA 3QB8A 2VI7A 1QSOA 2X7BA 4Y49B 2DPTA 2PQ8A 4QB9A 2GIVA 4X5KA 4QVTA 2WUUA 3GYAA 4MFZA 2FIAA 2Z3NA 2B3UA 2ZW4A 2ZW5A 5AG5A 1QSRA 1NMTA 2VZYA 4E8OA 3EC4A 1MJ9A 2OZHA 1YVKA 4Y49C 5AGEA 4B10A 3TE4A 2YNDA 2H5MA 2OU2A 4MJ8A 2A4NA 1RXTA 4F0XA 2GANA 4KOTA 5A28A 1MK4A 3T90A 2FCKA 4JXQA 1YGHA 3D2MA 4A32A 2Z3LA 4FD5A 4HNWB 3FB3A 2B4DA 1Z9UA 5E96A 5I0CA 5J8CA 1XF8A 1XEBA 4UA3A 2ZW6A 1Z4EA 4AB7A 2D4OA 4FD4A 3P2FA 3OWCA 3JTKA 1YVOA 4JJXA 4LX9A 1R57A 5FVJA 4XPKA 3E0KA 2QECA 1CM0A 3CXQA 2B4BA 1S5KA 1M44A 2Q0YA 4C7IA 4Q38A 4QBJA 1KZFA 2DPSA 3CXSA 3IU2A 4KVOE 4NSQA 2CNTA 1CJWA 4FD7A 2P6EA 3WR7A 1PUAA 2YGWA 4MY3A 1B6BA 2WSAA 3EO4A 4KOSA 5EC4A 2FL4A 1K4JA 3F8KA 1Y9KA 4CGNA 2VZZA 5JPHA 3FBUA 2PRBA 4KLWA 3TT2A 5BWAB 2B3VA 5DWNA 2YNCC 2B5GB 3BJ8A 3K9UA 4CAWA 4E0AA 5ISVA 2QMLA 2HQYA 4KVXA 3FRMA 4ONUA 2AE6A 1LRZA 5IV0A 1TIQA 2RC4A 3F0AA 3SXOA 4R9MA 4UWJA 4CGLA 2J8RA 4KSAA 4KS9A 2I79A 3DDDA 4XNHB 1Q2YA 1RO5A 4A33A 1GHEA 4LUAA 5KTCA 2R98A 2OZUA 4GS4A 4JWPA 2JEVA 3DNSA 1Q2DA 3LODA 4U9YA 4OADA 3G3SA 4UFXA 1SQHA 4PK2A 2Z3MA 4JLYA 1S3ZA 2FXFA 4XNHC 1QSTA 4AVCA 1M4GA 1V0CA 1YR0A 3VWEA 4KOWA 4YRHA 2NMTA 1YREA 4YGOA 4ORFA 1P4NA 2PDOA 2Z3KA 4DNCA 3W6SA 3EFAA 4B5OA 1XE4A 4PSXA 4MFLA 3A9LA 3R96A 4KORA 1NSLA 3PZJA 5IX3A 1IIDA 2Z11A 1M4DA 3TFYA 1MJAA 4NCZA 2Q7BA 1I12A 2JLMA 4IF5A 3S6KA 2Z0ZA 2VQYA 1L0CA 4UCMA 1ON0A 3CXPA 4MBUA 1FY7A 4BMHA 3ZZIA 2D4PA 2QIRA 1N71A 4KSFA 3BJ7A 2G3AA 1OZPA 4B11A 4MI4A 5KTDA 4OAEA 1S7KA 4PV6A 3R95A 2AJ6A 4II9A 2DXQA 2YNCA 3TO9A 4C2YA 4XPDB 3VWDA 3FIXA 4B13A 5JQ4A 1WWZA 2GE3A 2WPWA 4R3KA 3IGRA 1ZO0A 5KTAA 3QAHA 3D2PA 1YK3A 2B5GA 4MFKA 2F5IA 4XPDC 2JDCA 4M3SA 2P6GA 4KUBA 5F46A 4CAEA 4NXYA 4CAXA 2Q44A 2VXKA 4UBRA 4FD6A 5HH1A 1MJBA 2Z3PA 4MFQA 2FE7A 2G0BA 4J3GA 5G1ZA 5AG6A 3V8IA 4UCNA 2BSWA 4B5PB 1IICA 2PSWA 2R1IA 4R3LA 5C82A 4KVME 2OB0A 2Y0MA 4H6ZA 4AVAA 3H4QA 4U5YA 4HKFA 2ZPAA 3R9FA 2Q4VA 4EVYA 3LD2A 3H5ZA 4MY0A 3KKWA 3TOAA 4KUAA 2OH1A 3G8WA 1KUYA 3DR8A 5G20A 4KOUA 3W91A 4AG9A 3JUWA 2YNEA 2BEIA 1YLEA 2Z3OA 4R87A 4CS0B 3PP9A 4CRZB 1S7LA 5HMNA 2P0WA 3I3GA 4AVBA 1P0HA 4C68A 3BLNA 4I49A 5F48A 2REEA 4MFJA 5H84A 2FIWA 3FXTA 4ZBGA 5CNPA 4CYPA 4UFWA 4U9ZA 1Y7RA 5C88A 2R8VA 2CXAA 2ZW7A 2KCWA 5EBVA 4UWIA 4KOXA 1IYKA 1S7NA 1Z4RA 1UFHA 3W6XA 4B14A 4PSWA 4UCPA 3TO7A 1KUXA 2OZGA 3EY5A 3D3SA 4C7HA 3B8GA 4A2ZA 4MHDA 4IUSA 3R9EA 4KZTA 2C27A 4CGPA 4HNYB 3IWEA 4CGOA 2FS5A 1I21A 2ARHA 2CNMA 3I9SA 3S6FA 1QSNA 4Q36A 4NF1A 5GCNA 4RS2A 3PGPA 4UFVA 1M4IA 4MFPA 5F47A 5A27A 4C2ZA 2CY2A 5DWMA 2BUEA 3S6HA 3TTHA 4R57A 1QSMA 4XPLA 5J8FA 2Q04A 4BBHA 3D8PA 3UY5A 4A30A 4B5PA 4OLLA 4B12A 1BO4A 4H89A 3IU1A 2J8NA 2J8MA 3T9YA 4F0YA 1IB1E 2ATRA 2I00A 3P2HA 5AG4A 5H86A 3F5BA 3TOBA 3EXNA 2P6FA 4RI1A 4CAFA 2B4DB 5IB0A 2EVNA 3DR6A 1BOBA 3R9GA 3N7ZA 1IYLA 4HNXB 4A95A 4YFJA 1KUVA 4CYNA 4CYQA 4KLVA 3ZJ0A 1J4JA 1VHSA 4L89A 1Q2CA 1XMTA 1M1DA 2O28A 2B58A 4QC6A 3SHPA 2HUZA 2FSRA 4H6UA 3JVNA 3R1KA 4QUSA 4JD6A 3DSBA 2VEZA 2Q4YA 1PU9A 3FYNA 1Y9WA 4KOYA 4AG7A 2ZXVA 1NE9A 4NEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO6 A;  1XIX A;  1I1D A;  2EUI A;  2VBQ A;  2BL1 A;  2PC1 A;  3SXN A;  3S6G A;  2G3T A;  2WPX A;  1B87 A;  3NE7 A;  4K30 A;  4F6A A;  2PR8 A;  5F49 A;  2R7H A;  1S7F A;  3GKR A;  2HV2 A;  4CAV A;  1VKC A;  4L8A A;  1YX0 A;  4CRY B;  3GY9 A;  2JDD A;  2IL4 A;  4M85 A;  2CNS A;  1S60 A;  3FNC A;  3C26 A;  2PR1 A;  2Z10 A;  4E2A A;  3MGD A;  3RYO A;  3TCV A;  1U6M A;  2REF A;  1WK4 A;  2FT0 A;  4JXR A;  3IWG A;  4PK3 A;  4KOV A;  2K5T A;  3QB8 A;  2VI7 A;  1QSO A;  2X7B A;  4Y49 B;  2PQ8 A;  4QB9 A;  2GIV A;  4X5K A;  4QVT A;  3GYA A;  2FIA A;  2B3U A;  2ZW4 A;  2ZW5 A;  1QSR A;  1NMT A;  2VZY A;  4E8O A;  3EC4 A;  1MJ9 A;  2OZH A;  1YVK A;  4Y49 C;  3TE4 A;  2H5M A;  2OU2 A;  4MJ8 A;  2A4N A;  1RXT A;  2GAN A;  4KOT A;  1MK4 A;  3T90 A;  2FCK A;  4JXQ A;  1YGH A;  3D2M A;  4FD5 A;  4HNW B;  3FB3 A;  2B4D A;  1Z9U A;  5E96 A;  5I0C A;  5J8C A;  1XF8 A;  1XEB A;  4UA3 A;  2ZW6 A;  1Z4E A;  4AB7 A;  2D4O A;  4FD4 A;  3P2F A;  3OWC A;  1YVO A;  4JJX A;  4LX9 A;  1R57 A;  5FVJ A;  4XPK A;  3E0K A;  2QEC A;  1CM0 A;  3CXQ A;  2B4B A;  1S5K A;  1M44 A;  2Q0Y A;  4QBJ A;  1KZF A;  3CXS A;  4KVO E;  4NSQ A;  2CNT A;  1CJW A;  4FD7 A;  2P6E A;  3WR7 A;  1PUA A;  4MY3 A;  1B6B A;  3EO4 A;  4KOS A;  5EC4 A;  2FL4 A;  1K4J A;  3F8K A;  1Y9K A;  2VZZ A;  5JPH A;  3FBU A;  2PRB A;  4KLW A;  3TT2 A;  2B3V A;  5DWN A;  2B5G B;  3BJ8 A;  3K9U A;  4CAW A;  4E0A A;  5ISV A;  2QML A;  2HQY A;  4KVX A;  3FRM A;  4ONU A;  2AE6 A;  1LRZ A;  5IV0 A;  1TIQ A;  2RC4 A;  3F0A A;  3SXO A;  4R9M A;  4UWJ A;  2J8R A;  2I79 A;  3DDD A;  4XNH B;  1Q2Y A;  1RO5 A;  1GHE A;  4LUA A;  5KTC A;  2R98 A;  2OZU A;  4GS4 A;  4JWP A;  2JEV A;  3DNS A;  1Q2D A;  3LOD A;  4U9Y A;  4OAD A;  3G3S A;  1SQH A;  4PK2 A;  4JLY A;  1S3Z A;  2FXF A;  4XNH C;  1QST A;  4AVC A;  1M4G A;  1V0C A;  1YR0 A;  3VWE A;  4KOW A;  4YRH A;  2NMT A;  1YRE A;  4YGO A;  4ORF A;  1P4N A;  2PDO A;  4DNC A;  3W6S A;  3EFA A;  4B5O A;  1XE4 A;  4PSX A;  3R96 A;  4KOR A;  1NSL A;  3PZJ A;  5IX3 A;  1IID A;  2Z11 A;  1M4D A;  3TFY A;  1MJA A;  4NCZ A;  2Q7B A;  1I12 A;  2JLM A;  4IF5 A;  3S6K A;  2Z0Z A;  2VQY A;  1L0C A;  1ON0 A;  3CXP A;  4MBU A;  1FY7 A;  4BMH A;  3ZZI A;  2D4P A;  2QIR A;  1N71 A;  3BJ7 A;  2G3A A;  1OZP A;  4MI4 A;  5KTD A;  4OAE A;  1S7K A;  4PV6 A;  3R95 A;  2AJ6 A;  4II9 A;  2DXQ A;  3TO9 A;  4XPD B;  3VWD A;  3FIX A;  5JQ4 A;  1WWZ A;  2GE3 A;  2WPW A;  4R3K A;  3IGR A;  5KTA A;  3QAH A;  3D2P A;  1YK3 A;  2B5G A;  4XPD C;  2F5I A;  2JDC A;  4M3S A;  2P6G A;  4KUB A;  5F46 A;  4NXY A;  4CAX A;  2Q44 A;  2VXK A;  4UBR A;  4FD6 A;  5HH1 A;  1MJB A;  2FE7 A;  2G0B A;  4J3G A;  3V8I A;  2BSW A;  4B5P B;  1IIC A;  2PSW A;  2R1I A;  4R3L A;  5C82 A;  4KVM E;  2OB0 A;  2Y0M A;  4H6Z A;  4AVA A;  3H4Q A;  4U5Y A;  4HKF A;  2ZPA A;  3R9F A;  2Q4V A;  4EVY A;  3LD2 A;  4MY0 A;  3KKW A;  3TOA A;  4KUA A;  2OH1 A;  3G8W A;  1KUY A;  3DR8 A;  4KOU A;  3W91 A;  4AG9 A;  3JUW A;  2BEI A;  1YLE A;  4R87 A;  4CS0 B;  3PP9 A;  4CRZ B;  1S7L A;  5HMN A;  2P0W A;  3I3G A;  4AVB A;  1P0H A;  3BLN A;  4I49 A;  5F48 A;  2REE A;  5H84 A;  2FIW A;  3FXT A;  4ZBG A;  5CNP A;  4U9Z A;  1Y7R A;  5C88 A;  2R8V A;  2ZW7 A;  2KCW A;  5EBV A;  4UWI A;  4KOX A;  1IYK A;  1S7N A;  1Z4R A;  1UFH A;  3W6X A;  4PSW A;  3TO7 A;  1KUX A;  2OZG A;  3EY5 A;  3D3S A;  3B8G A;  4MHD A;  4IUS A;  3R9E A;  4KZT A;  2C27 A;  4HNY B;  2FS5 A;  1I21 A;  2ARH A;  2CNM A;  3I9S A;  3S6F A;  1QSN A;  4NF1 A;  5GCN A;  4RS2 A;  3PGP A;  1M4I A;  5F47 A;  2CY2 A;  5DWM A;  2BUE A;  3S6H A;  3TTH A;  4R57 A;  1QSM A;  4XPL A;  5J8F A;  2Q04 A;  3D8P A;  3UY5 A;  4B5P A;  4OLL A;  1BO4 A;  4H89 A;  2J8N A;  2J8M A;  3T9Y A;  4F0Y A;  1IB1 E;  2ATR A;  2I00 A;  3P2H A;  5H86 A;  3F5B A;  3TOB A;  3EXN A;  2P6F A;  4RI1 A;  2B4D B;  5IB0 A;  2EVN A;  3DR6 A;  1BOB A;  3R9G A;  3N7Z A;  1IYL A;  4HNX B;  4YFJ A;  1KUV A;  4KLV A;  3ZJ0 A;  1J4J A;  1VHS A;  4L89 A;  1Q2C A;  1XMT A;  1M1D A;  2O28 A;  2B58 A;  4QC6 A;  3SHP A;  2HUZ A;  2FSR A;  4H6U A;  3JVN A;  3R1K A;  4QUS A;  4JD6 A;  3DSB A;  2VEZ A;  2Q4Y A;  1PU9 A;  3FYN A;  1Y9W A;  4KOY A;  4AG7 A;  2ZXV A;  1NE9 A;  4NEX A; 
#chains in the Genus database with same CATH topology
 4A31 A;  3TO6 A;  1XIX A;  1I1D A;  4OP4 A;  1QQ9 A;  1YME A;  2EUI A;  1IU8 A;  2VBQ A;  4P10 A;  2BL1 A;  4PXE A;  2PC1 A;  2OR4 A;  3LWU A;  4OC3 A;  3S6G A;  3SXN A;  2G3T A;  2WPX A;  1B87 A;  1LCP A;  1BLL E;  3NE7 A;  4K30 A;  4F6A A;  4Q7A A;  2PR8 A;  4P45 A;  5F49 A;  5HVG A;  2GU2 A;  2R7H A;  1S7F A;  3PBB A;  4ZGY B;  1CX8 A;  4CYO A;  5F09 A;  3GKR A;  1CBX A;  2HV2 A;  1YQE A;  4CAV A;  1VKC A;  2ZED A;  4L8A A;  3GB0 A;  2DF5 A;  3PB9 X;  5LRK A;  1M4L A;  3PB8 X;  1YX0 A;  3D7F A;  3KR5 A;  4CRY B;  3GY9 A;  2JDD A;  2AFX A;  2IL4 A;  4M85 A;  2CNS A;  4CGM A;  1S60 A;  5G22 A;  3FNC A;  3C26 A;  2PR1 A;  5AG7 A;  2ZOF A;  4W9Y A;  2Z10 A;  3D7D A;  3MGD A;  3RYO A;  4E2A A;  3TCV A;  3WC6 A;  3CT9 A;  1U6M A;  2REF A;  1WK4 A;  4C2X A;  2FT0 A;  2J9A A;  1EE3 P;  1TKH A;  3IWG A;  4JXR A;  4FUU A;  2BO9 A;  2K5T A;  3QB8 A;  2VI7 A;  4KOV A;  4R76 A;  5G21 A;  2JBJ A;  1QSO A;  2CTC A;  2X7B A;  4Y49 B;  2DPT A;  3QNV A;  4OKO A;  2PJ0 A;  2PQ8 A;  3L2N A;  4KSI A;  4QB9 A;  2GIV A;  4X5K A;  5LYD A;  1PYT B;  4QVT A;  4YU9 A;  2WUU A;  3GYA A;  4PK3 A;  4MFZ A;  4MCS A;  2FIA A;  3TC8 A;  2Z3N A;  1XBU A;  2B3U A;  2ZW4 A;  2ZW5 A;  3B7I A;  5AG5 A;  2HC9 A;  4RN7 A;  1IY7 A;  1QSR A;  1NMT A;  3D66 A;  2VZY A;  4E8O A;  3EC4 A;  1MJ9 A;  2OZH A;  2ZEH A;  1YVK A;  2GLF A;  1CG2 A;  4Y49 C;  1TF8 A;  5AGE A;  4BIN A;  4B10 A;  3TE4 A;  2YND A;  1ARM A;  1DTD A;  2AFO A;  3FX6 A;  4RUH A;  2H5M A;  2OU2 A;  4MJ8 A;  1TF9 A;  2A4N A;  2V8V A;  1RXT A;  4F0X A;  2GAN A;  4KOT A;  5A28 A;  2C6P A;  1HEE A;  2XEG A;  4P4E A;  1MK4 A;  1Y7E A;  2ODF A;  3T90 A;  4PQA A;  2FCK A;  4JXQ A;  3RBU A;  1YGH A;  3IJ3 A;  2F8H A;  3D2M A;  4A32 A;  2GRE A;  2Z3L A;  3D67 A;  4FD5 A;  4HNW B;  3FB3 A;  2PVV A;  2B4D A;  2ZEO A;  2IQ6 A;  3S9M A;  1Z9U A;  5E96 A;  5I0C A;  2V8G A;  2NSM A;  1ELL P;  5J8C A;  4NGP A;  3WC5 A;  1XF8 A;  2CTB A;  1XEB A;  1Z8T A;  2ZEP A;  1Y0Y A;  2PJB A;  4UA3 A;  2ZW6 A;  1Z4E A;  4IK2 A;  1IGB A;  2D4O A;  4AB7 A;  1VHE A;  4FD4 A;  3NFZ A;  3FH4 A;  3P2F A;  3PBE A;  3OWC A;  3JTK A;  1YVO A;  4JJX A;  1JQG A;  4LX9 A;  4FAI A;  4P44 A;  1F57 A;  1R57 A;  5FVJ A;  2BOA A;  4XPK A;  5LYL A;  2PJ8 A;  3H8G A;  3E0K A;  4MCR A;  2QEC A;  1CM0 A;  3CXQ A;  2B4B A;  4P4F A;  3KQZ A;  1S5K A;  1M44 A;  8CPA A;  2Q0Y A;  4OC4 A;  1YSJ A;  2EO8 A;  4Q38 A;  4C7I A;  4QBJ A;  1KZF A;  2DPS A;  3CXS A;  3IU2 A;  3IWW A;  3KR4 A;  4KVO E;  4NSQ A;  2PE3 A;  2CNT A;  4F8Z A;  1CJW A;  4FD7 A;  3B3V A;  2P6E A;  4GM5 A;  1PUA A;  4LQG A;  2YGW A;  4MY3 A;  3WR7 A;  5DS0 A;  1B6B A;  2WSA A;  3KI9 A;  3EO4 A;  4KOS A;  2AFM A;  3I1U A;  5EC4 A;  2FL4 A;  4P4B A;  1K4J A;  3F8K A;  3VAR A;  2AFU A;  1Y9K A;  4CGN A;  2JEW A;  2VZZ A;  5JPH A;  5HVH A;  1YW4 A;  2G9D A;  3FBU A;  3GLJ A;  2PRB A;  3H8F A;  3PB6 X;  4KLW A;  3TT2 A;  5BWA B;  4OC5 A;  3K2K A;  1BAV A;  3RNZ A;  2B3V A;  4R8F A;  5DWN A;  5ELY A;  4NGT A;  4NJQ A;  3SJF A;  3PFE A;  2YNC C;  2B5G B;  3BJ8 A;  2Q7S A;  3K9U A;  3BHX A;  4CAW A;  3NE8 A;  4E0A A;  3D4U A;  4BD9 A;  5ISV A;  3ISX A;  1TKJ A;  2QML A;  4NJR A;  4EFD A;  3S9L A;  2HQY A;  4KVX A;  4P4D A;  2ZEF A;  3FRM A;  3QAY A;  4UIA A;  2QJ8 A;  2AE6 A;  2O4H A;  1LRZ A;  4ONU A;  5IV0 A;  1TIQ A;  4A37 A;  2RC4 A;  3F0A A;  4IAV A;  3SXO A;  3ISZ A;  4R9M A;  4UWJ A;  4CGL A;  1KWM A;  4OID A;  2J8R A;  4KSA A;  4F9U A;  4OC1 A;  4KS9 A;  2ZEN A;  2I79 A;  3DDD A;  4XNH B;  1Q2Y A;  1RO5 A;  1HDU A;  4A33 A;  1GHE A;  1UWY A;  4OME A;  1CPS A;  2DEA A;  4LUA A;  4DJL A;  2EK9 A;  5KTC A;  4MCQ A;  2EK8 A;  2AFZ A;  2R98 A;  4P6Y A;  2OZU A;  4GS4 A;  4JWP A;  2JEV A;  4NGS A;  3DNS A;  1Q2D A;  3LOD A;  4U9Y A;  4DUK A;  4OAD A;  3G3S A;  4UFX A;  4A39 A;  3PFO A;  1SQH A;  4PK2 A;  2Z3M A;  4PXB A;  4JLY A;  3SI2 A;  1S3Z A;  4X3R A;  2FXF A;  4XNH C;  1QST A;  4IHM A;  4AVC A;  1M4G A;  1V0C A;  1YR0 A;  3VWE A;  1HDQ A;  4KOW A;  4YRH A;  4YWY A;  1FNO A;  2NMT A;  1YRE A;  4OIW A;  4YGO A;  4ORF A;  2GFQ A;  1P4N A;  3NH8 A;  4A94 A;  2PDO A;  1CP6 A;  2Z3K A;  4UEE A;  4UIB A;  4DNC A;  3W6S A;  3EFA A;  4MHY A;  4B5O A;  1XE4 A;  1IOF A;  3WT4 A;  3LAC A;  4PSX A;  4MFL A;  3A9L A;  1DE4 C;  3GUX A;  1XJO A;  3R96 A;  3IO1 A;  1RTQ A;  3B3S A;  2C6C A;  4KOR A;  1NSL A;  3PZJ A;  2Q51 A;  5IX3 A;  1IID A;  1FT7 A;  2Z11 A;  1M4D A;  1LAN A;  3WC7 A;  4CPA A;  4P4J A;  3TFY A;  1MJA A;  4NCZ A;  2Q7B A;  2VL1 A;  1I12 A;  2JLM A;  3MN8 A;  4IF5 A;  1TXR A;  2AFS A;  1ZG8 A;  3S6K A;  2Z0Z A;  2VQY A;  4LQ6 A;  1L0C A;  1Z2L A;  4UCM A;  1ON0 A;  1ZLH A;  3CXP A;  4MBU A;  3VAT A;  1FY7 A;  3KAS A;  5HXD A;  5CBM A;  4NGR A;  4BMH A;  3ZZI A;  2D4P A;  4UEF A;  2QIR A;  1N71 A;  3KHX A;  4NGQ A;  3WAB A;  4KSF A;  3BJ7 A;  2IJZ A;  2G3A A;  1OZP A;  4B11 A;  4K3N A;  4MI4 A;  7CPA A;  2POK A;  4OAE A;  5KTD A;  1S7K A;  3NA6 A;  4G1P A;  4PV6 A;  1JWQ A;  5JM6 A;  3R95 A;  4OC0 A;  4TWE A;  4ONW A;  4P4I A;  2V77 A;  2AJ6 A;  4II9 A;  1H8L A;  2DXQ A;  2BCO A;  2EWB A;  3NH4 A;  2YNC A;  3TO9 A;  4C2Y A;  1CPX A;  5LRJ A;  4XPD B;  3D7H A;  1X10 A;  3FIX A;  3VWD A;  4B13 A;  5JQ4 A;  1WWZ A;  2GE3 A;  3SJG A;  1Z8W A;  1GYT A;  2WPW A;  4R3K A;  5D29 A;  2PJ9 A;  3H8E A;  3IGR A;  4MHZ A;  1ZO0 A;  3N5F A;  5LYI A;  5KTA A;  4OC2 A;  2PIY A;  4FBE A;  3QAH A;  3D2P A;  2RB7 A;  2XEI A;  1YK3 A;  3DGV A;  2B5G A;  4MFK A;  2F5I A;  4XPD C;  3RAM A;  2JDC A;  3SI0 A;  4M3S A;  2P6G A;  4KUB A;  5F46 A;  4CAE A;  4NXY A;  4CAX A;  2Q44 A;  2VXK A;  4UBR A;  2PJ7 A;  3GIU A;  2PIZ A;  4FD6 A;  5HH1 A;  1MJB A;  2Z3P A;  4MFQ A;  2FE7 A;  2G0B A;  4J3G A;  3FVL A;  5G1Z A;  5AG6 A;  3V8I A;  1VGY A;  2OOT A;  4UCN A;  3HUV A;  2BSW A;  4B5P B;  1IIC A;  1Q7L A;  2ZOG A;  2PCU A;  2PSW A;  2R1I A;  4R3L A;  1YLO A;  5C82 A;  5D8N A;  4KVM E;  2OB0 A;  2Y0M A;  4H6Z A;  3CZX A;  4AVA A;  1XRY A;  3H4Q A;  5LYF A;  1F2O A;  4HKF A;  4U5Y A;  2RFH A;  2ZPA A;  3R9F A;  2ZEE A;  2Q4V A;  2PJA A;  4FWU A;  4X8I A;  4EVY A;  5J1Q A;  2XEJ A;  3KHZ A;  3LD2 A;  3H5Z A;  2JBK A;  2GLJ A;  4MY0 A;  3KKW A;  1Z8X A;  1R43 A;  4JYW A;  4UF4 A;  5K8N A;  5I4M A;  3KGQ A;  4ZYQ A;  1R3N A;  1Z5R A;  4M6G A;  4MMO A;  3TOA A;  4B6Z A;  3LMS A;  4KUA A;  2OH1 A;  3G8W A;  1KUY A;  2XEF A;  3DR8 A;  4WJB A;  5G20 A;  3SI1 A;  4ZY1 A;  4HPS A;  1ZG9 A;  4KOU A;  4M6H A;  2C1C A;  4NGM A;  3JUW A;  3W91 A;  4AG9 A;  2YNE A;  3SJX A;  1LFW A;  2BEI A;  1YLE A;  1AYE A;  4R7M A;  2Z3O A;  4R6T A;  4R87 A;  1LAM A;  4AXV A;  4CS0 B;  4M6I A;  4ZY2 A;  1VIX A;  3PP9 A;  4CRZ B;  1S7L A;  1XMB A;  4ZX9 A;  5HMN A;  1QMU A;  2P0W A;  3I3G A;  1BPN A;  4AVB A;  1P0H A;  3CPA A;  4PXD A;  4C68 A;  5K8M A;  3K9T A;  5K8P A;  3BLN A;  4I49 A;  4NFR A;  6CPA A;  1AMP A;  5F48 A;  1A2Z A;  2REE A;  3B35 A;  2WYR A;  3T8W A;  2V8D A;  3B2Y A;  4MFJ A;  5H84 A;  1ELM P;  1OBR A;  2ABZ A;  3FF3 A;  2FIW A;  3BI1 A;  3FXT A;  3JRU A;  4PXC A;  2PJ2 A;  4ZBG A;  5CNP A;  1IOI A;  4F9V A;  3CDX A;  4Z65 A;  4ZI6 A;  4CYP A;  3PEI A;  2O53 A;  4UFW A;  1ARL A;  4U9Z A;  2C6G A;  3KL9 A;  2PRQ A;  1Y7R A;  5C88 A;  4MXU A;  4MHP A;  2R8V A;  3IFE A;  2ZEM A;  5LRG A;  2CXA A;  2ZW7 A;  2PJ1 A;  5JH9 A;  3HLP A;  1PCA A;  2KCW A;  5EBV A;  1NSA A;  4UWI A;  4KOX A;  2ANP A;  2PJC A;  4EWT A;  1IYK A;  1S7N A;  1Z4R A;  1UFH A;  2CF4 A;  3W6X A;  1BPM A;  4B14 A;  1Z8L A;  3IIB A;  4PSW A;  4UCP A;  3KQX A;  3TO7 A;  4O23 A;  1KUX A;  2OZG A;  3EY5 A;  3D3S A;  4C7H A;  3B8G A;  4MHN A;  4A2Z A;  4MHD A;  5IB9 A;  4IUS A;  3R9E A;  4KZT A;  2C27 A;  4CGP A;  4HNY B;  4ZX8 A;  3IWE A;  4CGO A;  1YW6 A;  4PPZ A;  2FS5 A;  1I21 A;  2ARH A;  2CNM A;  3I9S A;  2I3C A;  3S6F A;  3V38 A;  1QSN A;  1CP7 A;  4GXH A;  3CPX A;  4NF1 A;  4Q36 A;  3B3T A;  2EBJ A;  3IC1 A;  4TNU A;  5GCN A;  3DLJ A;  3VH9 A;  2Q4Z A;  3B3W A;  3MRU A;  3PGP A;  4H2K A;  4RS2 A;  3D68 A;  4UFV A;  1AUG A;  1M4I A;  3D7G A;  2F7V A;  4MFP A;  5F47 A;  5A27 A;  3RO0 A;  3BXM A;  4C2Z A;  2CY2 A;  2PJ3 A;  1TKF A;  3FEC A;  5DWM A;  2BUE A;  3S6H A;  3TTH A;  4R57 A;  2ZEG A;  2ZEL A;  3KZW A;  1QSM A;  1F2P A;  3FMC A;  4XPL A;  2Q04 A;  3NH5 A;  5J8F A;  4UEZ A;  4BBH A;  2QYV A;  3D8P A;  3UY5 A;  4A30 A;  3B3C A;  4B5P A;  1XOV A;  2CIJ A;  4JZ0 A;  3TX8 A;  4OLL A;  4B12 A;  1BO4 A;  2FVG A;  3FEE A;  4H89 A;  3IU1 A;  2J8N A;  1XFO A;  3PRT A;  2J8M A;  5EMI A;  3IEH A;  2WZN A;  5HVF A;  2HB6 A;  3T9Y A;  3V7Z A;  4F0Y A;  1IB1 E;  2ATR A;  2I00 A;  3P2H A;  3RZA A;  5AG4 A;  4WWV A;  5JGF A;  5H86 A;  3F5B A;  3PB4 X;  1Y0R A;  3EXN A;  2P6F A;  3TOB A;  4RI1 A;  4CAF A;  2B4D B;  5IB0 A;  2EVN A;  3BI0 A;  3DR6 A;  1BOB A;  1VHO A;  3N7Z A;  3R9G A;  2V8H A;  1IYL A;  2PJ4 A;  4HNX B;  4NGN A;  3FJU A;  4A95 A;  4YFJ A;  1KUV A;  4ZY0 A;  5K8O A;  4CYN A;  5CPA A;  1LOK A;  4MCP A;  4CYQ A;  4KLV A;  3ZJ0 A;  1J4J A;  1VHS A;  4L89 A;  1Q2C A;  1X12 A;  2PJ5 A;  1XMT A;  1M1D A;  2O28 A;  2AFW A;  2B58 A;  4QC6 A;  4A38 A;  3SJE A;  3PB7 X;  2PJ6 A;  1ZG7 A;  3SHP A;  2Q43 A;  3S9N A;  2HUZ A;  2FSR A;  3FED A;  4H6U A;  3JVN A;  3R1K A;  4QUS A;  2PVW A;  4JD6 A;  2NYQ A;  3DSB A;  2QVP A;  2Q4Y A;  2VEZ A;  4EME A;  5THW A;  1PU9 A;  3FYN A;  4MRI A;  1Y9W A;  4KOY A;  4AG7 A;  2ZXV A;  1NE9 A;  1ZLI A;  4X2T A;  4DYO A;  1LAP A;  2IMO A;  4NEX A; 
#chains in the Genus database with same CATH homology
 4A31 A;  3TO6 A;  1XIX A;  1I1D A;  2EUI A;  2VBQ A;  2BL1 A;  2PC1 A;  3SXN A;  3S6G A;  2G3T A;  2WPX A;  1B87 A;  3NE7 A;  4K30 A;  4F6A A;  2PR8 A;  5F49 A;  2R7H A;  1S7F A;  4ZGY B;  4CYO A;  3GKR A;  2HV2 A;  4CAV A;  1VKC A;  4L8A A;  1YX0 A;  4CRY B;  3GY9 A;  2JDD A;  2IL4 A;  4M85 A;  2CNS A;  4CGM A;  1S60 A;  5G22 A;  3FNC A;  3C26 A;  2PR1 A;  5AG7 A;  2Z10 A;  4E2A A;  3MGD A;  3RYO A;  3TCV A;  1U6M A;  2REF A;  1WK4 A;  4C2X A;  2FT0 A;  4JXR A;  3IWG A;  4PK3 A;  5G21 A;  4KOV A;  2K5T A;  3QB8 A;  2VI7 A;  1QSO A;  2X7B A;  4Y49 B;  2DPT A;  2PQ8 A;  4QB9 A;  2GIV A;  4X5K A;  4QVT A;  2WUU A;  3GYA A;  4MFZ A;  2FIA A;  2Z3N A;  2B3U A;  2ZW4 A;  2ZW5 A;  5AG5 A;  1QSR A;  1NMT A;  2VZY A;  4E8O A;  3EC4 A;  1MJ9 A;  2OZH A;  1YVK A;  4Y49 C;  5AGE A;  4B10 A;  3TE4 A;  2YND A;  2H5M A;  2OU2 A;  4MJ8 A;  2A4N A;  1RXT A;  4F0X A;  2GAN A;  4KOT A;  5A28 A;  1MK4 A;  3T90 A;  2FCK A;  4JXQ A;  1YGH A;  3D2M A;  4A32 A;  2Z3L A;  4FD5 A;  4HNW B;  3FB3 A;  2B4D A;  1Z9U A;  5E96 A;  5I0C A;  5J8C A;  1XF8 A;  1XEB A;  4UA3 A;  2ZW6 A;  1Z4E A;  4AB7 A;  2D4O A;  4FD4 A;  3P2F A;  3OWC A;  3JTK A;  1YVO A;  4JJX A;  4LX9 A;  1R57 A;  5FVJ A;  4XPK A;  3E0K A;  2QEC A;  1CM0 A;  3CXQ A;  2B4B A;  1S5K A;  1M44 A;  2Q0Y A;  4C7I A;  4Q38 A;  4QBJ A;  1KZF A;  2DPS A;  3CXS A;  3IU2 A;  4KVO E;  4NSQ A;  2CNT A;  1CJW A;  4FD7 A;  2P6E A;  3WR7 A;  1PUA A;  2YGW A;  4MY3 A;  1B6B A;  2WSA A;  3EO4 A;  4KOS A;  5EC4 A;  2FL4 A;  1K4J A;  3F8K A;  1Y9K A;  4CGN A;  2VZZ A;  5JPH A;  3FBU A;  2PRB A;  4KLW A;  3TT2 A;  5BWA B;  2B3V A;  5DWN A;  2YNC C;  2B5G B;  3BJ8 A;  3K9U A;  4CAW A;  4E0A A;  5ISV A;  2QML A;  2HQY A;  4KVX A;  3FRM A;  4ONU A;  2AE6 A;  1LRZ A;  5IV0 A;  1TIQ A;  2RC4 A;  3F0A A;  3SXO A;  4R9M A;  4UWJ A;  4CGL A;  2J8R A;  4KSA A;  4KS9 A;  2I79 A;  3DDD A;  4XNH B;  1Q2Y A;  1RO5 A;  4A33 A;  1GHE A;  4LUA A;  5KTC A;  2R98 A;  2OZU A;  4GS4 A;  4JWP A;  2JEV A;  3DNS A;  1Q2D A;  3LOD A;  4U9Y A;  4OAD A;  3G3S A;  4UFX A;  1SQH A;  4PK2 A;  2Z3M A;  4JLY A;  1S3Z A;  2FXF A;  4XNH C;  1QST A;  4AVC A;  1M4G A;  1V0C A;  1YR0 A;  3VWE A;  4KOW A;  4YRH A;  2NMT A;  1YRE A;  4YGO A;  4ORF A;  1P4N A;  2PDO A;  2Z3K A;  4DNC A;  3W6S A;  3EFA A;  4B5O A;  1XE4 A;  4PSX A;  4MFL A;  3A9L A;  3R96 A;  4KOR A;  1NSL A;  3PZJ A;  5IX3 A;  1IID A;  2Z11 A;  1M4D A;  3TFY A;  1MJA A;  4NCZ A;  2Q7B A;  1I12 A;  2JLM A;  4IF5 A;  3S6K A;  2Z0Z A;  2VQY A;  1L0C A;  4UCM A;  1ON0 A;  3CXP A;  4MBU A;  1FY7 A;  4BMH A;  3ZZI A;  2D4P A;  2QIR A;  1N71 A;  4KSF A;  3BJ7 A;  2G3A A;  1OZP A;  4B11 A;  4MI4 A;  5KTD A;  4OAE A;  1S7K A;  4PV6 A;  3R95 A;  2AJ6 A;  4II9 A;  2DXQ A;  2YNC A;  3TO9 A;  4C2Y A;  4XPD B;  3VWD A;  3FIX A;  4B13 A;  5JQ4 A;  1WWZ A;  2GE3 A;  2WPW A;  4R3K A;  3IGR A;  1ZO0 A;  5KTA A;  3QAH A;  3D2P A;  1YK3 A;  2B5G A;  4MFK A;  2F5I A;  4XPD C;  2JDC A;  4M3S A;  2P6G A;  4KUB A;  5F46 A;  4CAE A;  4NXY A;  4CAX A;  2Q44 A;  2VXK A;  4UBR A;  4FD6 A;  5HH1 A;  1MJB A;  2Z3P A;  4MFQ A;  2FE7 A;  2G0B A;  4J3G A;  5G1Z A;  5AG6 A;  3V8I A;  4UCN A;  2BSW A;  4B5P B;  1IIC A;  2PSW A;  2R1I A;  4R3L A;  5C82 A;  4KVM E;  2OB0 A;  2Y0M A;  4H6Z A;  4AVA A;  3H4Q A;  4U5Y A;  4HKF A;  2ZPA A;  3R9F A;  2Q4V A;  4EVY A;  3LD2 A;  3H5Z A;  4MY0 A;  3KKW A;  3TOA A;  4KUA A;  2OH1 A;  3G8W A;  1KUY A;  3DR8 A;  5G20 A;  4KOU A;  3W91 A;  4AG9 A;  3JUW A;  2YNE A;  2BEI A;  1YLE A;  2Z3O A;  4R87 A;  4CS0 B;  3PP9 A;  4CRZ B;  1S7L A;  5HMN A;  2P0W A;  3I3G A;  4AVB A;  1P0H A;  4C68 A;  3BLN A;  4I49 A;  5F48 A;  2REE A;  4MFJ A;  5H84 A;  2FIW A;  3FXT A;  4ZBG A;  5CNP A;  4CYP A;  4UFW A;  4U9Z A;  1Y7R A;  5C88 A;  2R8V A;  2CXA A;  2ZW7 A;  2KCW A;  5EBV A;  4UWI A;  4KOX A;  1IYK A;  1S7N A;  1Z4R A;  1UFH A;  3W6X A;  4B14 A;  4PSW A;  4UCP A;  3TO7 A;  1KUX A;  2OZG A;  3EY5 A;  3D3S A;  4C7H A;  3B8G A;  4A2Z A;  4MHD A;  4IUS A;  3R9E A;  4KZT A;  2C27 A;  4CGP A;  4HNY B;  3IWE A;  4CGO A;  2FS5 A;  1I21 A;  2ARH A;  2CNM A;  3I9S A;  3S6F A;  1QSN A;  4Q36 A;  4NF1 A;  5GCN A;  4RS2 A;  3PGP A;  4UFV A;  1M4I A;  4MFP A;  5F47 A;  5A27 A;  4C2Z A;  2CY2 A;  5DWM A;  2BUE A;  3S6H A;  3TTH A;  4R57 A;  1QSM A;  4XPL A;  5J8F A;  2Q04 A;  4BBH A;  3D8P A;  3UY5 A;  4A30 A;  4B5P A;  4OLL A;  4B12 A;  1BO4 A;  4H89 A;  3IU1 A;  2J8N A;  2J8M A;  3T9Y A;  4F0Y A;  1IB1 E;  2ATR A;  2I00 A;  3P2H A;  5AG4 A;  5H86 A;  3F5B A;  3TOB A;  3EXN A;  2P6F A;  4RI1 A;  4CAF A;  2B4D B;  5IB0 A;  2EVN A;  3DR6 A;  1BOB A;  3R9G A;  3N7Z A;  1IYL A;  4HNX B;  4A95 A;  4YFJ A;  1KUV A;  4CYN A;  4CYQ A;  4KLV A;  3ZJ0 A;  1J4J A;  1VHS A;  4L89 A;  1Q2C A;  1XMT A;  1M1D A;  2O28 A;  2B58 A;  4QC6 A;  3SHP A;  2HUZ A;  2FSR A;  4H6U A;  3JVN A;  3R1K A;  4QUS A;  4JD6 A;  3DSB A;  2VEZ A;  2Q4Y A;  1PU9 A;  3FYN A;  1Y9W A;  4KOY A;  4AG7 A;  2ZXV A;  1NE9 A;  4NEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...