4CRYB

Direct visualisation of strain-induced protein post-translational modification
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title Direct Visualisation of Strain-Induced Protein Post-Translational Modification
rcsb
source organism Escherichia coli k-12
total genus 38
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cryB00
1M44A 3R1KA 1QSNA 3S6KA 4YFJA 1I1DA 3W6XA 1QSMA 4B5OA 4UBRA 4HNYB 3I9SA 3PGPA 5JPHA 2REEA 1I12A 1YREA 4PK2A 2B58A 1M4DA 4FD4A 5GCNA 2RC4A 2G0BA 2I79A 4OLLA 2CY2A 3EO4A 1Y7RA 3NE7A 2QIRA 1YK3A 2R7HA 4JLYA 5IX3A 4F0YA 2B4DA 4KVME 5F49A 2OZUA 5DWNA 4QB9A 1XF8A 2A4NA 3GY9A 5IV0A 2B4BA 2P0WA 1Y9KA 4RI1A 4YGOA 5KTCA 3BLNA 2BSWA 4AVCA 1XEBA 1MK4A 2FE7A 2HQYA 5EC4A 4NF1A 2WPWA 2Z11A 4AG7A 3EFAA 3IWGA 3W91A 2B3VA 2CNMA 4YRHA 4CAWA 3BJ7A 5C88A 2B5GB 5F48A 3K9UA 3FNCA 2OH1A 4KORA 1B6BA 4B5PB 2PDOA 3VWEA 1Z4RA 5C82A 1PU9A 3IGRA 5KTAA 2GE3A 3TE4A 1KUVA 5HMNA 5ISVA 4R3LA 1K4JA 3LD2A 4LX9A 3D8PA 1S5KA 1BOBA 4ORFA 4RS2A 2Q44A 3C26A 1QSRA 2PSWA 4IF5A 4II9A 2PQ8A 4OAEA 4Y49B 3I3GA 1XIXA 2BEIA 1V0CA 4GS4A 4R9MA 1RXTA 4XPKA 2FL4A 4F6AA 2ZPAA 3CXPA 3PZJA 4KVOE 2FT0A 3DSBA 2HUZA 3JUWA 4HNXB 4HNWB 2QMLA 1RO5A 2D4OA 3PP9A 4KOVA 2FCKA 4B5PA 4Y49C 1XE4A 3R9GA 5I0CA 2OZGA 5CNPA 1Z4EA 1Z9UA 1NE9A 4KUBA 3RYOA 4E0AA 4KOUA 1M4GA 2ZW7A 4U9YA 4EVYA 1IICA 2P6EA 4QUSA 4M3SA 2D4PA 2JLMA 1IYLA 2OB0A 2VQYA 4UA3A 3ZZIA 1YX0A 1I21A 1P0HA 4IUSA 3GKRA 3FIXA 2VBQA 5J8CA 1Q2YA 2Y0MA 1U6MA 1MJAA 4FD5A 4KOTA 4JXQA 3N7ZA 2K5TA 2H5MA 4R57A 3TOAA 3DR6A 4AVBA 2ZXVA 1BO4A 1M1DA 3F8KA 2VEZA 2P6GA 1CJWA 3TT2A 2OU2A 2QECA 1WWZA 3D3SA 2Q4VA 5F47A 2VXKA 1MJBA 5H86A 4KZTA 4UWJA 4KOWA 4CRZB 2I00A 2BL1A 4MBUA 2FIAA 1UFHA 1YVKA 1MJ9A 2WPXA 1VHSA 2FIWA 2Q04A 3CXQA 4MY3A 4CS0B 1YLEA 4LUAA 2VZZA 3F5BA 4CRYB 4MJ8A 2DXQA 1OZPA 1S7KA 3R9FA 4AVAA 1YVOA 1S3ZA 1IYKA 4KVXA 5FVJA 2FXFA 4X5KA 4AG9A 1YGHA 4PSWA 4KUAA 1KUYA 3FBUA 3FRMA 2Z10A 4MY0A 3TTHA 5H84A 4ZBGA 2X7BA 3FB3A 4DNCA 1QSTA 3MGDA 2GANA 1FY7A 4H6ZA 2FS5A 3W6SA 5JQ4A 5IB0A 3WR7A 2VZYA 1QSOA 2J8RA 3LODA 2R98A 1TIQA 2B5GA 1S7LA 4QBJA 3EC4A 4ONUA 2R1IA 2IL4A 3G3SA 4JJXA 4NXYA 4JXRA 4CAXA 2PRBA 1XMTA 3SHPA 4KOSA 1WK4A 3DDDA 3TCVA 4BMHA 2ZW4A 2CNSA 3FYNA 2GIVA 2EVNA 3R9EA 4KLVA 2VI7A 2ATRA 4M85A 2Z0ZA 2Q7BA 3JVNA 4XPDB 5J8FA 3TFYA 5HH1A 4QC6A 2REFA 2PC1A 1NSLA 4HKFA 1CM0A 3H4QA 3GYAA 1Q2DA 4L8AA 4E2AA 4L89A 4R3KA 3T9YA 4XPDC 2Q4YA 3TO6A 4XPLA 2JDDA 5KTDA 4UWIA 4PSXA 1L0CA 3F0AA 3KKWA 4AB7A 3ZJ0A 2R8VA 3B8GA 4OADA 4I49A 4FD6A 2J8NA 1IIDA 4NSQA 2ZW5A 3QB8A 3S6HA 2OZHA 3CXSA 3SXOA 1S7FA 2PR1A 4U9ZA 2PR8A 3VWDA 1P4NA 2BUEA 4QVTA 3P2FA 3V8IA 3E0KA 4J3GA 1Q2CA 3R96A 4JWPA 4PV6A 2NMTA 2Q0YA 4KLWA 3S6FA 2AJ6A 1J4JA 2EUIA 2KCWA 1S7NA 4H89A 3TOBA 4K30A 1YR0A 3T90A 1LRZA 1N71A 4NEXA 2G3AA 2CNTA 5E96A 1PUAA 1M4IA 3D2MA 2ARHA 1IB1E 2JDCA 3P2HA 1ON0A 1Y9WA 2AE6A 2JEVA 3TO7A 1KUXA 4R87A 2O28A 2B3UA 4FD7A 4NCZA 1SQHA 4U5YA 4XNHB 2J8MA 2F5IA 4MI4A 3EXNA 1B87A 3EY5A 3TO9A 2G3TA 2HV2A 3FXTA 4KOXA 1NMTA 4E8OA 1GHEA 2P6FA 4MHDA 3G8WA 2ZW6A 1R57A 4XNHC 1KZFA 3DR8A 3S6GA 4JD6A 2B4DB 3OWCA 4PK3A 3D2PA 5DWMA 3DNSA 1VKCA 3QAHA 3UY5A 2C27A 5EBVA 4CAVA 4H6UA 5F46A 4KOYA 3SXNA 3BJ8A 1S60A 3R95A 2FSRA
chains in the Genus database with same CATH superfamily
3D68A 1M44A 5LYLA 3R1KA 1QSNA 2PJ8A 3S6KA 2C6PA 1I1DA 1ARMA 3D4UA 3S9MA 3W6XA 4YFJA 1QSMA 4B5OA 4X8IA 4UBRA 4HNYB 4Z65A 3I9SA 3KR4A 4B13A 5JM6A 3PGPA 5JPHA 4C2YA 2REEA 4BBHA 1I12A 2FVGA 2YNDA 1YREA 4PK2A 2B58A 5CPAA 1M4DA 1CP7A 4FD4A 2OR4A 3NH4A 2XEIA 5GCNA 1Y7EA 4OIWA 3K2KA 4MCPA 1BPNA 2RC4A 2G0BA 1IY7A 2PE3A 4AXVA 4FBEA 4A30A 2I79A 4OLLA 2QJ8A 2CY2A 3EO4A 1Y7RA 2POKA 3NE7A 2QIRA 2DF5A 4TNUA 1YK3A 2R7HA 3IO1A 2PJ5A 4JLYA 1H8LA 3FX6A 4F0YA 2BCOA 5IX3A 2B4DA 4UEEA 4DUKA 2ZEGA 4KVME 5F49A 4A38A 4A95A 3SJXA 4ZY0A 2OZUA 2DPTA 2GREA 3QAYA 5DWNA 4PQAA 4QB9A 1R43A 1Y0YA 3BI1A 2EO8A 4NFRA 3D7FA 1XF8A 3L2NA 2A4NA 3GY9A 3JTKA 3B3CA 2B4BA 2ZEDA 5IV0A 1CPSA 2P0WA 1Y9KA 3KASA 4RI1A 4YGOA 5KTCA 3BLNA 2QVPA 3B3SA 4MHZA 2BSWA 2O4HA 2JBKA 1XEBA 1MK4A 1CX8A 2FE7A 2HQYA 2PJAA 3PEIA 4NF1A 2WPWA 4WJBA 2AFSA 5EC4A 4CYQA 3SJFA 5LRKA 4P4IA 3S9LA 1YMEA 2Z11A 4AG7A 2JBJA 2PJCA 3EFAA 1QMUA 3IWGA 2RFHA 3W91A 2B3VA 3H8FA 2CNMA 4YRHA 1TKHA 2AFUA 4CAWA 4NGRA 3BJ7A 1ZLHA 4OMEA 3IU2A 5C88A 2AFWA 2B5GB 2WSAA 4UCPA 3K9UA 5F48A 3FNCA 2OH1A 1YW4A 3IEHA 4KORA 2YNCC 2ZEPA 1B6BA 3RBUA 4B5PB 3KR5A 2PVWA 2ABZA 2PDOA 3VWEA 3S9NA 5K8NA 4X2TA 3SI2A 4UFWA 1Z4RA 3B3TA 4MFZA 4P4BA 5C82A 1PU9A 1XOVA 3BI0A 2Z3KA 3FMCA 4X3RA 1ZG9A 4B14A 1ZO0A 3IGRA 2OOTA 2HB6A 5KTAA 2GE3A 3FH4A 4P6YA 3TE4A 1KUVA 4O23A 5HMNA 2ZEOA 4UCNA 4R3LA 5ISVA 2V8DA 1K4JA 1Y0RA 1F2OA 2V8GA 3LD2A 4MCQA 4LX9A 4M6HA 4R7MA 2HC9A 3RZAA 1JWQA 3D8PA 1S5KA 1BOBA 4W9YA 4CGPA 2O53A 5K8MA 4G1PA 4ORFA 4RS2A 2Q44A 3C26A 1QSRA 1R3NA 2PSWA 2PJ6A 2PQ8A 2Z3PA 2ZOGA 4IF5A 4OAEA 4II9A 4Y49B 3GIUA 3I3GA 4MRIA 5A27A 1XIXA 2BEIA 4ZX9A 1V0CA 4EMEA 4PPZA 2YNEA 5LRGA 2PJ9A 2CIJA 4GS4A 1JQGA 1TF9A 4R9MA 4CYPA 1RXTA 4XPKA 2FL4A 4CGLA 1HDUA 4F6AA 2ZPAA 3HUVA 3GUXA 4R8FA 3RAMA 3CXPA 1YSJA 3KHZA 2FT0A 3PZJA 3DSBA 4KVOE 2HUZA 3JUWA 3NH8A 4JZ0A 4HNXB 1Z8XA 4HNWB 2QMLA 4ONWA 4RN7A 1RO5A 1VIXA 2D4OA 3PP9A 2BO9A 3KZWA 4MFPA 1IGBA 4NGPA 4UEFA 2Z3MA 4KOVA 2FCKA 4B5PA 4Y49C 3GLJA 1Q7LA 1XE4A 3R9GA 5I0CA 2QYVA 1ZG7A 1ARLA 2OZGA 5CNPA 1Z4EA 1Z9UA 3KQXA 4C7HA 1NE9A 4KUBA 4PXBA 2PJBA 4BINA 2JEWA 3RYOA 4A2ZA 4E0AA 4KOUA 4CYNA 3IWWA 1M4GA 3B2YA 1TF8A 2F7VA 2C1CA 2ZW7A 4U9YA 4EVYA 4NGQA 1IICA 2AFZA 3RO0A 2P6EA 4QUSA 4M3SA 2D4PA 4MFJA 1Z5RA 2JLMA 3FVLA 1IYLA 3FECA 1UWYA 2IJZA 2OB0A 2VQYA 3PFOA 4MCSA 4PXEA 4IK2A 4UA3A 4F8ZA 4A33A 3T8WA 4BD9A 3ZZIA 1YX0A 4P45A 1I21A 1P0HA 3WABA 3WC5A 4CGOA 2GU2A 4UEZA 4FUUA 4IUSA 4HPSA 5IB9A 2GLJA 3GKRA 5LYFA 3FIXA 2BOAA 2ZOFA 2VBQA 2IQ6A 2RB7A 4FWUA 5J8CA 1Q2YA 3LWUA 2Y0MA 3CPXA 3DGVA 1U6MA 1MJAA 2G9DA 4FD5A 4KOTA 4JXQA 4MMOA 3N7ZA 2AFMA 2K5TA 4MHPA 7CPAA 2H5MA 3SI1A 4R57A 3TOAA 3SJGA 5K8OA 3DR6A 4AVBA 2IMOA 4IAVA 2ZXVA 2ZENA 1BO4A 1M1DA 5AG6A 3TX8A 3F8KA 4EWTA 2VEZA 1BAVA 1Z8LA 5LYDA 2P6GA 3KL9A 1CJWA 3TT2A 4ZYQA 2OU2A 4OP4A 2QECA 1WWZA 1ELLP 2EBJA 2Q4VA 3D3SA 3WT4A 5F47A 4YU9A 2VXKA 6CPAA 1MJBA 4NGSA 5H86A 4KZTA 4OC3A 4UWJA 4WWVA 4KOWA 4CRZB 4F0XA 2I00A 4LQGA 2BL1A 1A2ZA 4MBUA 5G22A 2FIAA 1QQ9A 1UFHA 3WC6A 2F8HA 1YVKA 3FJUA 1CG2A 1MJ9A 2EWBA 1VHSA 2WPXA 5LRJA 4UF4A 5HVGA 5AGEA 2FIWA 2WYRA 3I1UA 1AUGA 2Q04A 3CXQA 1TKJA 3FEEA 1TKFA 4MY3A 5EMIA 4CS0B 3PFEA 1YLEA 2AFXA 3H8GA 4LUAA 1TXRA 2VZZA 3F5BA 3CDXA 4CRYB 1OBRA 1Z2LA 2DXQA 4M6GA 4MJ8A 1OZPA 4F9UA 1S7KA 3CZXA 4UFVA 4ZX8A 3R9FA 4AVAA 1YVOA 1S3ZA 1IYKA 3BXMA 4KVXA 5FVJA 5G21A 2FXFA 3B3WA 4X5KA 4AG9A 5JH9A 1YGHA 4PSWA 4C68A 4KUAA 2C6GA 1KUYA 2V77A 3FBUA 3FRMA 1LFWA 2Z10A 4A39A 4NGMA 2WUUA 2DPSA 4UCMA 2CTCA 3D66A 4MY0A 3TTHA 3V7ZA 5H84A 2YNCA 2ODFA 4ZBGA 3WC7A 1IU8A 2X7BA 3FB3A 3CT9A 1QSTA 4DNCA 4MFQA 3MGDA 2GANA 5HVFA 1FY7A 4PXCA 4MHYA 4H6ZA 5AG4A 2FS5A 3W6SA 5JQ4A 5IB0A 3WR7A 2VZYA 4MCRA 4KSFA 5G20A 2PCUA 3IU1A 1QSOA 5JGFA 2Q43A 4M6IA 2J8RA 3LODA 4Q38A 1LAPA 2ZEHA 3ISZA 2R98A 1TIQA 4CGNA 2ZEFA 3DLJA 2B5GA 5D29A 1S7LA 4QBJA 3EC4A 1M4LA 4Q36A 4ONUA 2R1IA 1VGYA 2IL4A 4EFDA 3KGQA 4R76A 1XRYA 3G3SA 4JJXA 4NXYA 4P10A 4JXRA 4CAXA 2PRBA 1XMTA 3SHPA 1CPXA 4KOSA 1WK4A 3BHXA 3IC1A 4NJRA 1GYTA 3DDDA 3PB8X 3JRUA 3TCVA 3V38A 4BMHA 2ZW4A 2CNSA 4CAFA 1ZG8A 1PYTB 4OC2A 3FYNA 4A94A 4DJLA 2GIVA 4RUHA 2EVNA 4GXHA 3R9EA 2WZNA 4A32A 4KLVA 2VI7A 1YLOA 2ATRA 3KQZA 4OIDA 4M85A 4MFKA 2PJ0A 2ANPA 4OC1A 3NA6A 1EE3P 2Z0ZA 2Q7BA 1DE4C 1F2PA 3JVNA 3KHXA 4XPDB 5J8FA 3TFYA 5HH1A 3A9LA 3H8EA 3D7DA 3PBBA 4B6ZA 4QC6A 3PRTA 2REFA 1BLLE 5I4MA 2PC1A 1NSLA 4HKFA 1VHEA 1CM0A 3NH5A 3IFEA 4NGTA 4ZI6A 3H4QA 3GYAA 8CPAA 2CF4A 1F57A 4UIAA 1Q2DA 3HLPA 3VARA 3IWEA 1CBXA 1LAMA 4L8AA 4E2AA 2C6CA 3VH9A 4CYOA 4L89A 4R3KA 3T9YA 4XPDC 2Q4YA 4PXDA 5A28A 2XEFA 3TO6A 3CPAA 4XPLA 2JDDA 1HEEA 3D7HA 5KTDA 1XMBA 4UWIA 4PSXA 1AMPA 2PJ2A 1L0CA 3MN8A 4KS9A 4ZY2A 3TC8A 4UFXA 3F0AA 3PB9X 5D8NA 3KKWA 1LANA 3B35A 3SJEA 4C2ZA 1LOKA 4H2KA 4AB7A 1ZLIA 2XEJA 2NYQA 2R8VA 3B8GA 4OADA 4KSIA 2V8HA 3ZJ0A 2ZELA 4OC5A 4MHNA 3B3VA 4P44A 4P4DA 4LQ6A 3VATA 4I49A 4FD6A 2J8NA 5F09A 1IIDA 4NSQA 2ZW5A 2Q4ZA 3QB8A 3S6HA 2OZHA 1HDQA 3CXSA 3SXOA 4P4FA 3PB7X 1S7FA 1ELMP 5K8PA 2PR1A 2PJ1A 4U9ZA 2EK8A 1CP6A 2PR8A 5LYIA 3VWDA 3PBEA 4C2XA 4F9VA 2DEAA 5G1ZA 1P4NA 1IOIA 2AFOA 2BUEA 4QVTA 3P2FA 3V8IA 3E0KA 4J3GA 1FNOA 1Q2CA 3R96A 2PIZA 4JWPA 3FF3A 4GM5A 3IJ3A 1PCAA 2ZEMA 4NJQA 4TWEA 4PV6A 3H5ZA 2NMTA 1XBUA 2I3CA 2Q0YA 4KLWA 4JYWA 1YW6A 3QNVA 4CGMA 3S6FA 2AJ6A 3IIBA 4B12A 2EK9A 1J4JA 2EUIA 2KCWA 1S7NA 2GLFA 4H89A 2PVVA 3TOBA 1XFOA 1X10A 4YWYA 5DS0A 4K30A 1YR0A 1YQEA 3T90A 1XJOA 3B7IA 3ISXA 1AYEA 4CAEA 3GB0A 4AVCA 1LRZA 1N71A 1Z8TA 1FT7A 2Z3NA 5THWA 4NEXA 4P4EA 2NSMA 2G3AA 2CNTA 2PRQA 5E96A 4B11A 1PUAA 3RNZA 3N5FA 2GFQA 4C7IA 4ZGYB 1M4IA 3D2MA 2ARHA 2PJ4A 3PB4X 4ZY1A 5CBMA 1IB1E 2JDCA 4P4JA 3P2HA 4FAIA 5AG5A 4B10A 1ON0A 1Y9WA 2AE6A 2JEVA 3TO7A 3K9TA 1KUXA 3MRUA 4OC0A 4R87A 2O28A 2B3UA 4FD7A 4NCZA 1SQHA 4U5YA 4XNHB 1VHOA 2CTBA 2V8VA 2CXAA 2J8MA 2XEGA 1BPMA 4MXUA 3PB6X 2F5IA 4UIBA 2Z3LA 4MI4A 2PIYA 3EXNA 5BWAB 3NFZA 1B87A 3EY5A 3TO9A 2G3TA 1Z8WA 3D7GA 2HV2A 1RTQA 1IOFA 3FXTA 4KOXA 4R6TA 1NMTA 2YGWA 4E8OA 1GHEA 2P6FA 2VL1A 4Q7AA 4MHDA 2PJ3A 3G8WA 2ZW6A 1R57A 2ZEEA 1LCPA 2Q7SA 2Z3OA 2Q51A 5AG7A 3LMSA 4XNHC 1KZFA 3DR8A 3S6GA 4JD6A 5HVHA 2B4DB 3OWCA 4PK3A 5HXDA 4NGNA 3D67A 5ELYA 4DYOA 3D2PA 1X12A 3DNSA 5DWMA 1VKCA 3QAHA 3UY5A 4A31A 4OKOA 2C27A 2PJ7A 1DTDA 5EBVA 4CAVA 4CPAA 5J1QA 3LACA 3KI9A 4H6UA 4KSAA 3SI0A 2J9AA 1KWMA 4IHMA 5F46A 4K3NA 4KOYA 3SXNA 3BJ8A 4OC4A 4MFLA 1NSAA 4A37A 1S60A 3NE8A 3R95A 2FSRA 3FEDA
chains in the Genus database with same CATH topology
1M44A 3R1KA 1QSNA 3S6KA 4YFJA 1I1DA 3W6XA 1QSMA 4B5OA 4UBRA 4HNYB 3I9SA 4B13A 3PGPA 5JPHA 2REEA 4BBHA 1I12A 2YNDA 1YREA 4PK2A 2B58A 1M4DA 4FD4A 5GCNA 2RC4A 2G0BA 4A30A 2I79A 4OLLA 2CY2A 3EO4A 1Y7RA 3NE7A 2QIRA 1YK3A 2R7HA 4JLYA 5IX3A 4F0YA 2B4DA 4KVME 5F49A 4A95A 2OZUA 2DPTA 5DWNA 4QB9A 1XF8A 2A4NA 3GY9A 3JTKA 5IV0A 2B4BA 2P0WA 1Y9KA 4RI1A 4YGOA 5KTCA 3BLNA 2BSWA 4AVCA 1XEBA 1MK4A 2FE7A 2HQYA 5EC4A 4NF1A 4CYQA 2WPWA 2Z11A 4AG7A 3EFAA 3IWGA 3W91A 2B3VA 2CNMA 4YRHA 4CAWA 3BJ7A 3IU2A 5C88A 2B5GB 2WSAA 4UCPA 3K9UA 5F48A 3FNCA 2OH1A 4KORA 2YNCC 1B6BA 4B5PB 2PDOA 3VWEA 4UFWA 1Z4RA 4MFZA 5C82A 1PU9A 2Z3KA 4B14A 1ZO0A 3IGRA 5KTAA 2GE3A 3TE4A 1KUVA 5HMNA 4UCNA 4R3LA 5ISVA 1K4JA 3LD2A 4LX9A 3D8PA 1S5KA 1BOBA 4CGPA 4ORFA 4RS2A 2Q44A 3C26A 1QSRA 2PSWA 4IF5A 2Z3PA 2PQ8A 4OAEA 4II9A 4Y49B 3I3GA 5A27A 1XIXA 2BEIA 1V0CA 2YNEA 4GS4A 4R9MA 4CYPA 1RXTA 4XPKA 2FL4A 4CGLA 4F6AA 2ZPAA 3CXPA 3PZJA 4KVOE 2FT0A 3DSBA 2HUZA 3JUWA 4HNXB 4HNWB 2QMLA 1RO5A 2D4OA 3PP9A 4MFPA 2Z3MA 4KOVA 2FCKA 4B5PA 4Y49C 1XE4A 3R9GA 5I0CA 2OZGA 5CNPA 1Z4EA 1Z9UA 4C7HA 1NE9A 4KUBA 3RYOA 4A2ZA 4E0AA 4KOUA 4CYNA 1M4GA 2ZW7A 4U9YA 4EVYA 1IICA 2P6EA 4QUSA 4M3SA 2D4PA 4MFJA 2JLMA 1IYLA 2OB0A 2VQYA 4UA3A 4A33A 3ZZIA 1YX0A 1I21A 1P0HA 4CGOA 4IUSA 3GKRA 3FIXA 2VBQA 5J8CA 1Q2YA 2Y0MA 1U6MA 1MJAA 4FD5A 4KOTA 4JXQA 3N7ZA 2K5TA 2H5MA 4R57A 3TOAA 3DR6A 4AVBA 2ZXVA 1BO4A 1M1DA 5AG6A 3F8KA 2VEZA 2P6GA 1CJWA 3TT2A 2OU2A 2QECA 1WWZA 3D3SA 2Q4VA 5F47A 2VXKA 1MJBA 5H86A 4KZTA 4UWJA 4KOWA 4CRZB 4F0XA 2I00A 2BL1A 4MBUA 5G22A 2FIAA 1UFHA 1YVKA 1MJ9A 2WPXA 1VHSA 5AGEA 2FIWA 2Q04A 3CXQA 4MY3A 4CS0B 1YLEA 4LUAA 2VZZA 3F5BA 4CRYB 4MJ8A 2DXQA 1OZPA 1S7KA 4UFVA 3R9FA 4AVAA 1YVOA 1S3ZA 1IYKA 4KVXA 5FVJA 5G21A 2FXFA 4X5KA 4AG9A 1YGHA 4PSWA 4C68A 4KUAA 1KUYA 3FBUA 3FRMA 2Z10A 2WUUA 2DPSA 4UCMA 4MY0A 3TTHA 5H84A 2YNCA 4ZBGA 2X7BA 3FB3A 4DNCA 1QSTA 4MFQA 3MGDA 2GANA 1FY7A 4H6ZA 5AG4A 2FS5A 3W6SA 5JQ4A 5IB0A 3WR7A 2VZYA 4KSFA 5G20A 3IU1A 1QSOA 2J8RA 3LODA 4Q38A 2R98A 1TIQA 4CGNA 2B5GA 1S7LA 4QBJA 3EC4A 4Q36A 4ONUA 2R1IA 2IL4A 3G3SA 4JJXA 4NXYA 4JXRA 4CAXA 2PRBA 1XMTA 3SHPA 4KOSA 1WK4A 3DDDA 3TCVA 4BMHA 2ZW4A 2CNSA 4CAFA 3FYNA 2GIVA 2EVNA 3R9EA 4A32A 4KLVA 2VI7A 2ATRA 4M85A 4MFKA 2Z0ZA 2Q7BA 3JVNA 4XPDB 5J8FA 3TFYA 5HH1A 3A9LA 4QC6A 2REFA 2PC1A 1NSLA 4HKFA 1CM0A 3H4QA 3GYAA 1Q2DA 3IWEA 4L8AA 4E2AA 4CYOA 4L89A 4R3KA 3T9YA 4XPDC 2Q4YA 5A28A 3TO6A 4XPLA 2JDDA 5KTDA 4UWIA 4PSXA 4KS9A 1L0CA 4UFXA 3F0AA 3KKWA 4C2ZA 4C2YA 4AB7A 3ZJ0A 2R8VA 3B8GA 4OADA 4I49A 4FD6A 2J8NA 1IIDA 4NSQA 2ZW5A 3QB8A 3S6HA 2OZHA 3CXSA 3SXOA 1S7FA 2PR1A 4U9ZA 2PR8A 3VWDA 4C2XA 5G1ZA 1P4NA 2BUEA 4QVTA 3P2FA 3V8IA 3E0KA 4J3GA 1Q2CA 3R96A 4JWPA 4PV6A 3H5ZA 2NMTA 2Q0YA 4KLWA 4CGMA 3S6FA 2AJ6A 4B12A 1J4JA 2EUIA 2KCWA 1S7NA 4H89A 3TOBA 4K30A 1YR0A 3T90A 4CAEA 1LRZA 1N71A 2Z3NA 4NEXA 4B11A 2G3AA 2CNTA 5E96A 1PUAA 4C7IA 4ZGYB 1M4IA 3D2MA 2ARHA 1IB1E 2JDCA 3P2HA 5AG5A 4B10A 1ON0A 1Y9WA 2AE6A 2JEVA 3TO7A 1KUXA 4R87A 2O28A 2B3UA 4FD7A 4NCZA 1SQHA 4U5YA 4XNHB 2CXAA 2J8MA 2F5IA 2Z3LA 4MI4A 5BWAB 3EXNA 1B87A 3EY5A 3TO9A 2G3TA 2HV2A 3FXTA 4KOXA 1NMTA 2YGWA 4E8OA 1GHEA 2P6FA 4MHDA 3G8WA 2ZW6A 1R57A 2Z3OA 5AG7A 4XNHC 1KZFA 3DR8A 3S6GA 4JD6A 2B4DB 3OWCA 4PK3A 3D2PA 5DWMA 3DNSA 1VKCA 3QAHA 3UY5A 4A31A 2C27A 5EBVA 4CAVA 4H6UA 4KSAA 5F46A 4KOYA 3SXNA 3BJ8A 4MFLA 1S60A 3R95A 2FSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M44 A;  3R1K A;  1QSN A;  3S6K A;  4YFJ A;  1I1D A;  3W6X A;  1QSM A;  4B5O A;  4UBR A;  4HNY B;  3I9S A;  3PGP A;  5JPH A;  2REE A;  1I12 A;  1YRE A;  4PK2 A;  2B58 A;  1M4D A;  4FD4 A;  5GCN A;  2RC4 A;  2G0B A;  2I79 A;  4OLL A;  2CY2 A;  3EO4 A;  1Y7R A;  3NE7 A;  2QIR A;  1YK3 A;  2R7H A;  4JLY A;  5IX3 A;  4F0Y A;  2B4D A;  4KVM E;  5F49 A;  2OZU A;  5DWN A;  4QB9 A;  1XF8 A;  2A4N A;  3GY9 A;  5IV0 A;  2B4B A;  2P0W A;  1Y9K A;  4RI1 A;  4YGO A;  5KTC A;  3BLN A;  2BSW A;  4AVC A;  1XEB A;  1MK4 A;  2FE7 A;  2HQY A;  5EC4 A;  4NF1 A;  2WPW A;  2Z11 A;  4AG7 A;  3EFA A;  3IWG A;  3W91 A;  2B3V A;  2CNM A;  4YRH A;  4CAW A;  3BJ7 A;  5C88 A;  2B5G B;  5F48 A;  3K9U A;  3FNC A;  2OH1 A;  4KOR A;  1B6B A;  4B5P B;  2PDO A;  3VWE A;  1Z4R A;  5C82 A;  1PU9 A;  3IGR A;  5KTA A;  2GE3 A;  3TE4 A;  1KUV A;  5HMN A;  5ISV A;  4R3L A;  1K4J A;  3LD2 A;  4LX9 A;  3D8P A;  1S5K A;  1BOB A;  4ORF A;  4RS2 A;  2Q44 A;  3C26 A;  1QSR A;  2PSW A;  4IF5 A;  4II9 A;  2PQ8 A;  4OAE A;  4Y49 B;  3I3G A;  1XIX A;  2BEI A;  1V0C A;  4GS4 A;  4R9M A;  1RXT A;  4XPK A;  2FL4 A;  4F6A A;  2ZPA A;  3CXP A;  3PZJ A;  4KVO E;  2FT0 A;  3DSB A;  2HUZ A;  3JUW A;  4HNX B;  4HNW B;  2QML A;  1RO5 A;  2D4O A;  3PP9 A;  4KOV A;  2FCK A;  4B5P A;  4Y49 C;  1XE4 A;  3R9G A;  5I0C A;  2OZG A;  5CNP A;  1Z4E A;  1Z9U A;  1NE9 A;  4KUB A;  3RYO A;  4E0A A;  4KOU A;  1M4G A;  2ZW7 A;  4U9Y A;  4EVY A;  1IIC A;  2P6E A;  4QUS A;  4M3S A;  2D4P A;  2JLM A;  1IYL A;  2OB0 A;  2VQY A;  4UA3 A;  3ZZI A;  1YX0 A;  1I21 A;  1P0H A;  4IUS A;  3GKR A;  3FIX A;  2VBQ A;  5J8C A;  1Q2Y A;  2Y0M A;  1U6M A;  1MJA A;  4FD5 A;  4KOT A;  4JXQ A;  3N7Z A;  2K5T A;  2H5M A;  4R57 A;  3TOA A;  3DR6 A;  4AVB A;  2ZXV A;  1BO4 A;  1M1D A;  3F8K A;  2VEZ A;  2P6G A;  1CJW A;  3TT2 A;  2OU2 A;  2QEC A;  1WWZ A;  3D3S A;  2Q4V A;  5F47 A;  2VXK A;  1MJB A;  5H86 A;  4KZT A;  4UWJ A;  4KOW A;  4CRZ B;  2I00 A;  2BL1 A;  4MBU A;  2FIA A;  1UFH A;  1YVK A;  1MJ9 A;  2WPX A;  1VHS A;  2FIW A;  2Q04 A;  3CXQ A;  4MY3 A;  4CS0 B;  1YLE A;  4LUA A;  2VZZ A;  3F5B A;  4CRY B;  4MJ8 A;  2DXQ A;  1OZP A;  1S7K A;  3R9F A;  4AVA A;  1YVO A;  1S3Z A;  1IYK A;  4KVX A;  5FVJ A;  2FXF A;  4X5K A;  4AG9 A;  1YGH A;  4PSW A;  4KUA A;  1KUY A;  3FBU A;  3FRM A;  2Z10 A;  4MY0 A;  3TTH A;  5H84 A;  4ZBG A;  2X7B A;  3FB3 A;  4DNC A;  1QST A;  3MGD A;  2GAN A;  1FY7 A;  4H6Z A;  2FS5 A;  3W6S A;  5JQ4 A;  5IB0 A;  3WR7 A;  2VZY A;  1QSO A;  2J8R A;  3LOD A;  2R98 A;  1TIQ A;  2B5G A;  1S7L A;  4QBJ A;  3EC4 A;  4ONU A;  2R1I A;  2IL4 A;  3G3S A;  4JJX A;  4NXY A;  4JXR A;  4CAX A;  2PRB A;  1XMT A;  3SHP A;  4KOS A;  1WK4 A;  3DDD A;  3TCV A;  4BMH A;  2ZW4 A;  2CNS A;  3FYN A;  2GIV A;  2EVN A;  3R9E A;  4KLV A;  2VI7 A;  2ATR A;  4M85 A;  2Z0Z A;  2Q7B A;  3JVN A;  4XPD B;  5J8F A;  3TFY A;  5HH1 A;  4QC6 A;  2REF A;  2PC1 A;  1NSL A;  4HKF A;  1CM0 A;  3H4Q A;  3GYA A;  1Q2D A;  4L8A A;  4E2A A;  4L89 A;  4R3K A;  3T9Y A;  4XPD C;  2Q4Y A;  3TO6 A;  4XPL A;  2JDD A;  5KTD A;  4UWI A;  4PSX A;  1L0C A;  3F0A A;  3KKW A;  4AB7 A;  3ZJ0 A;  2R8V A;  3B8G A;  4OAD A;  4I49 A;  4FD6 A;  2J8N A;  1IID A;  4NSQ A;  2ZW5 A;  3QB8 A;  3S6H A;  2OZH A;  3CXS A;  3SXO A;  1S7F A;  2PR1 A;  4U9Z A;  2PR8 A;  3VWD A;  1P4N A;  2BUE A;  4QVT A;  3P2F A;  3V8I A;  3E0K A;  4J3G A;  1Q2C A;  3R96 A;  4JWP A;  4PV6 A;  2NMT A;  2Q0Y A;  4KLW A;  3S6F A;  2AJ6 A;  1J4J A;  2EUI A;  2KCW A;  1S7N A;  4H89 A;  3TOB A;  4K30 A;  1YR0 A;  3T90 A;  1LRZ A;  1N71 A;  4NEX A;  2G3A A;  2CNT A;  5E96 A;  1PUA A;  1M4I A;  3D2M A;  2ARH A;  1IB1 E;  2JDC A;  3P2H A;  1ON0 A;  1Y9W A;  2AE6 A;  2JEV A;  3TO7 A;  1KUX A;  4R87 A;  2O28 A;  2B3U A;  4FD7 A;  4NCZ A;  1SQH A;  4U5Y A;  4XNH B;  2J8M A;  2F5I A;  4MI4 A;  3EXN A;  1B87 A;  3EY5 A;  3TO9 A;  2G3T A;  2HV2 A;  3FXT A;  4KOX A;  1NMT A;  4E8O A;  1GHE A;  2P6F A;  4MHD A;  3G8W A;  2ZW6 A;  1R57 A;  4XNH C;  1KZF A;  3DR8 A;  3S6G A;  4JD6 A;  2B4D B;  3OWC A;  4PK3 A;  3D2P A;  5DWM A;  3DNS A;  1VKC A;  3QAH A;  3UY5 A;  2C27 A;  5EBV A;  4CAV A;  4H6U A;  5F46 A;  4KOY A;  3SXN A;  3BJ8 A;  1S60 A;  3R95 A;  2FSR A; 
#chains in the Genus database with same CATH topology
 3D68 A;  1M44 A;  5LYL A;  3R1K A;  1QSN A;  2PJ8 A;  3S6K A;  2C6P A;  1I1D A;  1ARM A;  3D4U A;  3S9M A;  3W6X A;  4YFJ A;  1QSM A;  4B5O A;  4X8I A;  4UBR A;  4HNY B;  4Z65 A;  3I9S A;  3KR4 A;  4B13 A;  5JM6 A;  3PGP A;  5JPH A;  4C2Y A;  2REE A;  4BBH A;  1I12 A;  2FVG A;  2YND A;  1YRE A;  4PK2 A;  2B58 A;  5CPA A;  1M4D A;  1CP7 A;  4FD4 A;  2OR4 A;  3NH4 A;  2XEI A;  5GCN A;  1Y7E A;  4OIW A;  3K2K A;  4MCP A;  1BPN A;  2RC4 A;  2G0B A;  1IY7 A;  2PE3 A;  4AXV A;  4FBE A;  4A30 A;  2I79 A;  4OLL A;  2QJ8 A;  2CY2 A;  3EO4 A;  1Y7R A;  2POK A;  3NE7 A;  2QIR A;  2DF5 A;  4TNU A;  1YK3 A;  2R7H A;  3IO1 A;  2PJ5 A;  4JLY A;  1H8L A;  3FX6 A;  4F0Y A;  2BCO A;  5IX3 A;  2B4D A;  4UEE A;  4DUK A;  2ZEG A;  4KVM E;  5F49 A;  4A38 A;  4A95 A;  3SJX A;  4ZY0 A;  2OZU A;  2DPT A;  2GRE A;  3QAY A;  5DWN A;  4PQA A;  4QB9 A;  1R43 A;  1Y0Y A;  3BI1 A;  2EO8 A;  4NFR A;  3D7F A;  1XF8 A;  3L2N A;  2A4N A;  3GY9 A;  3JTK A;  3B3C A;  2B4B A;  2ZED A;  5IV0 A;  1CPS A;  2P0W A;  1Y9K A;  3KAS A;  4RI1 A;  4YGO A;  5KTC A;  3BLN A;  2QVP A;  3B3S A;  4MHZ A;  2BSW A;  2O4H A;  2JBK A;  1XEB A;  1MK4 A;  1CX8 A;  2FE7 A;  2HQY A;  2PJA A;  3PEI A;  4NF1 A;  2WPW A;  4WJB A;  2AFS A;  5EC4 A;  4CYQ A;  3SJF A;  5LRK A;  4P4I A;  3S9L A;  1YME A;  2Z11 A;  4AG7 A;  2JBJ A;  2PJC A;  3EFA A;  1QMU A;  3IWG A;  2RFH A;  3W91 A;  2B3V A;  3H8F A;  2CNM A;  4YRH A;  1TKH A;  2AFU A;  4CAW A;  4NGR A;  3BJ7 A;  1ZLH A;  4OME A;  3IU2 A;  5C88 A;  2AFW A;  2B5G B;  2WSA A;  4UCP A;  3K9U A;  5F48 A;  3FNC A;  2OH1 A;  1YW4 A;  3IEH A;  4KOR A;  2YNC C;  2ZEP A;  1B6B A;  3RBU A;  4B5P B;  3KR5 A;  2PVW A;  2ABZ A;  2PDO A;  3VWE A;  3S9N A;  5K8N A;  4X2T A;  3SI2 A;  4UFW A;  1Z4R A;  3B3T A;  4MFZ A;  4P4B A;  5C82 A;  1PU9 A;  1XOV A;  3BI0 A;  2Z3K A;  3FMC A;  4X3R A;  1ZG9 A;  4B14 A;  1ZO0 A;  3IGR A;  2OOT A;  2HB6 A;  5KTA A;  2GE3 A;  3FH4 A;  4P6Y A;  3TE4 A;  1KUV A;  4O23 A;  5HMN A;  2ZEO A;  4UCN A;  4R3L A;  5ISV A;  2V8D A;  1K4J A;  1Y0R A;  1F2O A;  2V8G A;  3LD2 A;  4MCQ A;  4LX9 A;  4M6H A;  4R7M A;  2HC9 A;  3RZA A;  1JWQ A;  3D8P A;  1S5K A;  1BOB A;  4W9Y A;  4CGP A;  2O53 A;  5K8M A;  4G1P A;  4ORF A;  4RS2 A;  2Q44 A;  3C26 A;  1QSR A;  1R3N A;  2PSW A;  2PJ6 A;  2PQ8 A;  2Z3P A;  2ZOG A;  4IF5 A;  4OAE A;  4II9 A;  4Y49 B;  3GIU A;  3I3G A;  4MRI A;  5A27 A;  1XIX A;  2BEI A;  4ZX9 A;  1V0C A;  4EME A;  4PPZ A;  2YNE A;  5LRG A;  2PJ9 A;  2CIJ A;  4GS4 A;  1JQG A;  1TF9 A;  4R9M A;  4CYP A;  1RXT A;  4XPK A;  2FL4 A;  4CGL A;  1HDU A;  4F6A A;  2ZPA A;  3HUV A;  3GUX A;  4R8F A;  3RAM A;  3CXP A;  1YSJ A;  3KHZ A;  2FT0 A;  3PZJ A;  3DSB A;  4KVO E;  2HUZ A;  3JUW A;  3NH8 A;  4JZ0 A;  4HNX B;  1Z8X A;  4HNW B;  2QML A;  4ONW A;  4RN7 A;  1RO5 A;  1VIX A;  2D4O A;  3PP9 A;  2BO9 A;  3KZW A;  4MFP A;  1IGB A;  4NGP A;  4UEF A;  2Z3M A;  4KOV A;  2FCK A;  4B5P A;  4Y49 C;  3GLJ A;  1Q7L A;  1XE4 A;  3R9G A;  5I0C A;  2QYV A;  1ZG7 A;  1ARL A;  2OZG A;  5CNP A;  1Z4E A;  1Z9U A;  3KQX A;  4C7H A;  1NE9 A;  4KUB A;  4PXB A;  2PJB A;  4BIN A;  2JEW A;  3RYO A;  4A2Z A;  4E0A A;  4KOU A;  4CYN A;  3IWW A;  1M4G A;  3B2Y A;  1TF8 A;  2F7V A;  2C1C A;  2ZW7 A;  4U9Y A;  4EVY A;  4NGQ A;  1IIC A;  2AFZ A;  3RO0 A;  2P6E A;  4QUS A;  4M3S A;  2D4P A;  4MFJ A;  1Z5R A;  2JLM A;  3FVL A;  1IYL A;  3FEC A;  1UWY A;  2IJZ A;  2OB0 A;  2VQY A;  3PFO A;  4MCS A;  4PXE A;  4IK2 A;  4UA3 A;  4F8Z A;  4A33 A;  3T8W A;  4BD9 A;  3ZZI A;  1YX0 A;  4P45 A;  1I21 A;  1P0H A;  3WAB A;  3WC5 A;  4CGO A;  2GU2 A;  4UEZ A;  4FUU A;  4IUS A;  4HPS A;  5IB9 A;  2GLJ A;  3GKR A;  5LYF A;  3FIX A;  2BOA A;  2ZOF A;  2VBQ A;  2IQ6 A;  2RB7 A;  4FWU A;  5J8C A;  1Q2Y A;  3LWU A;  2Y0M A;  3CPX A;  3DGV A;  1U6M A;  1MJA A;  2G9D A;  4FD5 A;  4KOT A;  4JXQ A;  4MMO A;  3N7Z A;  2AFM A;  2K5T A;  4MHP A;  7CPA A;  2H5M A;  3SI1 A;  4R57 A;  3TOA A;  3SJG A;  5K8O A;  3DR6 A;  4AVB A;  2IMO A;  4IAV A;  2ZXV A;  2ZEN A;  1BO4 A;  1M1D A;  5AG6 A;  3TX8 A;  3F8K A;  4EWT A;  2VEZ A;  1BAV A;  1Z8L A;  5LYD A;  2P6G A;  3KL9 A;  1CJW A;  3TT2 A;  4ZYQ A;  2OU2 A;  4OP4 A;  2QEC A;  1WWZ A;  1ELL P;  2EBJ A;  2Q4V A;  3D3S A;  3WT4 A;  5F47 A;  4YU9 A;  2VXK A;  6CPA A;  1MJB A;  4NGS A;  5H86 A;  4KZT A;  4OC3 A;  4UWJ A;  4WWV A;  4KOW A;  4CRZ B;  4F0X A;  2I00 A;  4LQG A;  2BL1 A;  1A2Z A;  4MBU A;  5G22 A;  2FIA A;  1QQ9 A;  1UFH A;  3WC6 A;  2F8H A;  1YVK A;  3FJU A;  1CG2 A;  1MJ9 A;  2EWB A;  1VHS A;  2WPX A;  5LRJ A;  4UF4 A;  5HVG A;  5AGE A;  2FIW A;  2WYR A;  3I1U A;  1AUG A;  2Q04 A;  3CXQ A;  1TKJ A;  3FEE A;  1TKF A;  4MY3 A;  5EMI A;  4CS0 B;  3PFE A;  1YLE A;  2AFX A;  3H8G A;  4LUA A;  1TXR A;  2VZZ A;  3F5B A;  3CDX A;  4CRY B;  1OBR A;  1Z2L A;  2DXQ A;  4M6G A;  4MJ8 A;  1OZP A;  4F9U A;  1S7K A;  3CZX A;  4UFV A;  4ZX8 A;  3R9F A;  4AVA A;  1YVO A;  1S3Z A;  1IYK A;  3BXM A;  4KVX A;  5FVJ A;  5G21 A;  2FXF A;  3B3W A;  4X5K A;  4AG9 A;  5JH9 A;  1YGH A;  4PSW A;  4C68 A;  4KUA A;  2C6G A;  1KUY A;  2V77 A;  3FBU A;  3FRM A;  1LFW A;  2Z10 A;  4A39 A;  4NGM A;  2WUU A;  2DPS A;  4UCM A;  2CTC A;  3D66 A;  4MY0 A;  3TTH A;  3V7Z A;  5H84 A;  2YNC A;  2ODF A;  4ZBG A;  3WC7 A;  1IU8 A;  2X7B A;  3FB3 A;  3CT9 A;  1QST A;  4DNC A;  4MFQ A;  3MGD A;  2GAN A;  5HVF A;  1FY7 A;  4PXC A;  4MHY A;  4H6Z A;  5AG4 A;  2FS5 A;  3W6S A;  5JQ4 A;  5IB0 A;  3WR7 A;  2VZY A;  4MCR A;  4KSF A;  5G20 A;  2PCU A;  3IU1 A;  1QSO A;  5JGF A;  2Q43 A;  4M6I A;  2J8R A;  3LOD A;  4Q38 A;  1LAP A;  2ZEH A;  3ISZ A;  2R98 A;  1TIQ A;  4CGN A;  2ZEF A;  3DLJ A;  2B5G A;  5D29 A;  1S7L A;  4QBJ A;  3EC4 A;  1M4L A;  4Q36 A;  4ONU A;  2R1I A;  1VGY A;  2IL4 A;  4EFD A;  3KGQ A;  4R76 A;  1XRY A;  3G3S A;  4JJX A;  4NXY A;  4P10 A;  4JXR A;  4CAX A;  2PRB A;  1XMT A;  3SHP A;  1CPX A;  4KOS A;  1WK4 A;  3BHX A;  3IC1 A;  4NJR A;  1GYT A;  3DDD A;  3PB8 X;  3JRU A;  3TCV A;  3V38 A;  4BMH A;  2ZW4 A;  2CNS A;  4CAF A;  1ZG8 A;  1PYT B;  4OC2 A;  3FYN A;  4A94 A;  4DJL A;  2GIV A;  4RUH A;  2EVN A;  4GXH A;  3R9E A;  2WZN A;  4A32 A;  4KLV A;  2VI7 A;  1YLO A;  2ATR A;  3KQZ A;  4OID A;  4M85 A;  4MFK A;  2PJ0 A;  2ANP A;  4OC1 A;  3NA6 A;  1EE3 P;  2Z0Z A;  2Q7B A;  1DE4 C;  1F2P A;  3JVN A;  3KHX A;  4XPD B;  5J8F A;  3TFY A;  5HH1 A;  3A9L A;  3H8E A;  3D7D A;  3PBB A;  4B6Z A;  4QC6 A;  3PRT A;  2REF A;  1BLL E;  5I4M A;  2PC1 A;  1NSL A;  4HKF A;  1VHE A;  1CM0 A;  3NH5 A;  3IFE A;  4NGT A;  4ZI6 A;  3H4Q A;  3GYA A;  8CPA A;  2CF4 A;  1F57 A;  4UIA A;  1Q2D A;  3HLP A;  3VAR A;  3IWE A;  1CBX A;  1LAM A;  4L8A A;  4E2A A;  2C6C A;  3VH9 A;  4CYO A;  4L89 A;  4R3K A;  3T9Y A;  4XPD C;  2Q4Y A;  4PXD A;  5A28 A;  2XEF A;  3TO6 A;  3CPA A;  4XPL A;  2JDD A;  1HEE A;  3D7H A;  5KTD A;  1XMB A;  4UWI A;  4PSX A;  1AMP A;  2PJ2 A;  1L0C A;  3MN8 A;  4KS9 A;  4ZY2 A;  3TC8 A;  4UFX A;  3F0A A;  3PB9 X;  5D8N A;  3KKW A;  1LAN A;  3B35 A;  3SJE A;  4C2Z A;  1LOK A;  4H2K A;  4AB7 A;  1ZLI A;  2XEJ A;  2NYQ A;  2R8V A;  3B8G A;  4OAD A;  4KSI A;  2V8H A;  3ZJ0 A;  2ZEL A;  4OC5 A;  4MHN A;  3B3V A;  4P44 A;  4P4D A;  4LQ6 A;  3VAT A;  4I49 A;  4FD6 A;  2J8N A;  5F09 A;  1IID A;  4NSQ A;  2ZW5 A;  2Q4Z A;  3QB8 A;  3S6H A;  2OZH A;  1HDQ A;  3CXS A;  3SXO A;  4P4F A;  3PB7 X;  1S7F A;  1ELM P;  5K8P A;  2PR1 A;  2PJ1 A;  4U9Z A;  2EK8 A;  1CP6 A;  2PR8 A;  5LYI A;  3VWD A;  3PBE A;  4C2X A;  4F9V A;  2DEA A;  5G1Z A;  1P4N A;  1IOI A;  2AFO A;  2BUE A;  4QVT A;  3P2F A;  3V8I A;  3E0K A;  4J3G A;  1FNO A;  1Q2C A;  3R96 A;  2PIZ A;  4JWP A;  3FF3 A;  4GM5 A;  3IJ3 A;  1PCA A;  2ZEM A;  4NJQ A;  4TWE A;  4PV6 A;  3H5Z A;  2NMT A;  1XBU A;  2I3C A;  2Q0Y A;  4KLW A;  4JYW A;  1YW6 A;  3QNV A;  4CGM A;  3S6F A;  2AJ6 A;  3IIB A;  4B12 A;  2EK9 A;  1J4J A;  2EUI A;  2KCW A;  1S7N A;  2GLF A;  4H89 A;  2PVV A;  3TOB A;  1XFO A;  1X10 A;  4YWY A;  5DS0 A;  4K30 A;  1YR0 A;  1YQE A;  3T90 A;  1XJO A;  3B7I A;  3ISX A;  1AYE A;  4CAE A;  3GB0 A;  4AVC A;  1LRZ A;  1N71 A;  1Z8T A;  1FT7 A;  2Z3N A;  5THW A;  4NEX A;  4P4E A;  2NSM A;  2G3A A;  2CNT A;  2PRQ A;  5E96 A;  4B11 A;  1PUA A;  3RNZ A;  3N5F A;  2GFQ A;  4C7I A;  4ZGY B;  1M4I A;  3D2M A;  2ARH A;  2PJ4 A;  3PB4 X;  4ZY1 A;  5CBM A;  1IB1 E;  2JDC A;  4P4J A;  3P2H A;  4FAI A;  5AG5 A;  4B10 A;  1ON0 A;  1Y9W A;  2AE6 A;  2JEV A;  3TO7 A;  3K9T A;  1KUX A;  3MRU A;  4OC0 A;  4R87 A;  2O28 A;  2B3U A;  4FD7 A;  4NCZ A;  1SQH A;  4U5Y A;  4XNH B;  1VHO A;  2CTB A;  2V8V A;  2CXA A;  2J8M A;  2XEG A;  1BPM A;  4MXU A;  3PB6 X;  2F5I A;  4UIB A;  2Z3L A;  4MI4 A;  2PIY A;  3EXN A;  5BWA B;  3NFZ A;  1B87 A;  3EY5 A;  3TO9 A;  2G3T A;  1Z8W A;  3D7G A;  2HV2 A;  1RTQ A;  1IOF A;  3FXT A;  4KOX A;  4R6T A;  1NMT A;  2YGW A;  4E8O A;  1GHE A;  2P6F A;  2VL1 A;  4Q7A A;  4MHD A;  2PJ3 A;  3G8W A;  2ZW6 A;  1R57 A;  2ZEE A;  1LCP A;  2Q7S A;  2Z3O A;  2Q51 A;  5AG7 A;  3LMS A;  4XNH C;  1KZF A;  3DR8 A;  3S6G A;  4JD6 A;  5HVH A;  2B4D B;  3OWC A;  4PK3 A;  5HXD A;  4NGN A;  3D67 A;  5ELY A;  4DYO A;  3D2P A;  1X12 A;  3DNS A;  5DWM A;  1VKC A;  3QAH A;  3UY5 A;  4A31 A;  4OKO A;  2C27 A;  2PJ7 A;  1DTD A;  5EBV A;  4CAV A;  4CPA A;  5J1Q A;  3LAC A;  3KI9 A;  4H6U A;  4KSA A;  3SI0 A;  2J9A A;  1KWM A;  4IHM A;  5F46 A;  4K3N A;  4KOY A;  3SXN A;  3BJ8 A;  4OC4 A;  4MFL A;  1NSA A;  4A37 A;  1S60 A;  3NE8 A;  3R95 A;  2FSR A;  3FED A; 
#chains in the Genus database with same CATH homology
 1M44 A;  3R1K A;  1QSN A;  3S6K A;  4YFJ A;  1I1D A;  3W6X A;  1QSM A;  4B5O A;  4UBR A;  4HNY B;  3I9S A;  4B13 A;  3PGP A;  5JPH A;  2REE A;  4BBH A;  1I12 A;  2YND A;  1YRE A;  4PK2 A;  2B58 A;  1M4D A;  4FD4 A;  5GCN A;  2RC4 A;  2G0B A;  4A30 A;  2I79 A;  4OLL A;  2CY2 A;  3EO4 A;  1Y7R A;  3NE7 A;  2QIR A;  1YK3 A;  2R7H A;  4JLY A;  5IX3 A;  4F0Y A;  2B4D A;  4KVM E;  5F49 A;  4A95 A;  2OZU A;  2DPT A;  5DWN A;  4QB9 A;  1XF8 A;  2A4N A;  3GY9 A;  3JTK A;  5IV0 A;  2B4B A;  2P0W A;  1Y9K A;  4RI1 A;  4YGO A;  5KTC A;  3BLN A;  2BSW A;  4AVC A;  1XEB A;  1MK4 A;  2FE7 A;  2HQY A;  5EC4 A;  4NF1 A;  4CYQ A;  2WPW A;  2Z11 A;  4AG7 A;  3EFA A;  3IWG A;  3W91 A;  2B3V A;  2CNM A;  4YRH A;  4CAW A;  3BJ7 A;  3IU2 A;  5C88 A;  2B5G B;  2WSA A;  4UCP A;  3K9U A;  5F48 A;  3FNC A;  2OH1 A;  4KOR A;  2YNC C;  1B6B A;  4B5P B;  2PDO A;  3VWE A;  4UFW A;  1Z4R A;  4MFZ A;  5C82 A;  1PU9 A;  2Z3K A;  4B14 A;  1ZO0 A;  3IGR A;  5KTA A;  2GE3 A;  3TE4 A;  1KUV A;  5HMN A;  4UCN A;  4R3L A;  5ISV A;  1K4J A;  3LD2 A;  4LX9 A;  3D8P A;  1S5K A;  1BOB A;  4CGP A;  4ORF A;  4RS2 A;  2Q44 A;  3C26 A;  1QSR A;  2PSW A;  4IF5 A;  2Z3P A;  2PQ8 A;  4OAE A;  4II9 A;  4Y49 B;  3I3G A;  5A27 A;  1XIX A;  2BEI A;  1V0C A;  2YNE A;  4GS4 A;  4R9M A;  4CYP A;  1RXT A;  4XPK A;  2FL4 A;  4CGL A;  4F6A A;  2ZPA A;  3CXP A;  3PZJ A;  4KVO E;  2FT0 A;  3DSB A;  2HUZ A;  3JUW A;  4HNX B;  4HNW B;  2QML A;  1RO5 A;  2D4O A;  3PP9 A;  4MFP A;  2Z3M A;  4KOV A;  2FCK A;  4B5P A;  4Y49 C;  1XE4 A;  3R9G A;  5I0C A;  2OZG A;  5CNP A;  1Z4E A;  1Z9U A;  4C7H A;  1NE9 A;  4KUB A;  3RYO A;  4A2Z A;  4E0A A;  4KOU A;  4CYN A;  1M4G A;  2ZW7 A;  4U9Y A;  4EVY A;  1IIC A;  2P6E A;  4QUS A;  4M3S A;  2D4P A;  4MFJ A;  2JLM A;  1IYL A;  2OB0 A;  2VQY A;  4UA3 A;  4A33 A;  3ZZI A;  1YX0 A;  1I21 A;  1P0H A;  4CGO A;  4IUS A;  3GKR A;  3FIX A;  2VBQ A;  5J8C A;  1Q2Y A;  2Y0M A;  1U6M A;  1MJA A;  4FD5 A;  4KOT A;  4JXQ A;  3N7Z A;  2K5T A;  2H5M A;  4R57 A;  3TOA A;  3DR6 A;  4AVB A;  2ZXV A;  1BO4 A;  1M1D A;  5AG6 A;  3F8K A;  2VEZ A;  2P6G A;  1CJW A;  3TT2 A;  2OU2 A;  2QEC A;  1WWZ A;  3D3S A;  2Q4V A;  5F47 A;  2VXK A;  1MJB A;  5H86 A;  4KZT A;  4UWJ A;  4KOW A;  4CRZ B;  4F0X A;  2I00 A;  2BL1 A;  4MBU A;  5G22 A;  2FIA A;  1UFH A;  1YVK A;  1MJ9 A;  2WPX A;  1VHS A;  5AGE A;  2FIW A;  2Q04 A;  3CXQ A;  4MY3 A;  4CS0 B;  1YLE A;  4LUA A;  2VZZ A;  3F5B A;  4CRY B;  4MJ8 A;  2DXQ A;  1OZP A;  1S7K A;  4UFV A;  3R9F A;  4AVA A;  1YVO A;  1S3Z A;  1IYK A;  4KVX A;  5FVJ A;  5G21 A;  2FXF A;  4X5K A;  4AG9 A;  1YGH A;  4PSW A;  4C68 A;  4KUA A;  1KUY A;  3FBU A;  3FRM A;  2Z10 A;  2WUU A;  2DPS A;  4UCM A;  4MY0 A;  3TTH A;  5H84 A;  2YNC A;  4ZBG A;  2X7B A;  3FB3 A;  4DNC A;  1QST A;  4MFQ A;  3MGD A;  2GAN A;  1FY7 A;  4H6Z A;  5AG4 A;  2FS5 A;  3W6S A;  5JQ4 A;  5IB0 A;  3WR7 A;  2VZY A;  4KSF A;  5G20 A;  3IU1 A;  1QSO A;  2J8R A;  3LOD A;  4Q38 A;  2R98 A;  1TIQ A;  4CGN A;  2B5G A;  1S7L A;  4QBJ A;  3EC4 A;  4Q36 A;  4ONU A;  2R1I A;  2IL4 A;  3G3S A;  4JJX A;  4NXY A;  4JXR A;  4CAX A;  2PRB A;  1XMT A;  3SHP A;  4KOS A;  1WK4 A;  3DDD A;  3TCV A;  4BMH A;  2ZW4 A;  2CNS A;  4CAF A;  3FYN A;  2GIV A;  2EVN A;  3R9E A;  4A32 A;  4KLV A;  2VI7 A;  2ATR A;  4M85 A;  4MFK A;  2Z0Z A;  2Q7B A;  3JVN A;  4XPD B;  5J8F A;  3TFY A;  5HH1 A;  3A9L A;  4QC6 A;  2REF A;  2PC1 A;  1NSL A;  4HKF A;  1CM0 A;  3H4Q A;  3GYA A;  1Q2D A;  3IWE A;  4L8A A;  4E2A A;  4CYO A;  4L89 A;  4R3K A;  3T9Y A;  4XPD C;  2Q4Y A;  5A28 A;  3TO6 A;  4XPL A;  2JDD A;  5KTD A;  4UWI A;  4PSX A;  4KS9 A;  1L0C A;  4UFX A;  3F0A A;  3KKW A;  4C2Z A;  4C2Y A;  4AB7 A;  3ZJ0 A;  2R8V A;  3B8G A;  4OAD A;  4I49 A;  4FD6 A;  2J8N A;  1IID A;  4NSQ A;  2ZW5 A;  3QB8 A;  3S6H A;  2OZH A;  3CXS A;  3SXO A;  1S7F A;  2PR1 A;  4U9Z A;  2PR8 A;  3VWD A;  4C2X A;  5G1Z A;  1P4N A;  2BUE A;  4QVT A;  3P2F A;  3V8I A;  3E0K A;  4J3G A;  1Q2C A;  3R96 A;  4JWP A;  4PV6 A;  3H5Z A;  2NMT A;  2Q0Y A;  4KLW A;  4CGM A;  3S6F A;  2AJ6 A;  4B12 A;  1J4J A;  2EUI A;  2KCW A;  1S7N A;  4H89 A;  3TOB A;  4K30 A;  1YR0 A;  3T90 A;  4CAE A;  1LRZ A;  1N71 A;  2Z3N A;  4NEX A;  4B11 A;  2G3A A;  2CNT A;  5E96 A;  1PUA A;  4C7I A;  4ZGY B;  1M4I A;  3D2M A;  2ARH A;  1IB1 E;  2JDC A;  3P2H A;  5AG5 A;  4B10 A;  1ON0 A;  1Y9W A;  2AE6 A;  2JEV A;  3TO7 A;  1KUX A;  4R87 A;  2O28 A;  2B3U A;  4FD7 A;  4NCZ A;  1SQH A;  4U5Y A;  4XNH B;  2CXA A;  2J8M A;  2F5I A;  2Z3L A;  4MI4 A;  5BWA B;  3EXN A;  1B87 A;  3EY5 A;  3TO9 A;  2G3T A;  2HV2 A;  3FXT A;  4KOX A;  1NMT A;  2YGW A;  4E8O A;  1GHE A;  2P6F A;  4MHD A;  3G8W A;  2ZW6 A;  1R57 A;  2Z3O A;  5AG7 A;  4XNH C;  1KZF A;  3DR8 A;  3S6G A;  4JD6 A;  2B4D B;  3OWC A;  4PK3 A;  3D2P A;  5DWM A;  3DNS A;  1VKC A;  3QAH A;  3UY5 A;  4A31 A;  2C27 A;  5EBV A;  4CAV A;  4H6U A;  4KSA A;  5F46 A;  4KOY A;  3SXN A;  3BJ8 A;  4MFL A;  1S60 A;  3R95 A;  2FSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...