4YRHA

P21 isoform of mec-17 from danio rerio
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
184
structure length
177
Chain Sequence
DFPYDLNALFPERISVLDSNLSRPDPLPQVTTVIDELGKASSKAQQLPAPITSAAKLQANRHHLYLLKDGEQNGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tubulin N-acetyltransferase 1
publication title Structure of DrMEC-17 residue 2-185 at 2.85 Angstroms resolution
rcsb
source organism Danio rerio
molecule tags Transferase
total genus 41
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2015-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yrhA00
5KTAA 1OZPA 4L8AA 2P0WA 4R57A 2WPXA 3EO4A 4JD6A 4MY0A 1IYLA 1YX0A 3GKRA 2I79A 1GHEA 4KOWA 3UY5A 3RYOA 4RI1A 2VI7A 4UA3A 2DXQA 1NSLA 1K4JA 2ZW7A 4BMHA 3VWDA 1YGHA 4FD5A 3D2MA 3PZJA 1CM0A 2GIVA 3GY9A 1MJAA 4AVAA 3S6GA 5H86A 2R7HA 4MJ8A 2B3VA 3R96A 2JDCA 2Z11A 4Y49B 2AE6A 2R1IA 5GCNA 1SQHA 3S6FA 1S7FA 1J4JA 2B4DB 2PC1A 2ARHA 2OH1A 3JUWA 1B87A 4KUAA 3TT2A 4KORA 5J8CA 3JVNA 1IYKA 4XPKA 2CY2A 1NMTA 3T9YA 1B6BA 4MBUA 4KOVA 5J8FA 2EVNA 2B5GA 2VEZA 1IICA 4JLYA 1M1DA 4PV6A 4R87A 3G3SA 4HNYB 1RO5A 4AVBA 3TE4A 4II9A 4M85A 1XE4A 1RXTA 4I49A 5HH1A 2Q4VA 3C26A 3N7ZA 4JJXA 5JQ4A 2QECA 4JWPA 1M4IA 2REFA 3SHPA 1Q2DA 2B58A 2C27A 2HV2A 1Q2CA 5HMNA 3FXTA 5F47A 3EC4A 3EFAA 3PGPA 4PSWA 4QBJA 4OLLA 2RC4A 2P6FA 4B5OA 3MGDA 2R8VA 2D4PA 2ZW4A 3CXSA 2OZGA 3LODA 2QIRA 4PK2A 4U9YA 3E0KA 5E96A 1IIDA 3K9UA 5DWNA 3R95A 1WWZA 4FD7A 4MY3A 2Z10A 1QSMA 4J3GA 1KZFA 3R9FA 4KOTA 4AB7A 2P6EA 2ZPAA 2J8RA 3TOBA 5IX3A 4KOYA 4KLVA 2FIWA 4XNHC 4XPDB 3FBUA 4L89A 2BSWA 2H5MA 2FIAA 4QC6A 4ONUA 4B5PA 1MJBA 1S7LA 4FD4A 5DWMA 4KLWA 3OWCA 3D3SA 3TOAA 3P2FA 2ATRA 4JXQA 2CNMA 3I9SA 2FL4A 2J8MA 1L0CA 2FCKA 4EVYA 2VXKA 2I00A 2CNTA 2Q04A 3R1KA 1NE9A 3W6SA 1KUYA 2WPWA 3CXPA 4NCZA 4KUBA 4RS2A 4XNHB 3TTHA 1XMTA 2FE7A 2B4BA 1Z4RA 1TIQA 1M4DA 1P0HA 2VQYA 3S6HA 5KTCA 4KVXA 3TFYA 4CAVA 3IGRA 4K30A 2BUEA 5H84A 4CRYB 1V0CA 3BJ7A 1MK4A 1XIXA 4U9ZA 3D8PA 1XEBA 3QAHA 4HNXB 4HNWB 3S6KA 2JDDA 4IF5A 2FXFA 3W6XA 3T90A 3FYNA 4XPLA 3DDDA 4ZBGA 5F48A 4LX9A 3TO7A 3I3GA 1I12A 4R3LA 2QMLA 4MI4A 2OB0A 5F46A 2FSRA 1R57A 3F8KA 5F49A 1I1DA 3R9GA 4PK3A 4UWIA 3TCVA 2PRBA 3FB3A 1QSTA 4E2AA 4U5YA 4IUSA 4OADA 1PU9A 3G8WA 4H6UA 1PUAA 2OZUA 1S5KA 4R3KA 3BJ8A 2GANA 2CNSA 4FD6A 1S3ZA 3SXNA 1Z9UA 2ZXVA 4PSXA 2J8NA 1QSRA 1XF8A 3DR8A 2F5IA 5C82A 2Z0ZA 4YFJA 1VKCA 5IB0A 2REEA 3EY5A 2G3TA 1Y7RA 2G3AA 1QSNA 1QSOA 2FT0A 2B3UA 2R98A 3FNCA 1MJ9A 2PSWA 4F6AA 4H89A 1CJWA 3EXNA 3DR6A 3TO6A 2ZW5A 2EUIA 4R9MA 2Q7BA 3D2PA 3ZZIA 2PR8A 3FIXA 1YVKA 3GYAA 4LUAA 4AG9A 2JLMA 4M3SA 3V8IA 3F0AA 2Y0MA 4CS0B 1Q2YA 4AVCA 2OU2A 4E0AA 4Y49C 2BEIA 5EC4A 1ON0A 4YRHA 5IV0A 1P4NA 2K5TA 2FS5A 3FRMA 2VZZA 5CNPA 4OAEA 4KOXA 3SXOA 4B5PB 2Q44A 2B4DA 3NE7A 2Q4YA 1YR0A 1KUXA 2BL1A 2HQYA 1Y9WA 5KTDA 3IWGA 4X5KA 2GE3A 5JPHA 1UFHA 3WR7A 4KOSA 2ZW6A 4JXRA 4CAXA 2O28A 4F0YA 4AG7A 2VZYA 1YLEA 1N71A 2PDOA 3VWEA 4UWJA 2OZHA 3LD2A 3DNSA 1VHSA 4KOUA 5C88A 4YGOA 4DNCA 1U6MA 4E8OA 2A4NA 3W91A 1BO4A 1FY7A 4QVTA 1S60A 3P2HA 2X7BA 4HKFA 2D4OA 2JEVA 3ZJ0A 5ISVA 1IB1E 4KZTA 1WK4A 4GS4A 5EBVA 3KKWA 4H6ZA 2Q0YA 4MHDA 2B5GB 4QUSA 4CRZB 1YK3A 2NMTA 2KCWA 4XPDC 5FVJA 4ORFA 2HUZA 4NSQA 2VBQA 4UBRA 1S7KA 3H4QA 1LRZA 3R9EA 2P6GA 3QB8A 3PP9A 1BOBA 3B8GA 3DSBA 3BLNA 4NXYA 2PQ8A 4QB9A 1I21A 3TO9A 1YREA 4CAWA 3F5BA 4KVME 1S7NA 4NEXA 4NF1A 1Y9KA 1Z4EA 4KVOE 2IL4A 1YVOA 2G0BA 3CXQA 1M4GA 1KUVA 5I0CA 2AJ6A 2PR1A 1M44A
chains in the Genus database with same CATH superfamily
5KTAA 2GLJA 5LYDA 3KI9A 4PXEA 2PJBA 1BLLE 2OR4A 1OZPA 4L8AA 2P0WA 4R57A 4A39A 4A30A 4BINA 1BAVA 1BPMA 2WPXA 5G22A 3MN8A 3EO4A 4MXUA 3DGVA 4JD6A 4MY0A 4PPZA 5CBMA 1IYLA 4RN7A 1YX0A 3GKRA 1LOKA 2I79A 1GHEA 5IB9A 4KSAA 5F09A 4KOWA 3UY5A 1GYTA 3RYOA 3B35A 2AFOA 2Q7SA 4G1PA 4X3RA 1FT7A 3KZWA 4RI1A 4M6IA 3IU1A 4OC5A 4NJQA 4P10A 3IO1A 2PE3A 4P4DA 4Q7AA 2VI7A 2YNEA 4MFPA 2JEWA 4Z65A 4UA3A 3RO0A 2DXQA 1NSLA 1PYTB 1JQGA 1K4JA 4UF4A 4OC3A 2ZW7A 4BMHA 3PB6X 2PJ3A 1YGHA 3VWDA 2PJ5A 3D2MA 1XMBA 3DLJA 3NE8A 1CM0A 3PZJA 4FD5A 4F9UA 5AG5A 2GIVA 3GY9A 1MJAA 1IGBA 4AVAA 2Q43A 2EK8A 1ZG7A 4PXBA 3S6GA 5H86A 3VH9A 2R7HA 3TC8A 4CGNA 4MJ8A 4UFVA 2B3VA 3R96A 2JDCA 2Z11A 4M6HA 5LRKA 4Y49B 2AE6A 3B3WA 2PJCA 2R1IA 5GCNA 1SQHA 3PB9X 3S6FA 1S7FA 2PJ2A 4GXHA 5K8NA 1J4JA 1H8LA 1A2ZA 2B4DB 2PC1A 2ARHA 4CAFA 2OH1A 3JUWA 1B87A 2EBJA 2GU2A 2J9AA 2RFHA 2VL1A 4KUAA 5DS0A 3TT2A 4CGLA 4DUKA 3S9MA 3D7DA 2QVPA 4KORA 4MRIA 5J8CA 2EO8A 3JVNA 1TKJA 3H8FA 1IYKA 4XPKA 2CY2A 1NMTA 2Z3MA 1HEEA 3PFEA 1B6BA 4OC1A 3K2KA 4MBUA 3T9YA 5LYFA 4KOVA 5J8FA 2EVNA 4NGNA 1CPSA 1TKFA 2B5GA 4P4FA 2VEZA 1IICA 2POKA 4JLYA 1M1DA 4CYNA 4LQ6A 4PV6A 1XBUA 3G3SA 4HNYB 3GLJA 4MHYA 4R87A 5K8MA 1RO5A 2ZEOA 1DTDA 4AVBA 1ELLP 4OC0A 4C2ZA 3TE4A 4II9A 4M85A 5LRJA 1ARMA 2Z3LA 1XE4A 1RXTA 4I49A 4X2TA 5HH1A 4TWEA 3LACA 3FECA 2Q4VA 3C26A 3KQXA 4UIBA 1YQEA 3N7ZA 4R6TA 4F8ZA 2JBJA 1OBRA 4JJXA 5JQ4A 2QECA 3JTKA 4JWPA 1M4IA 2REFA 2V8DA 1Q2DA 2B58A 2C27A 2HV2A 3SHPA 1Q2CA 2DF5A 5HMNA 3FXTA 5F47A 3EC4A 3EFAA 3PGPA 4PSWA 2XEIA 1DE4C 4QBJA 4P44A 4A95A 4OLLA 2RC4A 2P6FA 4B5OA 3MGDA 1QQ9A 1Y0RA 2R8VA 2D4PA 8CPAA 2ZW4A 2XEGA 2XEJA 4WWVA 1HDQA 3CXSA 4CAEA 4ZGYB 2OZGA 3LODA 2DEAA 5HVFA 2QIRA 4PK2A 4U9YA 3E0KA 5E96A 1IIDA 4MHPA 1IOIA 3K9UA 5D29A 4JZ0A 5DWNA 2EK9A 5LYIA 3NH5A 2PJ4A 3R95A 1WWZA 4FD7A 4A37A 4MY3A 2Z10A 1QSMA 1VHOA 4J3GA 4AXVA 1KZFA 3R9FA 3N5FA 3IU2A 2WSAA 3TX8A 3WC6A 4ONWA 2C6PA 4DYOA 2AFUA 4KOTA 3IEHA 2P6EA 2ZPAA 2J8RA 4NFRA 3SJGA 3TOBA 4AB7A 4DJLA 4OKOA 5IX3A 3K9TA 4KOYA 4FUUA 3MRUA 4KLVA 4ZY0A 2FIWA 4GM5A 4XNHC 4HPSA 4XPDB 3IFEA 5AG6A 3FBUA 3IJ3A 4L89A 1Z8WA 2XEFA 1XRYA 4UEFA 1YW6A 1CPXA 2BSWA 2H5MA 2BCOA 2FIAA 4P6YA 1AMPA 3ISZA 4NGRA 4Q36A 1LANA 4B6ZA 4UEZA 4MCSA 3CDXA 5D8NA 4QC6A 3B3VA 4B13A 4ONUA 4C68A 3SJXA 3FVLA 1F2OA 2DPSA 4IK2A 4X8IA 1R43A 2PJ0A 3BI1A 4B5PA 1MJBA 1S7LA 3LMSA 4FD4A 5I4MA 4FWUA 5DWMA 3PBBA 1LAPA 2AFXA 2NSMA 4KLWA 4B12A 3OWCA 2Z3NA 4ZX9A 2ZEEA 4PQAA 3D3SA 3TOAA 3P2FA 2ATRA 4JXQA 2OOTA 2CNMA 5A27A 4MFZA 3VATA 1PCAA 3I9SA 3KHXA 2FL4A 2J8MA 1L0CA 2FCKA 2ZEDA 1Y7EA 4EVYA 1TF9A 4R76A 3H8EA 2VXKA 3PBEA 2I00A 3WABA 2CNTA 2Q04A 3R1KA 1NE9A 3W6SA 1KUYA 2WPWA 3CXPA 4NCZA 4KUBA 4OC4A 4RS2A 2PJ8A 1Z2LA 4UCNA 4XNHB 4A33A 3TTHA 1XMTA 5BWAB 4R8FA 3SI1A 3BXMA 2FE7A 2V8VA 2B4BA 3S9LA 2PJ1A 1Z4RA 2IQ6A 3CPXA 4OC2A 5JGFA 2IMOA 1M4DA 1TIQA 4OMEA 1P0HA 3NFZA 2VQYA 3IWEA 3S6HA 4A2ZA 5KTCA 4KVXA 3TFYA 4CAVA 3IC1A 3IGRA 3V38A 5HVHA 1CX8A 4PXCA 2CTBA 2V8GA 1X12A 4K30A 1Z8XA 3BHXA 2BUEA 1YLOA 3QAYA 3FEEA 1IOFA 4MFKA 5H84A 4CRYB 4ZY1A 1V0CA 3BJ7A 1MK4A 5J1QA 1XIXA 4WJBA 4U9ZA 3D8PA 1RTQA 1XEBA 2NYQA 2C6CA 3QAHA 4HNWB 4HNXB 5AGEA 4C2XA 3BI0A 2C1CA 4MFJA 1ZLIA 2JDDA 3S6KA 4IF5A 2FXFA 3WC5A 3W6XA 4FBEA 3RNZA 3T90A 3FYNA 2DPTA 3DDDA 4XPLA 4ZBGA 4EFDA 4MCQA 5F48A 1YW4A 2PJ9A 4KSFA 4LX9A 5G20A 3I3GA 3TO7A 1I12A 1Y0YA 2QMLA 4MI4A 2OB0A 4R3LA 2CF4A 5F46A 2FSRA 1TKHA 1R57A 4ZI6A 2Q51A 3F8KA 4B10A 4H2KA 4BBHA 5F49A 3IWWA 4MFQA 2ZOGA 1I1DA 3RZAA 3R9GA 4PK3A 2YNCA 4UWIA 3TCVA 7CPAA 2PRBA 1AUGA 4UCMA 3FB3A 1QSTA 1ZO0A 3JRUA 4U5YA 4IUSA 4E2AA 4OADA 1PU9A 4CPAA 1CP7A 1VHEA 4YU9A 3G8WA 2AFSA 4H6UA 1PUAA 2OZUA 1S5KA 4NGTA 2I3CA 4R3KA 2CIJA 3BJ8A 3D7GA 2GANA 2CNSA 4KS9A 5G21A 2AFMA 1CBXA 3D67A 1S3ZA 4FD6A 1R3NA 5LRGA 3SXNA 1Z9UA 2BOAA 3L2NA 2ODFA 2ZXVA 4CGMA 2RB7A 1BPNA 3KQZA 4PSXA 4B11A 2J8NA 4MCRA 3B3TA 2EWBA 1QSRA 2CXAA 4NGPA 1XF8A 4A32A 2PCUA 3HUVA 3DR8A 2F5IA 5C82A 2Z0ZA 1EE3P 4YFJA 5JH9A 1VKCA 3HLPA 5IB0A 3PB8X 4W9YA 1Q7LA 4NGMA 5AG7A 3T8WA 2PVVA 2REEA 4NGSA 3EY5A 4TNUA 2G3TA 1Y7RA 1HDUA 1QSNA 1QSOA 2FT0A 2B3UA 2G3AA 2R98A 3D4UA 4CYOA 5THWA 3FNCA 3B7IA 4IHMA 5K8PA 3PB7X 1MJ9A 2ZELA 2PSWA 4F6AA 4H89A 1CJWA 4C7HA 3EXNA 3DR6A 2G9DA 3TO6A 2ZW5A 2EUIA 5EMIA 4UIAA 4UEEA 4R9MA 2Q7BA 3D2PA 3KR4A 1ELMP 2F7VA 2PR8A 3ZZIA 1Z8TA 5A28A 1F57A 3SI0A 3FIXA 1YVKA 4P45A 3GYAA 4LUAA 4P4EA 4AG9A 5G1ZA 1F2PA 5CPAA 4OP4A 2JLMA 4M3SA 3V8IA 3F0AA 4UFXA 4ZYQA 2Y0MA 1XFOA 1Z8LA 3CZXA 4CS0B 1Q2YA 4AVCA 2OU2A 4E0AA 4Y49C 4P4IA 2PVWA 2BEIA 2BO9A 4NGQA 3VARA 1UWYA 1XJOA 5EC4A 1NSAA 2Z3OA 1ON0A 4YRHA 2ZEFA 3CPAA 4IAVA 5IV0A 1P4NA 2CTCA 3FMCA 4K3NA 3RAMA 3I1UA 2K5TA 1VGYA 1JWQA 2FS5A 2WYRA 3FRMA 2VZZA 2WUUA 5CNPA 4C2YA 4PXDA 1QMUA 4OAEA 4KOXA 4B14A 3SXOA 4B5PB 6CPAA 3B3CA 3WT4A 3LWUA 2Q44A 4Q38A 2IJZA 2B4DA 4MCPA 1IY7A 2ZENA 3NE7A 4MFLA 5JM6A 1Z5RA 3CT9A 2Q4YA 3KGQA 1YR0A 1KUXA 2BL1A 2HQYA 3FX6A 4OIDA 1Y9WA 4CYPA 2GREA 3KASA 2ZOFA 5KTDA 3IWGA 4X5KA 3S9NA 2GE3A 1YSJA 4M6GA 2ZEGA 3PRTA 2Z3KA 4BD9A 5JPHA 1LAMA 4UFWA 1UFHA 2FVGA 3WR7A 5K8OA 4KOSA 2ZW6A 4A94A 4JXRA 2O4HA 3FF3A 3FEDA 4CAXA 2O28A 4F0YA 4AG7A 4FAIA 2VZYA 3D7HA 1YLEA 5ELYA 1LFWA 1N71A 2PDOA 3VWEA 2F8HA 3D68A 2OZHA 4UWJA 3LD2A 3DNSA 1VHSA 2GFQA 1ZLHA 4CGOA 2HC9A 4F9VA 3FH4A 2WZNA 4KOUA 4LQGA 5C88A 3H8GA 1CP6A 2YNDA 2YNCC 2Q4ZA 4YGOA 3SI2A 4DNCA 5LYLA 1U6MA 1X10A 2A4NA 4E8OA 4OIWA 2PIZA 3B3SA 3W91A 1BO4A 1FY7A 4QVTA 3SJFA 1S60A 5HVGA 3P2HA 3NH4A 2JBKA 2X7BA 4EMEA 4HKFA 2D4OA 5HXDA 2JEVA 4CGPA 4NJRA 3ZJ0A 5ISVA 1IB1E 4KZTA 4O23A 1LCPA 2YGWA 4RUHA 4UCPA 1WK4A 3PB4X 4GS4A 5EBVA 3D66A 3KKWA 3WC7A 4H6ZA 2Q0YA 4MHDA 2O53A 2B5GB 2V77A 3B2YA 4MHZA 4QUSA 4CRZB 1YK3A 3GB0A 3NA6A 2AFZA 2NMTA 4KSIA 2QYVA 2KCWA 1ZG9A 4A31A 2ABZA 3H5ZA 4P4BA 2ZEHA 3QNVA 4ORFA 4XPDC 5FVJA 1FNOA 3KR5A 4A38A 2HUZA 2ZEPA 4ZX8A 4C7IA 4NSQA 5AG4A 3SJEA 1M4LA 2AFWA 2ANPA 1ZG8A 3D7FA 2VBQA 3RBUA 4UBRA 1S7KA 3H4QA 1LRZA 3R9EA 1VIXA 2P6GA 3QB8A 3PP9A 4ZY2A 1BOBA 2PJ6A 3B8GA 3DSBA 3BLNA 3IIBA 4NXYA 2PQ8A 2GLFA 4QB9A 3GIUA 1I21A 3ISXA 1CG2A 3FJUA 3TO9A 2V8HA 1YREA 4CAWA 2C6GA 3F5BA 1S7NA 1TXRA 4KVME 1ARLA 4MMOA 4NEXA 4NF1A 1TF8A 1Y9KA 2PJ7A 1Z4EA 3GUXA 4KVOE 3PFOA 3KL9A 1XOVA 2IL4A 1YVOA 2G0BA 3CXQA 3NH8A 4YWYA 4P4JA 1KWMA 3A9LA 2Z3PA 1M4GA 2QJ8A 1KUVA 1IU8A 3PEIA 1YMEA 4JYWA 2HB6A 4EWTA 3V7ZA 2AJ6A 1AYEA 2PIYA 4MHNA 4R7MA 5I0CA 2PJAA 4F0XA 2PRQA 3KHZA 2PR1A 2ZEMA 4CYQA 1M44A
chains in the Genus database with same CATH topology
5KTAA 1OZPA 4L8AA 2P0WA 4R57A 4A30A 2WPXA 5G22A 3EO4A 4JD6A 4MY0A 1IYLA 1YX0A 3GKRA 2I79A 1GHEA 4KSAA 4KOWA 3UY5A 3RYOA 4RI1A 3IU1A 2VI7A 2YNEA 4MFPA 4UA3A 2DXQA 1NSLA 1K4JA 2ZW7A 4BMHA 3VWDA 1YGHA 4FD5A 3D2MA 3PZJA 1CM0A 5AG5A 2GIVA 3GY9A 1MJAA 4AVAA 3S6GA 5H86A 2R7HA 4CGNA 4MJ8A 4UFVA 2B3VA 3R96A 2JDCA 2Z11A 4Y49B 2AE6A 2R1IA 5GCNA 1SQHA 3S6FA 1S7FA 1J4JA 2B4DB 2PC1A 2ARHA 4CAFA 2OH1A 3JUWA 1B87A 4KUAA 3TT2A 4CGLA 4KORA 5J8CA 3JVNA 1IYKA 4XPKA 2CY2A 1NMTA 2Z3MA 3T9YA 1B6BA 4MBUA 4KOVA 5J8FA 2EVNA 2B5GA 2VEZA 1IICA 4JLYA 4CYNA 1M1DA 4PV6A 4R87A 3G3SA 4HNYB 1RO5A 4AVBA 3TE4A 4C2ZA 4II9A 4M85A 2Z3LA 1XE4A 1RXTA 4I49A 5HH1A 2Q4VA 3C26A 3N7ZA 4JJXA 5JQ4A 2QECA 3JTKA 4JWPA 1M4IA 2REFA 3SHPA 1Q2DA 2B58A 2C27A 2HV2A 1Q2CA 5HMNA 3FXTA 5F47A 3EC4A 3EFAA 3PGPA 4PSWA 4QBJA 4A95A 4OLLA 2RC4A 2P6FA 4B5OA 3MGDA 2R8VA 2D4PA 2ZW4A 3CXSA 4CAEA 4ZGYB 2OZGA 3LODA 2QIRA 4PK2A 4U9YA 3E0KA 5E96A 1IIDA 3K9UA 5DWNA 3R95A 1WWZA 4FD7A 4MY3A 2Z10A 1QSMA 4J3GA 1KZFA 3R9FA 3IU2A 2WSAA 4KOTA 4AB7A 2P6EA 2ZPAA 2J8RA 3TOBA 5IX3A 4KOYA 4KLVA 2FIWA 4XNHC 4XPDB 5AG6A 3FBUA 4L89A 2BSWA 2H5MA 2FIAA 4Q36A 4QC6A 4B13A 4C68A 4ONUA 2DPSA 4B5PA 1MJBA 1S7LA 4FD4A 5DWMA 4KLWA 4B12A 3OWCA 2Z3NA 3D3SA 3TOAA 3P2FA 2ATRA 4JXQA 2CNMA 5A27A 4MFZA 3I9SA 2FL4A 2J8MA 1L0CA 2FCKA 4EVYA 2VXKA 2I00A 2CNTA 2Q04A 3R1KA 1NE9A 3W6SA 1KUYA 2WPWA 3CXPA 4NCZA 4KUBA 4RS2A 4UCNA 4XNHB 4A33A 3TTHA 1XMTA 5BWAB 2FE7A 2B4BA 1Z4RA 1TIQA 1M4DA 1P0HA 2VQYA 3IWEA 3S6HA 4A2ZA 5KTCA 4KVXA 3TFYA 4CAVA 3IGRA 4K30A 2BUEA 4MFKA 5H84A 4CRYB 1V0CA 3BJ7A 1MK4A 1XIXA 4U9ZA 3D8PA 1XEBA 3QAHA 4HNXB 5AGEA 4HNWB 4C2XA 4MFJA 3S6KA 2JDDA 4IF5A 2FXFA 3W6XA 3T90A 3FYNA 2DPTA 3DDDA 4XPLA 4ZBGA 5F48A 4KSFA 4LX9A 5G20A 3TO7A 3I3GA 1I12A 4R3LA 2QMLA 4MI4A 2OB0A 5F46A 2FSRA 1R57A 3F8KA 4B10A 4BBHA 5F49A 4MFQA 1I1DA 3R9GA 4PK3A 2YNCA 4UWIA 3TCVA 2PRBA 4UCMA 3FB3A 1QSTA 1ZO0A 4E2AA 4U5YA 4IUSA 4OADA 1PU9A 3G8WA 4H6UA 1PUAA 2OZUA 1S5KA 4R3KA 3BJ8A 2GANA 2CNSA 4KS9A 5G21A 4FD6A 1S3ZA 3SXNA 1Z9UA 2ZXVA 4CGMA 4B11A 4PSXA 2J8NA 1QSRA 2CXAA 1XF8A 4A32A 3DR8A 2F5IA 5C82A 2Z0ZA 4YFJA 1VKCA 5IB0A 5AG7A 2REEA 3EY5A 2G3TA 1Y7RA 2G3AA 1QSNA 1QSOA 2FT0A 2B3UA 2R98A 4CYOA 3FNCA 1MJ9A 2PSWA 4F6AA 4H89A 1CJWA 4C7HA 3EXNA 3DR6A 3TO6A 2ZW5A 2EUIA 4R9MA 2Q7BA 3D2PA 3ZZIA 2PR8A 5A28A 3FIXA 1YVKA 3GYAA 4LUAA 4AG9A 5G1ZA 2JLMA 4M3SA 3V8IA 3F0AA 4UFXA 2Y0MA 4CS0B 1Q2YA 4AVCA 2OU2A 4E0AA 4Y49C 2BEIA 5EC4A 2Z3OA 1ON0A 4YRHA 5IV0A 1P4NA 2K5TA 2FS5A 3FRMA 2VZZA 2WUUA 5CNPA 4C2YA 4OAEA 4KOXA 4B14A 3SXOA 4B5PB 4Q38A 2Q44A 2B4DA 3NE7A 4MFLA 2Q4YA 1YR0A 1KUXA 2BL1A 2HQYA 1Y9WA 4CYPA 5KTDA 3IWGA 4X5KA 2GE3A 2Z3KA 5JPHA 4UFWA 1UFHA 3WR7A 4KOSA 2ZW6A 4JXRA 4CAXA 2O28A 4F0YA 4AG7A 2VZYA 1YLEA 1N71A 2PDOA 3VWEA 4UWJA 2OZHA 3LD2A 3DNSA 1VHSA 4CGOA 4KOUA 5C88A 2YNDA 2YNCC 4YGOA 4DNCA 1U6MA 4E8OA 2A4NA 3W91A 1BO4A 1FY7A 4QVTA 1S60A 3P2HA 2X7BA 4HKFA 2D4OA 2JEVA 4CGPA 3ZJ0A 5ISVA 1IB1E 4KZTA 2YGWA 4UCPA 1WK4A 4GS4A 5EBVA 3KKWA 4H6ZA 2Q0YA 4MHDA 2B5GB 4QUSA 4CRZB 1YK3A 2NMTA 2KCWA 4A31A 3H5ZA 4XPDC 5FVJA 4ORFA 2HUZA 4C7IA 4NSQA 5AG4A 2VBQA 4UBRA 1S7KA 3H4QA 1LRZA 3R9EA 2P6GA 3QB8A 3PP9A 1BOBA 3B8GA 3DSBA 3BLNA 4NXYA 2PQ8A 4QB9A 1I21A 3TO9A 1YREA 4CAWA 3F5BA 4KVME 1S7NA 4NEXA 4NF1A 1Y9KA 1Z4EA 4KVOE 2IL4A 1YVOA 2G0BA 3CXQA 3A9LA 2Z3PA 1M4GA 1KUVA 5I0CA 2AJ6A 4F0XA 2PR1A 4CYQA 1M44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTA A;  1OZP A;  4L8A A;  2P0W A;  4R57 A;  2WPX A;  3EO4 A;  4JD6 A;  4MY0 A;  1IYL A;  1YX0 A;  3GKR A;  2I79 A;  1GHE A;  4KOW A;  3UY5 A;  3RYO A;  4RI1 A;  2VI7 A;  4UA3 A;  2DXQ A;  1NSL A;  1K4J A;  2ZW7 A;  4BMH A;  3VWD A;  1YGH A;  4FD5 A;  3D2M A;  3PZJ A;  1CM0 A;  2GIV A;  3GY9 A;  1MJA A;  4AVA A;  3S6G A;  5H86 A;  2R7H A;  4MJ8 A;  2B3V A;  3R96 A;  2JDC A;  2Z11 A;  4Y49 B;  2AE6 A;  2R1I A;  5GCN A;  1SQH A;  3S6F A;  1S7F A;  1J4J A;  2B4D B;  2PC1 A;  2ARH A;  2OH1 A;  3JUW A;  1B87 A;  4KUA A;  3TT2 A;  4KOR A;  5J8C A;  3JVN A;  1IYK A;  4XPK A;  2CY2 A;  1NMT A;  3T9Y A;  1B6B A;  4MBU A;  4KOV A;  5J8F A;  2EVN A;  2B5G A;  2VEZ A;  1IIC A;  4JLY A;  1M1D A;  4PV6 A;  4R87 A;  3G3S A;  4HNY B;  1RO5 A;  4AVB A;  3TE4 A;  4II9 A;  4M85 A;  1XE4 A;  1RXT A;  4I49 A;  5HH1 A;  2Q4V A;  3C26 A;  3N7Z A;  4JJX A;  5JQ4 A;  2QEC A;  4JWP A;  1M4I A;  2REF A;  3SHP A;  1Q2D A;  2B58 A;  2C27 A;  2HV2 A;  1Q2C A;  5HMN A;  3FXT A;  5F47 A;  3EC4 A;  3EFA A;  3PGP A;  4PSW A;  4QBJ A;  4OLL A;  2RC4 A;  2P6F A;  4B5O A;  3MGD A;  2R8V A;  2D4P A;  2ZW4 A;  3CXS A;  2OZG A;  3LOD A;  2QIR A;  4PK2 A;  4U9Y A;  3E0K A;  5E96 A;  1IID A;  3K9U A;  5DWN A;  3R95 A;  1WWZ A;  4FD7 A;  4MY3 A;  2Z10 A;  1QSM A;  4J3G A;  1KZF A;  3R9F A;  4KOT A;  4AB7 A;  2P6E A;  2ZPA A;  2J8R A;  3TOB A;  5IX3 A;  4KOY A;  4KLV A;  2FIW A;  4XNH C;  4XPD B;  3FBU A;  4L89 A;  2BSW A;  2H5M A;  2FIA A;  4QC6 A;  4ONU A;  4B5P A;  1MJB A;  1S7L A;  4FD4 A;  5DWM A;  4KLW A;  3OWC A;  3D3S A;  3TOA A;  3P2F A;  2ATR A;  4JXQ A;  2CNM A;  3I9S A;  2FL4 A;  2J8M A;  1L0C A;  2FCK A;  4EVY A;  2VXK A;  2I00 A;  2CNT A;  2Q04 A;  3R1K A;  1NE9 A;  3W6S A;  1KUY A;  2WPW A;  3CXP A;  4NCZ A;  4KUB A;  4RS2 A;  4XNH B;  3TTH A;  1XMT A;  2FE7 A;  2B4B A;  1Z4R A;  1TIQ A;  1M4D A;  1P0H A;  2VQY A;  3S6H A;  5KTC A;  4KVX A;  3TFY A;  4CAV A;  3IGR A;  4K30 A;  2BUE A;  5H84 A;  4CRY B;  1V0C A;  3BJ7 A;  1MK4 A;  1XIX A;  4U9Z A;  3D8P A;  1XEB A;  3QAH A;  4HNX B;  4HNW B;  3S6K A;  2JDD A;  4IF5 A;  2FXF A;  3W6X A;  3T90 A;  3FYN A;  4XPL A;  3DDD A;  4ZBG A;  5F48 A;  4LX9 A;  3TO7 A;  3I3G A;  1I12 A;  4R3L A;  2QML A;  4MI4 A;  2OB0 A;  5F46 A;  2FSR A;  1R57 A;  3F8K A;  5F49 A;  1I1D A;  3R9G A;  4PK3 A;  4UWI A;  3TCV A;  2PRB A;  3FB3 A;  1QST A;  4E2A A;  4U5Y A;  4IUS A;  4OAD A;  1PU9 A;  3G8W A;  4H6U A;  1PUA A;  2OZU A;  1S5K A;  4R3K A;  3BJ8 A;  2GAN A;  2CNS A;  4FD6 A;  1S3Z A;  3SXN A;  1Z9U A;  2ZXV A;  4PSX A;  2J8N A;  1QSR A;  1XF8 A;  3DR8 A;  2F5I A;  5C82 A;  2Z0Z A;  4YFJ A;  1VKC A;  5IB0 A;  2REE A;  3EY5 A;  2G3T A;  1Y7R A;  2G3A A;  1QSN A;  1QSO A;  2FT0 A;  2B3U A;  2R98 A;  3FNC A;  1MJ9 A;  2PSW A;  4F6A A;  4H89 A;  1CJW A;  3EXN A;  3DR6 A;  3TO6 A;  2ZW5 A;  2EUI A;  4R9M A;  2Q7B A;  3D2P A;  3ZZI A;  2PR8 A;  3FIX A;  1YVK A;  3GYA A;  4LUA A;  4AG9 A;  2JLM A;  4M3S A;  3V8I A;  3F0A A;  2Y0M A;  4CS0 B;  1Q2Y A;  4AVC A;  2OU2 A;  4E0A A;  4Y49 C;  2BEI A;  5EC4 A;  1ON0 A;  4YRH A;  5IV0 A;  1P4N A;  2K5T A;  2FS5 A;  3FRM A;  2VZZ A;  5CNP A;  4OAE A;  4KOX A;  3SXO A;  4B5P B;  2Q44 A;  2B4D A;  3NE7 A;  2Q4Y A;  1YR0 A;  1KUX A;  2BL1 A;  2HQY A;  1Y9W A;  5KTD A;  3IWG A;  4X5K A;  2GE3 A;  5JPH A;  1UFH A;  3WR7 A;  4KOS A;  2ZW6 A;  4JXR A;  4CAX A;  2O28 A;  4F0Y A;  4AG7 A;  2VZY A;  1YLE A;  1N71 A;  2PDO A;  3VWE A;  4UWJ A;  2OZH A;  3LD2 A;  3DNS A;  1VHS A;  4KOU A;  5C88 A;  4YGO A;  4DNC A;  1U6M A;  4E8O A;  2A4N A;  3W91 A;  1BO4 A;  1FY7 A;  4QVT A;  1S60 A;  3P2H A;  2X7B A;  4HKF A;  2D4O A;  2JEV A;  3ZJ0 A;  5ISV A;  1IB1 E;  4KZT A;  1WK4 A;  4GS4 A;  5EBV A;  3KKW A;  4H6Z A;  2Q0Y A;  4MHD A;  2B5G B;  4QUS A;  4CRZ B;  1YK3 A;  2NMT A;  2KCW A;  4XPD C;  5FVJ A;  4ORF A;  2HUZ A;  4NSQ A;  2VBQ A;  4UBR A;  1S7K A;  3H4Q A;  1LRZ A;  3R9E A;  2P6G A;  3QB8 A;  3PP9 A;  1BOB A;  3B8G A;  3DSB A;  3BLN A;  4NXY A;  2PQ8 A;  4QB9 A;  1I21 A;  3TO9 A;  1YRE A;  4CAW A;  3F5B A;  4KVM E;  1S7N A;  4NEX A;  4NF1 A;  1Y9K A;  1Z4E A;  4KVO E;  2IL4 A;  1YVO A;  2G0B A;  3CXQ A;  1M4G A;  1KUV A;  5I0C A;  2AJ6 A;  2PR1 A;  1M44 A; 
#chains in the Genus database with same CATH topology
 5KTA A;  2GLJ A;  5LYD A;  3KI9 A;  4PXE A;  2PJB A;  1BLL E;  2OR4 A;  1OZP A;  4L8A A;  2P0W A;  4R57 A;  4A39 A;  4A30 A;  4BIN A;  1BAV A;  1BPM A;  2WPX A;  5G22 A;  3MN8 A;  3EO4 A;  4MXU A;  3DGV A;  4JD6 A;  4MY0 A;  4PPZ A;  5CBM A;  1IYL A;  4RN7 A;  1YX0 A;  3GKR A;  1LOK A;  2I79 A;  1GHE A;  5IB9 A;  4KSA A;  5F09 A;  4KOW A;  3UY5 A;  1GYT A;  3RYO A;  3B35 A;  2AFO A;  2Q7S A;  4G1P A;  4X3R A;  1FT7 A;  3KZW A;  4RI1 A;  4M6I A;  3IU1 A;  4OC5 A;  4NJQ A;  4P10 A;  3IO1 A;  2PE3 A;  4P4D A;  4Q7A A;  2VI7 A;  2YNE A;  4MFP A;  2JEW A;  4Z65 A;  4UA3 A;  3RO0 A;  2DXQ A;  1NSL A;  1PYT B;  1JQG A;  1K4J A;  4UF4 A;  4OC3 A;  2ZW7 A;  4BMH A;  3PB6 X;  2PJ3 A;  1YGH A;  3VWD A;  2PJ5 A;  3D2M A;  1XMB A;  3DLJ A;  3NE8 A;  1CM0 A;  3PZJ A;  4FD5 A;  4F9U A;  5AG5 A;  2GIV A;  3GY9 A;  1MJA A;  1IGB A;  4AVA A;  2Q43 A;  2EK8 A;  1ZG7 A;  4PXB A;  3S6G A;  5H86 A;  3VH9 A;  2R7H A;  3TC8 A;  4CGN A;  4MJ8 A;  4UFV A;  2B3V A;  3R96 A;  2JDC A;  2Z11 A;  4M6H A;  5LRK A;  4Y49 B;  2AE6 A;  3B3W A;  2PJC A;  2R1I A;  5GCN A;  1SQH A;  3PB9 X;  3S6F A;  1S7F A;  2PJ2 A;  4GXH A;  5K8N A;  1J4J A;  1H8L A;  1A2Z A;  2B4D B;  2PC1 A;  2ARH A;  4CAF A;  2OH1 A;  3JUW A;  1B87 A;  2EBJ A;  2GU2 A;  2J9A A;  2RFH A;  2VL1 A;  4KUA A;  5DS0 A;  3TT2 A;  4CGL A;  4DUK A;  3S9M A;  3D7D A;  2QVP A;  4KOR A;  4MRI A;  5J8C A;  2EO8 A;  3JVN A;  1TKJ A;  3H8F A;  1IYK A;  4XPK A;  2CY2 A;  1NMT A;  2Z3M A;  1HEE A;  3PFE A;  1B6B A;  4OC1 A;  3K2K A;  4MBU A;  3T9Y A;  5LYF A;  4KOV A;  5J8F A;  2EVN A;  4NGN A;  1CPS A;  1TKF A;  2B5G A;  4P4F A;  2VEZ A;  1IIC A;  2POK A;  4JLY A;  1M1D A;  4CYN A;  4LQ6 A;  4PV6 A;  1XBU A;  3G3S A;  4HNY B;  3GLJ A;  4MHY A;  4R87 A;  5K8M A;  1RO5 A;  2ZEO A;  1DTD A;  4AVB A;  1ELL P;  4OC0 A;  4C2Z A;  3TE4 A;  4II9 A;  4M85 A;  5LRJ A;  1ARM A;  2Z3L A;  1XE4 A;  1RXT A;  4I49 A;  4X2T A;  5HH1 A;  4TWE A;  3LAC A;  3FEC A;  2Q4V A;  3C26 A;  3KQX A;  4UIB A;  1YQE A;  3N7Z A;  4R6T A;  4F8Z A;  2JBJ A;  1OBR A;  4JJX A;  5JQ4 A;  2QEC A;  3JTK A;  4JWP A;  1M4I A;  2REF A;  2V8D A;  1Q2D A;  2B58 A;  2C27 A;  2HV2 A;  3SHP A;  1Q2C A;  2DF5 A;  5HMN A;  3FXT A;  5F47 A;  3EC4 A;  3EFA A;  3PGP A;  4PSW A;  2XEI A;  1DE4 C;  4QBJ A;  4P44 A;  4A95 A;  4OLL A;  2RC4 A;  2P6F A;  4B5O A;  3MGD A;  1QQ9 A;  1Y0R A;  2R8V A;  2D4P A;  8CPA A;  2ZW4 A;  2XEG A;  2XEJ A;  4WWV A;  1HDQ A;  3CXS A;  4CAE A;  4ZGY B;  2OZG A;  3LOD A;  2DEA A;  5HVF A;  2QIR A;  4PK2 A;  4U9Y A;  3E0K A;  5E96 A;  1IID A;  4MHP A;  1IOI A;  3K9U A;  5D29 A;  4JZ0 A;  5DWN A;  2EK9 A;  5LYI A;  3NH5 A;  2PJ4 A;  3R95 A;  1WWZ A;  4FD7 A;  4A37 A;  4MY3 A;  2Z10 A;  1QSM A;  1VHO A;  4J3G A;  4AXV A;  1KZF A;  3R9F A;  3N5F A;  3IU2 A;  2WSA A;  3TX8 A;  3WC6 A;  4ONW A;  2C6P A;  4DYO A;  2AFU A;  4KOT A;  3IEH A;  2P6E A;  2ZPA A;  2J8R A;  4NFR A;  3SJG A;  3TOB A;  4AB7 A;  4DJL A;  4OKO A;  5IX3 A;  3K9T A;  4KOY A;  4FUU A;  3MRU A;  4KLV A;  4ZY0 A;  2FIW A;  4GM5 A;  4XNH C;  4HPS A;  4XPD B;  3IFE A;  5AG6 A;  3FBU A;  3IJ3 A;  4L89 A;  1Z8W A;  2XEF A;  1XRY A;  4UEF A;  1YW6 A;  1CPX A;  2BSW A;  2H5M A;  2BCO A;  2FIA A;  4P6Y A;  1AMP A;  3ISZ A;  4NGR A;  4Q36 A;  1LAN A;  4B6Z A;  4UEZ A;  4MCS A;  3CDX A;  5D8N A;  4QC6 A;  3B3V A;  4B13 A;  4ONU A;  4C68 A;  3SJX A;  3FVL A;  1F2O A;  2DPS A;  4IK2 A;  4X8I A;  1R43 A;  2PJ0 A;  3BI1 A;  4B5P A;  1MJB A;  1S7L A;  3LMS A;  4FD4 A;  5I4M A;  4FWU A;  5DWM A;  3PBB A;  1LAP A;  2AFX A;  2NSM A;  4KLW A;  4B12 A;  3OWC A;  2Z3N A;  4ZX9 A;  2ZEE A;  4PQA A;  3D3S A;  3TOA A;  3P2F A;  2ATR A;  4JXQ A;  2OOT A;  2CNM A;  5A27 A;  4MFZ A;  3VAT A;  1PCA A;  3I9S A;  3KHX A;  2FL4 A;  2J8M A;  1L0C A;  2FCK A;  2ZED A;  1Y7E A;  4EVY A;  1TF9 A;  4R76 A;  3H8E A;  2VXK A;  3PBE A;  2I00 A;  3WAB A;  2CNT A;  2Q04 A;  3R1K A;  1NE9 A;  3W6S A;  1KUY A;  2WPW A;  3CXP A;  4NCZ A;  4KUB A;  4OC4 A;  4RS2 A;  2PJ8 A;  1Z2L A;  4UCN A;  4XNH B;  4A33 A;  3TTH A;  1XMT A;  5BWA B;  4R8F A;  3SI1 A;  3BXM A;  2FE7 A;  2V8V A;  2B4B A;  3S9L A;  2PJ1 A;  1Z4R A;  2IQ6 A;  3CPX A;  4OC2 A;  5JGF A;  2IMO A;  1M4D A;  1TIQ A;  4OME A;  1P0H A;  3NFZ A;  2VQY A;  3IWE A;  3S6H A;  4A2Z A;  5KTC A;  4KVX A;  3TFY A;  4CAV A;  3IC1 A;  3IGR A;  3V38 A;  5HVH A;  1CX8 A;  4PXC A;  2CTB A;  2V8G A;  1X12 A;  4K30 A;  1Z8X A;  3BHX A;  2BUE A;  1YLO A;  3QAY A;  3FEE A;  1IOF A;  4MFK A;  5H84 A;  4CRY B;  4ZY1 A;  1V0C A;  3BJ7 A;  1MK4 A;  5J1Q A;  1XIX A;  4WJB A;  4U9Z A;  3D8P A;  1RTQ A;  1XEB A;  2NYQ A;  2C6C A;  3QAH A;  4HNW B;  4HNX B;  5AGE A;  4C2X A;  3BI0 A;  2C1C A;  4MFJ A;  1ZLI A;  2JDD A;  3S6K A;  4IF5 A;  2FXF A;  3WC5 A;  3W6X A;  4FBE A;  3RNZ A;  3T90 A;  3FYN A;  2DPT A;  3DDD A;  4XPL A;  4ZBG A;  4EFD A;  4MCQ A;  5F48 A;  1YW4 A;  2PJ9 A;  4KSF A;  4LX9 A;  5G20 A;  3I3G A;  3TO7 A;  1I12 A;  1Y0Y A;  2QML A;  4MI4 A;  2OB0 A;  4R3L A;  2CF4 A;  5F46 A;  2FSR A;  1TKH A;  1R57 A;  4ZI6 A;  2Q51 A;  3F8K A;  4B10 A;  4H2K A;  4BBH A;  5F49 A;  3IWW A;  4MFQ A;  2ZOG A;  1I1D A;  3RZA A;  3R9G A;  4PK3 A;  2YNC A;  4UWI A;  3TCV A;  7CPA A;  2PRB A;  1AUG A;  4UCM A;  3FB3 A;  1QST A;  1ZO0 A;  3JRU A;  4U5Y A;  4IUS A;  4E2A A;  4OAD A;  1PU9 A;  4CPA A;  1CP7 A;  1VHE A;  4YU9 A;  3G8W A;  2AFS A;  4H6U A;  1PUA A;  2OZU A;  1S5K A;  4NGT A;  2I3C A;  4R3K A;  2CIJ A;  3BJ8 A;  3D7G A;  2GAN A;  2CNS A;  4KS9 A;  5G21 A;  2AFM A;  1CBX A;  3D67 A;  1S3Z A;  4FD6 A;  1R3N A;  5LRG A;  3SXN A;  1Z9U A;  2BOA A;  3L2N A;  2ODF A;  2ZXV A;  4CGM A;  2RB7 A;  1BPN A;  3KQZ A;  4PSX A;  4B11 A;  2J8N A;  4MCR A;  3B3T A;  2EWB A;  1QSR A;  2CXA A;  4NGP A;  1XF8 A;  4A32 A;  2PCU A;  3HUV A;  3DR8 A;  2F5I A;  5C82 A;  2Z0Z A;  1EE3 P;  4YFJ A;  5JH9 A;  1VKC A;  3HLP A;  5IB0 A;  3PB8 X;  4W9Y A;  1Q7L A;  4NGM A;  5AG7 A;  3T8W A;  2PVV A;  2REE A;  4NGS A;  3EY5 A;  4TNU A;  2G3T A;  1Y7R A;  1HDU A;  1QSN A;  1QSO A;  2FT0 A;  2B3U A;  2G3A A;  2R98 A;  3D4U A;  4CYO A;  5THW A;  3FNC A;  3B7I A;  4IHM A;  5K8P A;  3PB7 X;  1MJ9 A;  2ZEL A;  2PSW A;  4F6A A;  4H89 A;  1CJW A;  4C7H A;  3EXN A;  3DR6 A;  2G9D A;  3TO6 A;  2ZW5 A;  2EUI A;  5EMI A;  4UIA A;  4UEE A;  4R9M A;  2Q7B A;  3D2P A;  3KR4 A;  1ELM P;  2F7V A;  2PR8 A;  3ZZI A;  1Z8T A;  5A28 A;  1F57 A;  3SI0 A;  3FIX A;  1YVK A;  4P45 A;  3GYA A;  4LUA A;  4P4E A;  4AG9 A;  5G1Z A;  1F2P A;  5CPA A;  4OP4 A;  2JLM A;  4M3S A;  3V8I A;  3F0A A;  4UFX A;  4ZYQ A;  2Y0M A;  1XFO A;  1Z8L A;  3CZX A;  4CS0 B;  1Q2Y A;  4AVC A;  2OU2 A;  4E0A A;  4Y49 C;  4P4I A;  2PVW A;  2BEI A;  2BO9 A;  4NGQ A;  3VAR A;  1UWY A;  1XJO A;  5EC4 A;  1NSA A;  2Z3O A;  1ON0 A;  4YRH A;  2ZEF A;  3CPA A;  4IAV A;  5IV0 A;  1P4N A;  2CTC A;  3FMC A;  4K3N A;  3RAM A;  3I1U A;  2K5T A;  1VGY A;  1JWQ A;  2FS5 A;  2WYR A;  3FRM A;  2VZZ A;  2WUU A;  5CNP A;  4C2Y A;  4PXD A;  1QMU A;  4OAE A;  4KOX A;  4B14 A;  3SXO A;  4B5P B;  6CPA A;  3B3C A;  3WT4 A;  3LWU A;  2Q44 A;  4Q38 A;  2IJZ A;  2B4D A;  4MCP A;  1IY7 A;  2ZEN A;  3NE7 A;  4MFL A;  5JM6 A;  1Z5R A;  3CT9 A;  2Q4Y A;  3KGQ A;  1YR0 A;  1KUX A;  2BL1 A;  2HQY A;  3FX6 A;  4OID A;  1Y9W A;  4CYP A;  2GRE A;  3KAS A;  2ZOF A;  5KTD A;  3IWG A;  4X5K A;  3S9N A;  2GE3 A;  1YSJ A;  4M6G A;  2ZEG A;  3PRT A;  2Z3K A;  4BD9 A;  5JPH A;  1LAM A;  4UFW A;  1UFH A;  2FVG A;  3WR7 A;  5K8O A;  4KOS A;  2ZW6 A;  4A94 A;  4JXR A;  2O4H A;  3FF3 A;  3FED A;  4CAX A;  2O28 A;  4F0Y A;  4AG7 A;  4FAI A;  2VZY A;  3D7H A;  1YLE A;  5ELY A;  1LFW A;  1N71 A;  2PDO A;  3VWE A;  2F8H A;  3D68 A;  2OZH A;  4UWJ A;  3LD2 A;  3DNS A;  1VHS A;  2GFQ A;  1ZLH A;  4CGO A;  2HC9 A;  4F9V A;  3FH4 A;  2WZN A;  4KOU A;  4LQG A;  5C88 A;  3H8G A;  1CP6 A;  2YND A;  2YNC C;  2Q4Z A;  4YGO A;  3SI2 A;  4DNC A;  5LYL A;  1U6M A;  1X10 A;  2A4N A;  4E8O A;  4OIW A;  2PIZ A;  3B3S A;  3W91 A;  1BO4 A;  1FY7 A;  4QVT A;  3SJF A;  1S60 A;  5HVG A;  3P2H A;  3NH4 A;  2JBK A;  2X7B A;  4EME A;  4HKF A;  2D4O A;  5HXD A;  2JEV A;  4CGP A;  4NJR A;  3ZJ0 A;  5ISV A;  1IB1 E;  4KZT A;  4O23 A;  1LCP A;  2YGW A;  4RUH A;  4UCP A;  1WK4 A;  3PB4 X;  4GS4 A;  5EBV A;  3D66 A;  3KKW A;  3WC7 A;  4H6Z A;  2Q0Y A;  4MHD A;  2O53 A;  2B5G B;  2V77 A;  3B2Y A;  4MHZ A;  4QUS A;  4CRZ B;  1YK3 A;  3GB0 A;  3NA6 A;  2AFZ A;  2NMT A;  4KSI A;  2QYV A;  2KCW A;  1ZG9 A;  4A31 A;  2ABZ A;  3H5Z A;  4P4B A;  2ZEH A;  3QNV A;  4ORF A;  4XPD C;  5FVJ A;  1FNO A;  3KR5 A;  4A38 A;  2HUZ A;  2ZEP A;  4ZX8 A;  4C7I A;  4NSQ A;  5AG4 A;  3SJE A;  1M4L A;  2AFW A;  2ANP A;  1ZG8 A;  3D7F A;  2VBQ A;  3RBU A;  4UBR A;  1S7K A;  3H4Q A;  1LRZ A;  3R9E A;  1VIX A;  2P6G A;  3QB8 A;  3PP9 A;  4ZY2 A;  1BOB A;  2PJ6 A;  3B8G A;  3DSB A;  3BLN A;  3IIB A;  4NXY A;  2PQ8 A;  2GLF A;  4QB9 A;  3GIU A;  1I21 A;  3ISX A;  1CG2 A;  3FJU A;  3TO9 A;  2V8H A;  1YRE A;  4CAW A;  2C6G A;  3F5B A;  1S7N A;  1TXR A;  4KVM E;  1ARL A;  4MMO A;  4NEX A;  4NF1 A;  1TF8 A;  1Y9K A;  2PJ7 A;  1Z4E A;  3GUX A;  4KVO E;  3PFO A;  3KL9 A;  1XOV A;  2IL4 A;  1YVO A;  2G0B A;  3CXQ A;  3NH8 A;  4YWY A;  4P4J A;  1KWM A;  3A9L A;  2Z3P A;  1M4G A;  2QJ8 A;  1KUV A;  1IU8 A;  3PEI A;  1YME A;  4JYW A;  2HB6 A;  4EWT A;  3V7Z A;  2AJ6 A;  1AYE A;  2PIY A;  4MHN A;  4R7M A;  5I0C A;  2PJA A;  4F0X A;  2PRQ A;  3KHZ A;  2PR1 A;  2ZEM A;  4CYQ A;  1M44 A; 
#chains in the Genus database with same CATH homology
 5KTA A;  1OZP A;  4L8A A;  2P0W A;  4R57 A;  4A30 A;  2WPX A;  5G22 A;  3EO4 A;  4JD6 A;  4MY0 A;  1IYL A;  1YX0 A;  3GKR A;  2I79 A;  1GHE A;  4KSA A;  4KOW A;  3UY5 A;  3RYO A;  4RI1 A;  3IU1 A;  2VI7 A;  2YNE A;  4MFP A;  4UA3 A;  2DXQ A;  1NSL A;  1K4J A;  2ZW7 A;  4BMH A;  3VWD A;  1YGH A;  4FD5 A;  3D2M A;  3PZJ A;  1CM0 A;  5AG5 A;  2GIV A;  3GY9 A;  1MJA A;  4AVA A;  3S6G A;  5H86 A;  2R7H A;  4CGN A;  4MJ8 A;  4UFV A;  2B3V A;  3R96 A;  2JDC A;  2Z11 A;  4Y49 B;  2AE6 A;  2R1I A;  5GCN A;  1SQH A;  3S6F A;  1S7F A;  1J4J A;  2B4D B;  2PC1 A;  2ARH A;  4CAF A;  2OH1 A;  3JUW A;  1B87 A;  4KUA A;  3TT2 A;  4CGL A;  4KOR A;  5J8C A;  3JVN A;  1IYK A;  4XPK A;  2CY2 A;  1NMT A;  2Z3M A;  3T9Y A;  1B6B A;  4MBU A;  4KOV A;  5J8F A;  2EVN A;  2B5G A;  2VEZ A;  1IIC A;  4JLY A;  4CYN A;  1M1D A;  4PV6 A;  4R87 A;  3G3S A;  4HNY B;  1RO5 A;  4AVB A;  3TE4 A;  4C2Z A;  4II9 A;  4M85 A;  2Z3L A;  1XE4 A;  1RXT A;  4I49 A;  5HH1 A;  2Q4V A;  3C26 A;  3N7Z A;  4JJX A;  5JQ4 A;  2QEC A;  3JTK A;  4JWP A;  1M4I A;  2REF A;  3SHP A;  1Q2D A;  2B58 A;  2C27 A;  2HV2 A;  1Q2C A;  5HMN A;  3FXT A;  5F47 A;  3EC4 A;  3EFA A;  3PGP A;  4PSW A;  4QBJ A;  4A95 A;  4OLL A;  2RC4 A;  2P6F A;  4B5O A;  3MGD A;  2R8V A;  2D4P A;  2ZW4 A;  3CXS A;  4CAE A;  4ZGY B;  2OZG A;  3LOD A;  2QIR A;  4PK2 A;  4U9Y A;  3E0K A;  5E96 A;  1IID A;  3K9U A;  5DWN A;  3R95 A;  1WWZ A;  4FD7 A;  4MY3 A;  2Z10 A;  1QSM A;  4J3G A;  1KZF A;  3R9F A;  3IU2 A;  2WSA A;  4KOT A;  4AB7 A;  2P6E A;  2ZPA A;  2J8R A;  3TOB A;  5IX3 A;  4KOY A;  4KLV A;  2FIW A;  4XNH C;  4XPD B;  5AG6 A;  3FBU A;  4L89 A;  2BSW A;  2H5M A;  2FIA A;  4Q36 A;  4QC6 A;  4B13 A;  4C68 A;  4ONU A;  2DPS A;  4B5P A;  1MJB A;  1S7L A;  4FD4 A;  5DWM A;  4KLW A;  4B12 A;  3OWC A;  2Z3N A;  3D3S A;  3TOA A;  3P2F A;  2ATR A;  4JXQ A;  2CNM A;  5A27 A;  4MFZ A;  3I9S A;  2FL4 A;  2J8M A;  1L0C A;  2FCK A;  4EVY A;  2VXK A;  2I00 A;  2CNT A;  2Q04 A;  3R1K A;  1NE9 A;  3W6S A;  1KUY A;  2WPW A;  3CXP A;  4NCZ A;  4KUB A;  4RS2 A;  4UCN A;  4XNH B;  4A33 A;  3TTH A;  1XMT A;  5BWA B;  2FE7 A;  2B4B A;  1Z4R A;  1TIQ A;  1M4D A;  1P0H A;  2VQY A;  3IWE A;  3S6H A;  4A2Z A;  5KTC A;  4KVX A;  3TFY A;  4CAV A;  3IGR A;  4K30 A;  2BUE A;  4MFK A;  5H84 A;  4CRY B;  1V0C A;  3BJ7 A;  1MK4 A;  1XIX A;  4U9Z A;  3D8P A;  1XEB A;  3QAH A;  4HNX B;  5AGE A;  4HNW B;  4C2X A;  4MFJ A;  3S6K A;  2JDD A;  4IF5 A;  2FXF A;  3W6X A;  3T90 A;  3FYN A;  2DPT A;  3DDD A;  4XPL A;  4ZBG A;  5F48 A;  4KSF A;  4LX9 A;  5G20 A;  3TO7 A;  3I3G A;  1I12 A;  4R3L A;  2QML A;  4MI4 A;  2OB0 A;  5F46 A;  2FSR A;  1R57 A;  3F8K A;  4B10 A;  4BBH A;  5F49 A;  4MFQ A;  1I1D A;  3R9G A;  4PK3 A;  2YNC A;  4UWI A;  3TCV A;  2PRB A;  4UCM A;  3FB3 A;  1QST A;  1ZO0 A;  4E2A A;  4U5Y A;  4IUS A;  4OAD A;  1PU9 A;  3G8W A;  4H6U A;  1PUA A;  2OZU A;  1S5K A;  4R3K A;  3BJ8 A;  2GAN A;  2CNS A;  4KS9 A;  5G21 A;  4FD6 A;  1S3Z A;  3SXN A;  1Z9U A;  2ZXV A;  4CGM A;  4B11 A;  4PSX A;  2J8N A;  1QSR A;  2CXA A;  1XF8 A;  4A32 A;  3DR8 A;  2F5I A;  5C82 A;  2Z0Z A;  4YFJ A;  1VKC A;  5IB0 A;  5AG7 A;  2REE A;  3EY5 A;  2G3T A;  1Y7R A;  2G3A A;  1QSN A;  1QSO A;  2FT0 A;  2B3U A;  2R98 A;  4CYO A;  3FNC A;  1MJ9 A;  2PSW A;  4F6A A;  4H89 A;  1CJW A;  4C7H A;  3EXN A;  3DR6 A;  3TO6 A;  2ZW5 A;  2EUI A;  4R9M A;  2Q7B A;  3D2P A;  3ZZI A;  2PR8 A;  5A28 A;  3FIX A;  1YVK A;  3GYA A;  4LUA A;  4AG9 A;  5G1Z A;  2JLM A;  4M3S A;  3V8I A;  3F0A A;  4UFX A;  2Y0M A;  4CS0 B;  1Q2Y A;  4AVC A;  2OU2 A;  4E0A A;  4Y49 C;  2BEI A;  5EC4 A;  2Z3O A;  1ON0 A;  4YRH A;  5IV0 A;  1P4N A;  2K5T A;  2FS5 A;  3FRM A;  2VZZ A;  2WUU A;  5CNP A;  4C2Y A;  4OAE A;  4KOX A;  4B14 A;  3SXO A;  4B5P B;  4Q38 A;  2Q44 A;  2B4D A;  3NE7 A;  4MFL A;  2Q4Y A;  1YR0 A;  1KUX A;  2BL1 A;  2HQY A;  1Y9W A;  4CYP A;  5KTD A;  3IWG A;  4X5K A;  2GE3 A;  2Z3K A;  5JPH A;  4UFW A;  1UFH A;  3WR7 A;  4KOS A;  2ZW6 A;  4JXR A;  4CAX A;  2O28 A;  4F0Y A;  4AG7 A;  2VZY A;  1YLE A;  1N71 A;  2PDO A;  3VWE A;  4UWJ A;  2OZH A;  3LD2 A;  3DNS A;  1VHS A;  4CGO A;  4KOU A;  5C88 A;  2YND A;  2YNC C;  4YGO A;  4DNC A;  1U6M A;  4E8O A;  2A4N A;  3W91 A;  1BO4 A;  1FY7 A;  4QVT A;  1S60 A;  3P2H A;  2X7B A;  4HKF A;  2D4O A;  2JEV A;  4CGP A;  3ZJ0 A;  5ISV A;  1IB1 E;  4KZT A;  2YGW A;  4UCP A;  1WK4 A;  4GS4 A;  5EBV A;  3KKW A;  4H6Z A;  2Q0Y A;  4MHD A;  2B5G B;  4QUS A;  4CRZ B;  1YK3 A;  2NMT A;  2KCW A;  4A31 A;  3H5Z A;  4XPD C;  5FVJ A;  4ORF A;  2HUZ A;  4C7I A;  4NSQ A;  5AG4 A;  2VBQ A;  4UBR A;  1S7K A;  3H4Q A;  1LRZ A;  3R9E A;  2P6G A;  3QB8 A;  3PP9 A;  1BOB A;  3B8G A;  3DSB A;  3BLN A;  4NXY A;  2PQ8 A;  4QB9 A;  1I21 A;  3TO9 A;  1YRE A;  4CAW A;  3F5B A;  4KVM E;  1S7N A;  4NEX A;  4NF1 A;  1Y9K A;  1Z4E A;  4KVO E;  2IL4 A;  1YVO A;  2G0B A;  3CXQ A;  3A9L A;  2Z3P A;  1M4G A;  1KUV A;  5I0C A;  2AJ6 A;  4F0X A;  2PR1 A;  4CYQ A;  1M44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...