4YRHA

P21 isoform of mec-17 from danio rerio
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
184
structure length
177
Chain Sequence
DFPYDLNALFPERISVLDSNLSRPDPLPQVTTVIDELGKASSKAQQLPAPITSAAKLQANRHHLYLLKDGEQNGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tubulin N-acetyltransferase 1
publication title Structure of DrMEC-17 residue 2-185 at 2.85 Angstroms resolution
rcsb
source organism Danio rerio
molecule tags Transferase
total genus 41
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2015-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yrhA00
4MI4A 1S7KA 1FY7A 2AE6A 2P0WA 1B6BA 1CJWA 1YR0A 4RI1A 4H6ZA 5KTAA 3EXNA 5IV0A 4R9MA 2REEA 2PSWA 3SHPA 1IICA 3D2MA 3PP9A 4UA3A 2B5GB 1BOBA 3ZJ0A 4KOSA 1LRZA 1IIDA 2IL4A 1SQHA 2OB0A 2G3AA 3JVNA 4EVYA 5JQ4A 1I21A 3RYOA 4U9YA 1Q2YA 2WPXA 2Q4YA 4MJ8A 1V0CA 4R3LA 2OU2A 2B5GA 2JDDA 2FS5A 3QB8A 2VQYA 2OZGA 4KOTA 4JD6A 1K4JA 5H84A 4Y49B 3P2HA 1I1DA 1Y9WA 4KORA 3QAHA 3EO4A 1UFHA 2P6FA 1YLEA 2CY2A 2B3VA 3BLNA 1VKCA 3OWCA 3PZJA 1Z9UA 2K5TA 2ZW5A 1YREA 3DR8A 4LX9A 4KVXA 4YFJA 2B58A 5DWNA 2FIAA 2FE7A 3KKWA 4KUAA 2QECA 4NEXA 1S3ZA 2REFA 2NMTA 1YX0A 1NMTA 3EFAA 3LD2A 4R87A 2D4OA 1M4GA 2ATRA 5GCNA 3K9UA 1Y7RA 4L89A 3TFYA 3S6HA 5EC4A 1P4NA 1ON0A 2Y0MA 3TO7A 4XPLA 4XNHC 1NSLA 2BEIA 4KVME 1QSRA 2Z0ZA 3IWGA 3F0AA 5HH1A 2EVNA 2Z10A 1I12A 1S7FA 4E2AA 2PRBA 3FXTA 3NE7A 2VZYA 2R7HA 4CAXA 3T90A 3S6GA 2Z11A 2B4DB 4MBUA 4E8OA 1WWZA 2CNSA 4QBJA 2VI7A 1XIXA 3DDDA 2BL1A 1M1DA 4KVOE 4YRHA 4QUSA 1YVOA 4QC6A 4ZBGA 5E96A 2JEVA 2EUIA 4DNCA 4UWIA 2DXQA 4KLWA 3H4QA 5IX3A 1PU9A 2CNTA 4QVTA 5EBVA 1J4JA 2Q44A 3DNSA 4HNXB 3R9GA 4B5OA 3IGRA 3E0KA 2HUZA 1S60A 4HNYB 1QSNA 3R9FA 1GHEA 2J8MA 3N7ZA 2G0BA 4RS2A 1P0HA 4YGOA 2OZHA 1RXTA 5ISVA 4ORFA 2VXKA 2GIVA 4PK2A 1XMTA 2ZW7A 3TO9A 5FVJA 2ZW6A 4JXRA 1Q2CA 2WPWA 5JPHA 2PR1A 1S5KA 4CRYB 1KUYA 3GYAA 4ONUA 3WR7A 4KUBA 3S6FA 2JDCA 5F46A 5H86A 3V8IA 1YK3A 2Q4VA 2J8RA 3G8WA 4CRZB 4HKFA 2ARHA 1WK4A 3TT2A 4CAWA 4XNHB 3TE4A 4XPDB 2Q0YA 3SXNA 3W6SA 3TTHA 2QIRA 5CNPA 1RO5A 3D2PA 3DSBA 1OZPA 4MHDA 1KUVA 2KCWA 3T9YA 2RC4A 4HNWB 4GS4A 2GE3A 4KOVA 4XPKA 5C88A 2A4NA 1XE4A 4X5KA 2VEZA 4OLLA 5F49A 2I79A 2X7BA 4PV6A 3TO6A 1S7LA 2ZXVA 2FSRA 4F6AA 1MJBA 2PDOA 3FIXA 2Q7BA 4CAVA 2ZPAA 1XF8A 4I49A 4BMHA 5F47A 3GY9A 4OADA 2P6EA 3C26A 2B4DA 3PGPA 1Z4EA 3R9EA 4JWPA 3R96A 1MJ9A 5J8CA 2FIWA 2B4BA 2D4PA 5F48A 1NE9A 1S7NA 4NXYA 4R57A 1QSTA 4M85A 3TCVA 2HV2A 2QMLA 4IUSA 4FD6A 1QSOA 3UY5A 1B87A 1BO4A 1N71A 1KZFA 2FXFA 4B5PB 1MK4A 2I00A 2P6GA 4AG7A 4KLVA 5KTCA 1U6MA 3B8GA 4MY3A 4JJXA 4R3KA 3FBUA 4IF5A 4B5PA 3W91A 3FB3A 4FD5A 2BUEA 3GKRA 2R98A 2F5IA 4KOXA 4F0YA 3R1KA 2GANA 2BSWA 3BJ8A 4AVAA 2FL4A 3BJ7A 1L0CA 2OH1A 3CXQA 1IB1E 4FD4A 4U9ZA 4NCZA 2J8NA 1TIQA 4QB9A 3VWDA 5KTDA 2G3TA 4PSWA 4UWJA 3DR6A 2PR8A 3TOBA 2O28A 1M44A 1YVKA 2ZW4A 3W6XA 1IYKA 1VHSA 4LUAA 2JLMA 3TOAA 2Q04A 2FCKA 4PSXA 3JUWA 4UBRA 1MJAA 4MY0A 3LODA 1XEBA 5DWMA 5IB0A 4KOWA 2R1IA 4KZTA 3SXOA 2VZZA 3I9SA 4NF1A 4CS0B 3FRMA 2CNMA 4H89A 4Y49C 1CM0A 2AJ6A 3S6KA 3P2FA 4J3GA 3MGDA 2FT0A 3FNCA 3F5BA 3EC4A 1Z4RA 3I3GA 4K30A 4KOYA 5I0CA 1R57A 5J8FA 4H6UA 2PC1A 3F8KA 2H5MA 1M4IA 2C27A 3D8PA 3ZZIA 1IYLA 3G3SA 3CXSA 2B3UA 2VBQA 4FD7A 1PUAA 3R95A 2HQYA 4XPDC 4AVCA 3FYNA 4AVBA 1QSMA 4M3SA 2PQ8A 2OZUA 4JLYA 4II9A 4L8AA 1M4DA 4PK3A 4AG9A 5C82A 1KUXA 3EY5A 4JXQA 3VWEA 5HMNA 1YGHA 1Y9KA 4NSQA 3D3SA 4OAEA 3CXPA 4AB7A 4E0AA 4U5YA 1Q2DA 2R8VA 4KOUA
chains in the Genus database with same CATH superfamily
6CPAA 5LYIA 3SJEA 4MI4A 2V8GA 1FNOA 1JQGA 4NFRA 1S7KA 1NSAA 3KHZA 4Q36A 5BWAB 1FY7A 1HEEA 2AE6A 2P0WA 3DLJA 3IU1A 3KR5A 4X2TA 4C68A 1B6BA 1CJWA 1F2PA 1F2OA 4MCRA 1YR0A 3GIUA 3RZAA 4RI1A 4H6ZA 5KTAA 3EXNA 5IV0A 5LYLA 4A37A 4OIDA 1M4LA 3K2KA 1BAVA 2HC9A 4R9MA 4B11A 1TKFA 2REEA 2PSWA 4MCQA 2YNCA 3SHPA 1IICA 3D2MA 3PP9A 4UA3A 2B5GB 1BOBA 4NGMA 3ZJ0A 4KOSA 1LRZA 1IIDA 2IL4A 1SQHA 4MRIA 4OC1A 2OB0A 4P4FA 1CP6A 3BI1A 2G3AA 3JVNA 4EVYA 4A33A 5JQ4A 1I21A 3SI1A 4C2ZA 4ZI6A 3RYOA 4U9YA 1Q2YA 2WPXA 2Q4YA 1CX8A 2Z3NA 4M6GA 2AFUA 1ZG7A 4MJ8A 3PBEA 1VHEA 3WABA 4BINA 1V0CA 4R3LA 2OU2A 3PB8X 4UF4A 2B5GA 2JDDA 4OC0A 2FS5A 3QB8A 3BHXA 3H8EA 4OC2A 5A27A 4OC5A 2VQYA 2OZGA 4B10A 4KOTA 4JD6A 1K4JA 4CYOA 5H84A 2G9DA 4Y49B 3P2HA 1I1DA 1Y9WA 3NH4A 3V7ZA 4KORA 3QAHA 2V8HA 1F57A 2F7VA 4ZY0A 3EO4A 1TKJA 1UFHA 3NH8A 2ANPA 2P6FA 3PFEA 4NGTA 2EK8A 3IIBA 1XFOA 1YLEA 1Q7LA 2CY2A 2B3VA 4PXDA 4ONWA 4R6TA 1IOFA 3MRUA 3BLNA 3NFZA 4MHYA 1VKCA 3OWCA 3PZJA 1Z9UA 1KWMA 2PJ9A 4GM5A 3JTKA 2BCOA 3H8GA 1Z5RA 2K5TA 2ZW5A 4K3NA 3S9LA 5JH9A 1YREA 3DR8A 2V77A 4LX9A 4KVXA 4YFJA 2B58A 5DWNA 2FIAA 5AG4A 2FE7A 3KKWA 4KUAA 4NJQA 4A30A 5LRJA 2QECA 5J1QA 3KQZA 4NEXA 1XRYA 2DF5A 4UCNA 1S3ZA 2REFA 2NMTA 1YX0A 1NMTA 2ZEOA 3EFAA 2DEAA 3LD2A 3FEDA 4R87A 4NJRA 2D4OA 2EK9A 1LCPA 3D7HA 1M4GA 2ATRA 3PB7X 5D8NA 3K9UA 5GCNA 4ZGYB 2OR4A 2VL1A 4OIWA 1Y7RA 4L89A 5K8MA 3TFYA 4F8ZA 4OC3A 5EC4A 3S6HA 1ZG8A 4F9UA 1LOKA 1P4NA 1ON0A 2Y0MA 3PRTA 3NH5A 3TO7A 2CTBA 4XPLA 4DJLA 3FECA 4XNHC 1NSLA 2BEIA 1Z2LA 4KVME 1X12A 1AMPA 4YWYA 5JGFA 1QSRA 2Z0ZA 2BO9A 3F0AA 3IWGA 5HH1A 2EVNA 3IJ3A 2Z10A 1I12A 4LQ6A 4X8IA 1S7FA 2PVVA 1UWYA 4CAEA 4E2AA 2ZEMA 2PRBA 4P6YA 3IEHA 5I4MA 3FXTA 3NE7A 1Z8TA 2VZYA 2R7HA 4CAXA 2IMOA 3S6GA 3T90A 2Z11A 3SJGA 2B4DB 4MBUA 4E8OA 3IWWA 1WWZA 2CNSA 4QBJA 4MFQA 2VI7A 1ZO0A 5ELYA 5HVFA 1XIXA 2AFWA 3DDDA 3VH9A 2BL1A 1M1DA 4KVOE 4YRHA 4QUSA 2AFXA 2PJ4A 3B3CA 1YVOA 4UFWA 3IC1A 2CF4A 4QC6A 3T8WA 4A38A 2FVGA 5AG7A 4KSIA 4ZBGA 5E96A 4UEEA 1JWQA 3HLPA 3FX6A 4CGLA 2JEVA 4P4BA 5HXDA 2EUIA 4R76A 4DNCA 4UWIA 4C7IA 2DXQA 3PBBA 4KLWA 1CPSA 3H4QA 4UEFA 2Q51A 2WYRA 3QNVA 5AGEA 5IX3A 1PU9A 4JZ0A 2CNTA 4QVTA 5EBVA 1J4JA 2Z3MA 5A28A 2Q44A 1DTDA 1TXRA 3DNSA 4HNXB 4OMEA 3R9GA 3MN8A 5AG6A 2QVPA 2ZEGA 1IY7A 5LRKA 2IQ6A 2GLFA 4B5OA 2GREA 3IGRA 3PFOA 3E0KA 1LAMA 3BXMA 2HUZA 1S60A 4HNYB 4Z65A 1Y0YA 4NGSA 1QSNA 3R9FA 1H8LA 2PIZA 4EWTA 1GHEA 2J8MA 2Z3OA 1CBXA 3N7ZA 1YW4A 2G0BA 2O4HA 4RS2A 3VATA 4MHPA 3B3WA 2ZEDA 1P0HA 3WC6A 4YGOA 4DYOA 2OZHA 4MFKA 1HDQA 1RXTA 4C2XA 3KI9A 5F09A 4M6IA 5ISVA 4PXBA 4ORFA 2VXKA 1YLOA 4OC4A 4A2ZA 2GIVA 4PK2A 1XMTA 2ZW7A 3TO9A 5FVJA 2PJCA 4P44A 1IOIA 4HPSA 2PJ7A 2ZW6A 2ZEFA 4JXRA 4CGMA 5K8NA 1Q2CA 2WPWA 2YNCC 5LYDA 2PJBA 5JPHA 2PR1A 1S5KA 3KASA 4MFJA 4MFPA 3RO0A 4CRYB 1KUYA 3GYAA 2C6CA 4TWEA 4ONUA 3WR7A 3FVLA 2ZOGA 4KUBA 3S6FA 2JDCA 5F46A 2C6PA 2PJ5A 5H86A 2I3CA 4RUHA 4WJBA 3V8IA 1YK3A 2ABZA 2JEWA 2GFQA 2J8RA 2PJ0A 2Q4VA 3G8WA 4CRZB 4HKFA 2ARHA 4FAIA 3KL9A 5G21A 1WK4A 1AUGA 3S9MA 3GB0A 3FH4A 3TT2A 3ISXA 1ZLIA 4OKOA 2V8DA 3CZXA 2Q7SA 3SJFA 4CAWA 4XNHB 2Z3PA 3IU2A 3TE4A 2JBJA 4XPDB 2Q0YA 3SJXA 1CP7A 1QQ9A 4W9YA 3SXNA 5K8PA 3W6SA 3B3SA 3TTHA 2QIRA 2V8VA 2GU2A 5CPAA 2PE3A 4O23A 4CGPA 2WSAA 1HDUA 1Y7EA 1PCAA 4CGNA 5CNPA 1RO5A 1YMEA 3D2PA 3DSBA 4Q38A 1OZPA 4MHDA 3B3VA 2EBJA 5LRGA 1Z8WA 1KUVA 4BBHA 2KCWA 3T9YA 2RC4A 4HNWB 2NSMA 5G22A 2ZENA 4GS4A 4CYNA 4A32A 2GE3A 2PRQA 1ARLA 4KOVA 4XPKA 4C7HA 5C88A 2A4NA 1XE4A 4MHNA 4X5KA 2VEZA 1CG2A 4OLLA 1ZLHA 5F49A 2I79A 2X7BA 4PV6A 3TO6A 3WC7A 2WUUA 1S7LA 1ELLP 2ZXVA 4AXVA 3FMCA 4UIBA 2FSRA 1TF8A 3ISZA 1AYEA 3WT4A 2J9AA 4TNUA 3B2YA 2PCUA 2NYQA 3LWUA 5AG5A 1MJBA 4EMEA 4F6AA 2PDOA 2QJ8A 3FIXA 4C2YA 1DE4C 3CT9A 1ELMP 2AFOA 3D7GA 1YQEA 4ZX8A 2Q7BA 4CAVA 2ZPAA 4PQAA 1XF8A 4I49A 4BMHA 2XEFA 5F47A 3GY9A 2BOAA 4OADA 2P6EA 3C26A 2GLJA 2DPSA 2IJZA 2B4DA 3PGPA 1Z4EA 3R9EA 4JWPA 3R96A 4G1PA 1MJ9A 4UIAA 5J8CA 4P4IA 4UCMA 2FIWA 2B4BA 4MXUA 2D4PA 4MCPA 4RN7A 1A2ZA 2ZELA 2CTCA 3IWEA 5F48A 1R43A 2RB7A 1NE9A 1S7NA 1XMBA 4NXYA 4R57A 1QSTA 4M85A 5G20A 3TCVA 1RTQA 1YSJA 2C1CA 3KHXA 2HV2A 2QMLA 4IUSA 4NGQA 3FJUA 3RBUA 2Q43A 4FD6A 4MFZA 4R7MA 4NGPA 4PPZA 4IK2A 3D7FA 1BLLE 1QSOA 3UY5A 1B87A 1BO4A 1N71A 1KZFA 2FXFA 1XJOA 4B5PB 1MK4A 4ZX9A 2I00A 2XEGA 2ZEEA 2P6GA 2CXAA 4FWUA 4KS9A 4AG7A 4KLVA 4FBEA 2ODFA 4F9VA 2C6GA 5KTCA 1U6MA 3B8GA 4KSAA 4MY3A 4CYPA 8CPAA 1VIXA 2AFMA 2YGWA 3PB4X 4MFLA 4JJXA 5K8OA 3RAMA 3B3TA 4R3KA 3FBUA 4IF5A 2PJ1A 3HUVA 4B5PA 4EFDA 3LMSA 3W91A 4CAFA 1Z8LA 2XEJA 4OP4A 4WWVA 3H8FA 1GYTA 3FB3A 1X10A 3NA6A 1BPNA 1XBUA 1YW6A 2QYVA 3I1UA 4JYWA 4FD5A 2BUEA 2AFSA 1PYTB 2YNDA 3KR4A 4UFVA 3B35A 1XOVA 3KQXA 2EO8A 3GKRA 2DPTA 4P4EA 4A39A 2R98A 4B6ZA 2ZOFA 3CPXA 5HVGA 4P4DA 1ARMA 2F5IA 1R3NA 4H2KA 2CIJA 4KOXA 4F0YA 3R1KA 2PJ6A 2GANA 4R8FA 1Y0RA 2BSWA 4F0XA 3BJ8A 3H5ZA 3D66A 2FL4A 2OOTA 4AVAA 3TC8A 4CPAA 3BJ7A 1L0CA 4A31A 3PEIA 4Q7AA 2OH1A 3GLJA 2PIYA 1IB1E 3CXQA 4FD4A 1QMUA 4U9ZA 4NCZA 2J8NA 2HB6A 1TIQA 4QB9A 3VWDA 3N5FA 3WC5A 5KTDA 1Z8XA 2AFZA 2G3TA 4NGNA 4PSWA 2PJ8A 2Z3LA 4ZY2A 4UWJA 3DR6A 2PR8A 2Z3KA 3TOBA 5JM6A 2O28A 5CBMA 2PJ3A 4FUUA 1M44A 1YVKA 4A94A 2ZW4A 3SI2A 3W6XA 1IYKA 1VHSA 2PJ2A 4LUAA 2JLMA 5D29A 3TOAA 3FF3A 2Q04A 2FCKA 3BI0A 1LFWA 2O53A 4PSXA 3DGVA 3JUWA 4UBRA 5DS0A 1MJAA 4MY0A 1VHOA 3LODA 7CPAA 1XEBA 5DWMA 2POKA 4NGRA 1FT7A 2R1IA 4KOWA 4KZTA 4UCPA 3SXOA 5IB0A 2VZZA 3I9SA 4UEZA 4NF1A 4CS0B 1VGYA 3FRMA 5THWA 2CNMA 2EWBA 4H89A 4P45A 1EE3P 4PXCA 4Y49C 1CM0A 3RNZA 4YU9A 2AJ6A 2ZEPA 3TX8A 3S6KA 3P2FA 1OBRA 3FEEA 4J3GA 3MGDA 4P10A 2FT0A 3PB6X 5IB9A 3FNCA 4GXHA 3IFEA 5LYFA 3IO1A 3L2NA 3F5BA 3EC4A 1Z4RA 3CPAA 3KGQA 2PJAA 3I3GA 4K30A 4KOYA 2PVWA 4A95A 1R57A 5I0CA 4BD9A 1LANA 5J8FA 4ZY1A 4H6UA 2PC1A 3F8KA 2H5MA 1M4IA 3PB9X 1IU8A 2C27A 3D8PA 3ZZIA 3B7IA 4IAVA 4KSFA 4X3RA 3LACA 4P4JA 1IYLA 3G3SA 3V38A 2YNEA 4PXEA 3CXSA 2B3UA 2VBQA 4MHZA 2WZNA 3QAYA 4DUKA 3VARA 4FD7A 1PUAA 5G1ZA 3SI0A 2F8HA 3NE8A 3JRUA 4B13A 3R95A 2HQYA 5HVHA 4XPDC 4CGOA 3D7DA 4AVCA 3D4UA 3FYNA 4AVBA 1QSMA 4M3SA 2PQ8A 2OZUA 4JLYA 4II9A 2ZEHA 4L8AA 1M4DA 4PK3A 3K9TA 4AG9A 3CDXA 4ZYQA 5C82A 1KUXA 3EY5A 4JXQA 2Q4ZA 3VWEA 4MCSA 3KZWA 4UFXA 5HMNA 1TF9A 1YGHA 1Y9KA 2XEIA 1BPMA 4NSQA 3D67A 5EMIA 4IHMA 3D3SA 4OAEA 3CXPA 1CPXA 4AB7A 4B12A 3D68A 4E0AA 4CYQA 3S9NA 4MMOA 4LQGA 1TKHA 1IGBA 4U5YA 1Q2DA 1ZG9A 2JBKA 2R8VA 1LAPA 2RFHA 3A9LA 3GUXA 4KOUA 4M6HA 4B14A
chains in the Genus database with same CATH topology
4MI4A 4Q36A 1S7KA 5BWAB 1FY7A 2AE6A 2P0WA 3IU1A 4C68A 1B6BA 1CJWA 1YR0A 4RI1A 4H6ZA 5KTAA 3EXNA 5IV0A 4R9MA 4B11A 2REEA 2PSWA 3SHPA 2YNCA 1IICA 3D2MA 3PP9A 4UA3A 2B5GB 1BOBA 3ZJ0A 4KOSA 1LRZA 1IIDA 2IL4A 1SQHA 2OB0A 2G3AA 3JVNA 4EVYA 4A33A 5JQ4A 1I21A 4C2ZA 3RYOA 4U9YA 1Q2YA 2WPXA 2Q4YA 4MJ8A 2Z3NA 1V0CA 4R3LA 2OU2A 2B5GA 2JDDA 2FS5A 3QB8A 5A27A 2VQYA 2OZGA 4B10A 4KOTA 4JD6A 1K4JA 4CYOA 5H84A 4Y49B 3P2HA 1I1DA 1Y9WA 4KORA 3QAHA 3EO4A 1UFHA 2P6FA 1YLEA 2CY2A 2B3VA 3BLNA 1VKCA 3OWCA 3PZJA 1Z9UA 3JTKA 2K5TA 2ZW5A 1YREA 3DR8A 4LX9A 4KVXA 4YFJA 2B58A 5DWNA 2FIAA 5AG4A 2FE7A 3KKWA 4KUAA 4A30A 2QECA 4NEXA 4UCNA 1S3ZA 2REFA 2NMTA 1YX0A 1NMTA 3EFAA 3LD2A 4R87A 2D4OA 1M4GA 2ATRA 5GCNA 3K9UA 4ZGYB 1Y7RA 4L89A 3TFYA 3S6HA 5EC4A 1P4NA 1ON0A 2Y0MA 3TO7A 4XPLA 4XNHC 1NSLA 2BEIA 4KVME 1QSRA 2Z0ZA 3IWGA 3F0AA 5HH1A 2EVNA 2Z10A 1I12A 1S7FA 4CAEA 4E2AA 2PRBA 3FXTA 3NE7A 2VZYA 2R7HA 4CAXA 3T90A 3S6GA 2Z11A 2B4DB 4MBUA 4E8OA 1WWZA 2CNSA 4QBJA 4MFQA 2VI7A 1ZO0A 1XIXA 3DDDA 2BL1A 1M1DA 4KVOE 4YRHA 4QUSA 1YVOA 4UFWA 4QC6A 5AG7A 4ZBGA 5E96A 4CGLA 2JEVA 2EUIA 4DNCA 4UWIA 4C7IA 2DXQA 4KLWA 3H4QA 5AGEA 5IX3A 1PU9A 2CNTA 4QVTA 5EBVA 1J4JA 2Z3MA 5A28A 2Q44A 3DNSA 4HNXB 3R9GA 5AG6A 4B5OA 3IGRA 3E0KA 2HUZA 1S60A 4HNYB 1QSNA 3R9FA 1GHEA 2J8MA 2Z3OA 3N7ZA 2G0BA 4RS2A 1P0HA 4YGOA 2OZHA 4MFKA 1RXTA 4C2XA 5ISVA 4ORFA 2VXKA 4A2ZA 2GIVA 4PK2A 1XMTA 2ZW7A 3TO9A 5FVJA 2ZW6A 4JXRA 4CGMA 1Q2CA 2WPWA 2YNCC 5JPHA 2PR1A 1S5KA 4MFJA 4MFPA 4CRYB 1KUYA 3GYAA 4ONUA 3WR7A 4KUBA 3S6FA 2JDCA 5F46A 5H86A 3V8IA 1YK3A 2Q4VA 2J8RA 3G8WA 4CRZB 4HKFA 2ARHA 5G21A 1WK4A 3TT2A 4CAWA 4XNHB 3IU2A 2Z3PA 3TE4A 4XPDB 2Q0YA 3SXNA 3W6SA 3TTHA 2QIRA 4CGPA 2WSAA 4CGNA 5CNPA 1RO5A 3D2PA 3DSBA 4Q38A 1OZPA 4MHDA 4BBHA 1KUVA 2KCWA 3T9YA 2RC4A 4HNWB 5G22A 4CYNA 4GS4A 4A32A 2GE3A 4KOVA 4XPKA 4C7HA 5C88A 2A4NA 1XE4A 4X5KA 2VEZA 4OLLA 5F49A 2I79A 2X7BA 4PV6A 3TO6A 2WUUA 1S7LA 2ZXVA 2FSRA 4F6AA 5AG5A 1MJBA 2PDOA 3FIXA 4C2YA 2Q7BA 4CAVA 2ZPAA 1XF8A 4I49A 4BMHA 5F47A 3GY9A 4OADA 2P6EA 3C26A 2DPSA 2B4DA 3PGPA 1Z4EA 3R9EA 4JWPA 3R96A 1MJ9A 5J8CA 4UCMA 2FIWA 2B4BA 2D4PA 3IWEA 5F48A 1NE9A 1S7NA 4NXYA 4R57A 1QSTA 4M85A 5G20A 3TCVA 2HV2A 2QMLA 4IUSA 4FD6A 4MFZA 1QSOA 3UY5A 1B87A 1BO4A 1N71A 1KZFA 2FXFA 4B5PB 1MK4A 2I00A 2P6GA 2CXAA 4KS9A 4AG7A 4KLVA 5KTCA 1U6MA 3B8GA 4KSAA 4MY3A 4CYPA 2YGWA 4MFLA 4JJXA 4R3KA 3FBUA 4IF5A 4B5PA 3W91A 4CAFA 3FB3A 4FD5A 2BUEA 4UFVA 2YNDA 3GKRA 2DPTA 2R98A 2F5IA 4KOXA 4F0YA 3R1KA 2GANA 2BSWA 4F0XA 3BJ8A 3H5ZA 4AVAA 2FL4A 3BJ7A 1L0CA 4A31A 2OH1A 3CXQA 1IB1E 4FD4A 4U9ZA 4NCZA 2J8NA 1TIQA 4QB9A 3VWDA 5KTDA 2G3TA 4PSWA 2Z3LA 4UWJA 3DR6A 2PR8A 2Z3KA 3TOBA 2O28A 1M44A 1YVKA 2ZW4A 3W6XA 1IYKA 1VHSA 4LUAA 2JLMA 3TOAA 2Q04A 2FCKA 4PSXA 3JUWA 4UBRA 1MJAA 4MY0A 3LODA 1XEBA 5DWMA 5IB0A 2R1IA 4KOWA 4KZTA 4UCPA 3SXOA 2VZZA 3I9SA 4NF1A 4CS0B 3FRMA 2CNMA 4H89A 4Y49C 1CM0A 2AJ6A 3S6KA 3P2FA 4J3GA 3MGDA 2FT0A 3FNCA 3F5BA 3EC4A 1Z4RA 3I3GA 4K30A 4KOYA 5I0CA 4A95A 1R57A 5J8FA 4H6UA 2PC1A 3F8KA 2H5MA 1M4IA 2C27A 3D8PA 3ZZIA 4KSFA 1IYLA 3G3SA 2YNEA 3CXSA 2B3UA 2VBQA 4FD7A 1PUAA 5G1ZA 4B13A 3R95A 2HQYA 4XPDC 4CGOA 4AVCA 3FYNA 4AVBA 1QSMA 4M3SA 2PQ8A 2OZUA 4JLYA 4II9A 4L8AA 1M4DA 4PK3A 4AG9A 5C82A 1KUXA 3EY5A 4JXQA 3VWEA 4UFXA 5HMNA 1YGHA 1Y9KA 4NSQA 3D3SA 4OAEA 3CXPA 4AB7A 4B12A 4E0AA 4CYQA 4U5YA 1Q2DA 2R8VA 3A9LA 4KOUA 4B14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MI4 A;  1S7K A;  1FY7 A;  2AE6 A;  2P0W A;  1B6B A;  1CJW A;  1YR0 A;  4RI1 A;  4H6Z A;  5KTA A;  3EXN A;  5IV0 A;  4R9M A;  2REE A;  2PSW A;  3SHP A;  1IIC A;  3D2M A;  3PP9 A;  4UA3 A;  2B5G B;  1BOB A;  3ZJ0 A;  4KOS A;  1LRZ A;  1IID A;  2IL4 A;  1SQH A;  2OB0 A;  2G3A A;  3JVN A;  4EVY A;  5JQ4 A;  1I21 A;  3RYO A;  4U9Y A;  1Q2Y A;  2WPX A;  2Q4Y A;  4MJ8 A;  1V0C A;  4R3L A;  2OU2 A;  2B5G A;  2JDD A;  2FS5 A;  3QB8 A;  2VQY A;  2OZG A;  4KOT A;  4JD6 A;  1K4J A;  5H84 A;  4Y49 B;  3P2H A;  1I1D A;  1Y9W A;  4KOR A;  3QAH A;  3EO4 A;  1UFH A;  2P6F A;  1YLE A;  2CY2 A;  2B3V A;  3BLN A;  1VKC A;  3OWC A;  3PZJ A;  1Z9U A;  2K5T A;  2ZW5 A;  1YRE A;  3DR8 A;  4LX9 A;  4KVX A;  4YFJ A;  2B58 A;  5DWN A;  2FIA A;  2FE7 A;  3KKW A;  4KUA A;  2QEC A;  4NEX A;  1S3Z A;  2REF A;  2NMT A;  1YX0 A;  1NMT A;  3EFA A;  3LD2 A;  4R87 A;  2D4O A;  1M4G A;  2ATR A;  5GCN A;  3K9U A;  1Y7R A;  4L89 A;  3TFY A;  3S6H A;  5EC4 A;  1P4N A;  1ON0 A;  2Y0M A;  3TO7 A;  4XPL A;  4XNH C;  1NSL A;  2BEI A;  4KVM E;  1QSR A;  2Z0Z A;  3IWG A;  3F0A A;  5HH1 A;  2EVN A;  2Z10 A;  1I12 A;  1S7F A;  4E2A A;  2PRB A;  3FXT A;  3NE7 A;  2VZY A;  2R7H A;  4CAX A;  3T90 A;  3S6G A;  2Z11 A;  2B4D B;  4MBU A;  4E8O A;  1WWZ A;  2CNS A;  4QBJ A;  2VI7 A;  1XIX A;  3DDD A;  2BL1 A;  1M1D A;  4KVO E;  4YRH A;  4QUS A;  1YVO A;  4QC6 A;  4ZBG A;  5E96 A;  2JEV A;  2EUI A;  4DNC A;  4UWI A;  2DXQ A;  4KLW A;  3H4Q A;  5IX3 A;  1PU9 A;  2CNT A;  4QVT A;  5EBV A;  1J4J A;  2Q44 A;  3DNS A;  4HNX B;  3R9G A;  4B5O A;  3IGR A;  3E0K A;  2HUZ A;  1S60 A;  4HNY B;  1QSN A;  3R9F A;  1GHE A;  2J8M A;  3N7Z A;  2G0B A;  4RS2 A;  1P0H A;  4YGO A;  2OZH A;  1RXT A;  5ISV A;  4ORF A;  2VXK A;  2GIV A;  4PK2 A;  1XMT A;  2ZW7 A;  3TO9 A;  5FVJ A;  2ZW6 A;  4JXR A;  1Q2C A;  2WPW A;  5JPH A;  2PR1 A;  1S5K A;  4CRY B;  1KUY A;  3GYA A;  4ONU A;  3WR7 A;  4KUB A;  3S6F A;  2JDC A;  5F46 A;  5H86 A;  3V8I A;  1YK3 A;  2Q4V A;  2J8R A;  3G8W A;  4CRZ B;  4HKF A;  2ARH A;  1WK4 A;  3TT2 A;  4CAW A;  4XNH B;  3TE4 A;  4XPD B;  2Q0Y A;  3SXN A;  3W6S A;  3TTH A;  2QIR A;  5CNP A;  1RO5 A;  3D2P A;  3DSB A;  1OZP A;  4MHD A;  1KUV A;  2KCW A;  3T9Y A;  2RC4 A;  4HNW B;  4GS4 A;  2GE3 A;  4KOV A;  4XPK A;  5C88 A;  2A4N A;  1XE4 A;  4X5K A;  2VEZ A;  4OLL A;  5F49 A;  2I79 A;  2X7B A;  4PV6 A;  3TO6 A;  1S7L A;  2ZXV A;  2FSR A;  4F6A A;  1MJB A;  2PDO A;  3FIX A;  2Q7B A;  4CAV A;  2ZPA A;  1XF8 A;  4I49 A;  4BMH A;  5F47 A;  3GY9 A;  4OAD A;  2P6E A;  3C26 A;  2B4D A;  3PGP A;  1Z4E A;  3R9E A;  4JWP A;  3R96 A;  1MJ9 A;  5J8C A;  2FIW A;  2B4B A;  2D4P A;  5F48 A;  1NE9 A;  1S7N A;  4NXY A;  4R57 A;  1QST A;  4M85 A;  3TCV A;  2HV2 A;  2QML A;  4IUS A;  4FD6 A;  1QSO A;  3UY5 A;  1B87 A;  1BO4 A;  1N71 A;  1KZF A;  2FXF A;  4B5P B;  1MK4 A;  2I00 A;  2P6G A;  4AG7 A;  4KLV A;  5KTC A;  1U6M A;  3B8G A;  4MY3 A;  4JJX A;  4R3K A;  3FBU A;  4IF5 A;  4B5P A;  3W91 A;  3FB3 A;  4FD5 A;  2BUE A;  3GKR A;  2R98 A;  2F5I A;  4KOX A;  4F0Y A;  3R1K A;  2GAN A;  2BSW A;  3BJ8 A;  4AVA A;  2FL4 A;  3BJ7 A;  1L0C A;  2OH1 A;  3CXQ A;  1IB1 E;  4FD4 A;  4U9Z A;  4NCZ A;  2J8N A;  1TIQ A;  4QB9 A;  3VWD A;  5KTD A;  2G3T A;  4PSW A;  4UWJ A;  3DR6 A;  2PR8 A;  3TOB A;  2O28 A;  1M44 A;  1YVK A;  2ZW4 A;  3W6X A;  1IYK A;  1VHS A;  4LUA A;  2JLM A;  3TOA A;  2Q04 A;  2FCK A;  4PSX A;  3JUW A;  4UBR A;  1MJA A;  4MY0 A;  3LOD A;  1XEB A;  5DWM A;  5IB0 A;  4KOW A;  2R1I A;  4KZT A;  3SXO A;  2VZZ A;  3I9S A;  4NF1 A;  4CS0 B;  3FRM A;  2CNM A;  4H89 A;  4Y49 C;  1CM0 A;  2AJ6 A;  3S6K A;  3P2F A;  4J3G A;  3MGD A;  2FT0 A;  3FNC A;  3F5B A;  3EC4 A;  1Z4R A;  3I3G A;  4K30 A;  4KOY A;  5I0C A;  1R57 A;  5J8F A;  4H6U A;  2PC1 A;  3F8K A;  2H5M A;  1M4I A;  2C27 A;  3D8P A;  3ZZI A;  1IYL A;  3G3S A;  3CXS A;  2B3U A;  2VBQ A;  4FD7 A;  1PUA A;  3R95 A;  2HQY A;  4XPD C;  4AVC A;  3FYN A;  4AVB A;  1QSM A;  4M3S A;  2PQ8 A;  2OZU A;  4JLY A;  4II9 A;  4L8A A;  1M4D A;  4PK3 A;  4AG9 A;  5C82 A;  1KUX A;  3EY5 A;  4JXQ A;  3VWE A;  5HMN A;  1YGH A;  1Y9K A;  4NSQ A;  3D3S A;  4OAE A;  3CXP A;  4AB7 A;  4E0A A;  4U5Y A;  1Q2D A;  2R8V A;  4KOU A; 
#chains in the Genus database with same CATH topology
 6CPA A;  5LYI A;  3SJE A;  4MI4 A;  2V8G A;  1FNO A;  1JQG A;  4NFR A;  1S7K A;  1NSA A;  3KHZ A;  4Q36 A;  5BWA B;  1FY7 A;  1HEE A;  2AE6 A;  2P0W A;  3DLJ A;  3IU1 A;  3KR5 A;  4X2T A;  4C68 A;  1B6B A;  1CJW A;  1F2P A;  1F2O A;  4MCR A;  1YR0 A;  3GIU A;  3RZA A;  4RI1 A;  4H6Z A;  5KTA A;  3EXN A;  5IV0 A;  5LYL A;  4A37 A;  4OID A;  1M4L A;  3K2K A;  1BAV A;  2HC9 A;  4R9M A;  4B11 A;  1TKF A;  2REE A;  2PSW A;  4MCQ A;  2YNC A;  3SHP A;  1IIC A;  3D2M A;  3PP9 A;  4UA3 A;  2B5G B;  1BOB A;  4NGM A;  3ZJ0 A;  4KOS A;  1LRZ A;  1IID A;  2IL4 A;  1SQH A;  4MRI A;  4OC1 A;  2OB0 A;  4P4F A;  1CP6 A;  3BI1 A;  2G3A A;  3JVN A;  4EVY A;  4A33 A;  5JQ4 A;  1I21 A;  3SI1 A;  4C2Z A;  4ZI6 A;  3RYO A;  4U9Y A;  1Q2Y A;  2WPX A;  2Q4Y A;  1CX8 A;  2Z3N A;  4M6G A;  2AFU A;  1ZG7 A;  4MJ8 A;  3PBE A;  1VHE A;  3WAB A;  4BIN A;  1V0C A;  4R3L A;  2OU2 A;  3PB8 X;  4UF4 A;  2B5G A;  2JDD A;  4OC0 A;  2FS5 A;  3QB8 A;  3BHX A;  3H8E A;  4OC2 A;  5A27 A;  4OC5 A;  2VQY A;  2OZG A;  4B10 A;  4KOT A;  4JD6 A;  1K4J A;  4CYO A;  5H84 A;  2G9D A;  4Y49 B;  3P2H A;  1I1D A;  1Y9W A;  3NH4 A;  3V7Z A;  4KOR A;  3QAH A;  2V8H A;  1F57 A;  2F7V A;  4ZY0 A;  3EO4 A;  1TKJ A;  1UFH A;  3NH8 A;  2ANP A;  2P6F A;  3PFE A;  4NGT A;  2EK8 A;  3IIB A;  1XFO A;  1YLE A;  1Q7L A;  2CY2 A;  2B3V A;  4PXD A;  4ONW A;  4R6T A;  1IOF A;  3MRU A;  3BLN A;  3NFZ A;  4MHY A;  1VKC A;  3OWC A;  3PZJ A;  1Z9U A;  1KWM A;  2PJ9 A;  4GM5 A;  3JTK A;  2BCO A;  3H8G A;  1Z5R A;  2K5T A;  2ZW5 A;  4K3N A;  3S9L A;  5JH9 A;  1YRE A;  3DR8 A;  2V77 A;  4LX9 A;  4KVX A;  4YFJ A;  2B58 A;  5DWN A;  2FIA A;  5AG4 A;  2FE7 A;  3KKW A;  4KUA A;  4NJQ A;  4A30 A;  5LRJ A;  2QEC A;  5J1Q A;  3KQZ A;  4NEX A;  1XRY A;  2DF5 A;  4UCN A;  1S3Z A;  2REF A;  2NMT A;  1YX0 A;  1NMT A;  2ZEO A;  3EFA A;  2DEA A;  3LD2 A;  3FED A;  4R87 A;  4NJR A;  2D4O A;  2EK9 A;  1LCP A;  3D7H A;  1M4G A;  2ATR A;  3PB7 X;  5D8N A;  3K9U A;  5GCN A;  4ZGY B;  2OR4 A;  2VL1 A;  4OIW A;  1Y7R A;  4L89 A;  5K8M A;  3TFY A;  4F8Z A;  4OC3 A;  5EC4 A;  3S6H A;  1ZG8 A;  4F9U A;  1LOK A;  1P4N A;  1ON0 A;  2Y0M A;  3PRT A;  3NH5 A;  3TO7 A;  2CTB A;  4XPL A;  4DJL A;  3FEC A;  4XNH C;  1NSL A;  2BEI A;  1Z2L A;  4KVM E;  1X12 A;  1AMP A;  4YWY A;  5JGF A;  1QSR A;  2Z0Z A;  2BO9 A;  3F0A A;  3IWG A;  5HH1 A;  2EVN A;  3IJ3 A;  2Z10 A;  1I12 A;  4LQ6 A;  4X8I A;  1S7F A;  2PVV A;  1UWY A;  4CAE A;  4E2A A;  2ZEM A;  2PRB A;  4P6Y A;  3IEH A;  5I4M A;  3FXT A;  3NE7 A;  1Z8T A;  2VZY A;  2R7H A;  4CAX A;  2IMO A;  3S6G A;  3T90 A;  2Z11 A;  3SJG A;  2B4D B;  4MBU A;  4E8O A;  3IWW A;  1WWZ A;  2CNS A;  4QBJ A;  4MFQ A;  2VI7 A;  1ZO0 A;  5ELY A;  5HVF A;  1XIX A;  2AFW A;  3DDD A;  3VH9 A;  2BL1 A;  1M1D A;  4KVO E;  4YRH A;  4QUS A;  2AFX A;  2PJ4 A;  3B3C A;  1YVO A;  4UFW A;  3IC1 A;  2CF4 A;  4QC6 A;  3T8W A;  4A38 A;  2FVG A;  5AG7 A;  4KSI A;  4ZBG A;  5E96 A;  4UEE A;  1JWQ A;  3HLP A;  3FX6 A;  4CGL A;  2JEV A;  4P4B A;  5HXD A;  2EUI A;  4R76 A;  4DNC A;  4UWI A;  4C7I A;  2DXQ A;  3PBB A;  4KLW A;  1CPS A;  3H4Q A;  4UEF A;  2Q51 A;  2WYR A;  3QNV A;  5AGE A;  5IX3 A;  1PU9 A;  4JZ0 A;  2CNT A;  4QVT A;  5EBV A;  1J4J A;  2Z3M A;  5A28 A;  2Q44 A;  1DTD A;  1TXR A;  3DNS A;  4HNX B;  4OME A;  3R9G A;  3MN8 A;  5AG6 A;  2QVP A;  2ZEG A;  1IY7 A;  5LRK A;  2IQ6 A;  2GLF A;  4B5O A;  2GRE A;  3IGR A;  3PFO A;  3E0K A;  1LAM A;  3BXM A;  2HUZ A;  1S60 A;  4HNY B;  4Z65 A;  1Y0Y A;  4NGS A;  1QSN A;  3R9F A;  1H8L A;  2PIZ A;  4EWT A;  1GHE A;  2J8M A;  2Z3O A;  1CBX A;  3N7Z A;  1YW4 A;  2G0B A;  2O4H A;  4RS2 A;  3VAT A;  4MHP A;  3B3W A;  2ZED A;  1P0H A;  3WC6 A;  4YGO A;  4DYO A;  2OZH A;  4MFK A;  1HDQ A;  1RXT A;  4C2X A;  3KI9 A;  5F09 A;  4M6I A;  5ISV A;  4PXB A;  4ORF A;  2VXK A;  1YLO A;  4OC4 A;  4A2Z A;  2GIV A;  4PK2 A;  1XMT A;  2ZW7 A;  3TO9 A;  5FVJ A;  2PJC A;  4P44 A;  1IOI A;  4HPS A;  2PJ7 A;  2ZW6 A;  2ZEF A;  4JXR A;  4CGM A;  5K8N A;  1Q2C A;  2WPW A;  2YNC C;  5LYD A;  2PJB A;  5JPH A;  2PR1 A;  1S5K A;  3KAS A;  4MFJ A;  4MFP A;  3RO0 A;  4CRY B;  1KUY A;  3GYA A;  2C6C A;  4TWE A;  4ONU A;  3WR7 A;  3FVL A;  2ZOG A;  4KUB A;  3S6F A;  2JDC A;  5F46 A;  2C6P A;  2PJ5 A;  5H86 A;  2I3C A;  4RUH A;  4WJB A;  3V8I A;  1YK3 A;  2ABZ A;  2JEW A;  2GFQ A;  2J8R A;  2PJ0 A;  2Q4V A;  3G8W A;  4CRZ B;  4HKF A;  2ARH A;  4FAI A;  3KL9 A;  5G21 A;  1WK4 A;  1AUG A;  3S9M A;  3GB0 A;  3FH4 A;  3TT2 A;  3ISX A;  1ZLI A;  4OKO A;  2V8D A;  3CZX A;  2Q7S A;  3SJF A;  4CAW A;  4XNH B;  2Z3P A;  3IU2 A;  3TE4 A;  2JBJ A;  4XPD B;  2Q0Y A;  3SJX A;  1CP7 A;  1QQ9 A;  4W9Y A;  3SXN A;  5K8P A;  3W6S A;  3B3S A;  3TTH A;  2QIR A;  2V8V A;  2GU2 A;  5CPA A;  2PE3 A;  4O23 A;  4CGP A;  2WSA A;  1HDU A;  1Y7E A;  1PCA A;  4CGN A;  5CNP A;  1RO5 A;  1YME A;  3D2P A;  3DSB A;  4Q38 A;  1OZP A;  4MHD A;  3B3V A;  2EBJ A;  5LRG A;  1Z8W A;  1KUV A;  4BBH A;  2KCW A;  3T9Y A;  2RC4 A;  4HNW B;  2NSM A;  5G22 A;  2ZEN A;  4GS4 A;  4CYN A;  4A32 A;  2GE3 A;  2PRQ A;  1ARL A;  4KOV A;  4XPK A;  4C7H A;  5C88 A;  2A4N A;  1XE4 A;  4MHN A;  4X5K A;  2VEZ A;  1CG2 A;  4OLL A;  1ZLH A;  5F49 A;  2I79 A;  2X7B A;  4PV6 A;  3TO6 A;  3WC7 A;  2WUU A;  1S7L A;  1ELL P;  2ZXV A;  4AXV A;  3FMC A;  4UIB A;  2FSR A;  1TF8 A;  3ISZ A;  1AYE A;  3WT4 A;  2J9A A;  4TNU A;  3B2Y A;  2PCU A;  2NYQ A;  3LWU A;  5AG5 A;  1MJB A;  4EME A;  4F6A A;  2PDO A;  2QJ8 A;  3FIX A;  4C2Y A;  1DE4 C;  3CT9 A;  1ELM P;  2AFO A;  3D7G A;  1YQE A;  4ZX8 A;  2Q7B A;  4CAV A;  2ZPA A;  4PQA A;  1XF8 A;  4I49 A;  4BMH A;  2XEF A;  5F47 A;  3GY9 A;  2BOA A;  4OAD A;  2P6E A;  3C26 A;  2GLJ A;  2DPS A;  2IJZ A;  2B4D A;  3PGP A;  1Z4E A;  3R9E A;  4JWP A;  3R96 A;  4G1P A;  1MJ9 A;  4UIA A;  5J8C A;  4P4I A;  4UCM A;  2FIW A;  2B4B A;  4MXU A;  2D4P A;  4MCP A;  4RN7 A;  1A2Z A;  2ZEL A;  2CTC A;  3IWE A;  5F48 A;  1R43 A;  2RB7 A;  1NE9 A;  1S7N A;  1XMB A;  4NXY A;  4R57 A;  1QST A;  4M85 A;  5G20 A;  3TCV A;  1RTQ A;  1YSJ A;  2C1C A;  3KHX A;  2HV2 A;  2QML A;  4IUS A;  4NGQ A;  3FJU A;  3RBU A;  2Q43 A;  4FD6 A;  4MFZ A;  4R7M A;  4NGP A;  4PPZ A;  4IK2 A;  3D7F A;  1BLL E;  1QSO A;  3UY5 A;  1B87 A;  1BO4 A;  1N71 A;  1KZF A;  2FXF A;  1XJO A;  4B5P B;  1MK4 A;  4ZX9 A;  2I00 A;  2XEG A;  2ZEE A;  2P6G A;  2CXA A;  4FWU A;  4KS9 A;  4AG7 A;  4KLV A;  4FBE A;  2ODF A;  4F9V A;  2C6G A;  5KTC A;  1U6M A;  3B8G A;  4KSA A;  4MY3 A;  4CYP A;  8CPA A;  1VIX A;  2AFM A;  2YGW A;  3PB4 X;  4MFL A;  4JJX A;  5K8O A;  3RAM A;  3B3T A;  4R3K A;  3FBU A;  4IF5 A;  2PJ1 A;  3HUV A;  4B5P A;  4EFD A;  3LMS A;  3W91 A;  4CAF A;  1Z8L A;  2XEJ A;  4OP4 A;  4WWV A;  3H8F A;  1GYT A;  3FB3 A;  1X10 A;  3NA6 A;  1BPN A;  1XBU A;  1YW6 A;  2QYV A;  3I1U A;  4JYW A;  4FD5 A;  2BUE A;  2AFS A;  1PYT B;  2YND A;  3KR4 A;  4UFV A;  3B35 A;  1XOV A;  3KQX A;  2EO8 A;  3GKR A;  2DPT A;  4P4E A;  4A39 A;  2R98 A;  4B6Z A;  2ZOF A;  3CPX A;  5HVG A;  4P4D A;  1ARM A;  2F5I A;  1R3N A;  4H2K A;  2CIJ A;  4KOX A;  4F0Y A;  3R1K A;  2PJ6 A;  2GAN A;  4R8F A;  1Y0R A;  2BSW A;  4F0X A;  3BJ8 A;  3H5Z A;  3D66 A;  2FL4 A;  2OOT A;  4AVA A;  3TC8 A;  4CPA A;  3BJ7 A;  1L0C A;  4A31 A;  3PEI A;  4Q7A A;  2OH1 A;  3GLJ A;  2PIY A;  1IB1 E;  3CXQ A;  4FD4 A;  1QMU A;  4U9Z A;  4NCZ A;  2J8N A;  2HB6 A;  1TIQ A;  4QB9 A;  3VWD A;  3N5F A;  3WC5 A;  5KTD A;  1Z8X A;  2AFZ A;  2G3T A;  4NGN A;  4PSW A;  2PJ8 A;  2Z3L A;  4ZY2 A;  4UWJ A;  3DR6 A;  2PR8 A;  2Z3K A;  3TOB A;  5JM6 A;  2O28 A;  5CBM A;  2PJ3 A;  4FUU A;  1M44 A;  1YVK A;  4A94 A;  2ZW4 A;  3SI2 A;  3W6X A;  1IYK A;  1VHS A;  2PJ2 A;  4LUA A;  2JLM A;  5D29 A;  3TOA A;  3FF3 A;  2Q04 A;  2FCK A;  3BI0 A;  1LFW A;  2O53 A;  4PSX A;  3DGV A;  3JUW A;  4UBR A;  5DS0 A;  1MJA A;  4MY0 A;  1VHO A;  3LOD A;  7CPA A;  1XEB A;  5DWM A;  2POK A;  4NGR A;  1FT7 A;  2R1I A;  4KOW A;  4KZT A;  4UCP A;  3SXO A;  5IB0 A;  2VZZ A;  3I9S A;  4UEZ A;  4NF1 A;  4CS0 B;  1VGY A;  3FRM A;  5THW A;  2CNM A;  2EWB A;  4H89 A;  4P45 A;  1EE3 P;  4PXC A;  4Y49 C;  1CM0 A;  3RNZ A;  4YU9 A;  2AJ6 A;  2ZEP A;  3TX8 A;  3S6K A;  3P2F A;  1OBR A;  3FEE A;  4J3G A;  3MGD A;  4P10 A;  2FT0 A;  3PB6 X;  5IB9 A;  3FNC A;  4GXH A;  3IFE A;  5LYF A;  3IO1 A;  3L2N A;  3F5B A;  3EC4 A;  1Z4R A;  3CPA A;  3KGQ A;  2PJA A;  3I3G A;  4K30 A;  4KOY A;  2PVW A;  4A95 A;  1R57 A;  5I0C A;  4BD9 A;  1LAN A;  5J8F A;  4ZY1 A;  4H6U A;  2PC1 A;  3F8K A;  2H5M A;  1M4I A;  3PB9 X;  1IU8 A;  2C27 A;  3D8P A;  3ZZI A;  3B7I A;  4IAV A;  4KSF A;  4X3R A;  3LAC A;  4P4J A;  1IYL A;  3G3S A;  3V38 A;  2YNE A;  4PXE A;  3CXS A;  2B3U A;  2VBQ A;  4MHZ A;  2WZN A;  3QAY A;  4DUK A;  3VAR A;  4FD7 A;  1PUA A;  5G1Z A;  3SI0 A;  2F8H A;  3NE8 A;  3JRU A;  4B13 A;  3R95 A;  2HQY A;  5HVH A;  4XPD C;  4CGO A;  3D7D A;  4AVC A;  3D4U A;  3FYN A;  4AVB A;  1QSM A;  4M3S A;  2PQ8 A;  2OZU A;  4JLY A;  4II9 A;  2ZEH A;  4L8A A;  1M4D A;  4PK3 A;  3K9T A;  4AG9 A;  3CDX A;  4ZYQ A;  5C82 A;  1KUX A;  3EY5 A;  4JXQ A;  2Q4Z A;  3VWE A;  4MCS A;  3KZW A;  4UFX A;  5HMN A;  1TF9 A;  1YGH A;  1Y9K A;  2XEI A;  1BPM A;  4NSQ A;  3D67 A;  5EMI A;  4IHM A;  3D3S A;  4OAE A;  3CXP A;  1CPX A;  4AB7 A;  4B12 A;  3D68 A;  4E0A A;  4CYQ A;  3S9N A;  4MMO A;  4LQG A;  1TKH A;  1IGB A;  4U5Y A;  1Q2D A;  1ZG9 A;  2JBK A;  2R8V A;  1LAP A;  2RFH A;  3A9L A;  3GUX A;  4KOU A;  4M6H A;  4B14 A; 
#chains in the Genus database with same CATH homology
 4MI4 A;  4Q36 A;  1S7K A;  5BWA B;  1FY7 A;  2AE6 A;  2P0W A;  3IU1 A;  4C68 A;  1B6B A;  1CJW A;  1YR0 A;  4RI1 A;  4H6Z A;  5KTA A;  3EXN A;  5IV0 A;  4R9M A;  4B11 A;  2REE A;  2PSW A;  3SHP A;  2YNC A;  1IIC A;  3D2M A;  3PP9 A;  4UA3 A;  2B5G B;  1BOB A;  3ZJ0 A;  4KOS A;  1LRZ A;  1IID A;  2IL4 A;  1SQH A;  2OB0 A;  2G3A A;  3JVN A;  4EVY A;  4A33 A;  5JQ4 A;  1I21 A;  4C2Z A;  3RYO A;  4U9Y A;  1Q2Y A;  2WPX A;  2Q4Y A;  4MJ8 A;  2Z3N A;  1V0C A;  4R3L A;  2OU2 A;  2B5G A;  2JDD A;  2FS5 A;  3QB8 A;  5A27 A;  2VQY A;  2OZG A;  4B10 A;  4KOT A;  4JD6 A;  1K4J A;  4CYO A;  5H84 A;  4Y49 B;  3P2H A;  1I1D A;  1Y9W A;  4KOR A;  3QAH A;  3EO4 A;  1UFH A;  2P6F A;  1YLE A;  2CY2 A;  2B3V A;  3BLN A;  1VKC A;  3OWC A;  3PZJ A;  1Z9U A;  3JTK A;  2K5T A;  2ZW5 A;  1YRE A;  3DR8 A;  4LX9 A;  4KVX A;  4YFJ A;  2B58 A;  5DWN A;  2FIA A;  5AG4 A;  2FE7 A;  3KKW A;  4KUA A;  4A30 A;  2QEC A;  4NEX A;  4UCN A;  1S3Z A;  2REF A;  2NMT A;  1YX0 A;  1NMT A;  3EFA A;  3LD2 A;  4R87 A;  2D4O A;  1M4G A;  2ATR A;  5GCN A;  3K9U A;  4ZGY B;  1Y7R A;  4L89 A;  3TFY A;  3S6H A;  5EC4 A;  1P4N A;  1ON0 A;  2Y0M A;  3TO7 A;  4XPL A;  4XNH C;  1NSL A;  2BEI A;  4KVM E;  1QSR A;  2Z0Z A;  3IWG A;  3F0A A;  5HH1 A;  2EVN A;  2Z10 A;  1I12 A;  1S7F A;  4CAE A;  4E2A A;  2PRB A;  3FXT A;  3NE7 A;  2VZY A;  2R7H A;  4CAX A;  3T90 A;  3S6G A;  2Z11 A;  2B4D B;  4MBU A;  4E8O A;  1WWZ A;  2CNS A;  4QBJ A;  4MFQ A;  2VI7 A;  1ZO0 A;  1XIX A;  3DDD A;  2BL1 A;  1M1D A;  4KVO E;  4YRH A;  4QUS A;  1YVO A;  4UFW A;  4QC6 A;  5AG7 A;  4ZBG A;  5E96 A;  4CGL A;  2JEV A;  2EUI A;  4DNC A;  4UWI A;  4C7I A;  2DXQ A;  4KLW A;  3H4Q A;  5AGE A;  5IX3 A;  1PU9 A;  2CNT A;  4QVT A;  5EBV A;  1J4J A;  2Z3M A;  5A28 A;  2Q44 A;  3DNS A;  4HNX B;  3R9G A;  5AG6 A;  4B5O A;  3IGR A;  3E0K A;  2HUZ A;  1S60 A;  4HNY B;  1QSN A;  3R9F A;  1GHE A;  2J8M A;  2Z3O A;  3N7Z A;  2G0B A;  4RS2 A;  1P0H A;  4YGO A;  2OZH A;  4MFK A;  1RXT A;  4C2X A;  5ISV A;  4ORF A;  2VXK A;  4A2Z A;  2GIV A;  4PK2 A;  1XMT A;  2ZW7 A;  3TO9 A;  5FVJ A;  2ZW6 A;  4JXR A;  4CGM A;  1Q2C A;  2WPW A;  2YNC C;  5JPH A;  2PR1 A;  1S5K A;  4MFJ A;  4MFP A;  4CRY B;  1KUY A;  3GYA A;  4ONU A;  3WR7 A;  4KUB A;  3S6F A;  2JDC A;  5F46 A;  5H86 A;  3V8I A;  1YK3 A;  2Q4V A;  2J8R A;  3G8W A;  4CRZ B;  4HKF A;  2ARH A;  5G21 A;  1WK4 A;  3TT2 A;  4CAW A;  4XNH B;  3IU2 A;  2Z3P A;  3TE4 A;  4XPD B;  2Q0Y A;  3SXN A;  3W6S A;  3TTH A;  2QIR A;  4CGP A;  2WSA A;  4CGN A;  5CNP A;  1RO5 A;  3D2P A;  3DSB A;  4Q38 A;  1OZP A;  4MHD A;  4BBH A;  1KUV A;  2KCW A;  3T9Y A;  2RC4 A;  4HNW B;  5G22 A;  4CYN A;  4GS4 A;  4A32 A;  2GE3 A;  4KOV A;  4XPK A;  4C7H A;  5C88 A;  2A4N A;  1XE4 A;  4X5K A;  2VEZ A;  4OLL A;  5F49 A;  2I79 A;  2X7B A;  4PV6 A;  3TO6 A;  2WUU A;  1S7L A;  2ZXV A;  2FSR A;  4F6A A;  5AG5 A;  1MJB A;  2PDO A;  3FIX A;  4C2Y A;  2Q7B A;  4CAV A;  2ZPA A;  1XF8 A;  4I49 A;  4BMH A;  5F47 A;  3GY9 A;  4OAD A;  2P6E A;  3C26 A;  2DPS A;  2B4D A;  3PGP A;  1Z4E A;  3R9E A;  4JWP A;  3R96 A;  1MJ9 A;  5J8C A;  4UCM A;  2FIW A;  2B4B A;  2D4P A;  3IWE A;  5F48 A;  1NE9 A;  1S7N A;  4NXY A;  4R57 A;  1QST A;  4M85 A;  5G20 A;  3TCV A;  2HV2 A;  2QML A;  4IUS A;  4FD6 A;  4MFZ A;  1QSO A;  3UY5 A;  1B87 A;  1BO4 A;  1N71 A;  1KZF A;  2FXF A;  4B5P B;  1MK4 A;  2I00 A;  2P6G A;  2CXA A;  4KS9 A;  4AG7 A;  4KLV A;  5KTC A;  1U6M A;  3B8G A;  4KSA A;  4MY3 A;  4CYP A;  2YGW A;  4MFL A;  4JJX A;  4R3K A;  3FBU A;  4IF5 A;  4B5P A;  3W91 A;  4CAF A;  3FB3 A;  4FD5 A;  2BUE A;  4UFV A;  2YND A;  3GKR A;  2DPT A;  2R98 A;  2F5I A;  4KOX A;  4F0Y A;  3R1K A;  2GAN A;  2BSW A;  4F0X A;  3BJ8 A;  3H5Z A;  4AVA A;  2FL4 A;  3BJ7 A;  1L0C A;  4A31 A;  2OH1 A;  3CXQ A;  1IB1 E;  4FD4 A;  4U9Z A;  4NCZ A;  2J8N A;  1TIQ A;  4QB9 A;  3VWD A;  5KTD A;  2G3T A;  4PSW A;  2Z3L A;  4UWJ A;  3DR6 A;  2PR8 A;  2Z3K A;  3TOB A;  2O28 A;  1M44 A;  1YVK A;  2ZW4 A;  3W6X A;  1IYK A;  1VHS A;  4LUA A;  2JLM A;  3TOA A;  2Q04 A;  2FCK A;  4PSX A;  3JUW A;  4UBR A;  1MJA A;  4MY0 A;  3LOD A;  1XEB A;  5DWM A;  5IB0 A;  2R1I A;  4KOW A;  4KZT A;  4UCP A;  3SXO A;  2VZZ A;  3I9S A;  4NF1 A;  4CS0 B;  3FRM A;  2CNM A;  4H89 A;  4Y49 C;  1CM0 A;  2AJ6 A;  3S6K A;  3P2F A;  4J3G A;  3MGD A;  2FT0 A;  3FNC A;  3F5B A;  3EC4 A;  1Z4R A;  3I3G A;  4K30 A;  4KOY A;  5I0C A;  4A95 A;  1R57 A;  5J8F A;  4H6U A;  2PC1 A;  3F8K A;  2H5M A;  1M4I A;  2C27 A;  3D8P A;  3ZZI A;  4KSF A;  1IYL A;  3G3S A;  2YNE A;  3CXS A;  2B3U A;  2VBQ A;  4FD7 A;  1PUA A;  5G1Z A;  4B13 A;  3R95 A;  2HQY A;  4XPD C;  4CGO A;  4AVC A;  3FYN A;  4AVB A;  1QSM A;  4M3S A;  2PQ8 A;  2OZU A;  4JLY A;  4II9 A;  4L8A A;  1M4D A;  4PK3 A;  4AG9 A;  5C82 A;  1KUX A;  3EY5 A;  4JXQ A;  3VWE A;  4UFX A;  5HMN A;  1YGH A;  1Y9K A;  4NSQ A;  3D3S A;  4OAE A;  3CXP A;  4AB7 A;  4B12 A;  4E0A A;  4CYQ A;  4U5Y A;  1Q2D A;  2R8V A;  3A9L A;  4KOU A;  4B14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...