4YRHA

P21 isoform of mec-17 from danio rerio
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
184
structure length
177
Chain Sequence
b'DFPYDLNALFPERISVLDSNLSRPDPLPQVTTVIDELGKASSKAQQLPAPITSAAKLQANRHHLYLLKDGEQNGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tubulin N-acetyltransferase 1
publication title Structure of DrMEC-17 residue 2-185 at 2.85 Angstroms resolution
rcsb
source organism Danio rerio
molecule tags Transferase
total genus 41
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2015-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yrhA00
3FXTA 4PK3A 2FXFA 1XIXA 4KOSA 4NF1A 4FD5A 2Q04A 3PZJA 3SHPA 4AB7A 1IB1E 4CAWA 2QMLA 3E0KA 2OB0A 2R98A 1XE4A 2VZZA 3R1KA 3R96A 2RC4A 1V0CA 1Y9KA 4KOUA 1I1DA 1M4IA 2VXKA 2O28A 1QSOA 2ZW4A 1B87A 2J8NA 1I12A 1PUAA 2B5GA 3TOBA 4MHDA 3R9FA 1S7LA 4HNXB 4QB9A 4HNWB 3P2HA 2D4OA 1P4NA 1B6BA 2P6GA 5HH1A 4K30A 4B5OA 4KORA 3FRMA 3IWGA 1WK4A 3I3GA 3G3SA 2HQYA 1OZPA 4RI1A 3V8IA 3PGPA 3H4QA 4LX9A 2OZUA 3QB8A 1Q2DA 3B8GA 1M1DA 1S7KA 4R3KA 3FB3A 3S6GA 3T90A 4QUSA 1YVKA 1KZFA 4PSXA 4QBJA 2B3VA 4JD6A 4KLVA 2HUZA 3BJ8A 4IF5A 1YGHA 4L8AA 4Y49C 3TFYA 3JUWA 4B5PA 2R8VA 4KOYA 4JWPA 4OAEA 4RS2A 1YVOA 1TIQA 2Z0ZA 1Y7RA 2CNSA 2ZPAA 4MY0A 1YX0A 1MJAA 1J4JA 3BLNA 2B4DB 3SXNA 2PSWA 2BEIA 4JXRA 2PDOA 2KCWA 3OWCA 4U9YA 2GANA 5DWMA 2ZW6A 1XEBA 3LD2A 2PQ8A 2I79A 3K9UA 2VBQA 1MJ9A 5C82A 2R7HA 2ARHA 1MJBA 2BSWA 1RO5A 3GKRA 3R95A 3FBUA 3FIXA 3RYOA 4II9A 2PC1A 1U6MA 2EUIA 4HKFA 2K5TA 3S6KA 4KUAA 1NE9A 3UY5A 1IYLA 4BMHA 1M4DA 3EC4A 4OLLA 3TT2A 4AVCA 4H6UA 4U9ZA 4PSWA 5C88A 3DSBA 2Q4VA 1MK4A 2CNTA 2QIRA 4H6ZA 1IICA 4DNCA 3R9GA 4XPLA 5KTDA 4KOTA 3IGRA 2Q7BA 2GE3A 4AG9A 4U5YA 1YREA 1SQHA 2FIWA 2Q4YA 3I9SA 1YLEA 4NCZA 4UA3A 2PRBA 5FVJA 4JJXA 3SXOA 2J8MA 4ZBGA 3EO4A 2B5GB 4CRYB 1PU9A 2D4PA 2J8RA 4PK2A 2HV2A 1LRZA 4MJ8A 2G0BA 2DXQA 1YR0A 3DDDA 5ISVA 4XPDB 3DR6A 4XPDC 3PP9A 4XNHB 3F5BA 2G3TA 5I0CA 3EFAA 4XNHC 5J8FA 4KZTA 5GCNA 3GYAA 4KVOE 4FD4A 1K4JA 2OZGA 2FL4A 4R87A 3F8KA 3W6SA 1XMTA 4L89A 4QC6A 2WPXA 4YGOA 4QVTA 4NXYA 2QECA 2A4NA 3C26A 3G8WA 4ONUA 4E0AA 1QSRA 4M85A 2OU2A 2B3UA 2OH1A 3VWEA 2IL4A 2REFA 5KTAA 4FD6A 4HNYB 4F0YA 4IUSA 4B5PB 1NMTA 2BUEA 4AVAA 1WWZA 2Q44A 4X5KA 4AVBA 4NSQA 3T9YA 4H89A 5CNPA 2FE7A 4UBRA 1S60A 2FSRA 3BJ7A 1I21A 5EC4A 1QSNA 2VZYA 1Q2CA 2EVNA 3R9EA 4E2AA 1CM0A 2CNMA 1VKCA 2H5MA 2X7BA 1S7FA 2PR8A 5E96A 4I49A 4F6AA 4CAXA 2ATRA 4EVYA 1IIDA 3TCVA 1CJWA 2BL1A 2P6FA 4CRZB 4MI4A 1QSTA 2ZXVA 5F47A 3W6XA 2JLMA 1M4GA 5IB0A 1N71A 4AG7A 3WR7A 2CY2A 1KUYA 5IV0A 1YK3A 4UWJA 3TTHA 5HMNA 2G3AA 1VHSA 3FYNA 3D2PA 3JVNA 4YFJA 2REEA 3P2FA 4PV6A 2B58A 4ORFA 1KUXA 1P0HA 4R9MA 5H84A 2FT0A 1BOBA 2R1IA 4GS4A 3TO9A 1R57A 3D2MA 3GY9A 4NEXA 3D3SA 1Z4RA 1ON0A 2Q0YA 4KUBA 5KTCA 3EXNA 4E8OA 1S7NA 1S5KA 4KOXA 1IYKA 4KVXA 4R57A 3LODA 4CAVA 2ZW7A 4XPKA 3S6HA 2FS5A 1Q2YA 2FIAA 1KUVA 2Z10A 1NSLA 3ZZIA 1GHEA 2AJ6A 2GIVA 5JQ4A 2F5IA 5IX3A 2FCKA 1RXTA 3W91A 4CS0B 4R3LA 4OADA 2C27A 2P6EA 3ZJ0A 3TOAA 1L0CA 4KOWA 4KVME 1QSMA 2PR1A 2OZHA 4KOVA 1FY7A 2Y0MA 4J3GA 4UWIA 3TO7A 3TE4A 1Z4EA 4MY3A 4FD7A 4JXQA 5JPHA 2JEVA 1S3ZA 2VQYA 4Y49B 3FNCA 5H86A 3CXQA 5F48A 3NE7A 3N7ZA 5DWNA 2B4DA 5EBVA 5J8CA 4KLWA 5F49A 1XF8A 1Z9UA 3QAHA 2NMTA 2VEZA 1Y9WA 4JLYA 3DR8A 2I00A 3CXPA 5F46A 3D8PA 1UFHA 2JDCA 3DNSA 1BO4A 3MGDA 4LUAA 3VWDA 3CXSA 2P0WA 4YRHA 3TO6A 3S6FA 1M44A 2B4BA 2JDDA 3F0AA 4M3SA 3KKWA 3EY5A 2VI7A 2WPWA 4MBUA 2AE6A 2Z11A 2ZW5A
chains in the Genus database with same CATH superfamily
4CGMA 3FXTA 4PK3A 2PJ5A 2AFUA 5HVGA 2FXFA 2PJ7A 1XIXA 4KOSA 3FJUA 2VL1A 4NF1A 4R76A 5LYIA 4P4EA 1Q7LA 3SJXA 2JEWA 4FD5A 1CP6A 2Q04A 1BLLE 3PZJA 5LRGA 3SHPA 4AB7A 2IMOA 1IB1E 2V8GA 4WWVA 4CAWA 3H8FA 2QMLA 3E0KA 3LWUA 4ZX8A 2OB0A 2O53A 2R98A 4A38A 1XE4A 2VZZA 3BHXA 3GIUA 3H5ZA 3DLJA 4C68A 2AFOA 4ZY0A 3R1KA 3WC5A 3R96A 2RC4A 1V0CA 3RNZA 3JRUA 1Y9KA 4KOUA 1I1DA 1M4IA 2VXKA 2O28A 1ELMP 4A32A 3D67A 3K2KA 4NGSA 1QSOA 2ZW4A 1ZG7A 4P44A 1B87A 2J8NA 1I12A 3B3WA 3IU2A 4ZY2A 2Z3PA 1PUAA 3NA6A 1IOFA 2B5GA 3TOBA 4MHDA 3QNVA 3R9FA 1S7LA 4HNXB 4QB9A 4HNWB 1HEEA 2ZW5A 3P2HA 4KSIA 2D4OA 4B13A 1P4NA 5AG6A 4C2ZA 4A94A 1TF9A 1X10A 4NJQA 1B6BA 4C7HA 2P6GA 5CBMA 1EE3P 4M6IA 2AFSA 3SI0A 5HH1A 1KWMA 1YSJA 4K30A 2DPSA 4F8ZA 3IFEA 3N5FA 3HUVA 1IGBA 4B5OA 4AXVA 4KORA 4FUUA 3FRMA 3IWGA 5G1ZA 4MFJA 2Z3NA 5K8MA 1WK4A 2PIYA 3I3GA 2PJ4A 3G3SA 3NFZA 3V7ZA 2HQYA 1TKHA 2EBJA 1OZPA 4RI1A 3V8IA 3PGPA 3FX6A 3H4QA 4X2TA 4LX9A 2OZUA 3TC8A 2HC9A 3QB8A 1Q2DA 3B8GA 1M1DA 4FBEA 1S7KA 4R3KA 3FB3A 3S6GA 4NGMA 4QUSA 3T90A 3FF3A 2GLJA 3PEIA 5J1QA 1YVKA 3RBUA 1KZFA 1XBUA 4PSXA 4P4BA 4QBJA 1YLOA 2B3VA 4X8IA 4JD6A 5AG4A 2PJ0A 4KLVA 5G22A 4HPSA 4MFZA 2HUZA 4UEEA 3BJ8A 4IF5A 1YGHA 4L8AA 4Y49C 3TFYA 2YNCC 3JUWA 2ZENA 3B3CA 3WC7A 4B5PA 2R8VA 4KOYA 4M6GA 4JWPA 5AG7A 4OAEA 4UEZA 4RS2A 1YVOA 3IU1A 1Y0YA 1TIQA 3WABA 3H8GA 2Z0ZA 4F0XA 1Y7RA 2CNSA 1QQ9A 4B10A 1LOKA 2ZPAA 2EO8A 2PJBA 2BOAA 4MY0A 1ZLHA 1YX0A 3I1UA 1MJAA 3IC1A 1FT7A 5DS0A 2ODFA 1HDUA 4NGTA 1J4JA 5HXDA 3BLNA 5K8NA 4Z65A 2B4DB 2POKA 4MCRA 4PPZA 4M6HA 5JGFA 1VGYA 4OC5A 3SXNA 2PSWA 3PB9X 5LYFA 4R8FA 4MFLA 4PXBA 1BPNA 2BEIA 1TKJA 5F09A 4MHYA 4JXRA 4P4IA 2PDOA 4MFQA 2KCWA 3OWCA 4A33A 4UCMA 4NGNA 3KQZA 3PB4X 4BD9A 4U9YA 2GANA 5DWMA 2ZW6A 1XEBA 5LRKA 3LD2A 2OR4A 3KR4A 4GM5A 3BXMA 2PQ8A 2I79A 3A9LA 3K9UA 2VBQA 4OC3A 1MJ9A 5C82A 2R7HA 2ARHA 1MJBA 2BSWA 1DE4C 2CTBA 1BPMA 1CBXA 4TWEA 1ARMA 1RO5A 3PFEA 3SI2A 4MRIA 5A27A 3GKRA 3ISZA 3R95A 4MFPA 4B14A 1XFOA 2O4HA 3FBUA 5HVFA 3FIXA 4MFKA 1GYTA 3RYOA 4CYPA 6CPAA 3V38A 4II9A 2PC1A 4P6YA 1U6MA 2BO9A 2EUIA 4HKFA 2K5TA 3GUXA 3KHZA 2PJ8A 4CGPA 3SJGA 5I4MA 3S6KA 4F9UA 4H2KA 1F2PA 1F57A 3JTKA 4KUAA 1NE9A 5D8NA 1M4LA 3UY5A 4DJLA 1IYLA 3BI1A 4BMHA 2OOTA 1M4DA 3EC4A 4OLLA 4A30A 4P45A 4YU9A 5G21A 3TT2A 4H6UA 4U9ZA 4PSWA 3SI1A 4AVCA 3S9LA 4A95A 5C88A 3DSBA 4UFXA 3VH9A 1XJOA 2Q4VA 1MK4A 2CNTA 2QIRA 4H6ZA 1ZO0A 1IICA 2IJZA 4R6TA 2HB6A 4DNCA 3R9GA 2IQ6A 2QJ8A 4XPLA 4OC2A 5KTDA 4WJBA 4KOTA 3IGRA 4CAFA 2Q7BA 2GE3A 2QVPA 4AG9A 4U5YA 4DUKA 1YREA 1SQHA 2FIWA 1AYEA 2Q4YA 3MN8A 3I9SA 3QAYA 1YLEA 1Z8WA 2WSAA 3CPAA 4NCZA 3FMCA 3IEHA 4UA3A 2PRBA 3IJ3A 2XEFA 5FVJA 4JJXA 3SXOA 1LAMA 2J8MA 3PBEA 3NH8A 4ZBGA 1UWYA 3EO4A 3KHXA 4OC1A 4OC0A 2B5GB 4CRYB 1PU9A 2D4PA 2J8RA 4PK2A 2HV2A 1LRZA 4CYNA 2AFMA 5K8PA 4G1PA 3FEEA 4FWUA 4O23A 3D66A 4MJ8A 2G0BA 5ELYA 4CGNA 2DXQA 1NSAA 1YR0A 3DDDA 5EMIA 5ISVA 4UEFA 4XPDB 4OMEA 4P4FA 1QMUA 4ONWA 1LANA 3DR6A 4PQAA 3PP9A 4XPDC 3T8WA 2AFWA 4XNHB 3F5BA 2G3TA 2PJ6A 5I0CA 3EFAA 4XNHC 3PFOA 5AGEA 5J8FA 2J9AA 2DPTA 3B3SA 4UIBA 4KZTA 2XEIA 5GCNA 2YNCA 3GYAA 4KVOE 1Z2LA 2PJAA 3D4UA 3KR5A 4FD4A 1K4JA 2OZGA 2EWBA 2F8HA 2FL4A 4R87A 1Y7EA 4UFVA 5G20A 3F8KA 3W6SA 1XMTA 4L89A 4CGLA 2WYRA 3CT9A 2WPXA 4QC6A 2ANPA 4YGOA 4QVTA 3FVLA 4NXYA 2QECA 2A4NA 3C26A 1LFWA 3G8WA 4ONUA 4RN7A 4E0AA 5A28A 1QSRA 3S9MA 1CG2A 3MRUA 2JBKA 4M85A 2OU2A 2B3UA 4KSFA 4MHZA 4C7IA 2OH1A 3NH4A 3VWEA 2IL4A 2REFA 4UCPA 5KTAA 2YNDA 2Z3OA 4FD6A 2I3CA 4HNYB 1AUGA 4IUSA 4F0YA 8CPAA 4JYWA 4B5PB 3GLJA 4EFDA 1NMTA 1R43A 2BUEA 4AVAA 1CPSA 2Q51A 4GXHA 1WWZA 1YW6A 2Q44A 4Q38A 4X5KA 1Z8XA 4AVBA 5HVHA 1YMEA 4NSQA 3T9YA 4C2XA 4H89A 5CNPA 2FE7A 4UBRA 1S60A 2FSRA 3BJ7A 1I21A 1BAVA 3D7DA 5EC4A 3RZAA 4BBHA 1QSNA 4OIWA 1ZG8A 3GB0A 2ZEHA 4A31A 1XRYA 2VZYA 1Y0RA 2CXAA 3VARA 1Q2CA 2EK9A 2EVNA 4KS9A 3R9EA 4E2AA 1IY7A 1CM0A 2CNMA 1VKCA 2ZELA 3D7GA 2H5MA 2CTCA 4OP4A 4ZYQA 2X7BA 3LACA 1S7FA 2PR8A 5E96A 4I49A 2EK8A 4F6AA 2V8VA 4ZX9A 4CAXA 2ATRA 4EVYA 3IIBA 1IIDA 3RO0A 1ELLP 3TCVA 1CJWA 2WZNA 1Z8TA 2XEJA 2AFXA 2BL1A 3NH5A 4BINA 3KASA 3WC6A 3B35A 2ZEPA 2P6FA 4TNUA 4CRZB 1IOIA 5BWAB 2PJCA 2Q4ZA 1QSTA 4MI4A 2AFZA 3PB7X 4UCNA 4YWYA 1Z8LA 4P4DA 2Z3MA 2ZXVA 3KZWA 5F47A 1LCPA 3W6XA 3KI9A 2JLMA 1M4GA 1YQEA 5IB0A 1N71A 4AG7A 2PCUA 4Q7AA 5THWA 2Q7SA 2CY2A 3WR7A 1X12A 1KUYA 3CZXA 2C6CA 1LAPA 4UIAA 1A2ZA 1YK3A 2QYVA 4UWJA 3TTHA 5IV0A 4PXEA 5HMNA 4KSAA 4ZI6A 2V8HA 7CPAA 1TKFA 3D7HA 4FAIA 4F9VA 2G3AA 1VHSA 2C1CA 3FYNA 2PVWA 2PJ9A 3D2PA 4CAEA 1TXRA 4EMEA 3JVNA 4OC4A 4A39A 4YFJA 1ARLA 2REEA 3P2FA 4PV6A 2B58A 3DGVA 4MHNA 4ORFA 2Q43A 1KUXA 1P0HA 4UF4A 5JH9A 2CIJA 1ZLIA 4DYOA 2DF5A 2PE3A 2ZEFA 4R9MA 2ZEGA 4LQGA 4NGQA 1Z5RA 2ABZA 5LYDA 5H84A 2FT0A 3VATA 1BOBA 2R1IA 4JZ0A 4GS4A 3S9NA 2XEGA 3TO9A 1R57A 1OBRA 5AG5A 3KL9A 3TX8A 1VHEA 1H8LA 3D2MA 1PYTB 4OKOA 4Q36A 5LRJA 4MCPA 3GY9A 3CPXA 4ZGYB 4B12A 4NEXA 3BI0A 3D3SA 4IHMA 1Z4RA 2YNEA 1ON0A 2GU2A 3ISXA 3IWEA 2ZOGA 2Q0YA 4KUBA 4IAVA 5KTCA 4PXDA 3EXNA 2C6PA 4CYQA 1S7NA 4LQ6A 4E8OA 1S5KA 2BCOA 2GFQA 1XOVA 4KOXA 3RAMA 2PVVA 1IYKA 5LYLA 4KVXA 4R57A 3LODA 4CAVA 2FVGA 2ZW7A 4XPKA 3S6HA 1HDQA 2FS5A 4P10A 1Q2YA 2FIAA 1KUVA 4CYOA 2Z10A 4NGRA 1NSLA 1GHEA 2AJ6A 3ZZIA 2GIVA 5JQ4A 4MCQA 4NFRA 2F5IA 5IX3A 2GREA 1YW4A 1VHOA 2FCKA 2Z3KA 1RXTA 3PB8X 3W91A 3D7FA 1CPXA 4CS0B 1JWQA 4R3LA 4OADA 4PXCA 2C27A 2P6EA 2PRQA 1PCAA 3ZJ0A 3TOAA 1L0CA 4KOWA 4W9YA 4KVME 1QSMA 2PR1A 2OZHA 3LMSA 4KOVA 4R7MA 1FY7A 2Y0MA 2PJ2A 1DTDA 2ZEOA 4J3GA 4UWIA 3TO7A 4RUHA 1FNOA 5K8OA 3TE4A 2ZEMA 1JQGA 1Z4EA 4MY3A 1TF8A 4FD7A 4JXQA 4B11A 4ZY1A 3L2NA 5JPHA 2G9DA 1AMPA 3PB6X 2JEVA 5CPAA 1S3ZA 2VQYA 3SJEA 4Y49B 4CGOA 3IWWA 3FNCA 3KQXA 4IK2A 5H86A 1CP7A 2CF4A 3FH4A 3CXQA 3KGQA 3PBBA 5F48A 2V77A 3NE7A 4MXUA 4UFWA 3WT4A 3N7ZA 3FEDA 3FECA 5DWNA 4NJRA 3SJFA 2ZEDA 2B4DA 4MHPA 5EBVA 2V8DA 5J8CA 1ZG9A 5D29A 2GLFA 2RFHA 2NSMA 4KLWA 5F49A 3H8EA 1CX8A 1XF8A 1Z9UA 3QAHA 2NMTA 2VEZA 1Y9WA 2WUUA 4JLYA 3CDXA 4OIDA 4EWTA 1XMBA 3B2YA 3DR8A 2I00A 3CXPA 5F46A 4P4JA 4CPAA 2PJ3A 3D8PA 3D68A 1UFHA 2JDCA 2ZOFA 1BO4A 3DNSA 3MGDA 4LUAA 2F7VA 3K9TA 2JBJA 3B3VA 3VWDA 3CXSA 3NE8A 2P0WA 2PIZA 5JM6A 4YRHA 2NYQA 3PRTA 3TO6A 1R3NA 1VIXA 2PJ1A 2RB7A 3B3TA 1IU8A 3S6FA 4A2ZA 4A37A 4B6ZA 1M44A 2B4BA 2JDDA 3F0AA 2YGWA 4MCSA 3IO1A 4M3SA 3B7IA 2DEAA 3KKWA 2C6GA 4C2YA 5IB9A 2ZEEA 2Z3LA 3HLPA 4MMOA 3EY5A 2VI7A 2WPWA 4MBUA 4K3NA 4NGPA 2AE6A 2Z11A 1RTQA 4X3RA 1F2OA
chains in the Genus database with same CATH topology
4CGMA 3FXTA 4PK3A 2FXFA 1XIXA 4KOSA 4NF1A 4FD5A 2Q04A 3PZJA 3SHPA 4AB7A 1IB1E 4CAWA 2QMLA 3E0KA 2OB0A 2R98A 1XE4A 2VZZA 3H5ZA 4C68A 3R1KA 3R96A 2RC4A 1V0CA 1Y9KA 4KOUA 1I1DA 1M4IA 2VXKA 2O28A 4A32A 1QSOA 2ZW4A 1B87A 2J8NA 1I12A 3IU2A 2Z3PA 1PUAA 2B5GA 3TOBA 4MHDA 3R9FA 1S7LA 4HNXB 4QB9A 4HNWB 3P2HA 2D4OA 4B13A 1P4NA 5AG6A 4C2ZA 1B6BA 4C7HA 2P6GA 5HH1A 4K30A 2DPSA 4B5OA 4KORA 3FRMA 3IWGA 5G1ZA 4MFJA 2Z3NA 1WK4A 3I3GA 3G3SA 2HQYA 1OZPA 4RI1A 3V8IA 3PGPA 3H4QA 4LX9A 2OZUA 3QB8A 1Q2DA 3B8GA 1M1DA 1S7KA 4R3KA 3FB3A 3S6GA 3T90A 4QUSA 1YVKA 1KZFA 4PSXA 4QBJA 2B3VA 4JD6A 5AG4A 4KLVA 5G22A 4MFZA 2HUZA 3BJ8A 4IF5A 1YGHA 4L8AA 4Y49C 3TFYA 2YNCC 3JUWA 4B5PA 2R8VA 4KOYA 4JWPA 5AG7A 4OAEA 4RS2A 1YVOA 3IU1A 1TIQA 2Z0ZA 4F0XA 1Y7RA 2CNSA 4B10A 2ZPAA 4MY0A 1YX0A 1MJAA 1J4JA 3BLNA 2B4DB 3SXNA 2PSWA 4MFLA 2BEIA 4JXRA 2PDOA 4MFQA 2KCWA 3OWCA 4A33A 4UCMA 4U9YA 2GANA 5DWMA 2ZW6A 1XEBA 3LD2A 2PQ8A 2I79A 3A9LA 3K9UA 2VBQA 1MJ9A 5C82A 2R7HA 2ARHA 1MJBA 2BSWA 1RO5A 5A27A 3GKRA 3R95A 4MFPA 4B14A 3FBUA 3FIXA 4MFKA 3RYOA 4CYPA 4II9A 2PC1A 1U6MA 2EUIA 4HKFA 2K5TA 4CGPA 3S6KA 4KUAA 3JTKA 1NE9A 3UY5A 1IYLA 4BMHA 1M4DA 3EC4A 4OLLA 4A30A 5G21A 3TT2A 4AVCA 4H6UA 4U9ZA 4PSWA 4A95A 5C88A 3DSBA 4UFXA 2Q4VA 1MK4A 2CNTA 2QIRA 4H6ZA 1ZO0A 1IICA 4DNCA 3R9GA 4XPLA 5KTDA 4KOTA 3IGRA 4CAFA 2Q7BA 2GE3A 4AG9A 4U5YA 1YREA 1SQHA 2FIWA 2Q4YA 3I9SA 1YLEA 2WSAA 4NCZA 4UA3A 2PRBA 5FVJA 4JJXA 3SXOA 2J8MA 4ZBGA 3EO4A 2B5GB 4CRYB 1PU9A 2D4PA 2J8RA 4PK2A 2HV2A 1LRZA 4CYNA 4MJ8A 2G0BA 4CGNA 2DXQA 1YR0A 3DDDA 5ISVA 4XPDB 3DR6A 4XPDC 3PP9A 4XNHB 3F5BA 2G3TA 5I0CA 3EFAA 4XNHC 5AGEA 5J8FA 2DPTA 4KZTA 5GCNA 2YNCA 3GYAA 4KVOE 4FD4A 1K4JA 2OZGA 2FL4A 4R87A 4UFVA 5G20A 3F8KA 3W6SA 1XMTA 4L89A 4CGLA 4QC6A 2WPXA 4YGOA 4QVTA 4NXYA 2QECA 2A4NA 3C26A 3G8WA 4ONUA 4E0AA 5A28A 1QSRA 4M85A 4C7IA 2OU2A 2B3UA 4KSFA 2OH1A 3VWEA 2IL4A 2REFA 4UCPA 5KTAA 2YNDA 2Z3OA 4FD6A 4HNYB 4F0YA 4IUSA 4B5PB 1NMTA 2BUEA 4AVAA 1WWZA 2Q44A 4Q38A 4X5KA 4AVBA 4NSQA 3T9YA 4C2XA 4H89A 5CNPA 2FE7A 4UBRA 1S60A 2FSRA 3BJ7A 1I21A 5EC4A 4BBHA 1QSNA 4A31A 2VZYA 2CXAA 1Q2CA 2EVNA 4KS9A 3R9EA 4E2AA 1CM0A 2CNMA 1VKCA 2H5MA 2X7BA 1S7FA 2PR8A 5E96A 4I49A 4F6AA 4CAXA 2ATRA 4EVYA 1IIDA 3TCVA 1CJWA 2BL1A 2P6FA 4CRZB 5BWAB 4MI4A 1QSTA 4UCNA 2Z3MA 2ZXVA 5F47A 3W6XA 2JLMA 1M4GA 5IB0A 1N71A 4AG7A 3WR7A 2CY2A 1KUYA 5IV0A 1YK3A 4UWJA 3TTHA 5HMNA 4KSAA 2G3AA 1VHSA 3FYNA 4CAEA 3D2PA 3JVNA 4YFJA 2REEA 3P2FA 4PV6A 2B58A 4ORFA 1KUXA 1P0HA 4R9MA 5H84A 2FT0A 1BOBA 2R1IA 4GS4A 3TO9A 1R57A 5AG5A 3D2MA 4Q36A 4ZGYB 3GY9A 4B12A 4NEXA 3D3SA 1Z4RA 2YNEA 1ON0A 3IWEA 2Q0YA 4KUBA 5KTCA 3EXNA 4E8OA 4CYQA 1S7NA 1S5KA 4KOXA 1IYKA 4KVXA 4R57A 3LODA 4CAVA 2ZW7A 4XPKA 3S6HA 2FS5A 1Q2YA 2FIAA 1KUVA 4CYOA 2Z10A 1NSLA 3ZZIA 1GHEA 2AJ6A 2GIVA 5JQ4A 2F5IA 5IX3A 2FCKA 2Z3KA 1RXTA 3W91A 4CS0B 4R3LA 4OADA 2C27A 2P6EA 3ZJ0A 3TOAA 1L0CA 4KOWA 4KVME 1QSMA 2PR1A 2OZHA 4KOVA 1FY7A 2Y0MA 4J3GA 4UWIA 3TO7A 3TE4A 1Z4EA 4MY3A 4B11A 4FD7A 4JXQA 5JPHA 2JEVA 4CGOA 1S3ZA 2VQYA 4Y49B 3FNCA 5H86A 3CXQA 5F48A 3NE7A 4UFWA 3N7ZA 5DWNA 2B4DA 5EBVA 5J8CA 4KLWA 5F49A 1XF8A 1Z9UA 3QAHA 2NMTA 2VEZA 1Y9WA 2WUUA 4JLYA 3DR8A 2I00A 3CXPA 5F46A 3D8PA 1UFHA 2JDCA 3DNSA 1BO4A 3MGDA 4LUAA 3VWDA 3CXSA 2P0WA 4YRHA 3TO6A 3S6FA 4A2ZA 1M44A 2B4BA 2JDDA 3F0AA 2YGWA 4M3SA 3KKWA 4C2YA 2Z3LA 3EY5A 2VI7A 2WPWA 4MBUA 2AE6A 2Z11A 2ZW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXT A;  4PK3 A;  2FXF A;  1XIX A;  4KOS A;  4NF1 A;  4FD5 A;  2Q04 A;  3PZJ A;  3SHP A;  4AB7 A;  1IB1 E;  4CAW A;  2QML A;  3E0K A;  2OB0 A;  2R98 A;  1XE4 A;  2VZZ A;  3R1K A;  3R96 A;  2RC4 A;  1V0C A;  1Y9K A;  4KOU A;  1I1D A;  1M4I A;  2VXK A;  2O28 A;  1QSO A;  2ZW4 A;  1B87 A;  2J8N A;  1I12 A;  1PUA A;  2B5G A;  3TOB A;  4MHD A;  3R9F A;  1S7L A;  4HNX B;  4QB9 A;  4HNW B;  3P2H A;  2D4O A;  1P4N A;  1B6B A;  2P6G A;  5HH1 A;  4K30 A;  4B5O A;  4KOR A;  3FRM A;  3IWG A;  1WK4 A;  3I3G A;  3G3S A;  2HQY A;  1OZP A;  4RI1 A;  3V8I A;  3PGP A;  3H4Q A;  4LX9 A;  2OZU A;  3QB8 A;  1Q2D A;  3B8G A;  1M1D A;  1S7K A;  4R3K A;  3FB3 A;  3S6G A;  3T90 A;  4QUS A;  1YVK A;  1KZF A;  4PSX A;  4QBJ A;  2B3V A;  4JD6 A;  4KLV A;  2HUZ A;  3BJ8 A;  4IF5 A;  1YGH A;  4L8A A;  4Y49 C;  3TFY A;  3JUW A;  4B5P A;  2R8V A;  4KOY A;  4JWP A;  4OAE A;  4RS2 A;  1YVO A;  1TIQ A;  2Z0Z A;  1Y7R A;  2CNS A;  2ZPA A;  4MY0 A;  1YX0 A;  1MJA A;  1J4J A;  3BLN A;  2B4D B;  3SXN A;  2PSW A;  2BEI A;  4JXR A;  2PDO A;  2KCW A;  3OWC A;  4U9Y A;  2GAN A;  5DWM A;  2ZW6 A;  1XEB A;  3LD2 A;  2PQ8 A;  2I79 A;  3K9U A;  2VBQ A;  1MJ9 A;  5C82 A;  2R7H A;  2ARH A;  1MJB A;  2BSW A;  1RO5 A;  3GKR A;  3R95 A;  3FBU A;  3FIX A;  3RYO A;  4II9 A;  2PC1 A;  1U6M A;  2EUI A;  4HKF A;  2K5T A;  3S6K A;  4KUA A;  1NE9 A;  3UY5 A;  1IYL A;  4BMH A;  1M4D A;  3EC4 A;  4OLL A;  3TT2 A;  4AVC A;  4H6U A;  4U9Z A;  4PSW A;  5C88 A;  3DSB A;  2Q4V A;  1MK4 A;  2CNT A;  2QIR A;  4H6Z A;  1IIC A;  4DNC A;  3R9G A;  4XPL A;  5KTD A;  4KOT A;  3IGR A;  2Q7B A;  2GE3 A;  4AG9 A;  4U5Y A;  1YRE A;  1SQH A;  2FIW A;  2Q4Y A;  3I9S A;  1YLE A;  4NCZ A;  4UA3 A;  2PRB A;  5FVJ A;  4JJX A;  3SXO A;  2J8M A;  4ZBG A;  3EO4 A;  2B5G B;  4CRY B;  1PU9 A;  2D4P A;  2J8R A;  4PK2 A;  2HV2 A;  1LRZ A;  4MJ8 A;  2G0B A;  2DXQ A;  1YR0 A;  3DDD A;  5ISV A;  4XPD B;  3DR6 A;  4XPD C;  3PP9 A;  4XNH B;  3F5B A;  2G3T A;  5I0C A;  3EFA A;  4XNH C;  5J8F A;  4KZT A;  5GCN A;  3GYA A;  4KVO E;  4FD4 A;  1K4J A;  2OZG A;  2FL4 A;  4R87 A;  3F8K A;  3W6S A;  1XMT A;  4L89 A;  4QC6 A;  2WPX A;  4YGO A;  4QVT A;  4NXY A;  2QEC A;  2A4N A;  3C26 A;  3G8W A;  4ONU A;  4E0A A;  1QSR A;  4M85 A;  2OU2 A;  2B3U A;  2OH1 A;  3VWE A;  2IL4 A;  2REF A;  5KTA A;  4FD6 A;  4HNY B;  4F0Y A;  4IUS A;  4B5P B;  1NMT A;  2BUE A;  4AVA A;  1WWZ A;  2Q44 A;  4X5K A;  4AVB A;  4NSQ A;  3T9Y A;  4H89 A;  5CNP A;  2FE7 A;  4UBR A;  1S60 A;  2FSR A;  3BJ7 A;  1I21 A;  5EC4 A;  1QSN A;  2VZY A;  1Q2C A;  2EVN A;  3R9E A;  4E2A A;  1CM0 A;  2CNM A;  1VKC A;  2H5M A;  2X7B A;  1S7F A;  2PR8 A;  5E96 A;  4I49 A;  4F6A A;  4CAX A;  2ATR A;  4EVY A;  1IID A;  3TCV A;  1CJW A;  2BL1 A;  2P6F A;  4CRZ B;  4MI4 A;  1QST A;  2ZXV A;  5F47 A;  3W6X A;  2JLM A;  1M4G A;  5IB0 A;  1N71 A;  4AG7 A;  3WR7 A;  2CY2 A;  1KUY A;  5IV0 A;  1YK3 A;  4UWJ A;  3TTH A;  5HMN A;  2G3A A;  1VHS A;  3FYN A;  3D2P A;  3JVN A;  4YFJ A;  2REE A;  3P2F A;  4PV6 A;  2B58 A;  4ORF A;  1KUX A;  1P0H A;  4R9M A;  5H84 A;  2FT0 A;  1BOB A;  2R1I A;  4GS4 A;  3TO9 A;  1R57 A;  3D2M A;  3GY9 A;  4NEX A;  3D3S A;  1Z4R A;  1ON0 A;  2Q0Y A;  4KUB A;  5KTC A;  3EXN A;  4E8O A;  1S7N A;  1S5K A;  4KOX A;  1IYK A;  4KVX A;  4R57 A;  3LOD A;  4CAV A;  2ZW7 A;  4XPK A;  3S6H A;  2FS5 A;  1Q2Y A;  2FIA A;  1KUV A;  2Z10 A;  1NSL A;  3ZZI A;  1GHE A;  2AJ6 A;  2GIV A;  5JQ4 A;  2F5I A;  5IX3 A;  2FCK A;  1RXT A;  3W91 A;  4CS0 B;  4R3L A;  4OAD A;  2C27 A;  2P6E A;  3ZJ0 A;  3TOA A;  1L0C A;  4KOW A;  4KVM E;  1QSM A;  2PR1 A;  2OZH A;  4KOV A;  1FY7 A;  2Y0M A;  4J3G A;  4UWI A;  3TO7 A;  3TE4 A;  1Z4E A;  4MY3 A;  4FD7 A;  4JXQ A;  5JPH A;  2JEV A;  1S3Z A;  2VQY A;  4Y49 B;  3FNC A;  5H86 A;  3CXQ A;  5F48 A;  3NE7 A;  3N7Z A;  5DWN A;  2B4D A;  5EBV A;  5J8C A;  4KLW A;  5F49 A;  1XF8 A;  1Z9U A;  3QAH A;  2NMT A;  2VEZ A;  1Y9W A;  4JLY A;  3DR8 A;  2I00 A;  3CXP A;  5F46 A;  3D8P A;  1UFH A;  2JDC A;  3DNS A;  1BO4 A;  3MGD A;  4LUA A;  3VWD A;  3CXS A;  2P0W A;  4YRH A;  3TO6 A;  3S6F A;  1M44 A;  2B4B A;  2JDD A;  3F0A A;  4M3S A;  3KKW A;  3EY5 A;  2VI7 A;  2WPW A;  4MBU A;  2AE6 A;  2Z11 A;  2ZW5 A; 
#chains in the Genus database with same CATH topology
 4CGM A;  3FXT A;  4PK3 A;  2PJ5 A;  2AFU A;  5HVG A;  2FXF A;  2PJ7 A;  1XIX A;  4KOS A;  3FJU A;  2VL1 A;  4NF1 A;  4R76 A;  5LYI A;  4P4E A;  1Q7L A;  3SJX A;  2JEW A;  4FD5 A;  1CP6 A;  2Q04 A;  1BLL E;  3PZJ A;  5LRG A;  3SHP A;  4AB7 A;  2IMO A;  1IB1 E;  2V8G A;  4WWV A;  4CAW A;  3H8F A;  2QML A;  3E0K A;  3LWU A;  4ZX8 A;  2OB0 A;  2O53 A;  2R98 A;  4A38 A;  1XE4 A;  2VZZ A;  3BHX A;  3GIU A;  3H5Z A;  3DLJ A;  4C68 A;  2AFO A;  4ZY0 A;  3R1K A;  3WC5 A;  3R96 A;  2RC4 A;  1V0C A;  3RNZ A;  3JRU A;  1Y9K A;  4KOU A;  1I1D A;  1M4I A;  2VXK A;  2O28 A;  1ELM P;  4A32 A;  3D67 A;  3K2K A;  4NGS A;  1QSO A;  2ZW4 A;  1ZG7 A;  4P44 A;  1B87 A;  2J8N A;  1I12 A;  3B3W A;  3IU2 A;  4ZY2 A;  2Z3P A;  1PUA A;  3NA6 A;  1IOF A;  2B5G A;  3TOB A;  4MHD A;  3QNV A;  3R9F A;  1S7L A;  4HNX B;  4QB9 A;  4HNW B;  1HEE A;  2ZW5 A;  3P2H A;  4KSI A;  2D4O A;  4B13 A;  1P4N A;  5AG6 A;  4C2Z A;  4A94 A;  1TF9 A;  1X10 A;  4NJQ A;  1B6B A;  4C7H A;  2P6G A;  5CBM A;  1EE3 P;  4M6I A;  2AFS A;  3SI0 A;  5HH1 A;  1KWM A;  1YSJ A;  4K30 A;  2DPS A;  4F8Z A;  3IFE A;  3N5F A;  3HUV A;  1IGB A;  4B5O A;  4AXV A;  4KOR A;  4FUU A;  3FRM A;  3IWG A;  5G1Z A;  4MFJ A;  2Z3N A;  5K8M A;  1WK4 A;  2PIY A;  3I3G A;  2PJ4 A;  3G3S A;  3NFZ A;  3V7Z A;  2HQY A;  1TKH A;  2EBJ A;  1OZP A;  4RI1 A;  3V8I A;  3PGP A;  3FX6 A;  3H4Q A;  4X2T A;  4LX9 A;  2OZU A;  3TC8 A;  2HC9 A;  3QB8 A;  1Q2D A;  3B8G A;  1M1D A;  4FBE A;  1S7K A;  4R3K A;  3FB3 A;  3S6G A;  4NGM A;  4QUS A;  3T90 A;  3FF3 A;  2GLJ A;  3PEI A;  5J1Q A;  1YVK A;  3RBU A;  1KZF A;  1XBU A;  4PSX A;  4P4B A;  4QBJ A;  1YLO A;  2B3V A;  4X8I A;  4JD6 A;  5AG4 A;  2PJ0 A;  4KLV A;  5G22 A;  4HPS A;  4MFZ A;  2HUZ A;  4UEE A;  3BJ8 A;  4IF5 A;  1YGH A;  4L8A A;  4Y49 C;  3TFY A;  2YNC C;  3JUW A;  2ZEN A;  3B3C A;  3WC7 A;  4B5P A;  2R8V A;  4KOY A;  4M6G A;  4JWP A;  5AG7 A;  4OAE A;  4UEZ A;  4RS2 A;  1YVO A;  3IU1 A;  1Y0Y A;  1TIQ A;  3WAB A;  3H8G A;  2Z0Z A;  4F0X A;  1Y7R A;  2CNS A;  1QQ9 A;  4B10 A;  1LOK A;  2ZPA A;  2EO8 A;  2PJB A;  2BOA A;  4MY0 A;  1ZLH A;  1YX0 A;  3I1U A;  1MJA A;  3IC1 A;  1FT7 A;  5DS0 A;  2ODF A;  1HDU A;  4NGT A;  1J4J A;  5HXD A;  3BLN A;  5K8N A;  4Z65 A;  2B4D B;  2POK A;  4MCR A;  4PPZ A;  4M6H A;  5JGF A;  1VGY A;  4OC5 A;  3SXN A;  2PSW A;  3PB9 X;  5LYF A;  4R8F A;  4MFL A;  4PXB A;  1BPN A;  2BEI A;  1TKJ A;  5F09 A;  4MHY A;  4JXR A;  4P4I A;  2PDO A;  4MFQ A;  2KCW A;  3OWC A;  4A33 A;  4UCM A;  4NGN A;  3KQZ A;  3PB4 X;  4BD9 A;  4U9Y A;  2GAN A;  5DWM A;  2ZW6 A;  1XEB A;  5LRK A;  3LD2 A;  2OR4 A;  3KR4 A;  4GM5 A;  3BXM A;  2PQ8 A;  2I79 A;  3A9L A;  3K9U A;  2VBQ A;  4OC3 A;  1MJ9 A;  5C82 A;  2R7H A;  2ARH A;  1MJB A;  2BSW A;  1DE4 C;  2CTB A;  1BPM A;  1CBX A;  4TWE A;  1ARM A;  1RO5 A;  3PFE A;  3SI2 A;  4MRI A;  5A27 A;  3GKR A;  3ISZ A;  3R95 A;  4MFP A;  4B14 A;  1XFO A;  2O4H A;  3FBU A;  5HVF A;  3FIX A;  4MFK A;  1GYT A;  3RYO A;  4CYP A;  6CPA A;  3V38 A;  4II9 A;  2PC1 A;  4P6Y A;  1U6M A;  2BO9 A;  2EUI A;  4HKF A;  2K5T A;  3GUX A;  3KHZ A;  2PJ8 A;  4CGP A;  3SJG A;  5I4M A;  3S6K A;  4F9U A;  4H2K A;  1F2P A;  1F57 A;  3JTK A;  4KUA A;  1NE9 A;  5D8N A;  1M4L A;  3UY5 A;  4DJL A;  1IYL A;  3BI1 A;  4BMH A;  2OOT A;  1M4D A;  3EC4 A;  4OLL A;  4A30 A;  4P45 A;  4YU9 A;  5G21 A;  3TT2 A;  4H6U A;  4U9Z A;  4PSW A;  3SI1 A;  4AVC A;  3S9L A;  4A95 A;  5C88 A;  3DSB A;  4UFX A;  3VH9 A;  1XJO A;  2Q4V A;  1MK4 A;  2CNT A;  2QIR A;  4H6Z A;  1ZO0 A;  1IIC A;  2IJZ A;  4R6T A;  2HB6 A;  4DNC A;  3R9G A;  2IQ6 A;  2QJ8 A;  4XPL A;  4OC2 A;  5KTD A;  4WJB A;  4KOT A;  3IGR A;  4CAF A;  2Q7B A;  2GE3 A;  2QVP A;  4AG9 A;  4U5Y A;  4DUK A;  1YRE A;  1SQH A;  2FIW A;  1AYE A;  2Q4Y A;  3MN8 A;  3I9S A;  3QAY A;  1YLE A;  1Z8W A;  2WSA A;  3CPA A;  4NCZ A;  3FMC A;  3IEH A;  4UA3 A;  2PRB A;  3IJ3 A;  2XEF A;  5FVJ A;  4JJX A;  3SXO A;  1LAM A;  2J8M A;  3PBE A;  3NH8 A;  4ZBG A;  1UWY A;  3EO4 A;  3KHX A;  4OC1 A;  4OC0 A;  2B5G B;  4CRY B;  1PU9 A;  2D4P A;  2J8R A;  4PK2 A;  2HV2 A;  1LRZ A;  4CYN A;  2AFM A;  5K8P A;  4G1P A;  3FEE A;  4FWU A;  4O23 A;  3D66 A;  4MJ8 A;  2G0B A;  5ELY A;  4CGN A;  2DXQ A;  1NSA A;  1YR0 A;  3DDD A;  5EMI A;  5ISV A;  4UEF A;  4XPD B;  4OME A;  4P4F A;  1QMU A;  4ONW A;  1LAN A;  3DR6 A;  4PQA A;  3PP9 A;  4XPD C;  3T8W A;  2AFW A;  4XNH B;  3F5B A;  2G3T A;  2PJ6 A;  5I0C A;  3EFA A;  4XNH C;  3PFO A;  5AGE A;  5J8F A;  2J9A A;  2DPT A;  3B3S A;  4UIB A;  4KZT A;  2XEI A;  5GCN A;  2YNC A;  3GYA A;  4KVO E;  1Z2L A;  2PJA A;  3D4U A;  3KR5 A;  4FD4 A;  1K4J A;  2OZG A;  2EWB A;  2F8H A;  2FL4 A;  4R87 A;  1Y7E A;  4UFV A;  5G20 A;  3F8K A;  3W6S A;  1XMT A;  4L89 A;  4CGL A;  2WYR A;  3CT9 A;  2WPX A;  4QC6 A;  2ANP A;  4YGO A;  4QVT A;  3FVL A;  4NXY A;  2QEC A;  2A4N A;  3C26 A;  1LFW A;  3G8W A;  4ONU A;  4RN7 A;  4E0A A;  5A28 A;  1QSR A;  3S9M A;  1CG2 A;  3MRU A;  2JBK A;  4M85 A;  2OU2 A;  2B3U A;  4KSF A;  4MHZ A;  4C7I A;  2OH1 A;  3NH4 A;  3VWE A;  2IL4 A;  2REF A;  4UCP A;  5KTA A;  2YND A;  2Z3O A;  4FD6 A;  2I3C A;  4HNY B;  1AUG A;  4IUS A;  4F0Y A;  8CPA A;  4JYW A;  4B5P B;  3GLJ A;  4EFD A;  1NMT A;  1R43 A;  2BUE A;  4AVA A;  1CPS A;  2Q51 A;  4GXH A;  1WWZ A;  1YW6 A;  2Q44 A;  4Q38 A;  4X5K A;  1Z8X A;  4AVB A;  5HVH A;  1YME A;  4NSQ A;  3T9Y A;  4C2X A;  4H89 A;  5CNP A;  2FE7 A;  4UBR A;  1S60 A;  2FSR A;  3BJ7 A;  1I21 A;  1BAV A;  3D7D A;  5EC4 A;  3RZA A;  4BBH A;  1QSN A;  4OIW A;  1ZG8 A;  3GB0 A;  2ZEH A;  4A31 A;  1XRY A;  2VZY A;  1Y0R A;  2CXA A;  3VAR A;  1Q2C A;  2EK9 A;  2EVN A;  4KS9 A;  3R9E A;  4E2A A;  1IY7 A;  1CM0 A;  2CNM A;  1VKC A;  2ZEL A;  3D7G A;  2H5M A;  2CTC A;  4OP4 A;  4ZYQ A;  2X7B A;  3LAC A;  1S7F A;  2PR8 A;  5E96 A;  4I49 A;  2EK8 A;  4F6A A;  2V8V A;  4ZX9 A;  4CAX A;  2ATR A;  4EVY A;  3IIB A;  1IID A;  3RO0 A;  1ELL P;  3TCV A;  1CJW A;  2WZN A;  1Z8T A;  2XEJ A;  2AFX A;  2BL1 A;  3NH5 A;  4BIN A;  3KAS A;  3WC6 A;  3B35 A;  2ZEP A;  2P6F A;  4TNU A;  4CRZ B;  1IOI A;  5BWA B;  2PJC A;  2Q4Z A;  1QST A;  4MI4 A;  2AFZ A;  3PB7 X;  4UCN A;  4YWY A;  1Z8L A;  4P4D A;  2Z3M A;  2ZXV A;  3KZW A;  5F47 A;  1LCP A;  3W6X A;  3KI9 A;  2JLM A;  1M4G A;  1YQE A;  5IB0 A;  1N71 A;  4AG7 A;  2PCU A;  4Q7A A;  5THW A;  2Q7S A;  2CY2 A;  3WR7 A;  1X12 A;  1KUY A;  3CZX A;  2C6C A;  1LAP A;  4UIA A;  1A2Z A;  1YK3 A;  2QYV A;  4UWJ A;  3TTH A;  5IV0 A;  4PXE A;  5HMN A;  4KSA A;  4ZI6 A;  2V8H A;  7CPA A;  1TKF A;  3D7H A;  4FAI A;  4F9V A;  2G3A A;  1VHS A;  2C1C A;  3FYN A;  2PVW A;  2PJ9 A;  3D2P A;  4CAE A;  1TXR A;  4EME A;  3JVN A;  4OC4 A;  4A39 A;  4YFJ A;  1ARL A;  2REE A;  3P2F A;  4PV6 A;  2B58 A;  3DGV A;  4MHN A;  4ORF A;  2Q43 A;  1KUX A;  1P0H A;  4UF4 A;  5JH9 A;  2CIJ A;  1ZLI A;  4DYO A;  2DF5 A;  2PE3 A;  2ZEF A;  4R9M A;  2ZEG A;  4LQG A;  4NGQ A;  1Z5R A;  2ABZ A;  5LYD A;  5H84 A;  2FT0 A;  3VAT A;  1BOB A;  2R1I A;  4JZ0 A;  4GS4 A;  3S9N A;  2XEG A;  3TO9 A;  1R57 A;  1OBR A;  5AG5 A;  3KL9 A;  3TX8 A;  1VHE A;  1H8L A;  3D2M A;  1PYT B;  4OKO A;  4Q36 A;  5LRJ A;  4MCP A;  3GY9 A;  3CPX A;  4ZGY B;  4B12 A;  4NEX A;  3BI0 A;  3D3S A;  4IHM A;  1Z4R A;  2YNE A;  1ON0 A;  2GU2 A;  3ISX A;  3IWE A;  2ZOG A;  2Q0Y A;  4KUB A;  4IAV A;  5KTC A;  4PXD A;  3EXN A;  2C6P A;  4CYQ A;  1S7N A;  4LQ6 A;  4E8O A;  1S5K A;  2BCO A;  2GFQ A;  1XOV A;  4KOX A;  3RAM A;  2PVV A;  1IYK A;  5LYL A;  4KVX A;  4R57 A;  3LOD A;  4CAV A;  2FVG A;  2ZW7 A;  4XPK A;  3S6H A;  1HDQ A;  2FS5 A;  4P10 A;  1Q2Y A;  2FIA A;  1KUV A;  4CYO A;  2Z10 A;  4NGR A;  1NSL A;  1GHE A;  2AJ6 A;  3ZZI A;  2GIV A;  5JQ4 A;  4MCQ A;  4NFR A;  2F5I A;  5IX3 A;  2GRE A;  1YW4 A;  1VHO A;  2FCK A;  2Z3K A;  1RXT A;  3PB8 X;  3W91 A;  3D7F A;  1CPX A;  4CS0 B;  1JWQ A;  4R3L A;  4OAD A;  4PXC A;  2C27 A;  2P6E A;  2PRQ A;  1PCA A;  3ZJ0 A;  3TOA A;  1L0C A;  4KOW A;  4W9Y A;  4KVM E;  1QSM A;  2PR1 A;  2OZH A;  3LMS A;  4KOV A;  4R7M A;  1FY7 A;  2Y0M A;  2PJ2 A;  1DTD A;  2ZEO A;  4J3G A;  4UWI A;  3TO7 A;  4RUH A;  1FNO A;  5K8O A;  3TE4 A;  2ZEM A;  1JQG A;  1Z4E A;  4MY3 A;  1TF8 A;  4FD7 A;  4JXQ A;  4B11 A;  4ZY1 A;  3L2N A;  5JPH A;  2G9D A;  1AMP A;  3PB6 X;  2JEV A;  5CPA A;  1S3Z A;  2VQY A;  3SJE A;  4Y49 B;  4CGO A;  3IWW A;  3FNC A;  3KQX A;  4IK2 A;  5H86 A;  1CP7 A;  2CF4 A;  3FH4 A;  3CXQ A;  3KGQ A;  3PBB A;  5F48 A;  2V77 A;  3NE7 A;  4MXU A;  4UFW A;  3WT4 A;  3N7Z A;  3FED A;  3FEC A;  5DWN A;  4NJR A;  3SJF A;  2ZED A;  2B4D A;  4MHP A;  5EBV A;  2V8D A;  5J8C A;  1ZG9 A;  5D29 A;  2GLF A;  2RFH A;  2NSM A;  4KLW A;  5F49 A;  3H8E A;  1CX8 A;  1XF8 A;  1Z9U A;  3QAH A;  2NMT A;  2VEZ A;  1Y9W A;  2WUU A;  4JLY A;  3CDX A;  4OID A;  4EWT A;  1XMB A;  3B2Y A;  3DR8 A;  2I00 A;  3CXP A;  5F46 A;  4P4J A;  4CPA A;  2PJ3 A;  3D8P A;  3D68 A;  1UFH A;  2JDC A;  2ZOF A;  1BO4 A;  3DNS A;  3MGD A;  4LUA A;  2F7V A;  3K9T A;  2JBJ A;  3B3V A;  3VWD A;  3CXS A;  3NE8 A;  2P0W A;  2PIZ A;  5JM6 A;  4YRH A;  2NYQ A;  3PRT A;  3TO6 A;  1R3N A;  1VIX A;  2PJ1 A;  2RB7 A;  3B3T A;  1IU8 A;  3S6F A;  4A2Z A;  4A37 A;  4B6Z A;  1M44 A;  2B4B A;  2JDD A;  3F0A A;  2YGW A;  4MCS A;  3IO1 A;  4M3S A;  3B7I A;  2DEA A;  3KKW A;  2C6G A;  4C2Y A;  5IB9 A;  2ZEE A;  2Z3L A;  3HLP A;  4MMO A;  3EY5 A;  2VI7 A;  2WPW A;  4MBU A;  4K3N A;  4NGP A;  2AE6 A;  2Z11 A;  1RTQ A;  4X3R A;  1F2O A; 
#chains in the Genus database with same CATH homology
 4CGM A;  3FXT A;  4PK3 A;  2FXF A;  1XIX A;  4KOS A;  4NF1 A;  4FD5 A;  2Q04 A;  3PZJ A;  3SHP A;  4AB7 A;  1IB1 E;  4CAW A;  2QML A;  3E0K A;  2OB0 A;  2R98 A;  1XE4 A;  2VZZ A;  3H5Z A;  4C68 A;  3R1K A;  3R96 A;  2RC4 A;  1V0C A;  1Y9K A;  4KOU A;  1I1D A;  1M4I A;  2VXK A;  2O28 A;  4A32 A;  1QSO A;  2ZW4 A;  1B87 A;  2J8N A;  1I12 A;  3IU2 A;  2Z3P A;  1PUA A;  2B5G A;  3TOB A;  4MHD A;  3R9F A;  1S7L A;  4HNX B;  4QB9 A;  4HNW B;  3P2H A;  2D4O A;  4B13 A;  1P4N A;  5AG6 A;  4C2Z A;  1B6B A;  4C7H A;  2P6G A;  5HH1 A;  4K30 A;  2DPS A;  4B5O A;  4KOR A;  3FRM A;  3IWG A;  5G1Z A;  4MFJ A;  2Z3N A;  1WK4 A;  3I3G A;  3G3S A;  2HQY A;  1OZP A;  4RI1 A;  3V8I A;  3PGP A;  3H4Q A;  4LX9 A;  2OZU A;  3QB8 A;  1Q2D A;  3B8G A;  1M1D A;  1S7K A;  4R3K A;  3FB3 A;  3S6G A;  3T90 A;  4QUS A;  1YVK A;  1KZF A;  4PSX A;  4QBJ A;  2B3V A;  4JD6 A;  5AG4 A;  4KLV A;  5G22 A;  4MFZ A;  2HUZ A;  3BJ8 A;  4IF5 A;  1YGH A;  4L8A A;  4Y49 C;  3TFY A;  2YNC C;  3JUW A;  4B5P A;  2R8V A;  4KOY A;  4JWP A;  5AG7 A;  4OAE A;  4RS2 A;  1YVO A;  3IU1 A;  1TIQ A;  2Z0Z A;  4F0X A;  1Y7R A;  2CNS A;  4B10 A;  2ZPA A;  4MY0 A;  1YX0 A;  1MJA A;  1J4J A;  3BLN A;  2B4D B;  3SXN A;  2PSW A;  4MFL A;  2BEI A;  4JXR A;  2PDO A;  4MFQ A;  2KCW A;  3OWC A;  4A33 A;  4UCM A;  4U9Y A;  2GAN A;  5DWM A;  2ZW6 A;  1XEB A;  3LD2 A;  2PQ8 A;  2I79 A;  3A9L A;  3K9U A;  2VBQ A;  1MJ9 A;  5C82 A;  2R7H A;  2ARH A;  1MJB A;  2BSW A;  1RO5 A;  5A27 A;  3GKR A;  3R95 A;  4MFP A;  4B14 A;  3FBU A;  3FIX A;  4MFK A;  3RYO A;  4CYP A;  4II9 A;  2PC1 A;  1U6M A;  2EUI A;  4HKF A;  2K5T A;  4CGP A;  3S6K A;  4KUA A;  3JTK A;  1NE9 A;  3UY5 A;  1IYL A;  4BMH A;  1M4D A;  3EC4 A;  4OLL A;  4A30 A;  5G21 A;  3TT2 A;  4AVC A;  4H6U A;  4U9Z A;  4PSW A;  4A95 A;  5C88 A;  3DSB A;  4UFX A;  2Q4V A;  1MK4 A;  2CNT A;  2QIR A;  4H6Z A;  1ZO0 A;  1IIC A;  4DNC A;  3R9G A;  4XPL A;  5KTD A;  4KOT A;  3IGR A;  4CAF A;  2Q7B A;  2GE3 A;  4AG9 A;  4U5Y A;  1YRE A;  1SQH A;  2FIW A;  2Q4Y A;  3I9S A;  1YLE A;  2WSA A;  4NCZ A;  4UA3 A;  2PRB A;  5FVJ A;  4JJX A;  3SXO A;  2J8M A;  4ZBG A;  3EO4 A;  2B5G B;  4CRY B;  1PU9 A;  2D4P A;  2J8R A;  4PK2 A;  2HV2 A;  1LRZ A;  4CYN A;  4MJ8 A;  2G0B A;  4CGN A;  2DXQ A;  1YR0 A;  3DDD A;  5ISV A;  4XPD B;  3DR6 A;  4XPD C;  3PP9 A;  4XNH B;  3F5B A;  2G3T A;  5I0C A;  3EFA A;  4XNH C;  5AGE A;  5J8F A;  2DPT A;  4KZT A;  5GCN A;  2YNC A;  3GYA A;  4KVO E;  4FD4 A;  1K4J A;  2OZG A;  2FL4 A;  4R87 A;  4UFV A;  5G20 A;  3F8K A;  3W6S A;  1XMT A;  4L89 A;  4CGL A;  4QC6 A;  2WPX A;  4YGO A;  4QVT A;  4NXY A;  2QEC A;  2A4N A;  3C26 A;  3G8W A;  4ONU A;  4E0A A;  5A28 A;  1QSR A;  4M85 A;  4C7I A;  2OU2 A;  2B3U A;  4KSF A;  2OH1 A;  3VWE A;  2IL4 A;  2REF A;  4UCP A;  5KTA A;  2YND A;  2Z3O A;  4FD6 A;  4HNY B;  4F0Y A;  4IUS A;  4B5P B;  1NMT A;  2BUE A;  4AVA A;  1WWZ A;  2Q44 A;  4Q38 A;  4X5K A;  4AVB A;  4NSQ A;  3T9Y A;  4C2X A;  4H89 A;  5CNP A;  2FE7 A;  4UBR A;  1S60 A;  2FSR A;  3BJ7 A;  1I21 A;  5EC4 A;  4BBH A;  1QSN A;  4A31 A;  2VZY A;  2CXA A;  1Q2C A;  2EVN A;  4KS9 A;  3R9E A;  4E2A A;  1CM0 A;  2CNM A;  1VKC A;  2H5M A;  2X7B A;  1S7F A;  2PR8 A;  5E96 A;  4I49 A;  4F6A A;  4CAX A;  2ATR A;  4EVY A;  1IID A;  3TCV A;  1CJW A;  2BL1 A;  2P6F A;  4CRZ B;  5BWA B;  4MI4 A;  1QST A;  4UCN A;  2Z3M A;  2ZXV A;  5F47 A;  3W6X A;  2JLM A;  1M4G A;  5IB0 A;  1N71 A;  4AG7 A;  3WR7 A;  2CY2 A;  1KUY A;  5IV0 A;  1YK3 A;  4UWJ A;  3TTH A;  5HMN A;  4KSA A;  2G3A A;  1VHS A;  3FYN A;  4CAE A;  3D2P A;  3JVN A;  4YFJ A;  2REE A;  3P2F A;  4PV6 A;  2B58 A;  4ORF A;  1KUX A;  1P0H A;  4R9M A;  5H84 A;  2FT0 A;  1BOB A;  2R1I A;  4GS4 A;  3TO9 A;  1R57 A;  5AG5 A;  3D2M A;  4Q36 A;  4ZGY B;  3GY9 A;  4B12 A;  4NEX A;  3D3S A;  1Z4R A;  2YNE A;  1ON0 A;  3IWE A;  2Q0Y A;  4KUB A;  5KTC A;  3EXN A;  4E8O A;  4CYQ A;  1S7N A;  1S5K A;  4KOX A;  1IYK A;  4KVX A;  4R57 A;  3LOD A;  4CAV A;  2ZW7 A;  4XPK A;  3S6H A;  2FS5 A;  1Q2Y A;  2FIA A;  1KUV A;  4CYO A;  2Z10 A;  1NSL A;  3ZZI A;  1GHE A;  2AJ6 A;  2GIV A;  5JQ4 A;  2F5I A;  5IX3 A;  2FCK A;  2Z3K A;  1RXT A;  3W91 A;  4CS0 B;  4R3L A;  4OAD A;  2C27 A;  2P6E A;  3ZJ0 A;  3TOA A;  1L0C A;  4KOW A;  4KVM E;  1QSM A;  2PR1 A;  2OZH A;  4KOV A;  1FY7 A;  2Y0M A;  4J3G A;  4UWI A;  3TO7 A;  3TE4 A;  1Z4E A;  4MY3 A;  4B11 A;  4FD7 A;  4JXQ A;  5JPH A;  2JEV A;  4CGO A;  1S3Z A;  2VQY A;  4Y49 B;  3FNC A;  5H86 A;  3CXQ A;  5F48 A;  3NE7 A;  4UFW A;  3N7Z A;  5DWN A;  2B4D A;  5EBV A;  5J8C A;  4KLW A;  5F49 A;  1XF8 A;  1Z9U A;  3QAH A;  2NMT A;  2VEZ A;  1Y9W A;  2WUU A;  4JLY A;  3DR8 A;  2I00 A;  3CXP A;  5F46 A;  3D8P A;  1UFH A;  2JDC A;  3DNS A;  1BO4 A;  3MGD A;  4LUA A;  3VWD A;  3CXS A;  2P0W A;  4YRH A;  3TO6 A;  3S6F A;  4A2Z A;  1M44 A;  2B4B A;  2JDD A;  3F0A A;  2YGW A;  4M3S A;  3KKW A;  4C2Y A;  2Z3L A;  3EY5 A;  2VI7 A;  2WPW A;  4MBU A;  2AE6 A;  2Z11 A;  2ZW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...