4YRHA

P21 isoform of mec-17 from danio rerio
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
184
structure length
177
Chain Sequence
DFPYDLNALFPERISVLDSNLSRPDPLPQVTTVIDELGKASSKAQQLPAPITSAAKLQANRHHLYLLKDGEQNGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVFAGFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-tubulin N-acetyltransferase 1
publication title Structure of DrMEC-17 residue 2-185 at 2.85 Angstroms resolution
rcsb
source organism Danio rerio
total genus 41
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.1.108: Alpha-tubulin N-acetyltransferase.
pdb deposition date 2015-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05301 Acetyltransf_16 GNAT acetyltransferase, Mec-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yrhA00
5FVJA 4FD4A 2FCKA 4NF1A 4CS0B 4YRHA 2RC4A 3R96A 4JD6A 3DR8A 4FD5A 4KOWA 1GHEA 2R1IA 3T90A 2B4DB 5I0CA 4UBRA 4UWIA 1IICA 3R1KA 1S7LA 4AVAA 5F48A 4KVOE 1IYKA 2O28A 4B5PA 2FT0A 2VXKA 4KOYA 4OAEA 3R9GA 5EBVA 3D2PA 4HNYB 4XPKA 1XIXA 2ZW4A 2FIWA 3B8GA 3BLNA 2CNMA 4BMHA 4KUAA 2Q4YA 3I9SA 1CJWA 4AG7A 1BO4A 4QB9A 3S6GA 3EY5A 4IF5A 4CAXA 4UA3A 3EXNA 3OWCA 4MI4A 2PR8A 3NE7A 1Q2DA 3TO6A 5JQ4A 3W6SA 2BUEA 3FRMA 2G3TA 1YK3A 1XMTA 5IX3A 4B5PB 2VZZA 1M4IA 1XF8A 3F5BA 1N71A 3EC4A 5E96A 1YX0A 2B5GA 2PRBA 3I3GA 3R9FA 4U5YA 5F49A 4L8AA 3TOBA 1Y9WA 2CNSA 1YVKA 2R8VA 5KTAA 4OLLA 2EUIA 4E2AA 2F5IA 3CXQA 2ZW6A 4RS2A 1M4DA 2JLMA 1QSTA 2BL1A 5IB0A 3JUWA 2B3UA 4X5KA 4AG9A 4PV6A 1WK4A 3V8IA 4KLWA 4NCZA 1P0HA 1I21A 2HV2A 1YR0A 5KTCA 1J4JA 3ZZIA 1K4JA 5F47A 4UWJA 2FSRA 2X7BA 3TE4A 2Z0ZA 3TO9A 1I1DA 1MJ9A 3DNSA 3GKRA 2OZUA 3R9EA 1YGHA 1VHSA 2OH1A 2VI7A 4QBJA 3D2MA 4MJ8A 1TIQA 1YLEA 3EO4A 2G3AA 3W91A 3IWGA 2Q04A 4R3KA 2FE7A 2H5MA 2JEVA 4YGOA 4II9A 4M3SA 4KVME 3QB8A 1YVOA 3FYNA 3VWEA 4PK2A 2D4OA 3TOAA 2PR1A 1KUYA 4Y49B 4QUSA 1BOBA 3N7ZA 1S60A 2OZGA 4NXYA 2VBQA 4JXQA 1WWZA 4HNWB 2PSWA 4KOUA 4MHDA 5DWNA 3EFAA 5CNPA 3SXNA 4IUSA 1LRZA 3FIXA 4K30A 4H6ZA 1MK4A 4CRZB 4KOXA 4XPDB 3LD2A 3D8PA 4JJXA 2I00A 2AE6A 2OB0A 3S6KA 2J8RA 2B3VA 3PGPA 4ONUA 4KOVA 2J8MA 2ZXVA 1S7NA 5HMNA 3CXPA 2GIVA 2QMLA 3E0KA 1Y9KA 3QAHA 4CRYB 1M44A 4LX9A 3PZJA 5HH1A 1IIDA 3KKWA 4AVCA 1KZFA 2C27A 4PK3A 4R87A 2FL4A 2WPXA 4NEXA 1B87A 1UFHA 2BEIA 1CM0A 4R9MA 1Q2CA 1M1DA 2K5TA 3RYOA 2G0BA 2HQYA 2FXFA 2P0WA 3P2HA 3UY5A 5KTDA 3ZJ0A 4Y49C 1R57A 2R7HA 2GANA 2QECA 1I12A 3TCVA 2B4BA 5H84A 1PUAA 3TFYA 4E0AA 2I79A 1S5KA 2Q44A 4AB7A 4E8OA 1S7FA 4XPDC 5EC4A 4J3GA 2REEA 3GYAA 2JDCA 3DR6A 1P4NA 3G8WA 3P2FA 1M4GA 4MY3A 2OZHA 4KLVA 4QVTA 1PU9A 2PDOA 5GCNA 2VQYA 4FD6A 1L0CA 2Z11A 1NE9A 5DWMA 3H4QA 3CXSA 4OADA 4DNCA 2ATRA 3R95A 1YREA 3F8KA 2REFA 4KOSA 2Z10A 1MJBA 1XE4A 1QSOA 4JLYA 3LODA 1OZPA 2AJ6A 1KUVA 1RO5A 4U9ZA 4YFJA 2P6GA 2CNTA 4LUAA 4JWPA 1U6MA 1Q2YA 2FIAA 1S7KA 4KVXA 3TTHA 2JDDA 3FB3A 4GS4A 2ZW5A 4F6AA 2A4NA 4MBUA 2Y0MA 2FS5A 4FD7A 3FBUA 3PP9A 4NSQA 3D3SA 5C88A 2EVNA 1V0CA 1NSLA 2B58A 4QC6A 1SQHA 5IV0A 3TT2A 2WPWA 2PQ8A 1RXTA 1VKCA 3SXOA 2Q7BA 2IL4A 3T9YA 4KORA 4XNHB 1KUXA 4AVBA 1FY7A 3FNCA 5C82A 1ON0A 4HKFA 2KCWA 4R57A 4ORFA 2OU2A 4H89A 2CY2A 3JVNA 4U9YA 1Z4RA 5ISVA 2QIRA 2ARHA 4KZTA 3G3SA 4HNXB 3MGDA 4H6UA 5J8CA 1QSNA 3GY9A 3BJ8A 4RI1A 4KUBA 1S3ZA 3VWDA 2VEZA 4B5OA 1IYLA 1IB1E 4JXRA 3IGRA 3TO7A 2VZYA 3K9UA 2P6EA 2D4PA 4R3LA 4I49A 5J8FA 4PSXA 3DDDA 2PC1A 5JPHA 2GE3A 2ZW7A 1QSMA 2J8NA 4CAWA 1NMTA 4L89A 2Q4VA 1MJAA 3SHPA 3S6HA 3BJ7A 4MY0A 2NMTA 3DSBA 4ZBGA 4CAVA 3S6FA 2BSWA 2HUZA 3FXTA 4XNHC 2B4DA 4F0YA 1Y7RA 2B5GB 1B6BA 3C26A 5H86A 4KOTA 4EVYA 5F46A 2DXQA 3F0AA 1Z9UA 4PSWA 3W6XA 3WR7A 2R98A 1Z4EA 4M85A 2P6FA 4XPLA 1QSRA 1XEBA 2Q0YA 2ZPAA
chains in the Genus database with same CATH superfamily
2AFSA 3CDXA 3D7GA 2ZEFA 4FD4A 5FVJA 2FCKA 4NF1A 1YW6A 4CGLA 3WC7A 4YRHA 4CS0B 2QVPA 1X10A 2RC4A 3R96A 4FBEA 4JD6A 4UIBA 4UCPA 3DR8A 4M6IA 1F2OA 4FD5A 4KOWA 4GXHA 1GHEA 4AXVA 3VARA 1A2ZA 3SJXA 2R1IA 1Z8XA 4UEFA 3T90A 1Z8WA 2B4DB 3PRTA 4OC4A 3QAYA 1CG2A 5LRGA 4R7MA 5A28A 2AFOA 2NYQA 5I0CA 4UBRA 4UWIA 3ISZA 4ZY2A 2DPTA 1IICA 3R1KA 3KHZA 4NJRA 1S7LA 4AVAA 1Y0YA 5F48A 4M6GA 4KVOE 1IYKA 5K8PA 2O28A 3B3WA 4OMEA 4B5PA 2FT0A 2VXKA 4KOYA 1Y0RA 4B6ZA 1Z8TA 1VHEA 4OAEA 1HEEA 3R9GA 4CPAA 5EBVA 4LQGA 3D2PA 3KHXA 3GB0A 6CPAA 4HNYB 1DTDA 4XPKA 1XIXA 3D7DA 3SI0A 3JTKA 2ZW4A 4CYQA 3D4UA 3D67A 3V7ZA 5AGEA 3FEEA 2FIWA 4NGMA 3B8GA 1Z8LA 3BLNA 4ZI6A 3PB7X 1ARMA 2CNMA 4GM5A 4BMHA 2VL1A 5HVGA 2ZEPA 2Q4YA 3I9SA 3KR5A 4KUAA 1CJWA 4AG7A 1BO4A 4PXDA 2PJ1A 4QB9A 3S6GA 3EY5A 2V8HA 4IF5A 4CAXA 4UA3A 4A38A 2PJBA 3EXNA 3OWCA 4MI4A 3MN8A 2PR8A 3NE7A 1Q2DA 4CYNA 4YU9A 3TO6A 4OC1A 5JQ4A 3W6SA 3BI1A 2BUEA 4NGRA 3VH9A 1X12A 2Q51A 2WSAA 4BD9A 4C2YA 4CGMA 4JYWA 3FRMA 2G3TA 1YK3A 2DPSA 1XMTA 2DF5A 5IX3A 3A9LA 1ZG7A 4B5PB 4UFXA 2IMOA 2VZZA 1M4IA 1XF8A 3F5BA 1N71A 1Q7LA 2FVGA 2YNEA 3B3CA 3EC4A 4MXUA 4B11A 4CAFA 1PYTB 5E96A 2JBKA 1CPSA 1YX0A 1XMBA 5G1ZA 4UFVA 3FVLA 2B5GA 2PRBA 3I3GA 4Q36A 4TWEA 3KI9A 4U5YA 1YW4A 4KSIA 4ONWA 3R9FA 5F49A 4L8AA 3TOBA 4OKOA 2CXAA 4HPSA 2Z3LA 1Y9WA 1TF9A 2CNSA 3H8GA 1UWYA 1YVKA 1XFOA 4DJLA 2R8VA 5KTAA 2PJ6A 4MCRA 3PBEA 4OLLA 2EUIA 4A30A 2V77A 1Y7EA 4E2AA 2EK9A 2F5IA 3CXQA 2YNCA 2ZW6A 2CF4A 4RS2A 1YSJA 1M4DA 2JLMA 4MCQA 1QSTA 2BL1A 2ZOFA 2CIJA 5AG5A 3IWEA 4B10A 4CYOA 2BCOA 5IB0A 1OBRA 3JUWA 2B3UA 3KQZA 1XOVA 4X5KA 3RNZA 3SI2A 4AG9A 1XJOA 4A33A 4PV6A 5HVFA 4ZGYB 1CX8A 4LQ6A 1WK4A 3V8IA 4JZ0A 4KLWA 4NCZA 4CGOA 1P0HA 1I21A 4R8FA 2HV2A 1AUGA 1HDQA 1YR0A 2I3CA 4MCSA 3S9LA 5KTCA 1J4JA 3LMSA 1AMPA 2C6CA 2YGWA 4NGSA 3ZZIA 3FEDA 1K4JA 5F47A 3NH5A 4UWJA 2FSRA 2X7BA 1Z5RA 3IIBA 4IK2A 5DS0A 2Z0ZA 5G20A 2XEGA 3TO9A 1I1DA 4F0XA 3TE4A 1MJ9A 1YQEA 5LYDA 3DNSA 1XBUA 1LAMA 5D8NA 4EMEA 3GKRA 2OZUA 3R9EA 1YGHA 4MFJA 1BPMA 1VHSA 2OH1A 4ZYQA 2VI7A 4QBJA 3D68A 2PVVA 3D2MA 2C1CA 3S9MA 4IHMA 5EMIA 4P4DA 4MJ8A 1TIQA 5LYLA 4FWUA 3KL9A 3CZXA 1YLEA 2EWBA 3EO4A 4EFDA 4A31A 3TX8A 2G3AA 4RUHA 2GREA 2Q7SA 3W91A 2EBJA 1H8LA 2Q04A 2ZOGA 3IWGA 3PFEA 4MFKA 3PB6X 4MHZA 4R3KA 3SJEA 2FE7A 4UCNA 5K8NA 2H5MA 2JEVA 2ZEOA 4P45A 4K3NA 4YGOA 4DYOA 4II9A 2ZEEA 4M3SA 4OC0A 4KVME 1PCAA 3QB8A 1YVOA 2PIZA 3FYNA 2PJ4A 3VWEA 4PK2A 2D4OA 1IOFA 3LACA 2PJ5A 3TOAA 2GU2A 2PR1A 1KUYA 3B3SA 3H8EA 4Y49B 4QUSA 1BOBA 4R76A 3N7ZA 2OZGA 1S60A 4NXYA 3T8WA 2VBQA 4JXQA 4B12A 1WWZA 3KQXA 4HNWB 4BBHA 2PSWA 4KOUA 4MHDA 1ELLP 3HLPA 3EFAA 3NE8A 5CNPA 5DWNA 5A27A 2ZEMA 4DUKA 3SXNA 1R3NA 4IUSA 3RBUA 1LRZA 4CYPA 1TKJA 3IU2A 3FIXA 2AFWA 4K30A 2WUUA 4H6ZA 1MK4A 5K8OA 4CRZB 3V38A 4KOXA 4XPDB 3LD2A 3D8PA 2I00A 4G1PA 2AE6A 2OB0A 2ZEGA 4JJXA 3S6KA 5LRJA 2OR4A 3WABA 4KS9A 4ZY0A 4UFWA 2J8RA 2B3VA 3PGPA 4ONUA 3IU1A 2J8MA 2ZXVA 3DLJA 1S7NA 4KOVA 5HMNA 5K8MA 3FMCA 2YNCC 3CXPA 2GIVA 2QMLA 3E0KA 3K2KA 1Y9KA 4MMOA 1TF8A 2PCUA 1ELMP 1QQ9A 3QAHA 2JEWA 2PJ3A 4CRYB 2YNDA 3KASA 1M44A 3MRUA 4LX9A 3PZJA 2CTBA 4P6YA 1IIDA 5HH1A 1IY7A 3KKWA 1XRYA 4OP4A 3BXMA 2PJ0A 1KZFA 4AVCA 2C27A 5AG7A 5ELYA 3FX6A 4F8ZA 2PIYA 4PK3A 4R87A 2FL4A 2WPXA 4NEXA 1B87A 1UFHA 2POKA 2BEIA 4P4JA 4M6HA 4CGNA 3GUXA 4A95A 1CM0A 1R43A 4R9MA 4NGNA 1Q2CA 2WYRA 4ZX9A 3KGQA 3PB4X 1BPNA 1M1DA 2K5TA 4MCPA 4P10A 2G0BA 3RYOA 2HQYA 2FXFA 1HDUA 2P0WA 2PJAA 3P2HA 3UY5A 1F2PA 2IJZA 1FNOA 3IEHA 5KTDA 4MHNA 2Z3NA 4FAIA 1LOKA 3FECA 3ZJ0A 1RTQA 2Z3OA 1R57A 4Y49C 2R7HA 4OIDA 2GANA 2QECA 4UEZA 1I12A 1YMEA 3TCVA 4UF4A 7CPAA 2B4BA 3B3VA 5H84A 3NH8A 3H8FA 1PUAA 2WZNA 4WJBA 3TFYA 4P4FA 5HVHA 4A2ZA 4E0AA 3CPAA 3IC1A 5HXDA 3VATA 4UEEA 2ZELA 4B13A 4X3RA 5I4MA 2I79A 1S5KA 2Q44A 3SJFA 4AB7A 1S7FA 4XPDC 4E8OA 5EC4A 3NFZA 4J3GA 2Z3KA 2REEA 5LYFA 3GYAA 3PEIA 1LFWA 2JDCA 3DR6A 3L2NA 1LAPA 1CP7A 1P4NA 4P44A 2HC9A 2F7VA 4PXCA 3G8WA 3P2FA 1ZLHA 4PQAA 2OOTA 1M4GA 5AG6A 4MY3A 2OZHA 4PPZA 4P4EA 1EE3P 5G22A 1ZO0A 3BI0A 4KLVA 1LCPA 4MHPA 1PU9A 2PDOA 4QVTA 2ZEHA 3H5ZA 5GCNA 4UCMA 1QMUA 2GFQA 3RO0A 2VQYA 2PE3A 4FD6A 1VHOA 2PJCA 2PJ2A 1L0CA 3D66A 2Z11A 4C2XA 3IJ3A 1TXRA 2C6PA 4C7HA 2PJ8A 1IOIA 3PFOA 1NE9A 5DWMA 3H4QA 1ZG9A 2BOAA 4A94A 1BAVA 3RAMA 2JBJA 1IU8A 2IQ6A 3CXSA 4OADA 4DNCA 2O53A 4NJQA 2ATRA 3R95A 4MRIA 4OC3A 4MFZA 1YREA 4NGTA 3BHXA 2REFA 2AFUA 2Z10A 3F8KA 1MJBA 4IAVA 4KOSA 3GLJA 1CPXA 5F09A 1XE4A 1JQGA 2QJ8A 1QSOA 4JLYA 3LODA 4X8IA 5JM6A 1DE4C 1JWQA 1OZPA 2AJ6A 4F9UA 1BLLE 4C68A 1TKHA 3RZAA 5CPAA 4B14A 1KUVA 1RO5A 3B3TA 4U9ZA 4YFJA 2P6GA 2CNTA 4LUAA 4JWPA 4A37A 1U6MA 1CBXA 1ZG8A 5D29A 1Q2YA 3B7IA 3CT9A 3IWWA 3GIUA 3SI1A 2FIAA 2Q43A 2V8GA 1S7KA 3FF3A 4KVXA 3TTHA 5JH9A 2JDDA 3FB3A 4GS4A 2EK8A 2ZW5A 3DGVA 4F6AA 2A4NA 1IGBA 3NA6A 4MBUA 2Y0MA 2FS5A 4MFQA 4W9YA 4YWYA 4FD7A 5BWAB 3B2YA 3FBUA 4H2KA 5LRKA 4UIAA 3PP9A 4NSQA 2GLJA 3D3SA 2BO9A 4MFPA 5C88A 1FT7A 1NSAA 3D7HA 4NGQA 2EVNA 3LWUA 1V0CA 5IB9A 1NSLA 2B58A 4QC6A 1SQHA 3JRUA 5IV0A 4A32A 2CTCA 2Z3MA 3TT2A 2WPWA 2PQ8A 4OIWA 1RXTA 5AG4A 2ZENA 1VKCA 3I1UA 3SXOA 2PJ9A 2IL4A 2Q7BA 3T9YA 1VGYA 4OC2A 4KORA 4MFLA 4XNHB 1KUXA 4AVBA 2ANPA 1FY7A 3FNCA 3QNVA 2HB6A 4F9VA 5C82A 4BINA 4C7IA 1ON0A 5LYIA 4O23A 3HUVA 4HKFA 2KCWA 4R57A 4ORFA 2OU2A 4H89A 2CY2A 3JVNA 4U9YA 1Z4RA 4Q7AA 5ISVA 2QIRA 3B35A 1ZLIA 4P4BA 4ZX8A 1GYTA 2ARHA 4KZTA 2PJ7A 3G3SA 4HNXB 4Q38A 3MGDA 4H6UA 5J8CA 1QSNA 3GY9A 2QYVA 4EWTA 2O4HA 2RFHA 1M4LA 3BJ8A 4RI1A 4KUBA 3WC5A 4CAEA 1S3ZA 3VWDA 2VEZA 4B5OA 2ODFA 1IYLA 1IB1E 1VIXA 4JXRA 2XEIA 3IGRA 4WWVA 1Z2LA 2XEFA 3K9TA 2J9AA 3TO7A 5CBMA 2ABZA 2VZYA 3K9UA 4KSAA 2P6EA 2D4PA 4R3LA 4TNUA 2PVWA 4FUUA 4I49A 5THWA 2EO8A 2F8HA 2ZEDA 3TC8A 4A39A 3WT4A 2NSMA 5J8FA 4PSXA 3PBBA 5J1QA 3DDDA 2PC1A 1AYEA 5JPHA 2AFMA 2GLFA 3ISXA 2GE3A 3PB9X 2ZW7A 2PRQA 2AFXA 4ZY1A 3PB8X 1KWMA 1QSMA 2J8NA 1CP6A 4CAWA 1NMTA 4L89A 2Q4VA 1MJAA 3SHPA 2RB7A 3S6HA 1ARLA 4RN7A 3BJ7A 4NGPA 2V8DA 4MHYA 4MY0A 2NMTA 3DSBA 4ZBGA 4CAVA 2C6GA 1F57A 4C2ZA 2Q4ZA 4P4IA 5G21A 2V8VA 3S6FA 2BSWA 2HUZA 3FXTA 4PXBA 4XNHC 2XEJA 2B4DA 3IFEA 4NFRA 4F0YA 1Y7RA 2B5GB 1B6BA 2G9DA 3C26A 3D7FA 4KOTA 5H86A 4EVYA 3N5FA 3S9NA 5F46A 2DEAA 2DXQA 2AFZA 3F0AA 1Z9UA 4PSWA 3SJGA 4OC5A 3WC6A 3W6XA 4CGPA 3WR7A 1YLOA 3FJUA 2R98A 4R6TA 1Z4EA 1LANA 4PXEA 4Z65A 4KSFA 3FH4A 3KZWA 4M85A 2P6FA 4XPLA 1TKFA 1QSRA 1XEBA 3KR4A 4X2TA 2Q0YA 5JGFA 2Z3PA 3CPXA 3IO1A 3NH4A 8CPAA 2ZPAA
chains in the Genus database with same CATH topology
5FVJA 4FD4A 4CGLA 2FCKA 4NF1A 4CS0B 4YRHA 2RC4A 3R96A 4JD6A 4UCPA 3DR8A 4FD5A 4KOWA 1GHEA 2R1IA 3T90A 2B4DB 5A28A 5I0CA 4UBRA 4UWIA 2DPTA 1IICA 3R1KA 1S7LA 4AVAA 5F48A 4KVOE 1IYKA 2O28A 4B5PA 2FT0A 2VXKA 4KOYA 4OAEA 3R9GA 5EBVA 3D2PA 4HNYB 4XPKA 1XIXA 3JTKA 2ZW4A 4CYQA 5AGEA 2FIWA 3B8GA 3BLNA 2CNMA 4BMHA 4KUAA 2Q4YA 3I9SA 1CJWA 4AG7A 1BO4A 4QB9A 3S6GA 3EY5A 4IF5A 4CAXA 4UA3A 3EXNA 3OWCA 4MI4A 2PR8A 3NE7A 1Q2DA 4CYNA 3TO6A 5JQ4A 3W6SA 2BUEA 4C2YA 2WSAA 4CGMA 3FRMA 2G3TA 1YK3A 2DPSA 1XMTA 5IX3A 3A9LA 4B5PB 4UFXA 2VZZA 1M4IA 1XF8A 3F5BA 1N71A 2YNEA 4CAFA 3EC4A 4B11A 5E96A 1YX0A 5G1ZA 4UFVA 2B5GA 2PRBA 3I3GA 4Q36A 3R9FA 4U5YA 5F49A 4L8AA 3TOBA 2CXAA 2Z3LA 1Y9WA 2CNSA 1YVKA 2R8VA 5KTAA 4OLLA 2EUIA 4A30A 4E2AA 2F5IA 3CXQA 2YNCA 2ZW6A 4RS2A 1M4DA 2JLMA 1QSTA 2BL1A 5AG5A 3IWEA 4B10A 4CYOA 5IB0A 3JUWA 2B3UA 4X5KA 4ZGYB 4AG9A 4A33A 4PV6A 1WK4A 3V8IA 4KLWA 4NCZA 4CGOA 1P0HA 1I21A 2HV2A 1YR0A 5KTCA 1J4JA 2YGWA 3ZZIA 1K4JA 5F47A 4UWJA 2FSRA 2X7BA 3TE4A 2Z0ZA 5G20A 3TO9A 4F0XA 1I1DA 1MJ9A 3DNSA 3GKRA 2OZUA 3R9EA 1YGHA 4MFJA 1VHSA 2OH1A 2VI7A 4QBJA 3D2MA 4MJ8A 1TIQA 1YLEA 3EO4A 4A31A 2G3AA 3W91A 4MFKA 3IWGA 2Q04A 4R3KA 2FE7A 4UCNA 2H5MA 2JEVA 4YGOA 4II9A 4M3SA 4KVME 3QB8A 1YVOA 3FYNA 3VWEA 4PK2A 2D4OA 3TOAA 2PR1A 1KUYA 4Y49B 4QUSA 1BOBA 3N7ZA 1S60A 2OZGA 4NXYA 4B12A 2VBQA 4JXQA 1WWZA 4HNWB 4BBHA 2PSWA 4KOUA 4MHDA 5DWNA 3EFAA 5CNPA 5A27A 3SXNA 4IUSA 4CYPA 1LRZA 3IU2A 3FIXA 4K30A 2WUUA 4H6ZA 1MK4A 4CRZB 4KOXA 4XPDB 3LD2A 3D8PA 4JJXA 2I00A 2AE6A 2OB0A 3S6KA 4KS9A 4UFWA 2J8RA 2B3VA 3PGPA 4ONUA 3IU1A 2J8MA 2ZXVA 4KOVA 1S7NA 5HMNA 2YNCC 3CXPA 2GIVA 2QMLA 3E0KA 1Y9KA 3QAHA 4CRYB 2YNDA 1M44A 4LX9A 3PZJA 5HH1A 1IIDA 3KKWA 4AVCA 1KZFA 2C27A 5AG7A 4PK3A 4R87A 2FL4A 2WPXA 4NEXA 1B87A 1UFHA 2BEIA 4CGNA 4A95A 1CM0A 4R9MA 1Q2CA 1M1DA 2K5TA 3RYOA 2G0BA 2HQYA 2FXFA 2P0WA 3P2HA 3UY5A 5KTDA 2Z3NA 3ZJ0A 2Z3OA 1R57A 4Y49C 2R7HA 2GANA 2QECA 1I12A 3TCVA 2B4BA 5H84A 1PUAA 3TFYA 4A2ZA 4E0AA 4B13A 2I79A 1S5KA 2Q44A 4AB7A 4E8OA 1S7FA 4XPDC 5EC4A 4J3GA 2Z3KA 2REEA 3GYAA 2JDCA 3DR6A 1P4NA 3G8WA 3P2FA 1M4GA 5AG6A 4MY3A 2OZHA 5G22A 1ZO0A 4KLVA 4QVTA 1PU9A 2PDOA 5GCNA 3H5ZA 4UCMA 2VQYA 4FD6A 1L0CA 2Z11A 4C2XA 4C7HA 1NE9A 5DWMA 3H4QA 3CXSA 4OADA 4DNCA 2ATRA 3R95A 4MFZA 1YREA 3F8KA 2REFA 4KOSA 2Z10A 1MJBA 1XE4A 1QSOA 4JLYA 3LODA 1OZPA 2AJ6A 4C68A 4B14A 1KUVA 1RO5A 4U9ZA 4YFJA 2P6GA 2CNTA 4LUAA 4JWPA 1U6MA 1Q2YA 2FIAA 1S7KA 4KVXA 3TTHA 2JDDA 3FB3A 4GS4A 2ZW5A 4F6AA 2A4NA 4MBUA 2Y0MA 2FS5A 4MFQA 4FD7A 5BWAB 3FBUA 3PP9A 4NSQA 3D3SA 4MFPA 5C88A 2EVNA 1V0CA 1NSLA 2B58A 4QC6A 1SQHA 5IV0A 4A32A 2Z3MA 3TT2A 2WPWA 2PQ8A 1RXTA 5AG4A 1VKCA 3SXOA 2Q7BA 2IL4A 3T9YA 4KORA 4MFLA 4XNHB 1KUXA 4AVBA 1FY7A 3FNCA 5C82A 4C7IA 1ON0A 4HKFA 2KCWA 4R57A 4ORFA 2OU2A 4H89A 2CY2A 3JVNA 4U9YA 1Z4RA 5ISVA 2QIRA 2ARHA 4KZTA 3G3SA 4HNXB 4Q38A 3MGDA 4H6UA 5J8CA 1QSNA 3GY9A 3BJ8A 4RI1A 4KUBA 4CAEA 1S3ZA 3VWDA 2VEZA 4B5OA 1IYLA 1IB1E 4JXRA 3IGRA 3TO7A 2VZYA 3K9UA 4KSAA 2P6EA 2D4PA 4R3LA 4I49A 5J8FA 4PSXA 3DDDA 2PC1A 5JPHA 2GE3A 2ZW7A 1QSMA 2J8NA 4CAWA 1NMTA 4L89A 2Q4VA 1MJAA 3SHPA 3S6HA 3BJ7A 4MY0A 2NMTA 3DSBA 4ZBGA 4CAVA 4C2ZA 5G21A 3S6FA 2BSWA 2HUZA 3FXTA 4XNHC 2B4DA 4F0YA 1Y7RA 2B5GB 1B6BA 3C26A 5H86A 4KOTA 4EVYA 5F46A 2DXQA 4CGPA 3F0AA 1Z9UA 4PSWA 3W6XA 3WR7A 2R98A 1Z4EA 4KSFA 4M85A 2P6FA 4XPLA 1QSRA 1XEBA 2Q0YA 2Z3PA 2ZPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVJ A;  4FD4 A;  2FCK A;  4NF1 A;  4CS0 B;  4YRH A;  2RC4 A;  3R96 A;  4JD6 A;  3DR8 A;  4FD5 A;  4KOW A;  1GHE A;  2R1I A;  3T90 A;  2B4D B;  5I0C A;  4UBR A;  4UWI A;  1IIC A;  3R1K A;  1S7L A;  4AVA A;  5F48 A;  4KVO E;  1IYK A;  2O28 A;  4B5P A;  2FT0 A;  2VXK A;  4KOY A;  4OAE A;  3R9G A;  5EBV A;  3D2P A;  4HNY B;  4XPK A;  1XIX A;  2ZW4 A;  2FIW A;  3B8G A;  3BLN A;  2CNM A;  4BMH A;  4KUA A;  2Q4Y A;  3I9S A;  1CJW A;  4AG7 A;  1BO4 A;  4QB9 A;  3S6G A;  3EY5 A;  4IF5 A;  4CAX A;  4UA3 A;  3EXN A;  3OWC A;  4MI4 A;  2PR8 A;  3NE7 A;  1Q2D A;  3TO6 A;  5JQ4 A;  3W6S A;  2BUE A;  3FRM A;  2G3T A;  1YK3 A;  1XMT A;  5IX3 A;  4B5P B;  2VZZ A;  1M4I A;  1XF8 A;  3F5B A;  1N71 A;  3EC4 A;  5E96 A;  1YX0 A;  2B5G A;  2PRB A;  3I3G A;  3R9F A;  4U5Y A;  5F49 A;  4L8A A;  3TOB A;  1Y9W A;  2CNS A;  1YVK A;  2R8V A;  5KTA A;  4OLL A;  2EUI A;  4E2A A;  2F5I A;  3CXQ A;  2ZW6 A;  4RS2 A;  1M4D A;  2JLM A;  1QST A;  2BL1 A;  5IB0 A;  3JUW A;  2B3U A;  4X5K A;  4AG9 A;  4PV6 A;  1WK4 A;  3V8I A;  4KLW A;  4NCZ A;  1P0H A;  1I21 A;  2HV2 A;  1YR0 A;  5KTC A;  1J4J A;  3ZZI A;  1K4J A;  5F47 A;  4UWJ A;  2FSR A;  2X7B A;  3TE4 A;  2Z0Z A;  3TO9 A;  1I1D A;  1MJ9 A;  3DNS A;  3GKR A;  2OZU A;  3R9E A;  1YGH A;  1VHS A;  2OH1 A;  2VI7 A;  4QBJ A;  3D2M A;  4MJ8 A;  1TIQ A;  1YLE A;  3EO4 A;  2G3A A;  3W91 A;  3IWG A;  2Q04 A;  4R3K A;  2FE7 A;  2H5M A;  2JEV A;  4YGO A;  4II9 A;  4M3S A;  4KVM E;  3QB8 A;  1YVO A;  3FYN A;  3VWE A;  4PK2 A;  2D4O A;  3TOA A;  2PR1 A;  1KUY A;  4Y49 B;  4QUS A;  1BOB A;  3N7Z A;  1S60 A;  2OZG A;  4NXY A;  2VBQ A;  4JXQ A;  1WWZ A;  4HNW B;  2PSW A;  4KOU A;  4MHD A;  5DWN A;  3EFA A;  5CNP A;  3SXN A;  4IUS A;  1LRZ A;  3FIX A;  4K30 A;  4H6Z A;  1MK4 A;  4CRZ B;  4KOX A;  4XPD B;  3LD2 A;  3D8P A;  4JJX A;  2I00 A;  2AE6 A;  2OB0 A;  3S6K A;  2J8R A;  2B3V A;  3PGP A;  4ONU A;  4KOV A;  2J8M A;  2ZXV A;  1S7N A;  5HMN A;  3CXP A;  2GIV A;  2QML A;  3E0K A;  1Y9K A;  3QAH A;  4CRY B;  1M44 A;  4LX9 A;  3PZJ A;  5HH1 A;  1IID A;  3KKW A;  4AVC A;  1KZF A;  2C27 A;  4PK3 A;  4R87 A;  2FL4 A;  2WPX A;  4NEX A;  1B87 A;  1UFH A;  2BEI A;  1CM0 A;  4R9M A;  1Q2C A;  1M1D A;  2K5T A;  3RYO A;  2G0B A;  2HQY A;  2FXF A;  2P0W A;  3P2H A;  3UY5 A;  5KTD A;  3ZJ0 A;  4Y49 C;  1R57 A;  2R7H A;  2GAN A;  2QEC A;  1I12 A;  3TCV A;  2B4B A;  5H84 A;  1PUA A;  3TFY A;  4E0A A;  2I79 A;  1S5K A;  2Q44 A;  4AB7 A;  4E8O A;  1S7F A;  4XPD C;  5EC4 A;  4J3G A;  2REE A;  3GYA A;  2JDC A;  3DR6 A;  1P4N A;  3G8W A;  3P2F A;  1M4G A;  4MY3 A;  2OZH A;  4KLV A;  4QVT A;  1PU9 A;  2PDO A;  5GCN A;  2VQY A;  4FD6 A;  1L0C A;  2Z11 A;  1NE9 A;  5DWM A;  3H4Q A;  3CXS A;  4OAD A;  4DNC A;  2ATR A;  3R95 A;  1YRE A;  3F8K A;  2REF A;  4KOS A;  2Z10 A;  1MJB A;  1XE4 A;  1QSO A;  4JLY A;  3LOD A;  1OZP A;  2AJ6 A;  1KUV A;  1RO5 A;  4U9Z A;  4YFJ A;  2P6G A;  2CNT A;  4LUA A;  4JWP A;  1U6M A;  1Q2Y A;  2FIA A;  1S7K A;  4KVX A;  3TTH A;  2JDD A;  3FB3 A;  4GS4 A;  2ZW5 A;  4F6A A;  2A4N A;  4MBU A;  2Y0M A;  2FS5 A;  4FD7 A;  3FBU A;  3PP9 A;  4NSQ A;  3D3S A;  5C88 A;  2EVN A;  1V0C A;  1NSL A;  2B58 A;  4QC6 A;  1SQH A;  5IV0 A;  3TT2 A;  2WPW A;  2PQ8 A;  1RXT A;  1VKC A;  3SXO A;  2Q7B A;  2IL4 A;  3T9Y A;  4KOR A;  4XNH B;  1KUX A;  4AVB A;  1FY7 A;  3FNC A;  5C82 A;  1ON0 A;  4HKF A;  2KCW A;  4R57 A;  4ORF A;  2OU2 A;  4H89 A;  2CY2 A;  3JVN A;  4U9Y A;  1Z4R A;  5ISV A;  2QIR A;  2ARH A;  4KZT A;  3G3S A;  4HNX B;  3MGD A;  4H6U A;  5J8C A;  1QSN A;  3GY9 A;  3BJ8 A;  4RI1 A;  4KUB A;  1S3Z A;  3VWD A;  2VEZ A;  4B5O A;  1IYL A;  1IB1 E;  4JXR A;  3IGR A;  3TO7 A;  2VZY A;  3K9U A;  2P6E A;  2D4P A;  4R3L A;  4I49 A;  5J8F A;  4PSX A;  3DDD A;  2PC1 A;  5JPH A;  2GE3 A;  2ZW7 A;  1QSM A;  2J8N A;  4CAW A;  1NMT A;  4L89 A;  2Q4V A;  1MJA A;  3SHP A;  3S6H A;  3BJ7 A;  4MY0 A;  2NMT A;  3DSB A;  4ZBG A;  4CAV A;  3S6F A;  2BSW A;  2HUZ A;  3FXT A;  4XNH C;  2B4D A;  4F0Y A;  1Y7R A;  2B5G B;  1B6B A;  3C26 A;  5H86 A;  4KOT A;  4EVY A;  5F46 A;  2DXQ A;  3F0A A;  1Z9U A;  4PSW A;  3W6X A;  3WR7 A;  2R98 A;  1Z4E A;  4M85 A;  2P6F A;  4XPL A;  1QSR A;  1XEB A;  2Q0Y A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 2AFS A;  3CDX A;  3D7G A;  2ZEF A;  4FD4 A;  5FVJ A;  2FCK A;  4NF1 A;  1YW6 A;  4CGL A;  3WC7 A;  4YRH A;  4CS0 B;  2QVP A;  1X10 A;  2RC4 A;  3R96 A;  4FBE A;  4JD6 A;  4UIB A;  4UCP A;  3DR8 A;  4M6I A;  1F2O A;  4FD5 A;  4KOW A;  4GXH A;  1GHE A;  4AXV A;  3VAR A;  1A2Z A;  3SJX A;  2R1I A;  1Z8X A;  4UEF A;  3T90 A;  1Z8W A;  2B4D B;  3PRT A;  4OC4 A;  3QAY A;  1CG2 A;  5LRG A;  4R7M A;  5A28 A;  2AFO A;  2NYQ A;  5I0C A;  4UBR A;  4UWI A;  3ISZ A;  4ZY2 A;  2DPT A;  1IIC A;  3R1K A;  3KHZ A;  4NJR A;  1S7L A;  4AVA A;  1Y0Y A;  5F48 A;  4M6G A;  4KVO E;  1IYK A;  5K8P A;  2O28 A;  3B3W A;  4OME A;  4B5P A;  2FT0 A;  2VXK A;  4KOY A;  1Y0R A;  4B6Z A;  1Z8T A;  1VHE A;  4OAE A;  1HEE A;  3R9G A;  4CPA A;  5EBV A;  4LQG A;  3D2P A;  3KHX A;  3GB0 A;  6CPA A;  4HNY B;  1DTD A;  4XPK A;  1XIX A;  3D7D A;  3SI0 A;  3JTK A;  2ZW4 A;  4CYQ A;  3D4U A;  3D67 A;  3V7Z A;  5AGE A;  3FEE A;  2FIW A;  4NGM A;  3B8G A;  1Z8L A;  3BLN A;  4ZI6 A;  3PB7 X;  1ARM A;  2CNM A;  4GM5 A;  4BMH A;  2VL1 A;  5HVG A;  2ZEP A;  2Q4Y A;  3I9S A;  3KR5 A;  4KUA A;  1CJW A;  4AG7 A;  1BO4 A;  4PXD A;  2PJ1 A;  4QB9 A;  3S6G A;  3EY5 A;  2V8H A;  4IF5 A;  4CAX A;  4UA3 A;  4A38 A;  2PJB A;  3EXN A;  3OWC A;  4MI4 A;  3MN8 A;  2PR8 A;  3NE7 A;  1Q2D A;  4CYN A;  4YU9 A;  3TO6 A;  4OC1 A;  5JQ4 A;  3W6S A;  3BI1 A;  2BUE A;  4NGR A;  3VH9 A;  1X12 A;  2Q51 A;  2WSA A;  4BD9 A;  4C2Y A;  4CGM A;  4JYW A;  3FRM A;  2G3T A;  1YK3 A;  2DPS A;  1XMT A;  2DF5 A;  5IX3 A;  3A9L A;  1ZG7 A;  4B5P B;  4UFX A;  2IMO A;  2VZZ A;  1M4I A;  1XF8 A;  3F5B A;  1N71 A;  1Q7L A;  2FVG A;  2YNE A;  3B3C A;  3EC4 A;  4MXU A;  4B11 A;  4CAF A;  1PYT B;  5E96 A;  2JBK A;  1CPS A;  1YX0 A;  1XMB A;  5G1Z A;  4UFV A;  3FVL A;  2B5G A;  2PRB A;  3I3G A;  4Q36 A;  4TWE A;  3KI9 A;  4U5Y A;  1YW4 A;  4KSI A;  4ONW A;  3R9F A;  5F49 A;  4L8A A;  3TOB A;  4OKO A;  2CXA A;  4HPS A;  2Z3L A;  1Y9W A;  1TF9 A;  2CNS A;  3H8G A;  1UWY A;  1YVK A;  1XFO A;  4DJL A;  2R8V A;  5KTA A;  2PJ6 A;  4MCR A;  3PBE A;  4OLL A;  2EUI A;  4A30 A;  2V77 A;  1Y7E A;  4E2A A;  2EK9 A;  2F5I A;  3CXQ A;  2YNC A;  2ZW6 A;  2CF4 A;  4RS2 A;  1YSJ A;  1M4D A;  2JLM A;  4MCQ A;  1QST A;  2BL1 A;  2ZOF A;  2CIJ A;  5AG5 A;  3IWE A;  4B10 A;  4CYO A;  2BCO A;  5IB0 A;  1OBR A;  3JUW A;  2B3U A;  3KQZ A;  1XOV A;  4X5K A;  3RNZ A;  3SI2 A;  4AG9 A;  1XJO A;  4A33 A;  4PV6 A;  5HVF A;  4ZGY B;  1CX8 A;  4LQ6 A;  1WK4 A;  3V8I A;  4JZ0 A;  4KLW A;  4NCZ A;  4CGO A;  1P0H A;  1I21 A;  4R8F A;  2HV2 A;  1AUG A;  1HDQ A;  1YR0 A;  2I3C A;  4MCS A;  3S9L A;  5KTC A;  1J4J A;  3LMS A;  1AMP A;  2C6C A;  2YGW A;  4NGS A;  3ZZI A;  3FED A;  1K4J A;  5F47 A;  3NH5 A;  4UWJ A;  2FSR A;  2X7B A;  1Z5R A;  3IIB A;  4IK2 A;  5DS0 A;  2Z0Z A;  5G20 A;  2XEG A;  3TO9 A;  1I1D A;  4F0X A;  3TE4 A;  1MJ9 A;  1YQE A;  5LYD A;  3DNS A;  1XBU A;  1LAM A;  5D8N A;  4EME A;  3GKR A;  2OZU A;  3R9E A;  1YGH A;  4MFJ A;  1BPM A;  1VHS A;  2OH1 A;  4ZYQ A;  2VI7 A;  4QBJ A;  3D68 A;  2PVV A;  3D2M A;  2C1C A;  3S9M A;  4IHM A;  5EMI A;  4P4D A;  4MJ8 A;  1TIQ A;  5LYL A;  4FWU A;  3KL9 A;  3CZX A;  1YLE A;  2EWB A;  3EO4 A;  4EFD A;  4A31 A;  3TX8 A;  2G3A A;  4RUH A;  2GRE A;  2Q7S A;  3W91 A;  2EBJ A;  1H8L A;  2Q04 A;  2ZOG A;  3IWG A;  3PFE A;  4MFK A;  3PB6 X;  4MHZ A;  4R3K A;  3SJE A;  2FE7 A;  4UCN A;  5K8N A;  2H5M A;  2JEV A;  2ZEO A;  4P45 A;  4K3N A;  4YGO A;  4DYO A;  4II9 A;  2ZEE A;  4M3S A;  4OC0 A;  4KVM E;  1PCA A;  3QB8 A;  1YVO A;  2PIZ A;  3FYN A;  2PJ4 A;  3VWE A;  4PK2 A;  2D4O A;  1IOF A;  3LAC A;  2PJ5 A;  3TOA A;  2GU2 A;  2PR1 A;  1KUY A;  3B3S A;  3H8E A;  4Y49 B;  4QUS A;  1BOB A;  4R76 A;  3N7Z A;  2OZG A;  1S60 A;  4NXY A;  3T8W A;  2VBQ A;  4JXQ A;  4B12 A;  1WWZ A;  3KQX A;  4HNW B;  4BBH A;  2PSW A;  4KOU A;  4MHD A;  1ELL P;  3HLP A;  3EFA A;  3NE8 A;  5CNP A;  5DWN A;  5A27 A;  2ZEM A;  4DUK A;  3SXN A;  1R3N A;  4IUS A;  3RBU A;  1LRZ A;  4CYP A;  1TKJ A;  3IU2 A;  3FIX A;  2AFW A;  4K30 A;  2WUU A;  4H6Z A;  1MK4 A;  5K8O A;  4CRZ B;  3V38 A;  4KOX A;  4XPD B;  3LD2 A;  3D8P A;  2I00 A;  4G1P A;  2AE6 A;  2OB0 A;  2ZEG A;  4JJX A;  3S6K A;  5LRJ A;  2OR4 A;  3WAB A;  4KS9 A;  4ZY0 A;  4UFW A;  2J8R A;  2B3V A;  3PGP A;  4ONU A;  3IU1 A;  2J8M A;  2ZXV A;  3DLJ A;  1S7N A;  4KOV A;  5HMN A;  5K8M A;  3FMC A;  2YNC C;  3CXP A;  2GIV A;  2QML A;  3E0K A;  3K2K A;  1Y9K A;  4MMO A;  1TF8 A;  2PCU A;  1ELM P;  1QQ9 A;  3QAH A;  2JEW A;  2PJ3 A;  4CRY B;  2YND A;  3KAS A;  1M44 A;  3MRU A;  4LX9 A;  3PZJ A;  2CTB A;  4P6Y A;  1IID A;  5HH1 A;  1IY7 A;  3KKW A;  1XRY A;  4OP4 A;  3BXM A;  2PJ0 A;  1KZF A;  4AVC A;  2C27 A;  5AG7 A;  5ELY A;  3FX6 A;  4F8Z A;  2PIY A;  4PK3 A;  4R87 A;  2FL4 A;  2WPX A;  4NEX A;  1B87 A;  1UFH A;  2POK A;  2BEI A;  4P4J A;  4M6H A;  4CGN A;  3GUX A;  4A95 A;  1CM0 A;  1R43 A;  4R9M A;  4NGN A;  1Q2C A;  2WYR A;  4ZX9 A;  3KGQ A;  3PB4 X;  1BPN A;  1M1D A;  2K5T A;  4MCP A;  4P10 A;  2G0B A;  3RYO A;  2HQY A;  2FXF A;  1HDU A;  2P0W A;  2PJA A;  3P2H A;  3UY5 A;  1F2P A;  2IJZ A;  1FNO A;  3IEH A;  5KTD A;  4MHN A;  2Z3N A;  4FAI A;  1LOK A;  3FEC A;  3ZJ0 A;  1RTQ A;  2Z3O A;  1R57 A;  4Y49 C;  2R7H A;  4OID A;  2GAN A;  2QEC A;  4UEZ A;  1I12 A;  1YME A;  3TCV A;  4UF4 A;  7CPA A;  2B4B A;  3B3V A;  5H84 A;  3NH8 A;  3H8F A;  1PUA A;  2WZN A;  4WJB A;  3TFY A;  4P4F A;  5HVH A;  4A2Z A;  4E0A A;  3CPA A;  3IC1 A;  5HXD A;  3VAT A;  4UEE A;  2ZEL A;  4B13 A;  4X3R A;  5I4M A;  2I79 A;  1S5K A;  2Q44 A;  3SJF A;  4AB7 A;  1S7F A;  4XPD C;  4E8O A;  5EC4 A;  3NFZ A;  4J3G A;  2Z3K A;  2REE A;  5LYF A;  3GYA A;  3PEI A;  1LFW A;  2JDC A;  3DR6 A;  3L2N A;  1LAP A;  1CP7 A;  1P4N A;  4P44 A;  2HC9 A;  2F7V A;  4PXC A;  3G8W A;  3P2F A;  1ZLH A;  4PQA A;  2OOT A;  1M4G A;  5AG6 A;  4MY3 A;  2OZH A;  4PPZ A;  4P4E A;  1EE3 P;  5G22 A;  1ZO0 A;  3BI0 A;  4KLV A;  1LCP A;  4MHP A;  1PU9 A;  2PDO A;  4QVT A;  2ZEH A;  3H5Z A;  5GCN A;  4UCM A;  1QMU A;  2GFQ A;  3RO0 A;  2VQY A;  2PE3 A;  4FD6 A;  1VHO A;  2PJC A;  2PJ2 A;  1L0C A;  3D66 A;  2Z11 A;  4C2X A;  3IJ3 A;  1TXR A;  2C6P A;  4C7H A;  2PJ8 A;  1IOI A;  3PFO A;  1NE9 A;  5DWM A;  3H4Q A;  1ZG9 A;  2BOA A;  4A94 A;  1BAV A;  3RAM A;  2JBJ A;  1IU8 A;  2IQ6 A;  3CXS A;  4OAD A;  4DNC A;  2O53 A;  4NJQ A;  2ATR A;  3R95 A;  4MRI A;  4OC3 A;  4MFZ A;  1YRE A;  4NGT A;  3BHX A;  2REF A;  2AFU A;  2Z10 A;  3F8K A;  1MJB A;  4IAV A;  4KOS A;  3GLJ A;  1CPX A;  5F09 A;  1XE4 A;  1JQG A;  2QJ8 A;  1QSO A;  4JLY A;  3LOD A;  4X8I A;  5JM6 A;  1DE4 C;  1JWQ A;  1OZP A;  2AJ6 A;  4F9U A;  1BLL E;  4C68 A;  1TKH A;  3RZA A;  5CPA A;  4B14 A;  1KUV A;  1RO5 A;  3B3T A;  4U9Z A;  4YFJ A;  2P6G A;  2CNT A;  4LUA A;  4JWP A;  4A37 A;  1U6M A;  1CBX A;  1ZG8 A;  5D29 A;  1Q2Y A;  3B7I A;  3CT9 A;  3IWW A;  3GIU A;  3SI1 A;  2FIA A;  2Q43 A;  2V8G A;  1S7K A;  3FF3 A;  4KVX A;  3TTH A;  5JH9 A;  2JDD A;  3FB3 A;  4GS4 A;  2EK8 A;  2ZW5 A;  3DGV A;  4F6A A;  2A4N A;  1IGB A;  3NA6 A;  4MBU A;  2Y0M A;  2FS5 A;  4MFQ A;  4W9Y A;  4YWY A;  4FD7 A;  5BWA B;  3B2Y A;  3FBU A;  4H2K A;  5LRK A;  4UIA A;  3PP9 A;  4NSQ A;  2GLJ A;  3D3S A;  2BO9 A;  4MFP A;  5C88 A;  1FT7 A;  1NSA A;  3D7H A;  4NGQ A;  2EVN A;  3LWU A;  1V0C A;  5IB9 A;  1NSL A;  2B58 A;  4QC6 A;  1SQH A;  3JRU A;  5IV0 A;  4A32 A;  2CTC A;  2Z3M A;  3TT2 A;  2WPW A;  2PQ8 A;  4OIW A;  1RXT A;  5AG4 A;  2ZEN A;  1VKC A;  3I1U A;  3SXO A;  2PJ9 A;  2IL4 A;  2Q7B A;  3T9Y A;  1VGY A;  4OC2 A;  4KOR A;  4MFL A;  4XNH B;  1KUX A;  4AVB A;  2ANP A;  1FY7 A;  3FNC A;  3QNV A;  2HB6 A;  4F9V A;  5C82 A;  4BIN A;  4C7I A;  1ON0 A;  5LYI A;  4O23 A;  3HUV A;  4HKF A;  2KCW A;  4R57 A;  4ORF A;  2OU2 A;  4H89 A;  2CY2 A;  3JVN A;  4U9Y A;  1Z4R A;  4Q7A A;  5ISV A;  2QIR A;  3B35 A;  1ZLI A;  4P4B A;  4ZX8 A;  1GYT A;  2ARH A;  4KZT A;  2PJ7 A;  3G3S A;  4HNX B;  4Q38 A;  3MGD A;  4H6U A;  5J8C A;  1QSN A;  3GY9 A;  2QYV A;  4EWT A;  2O4H A;  2RFH A;  1M4L A;  3BJ8 A;  4RI1 A;  4KUB A;  3WC5 A;  4CAE A;  1S3Z A;  3VWD A;  2VEZ A;  4B5O A;  2ODF A;  1IYL A;  1IB1 E;  1VIX A;  4JXR A;  2XEI A;  3IGR A;  4WWV A;  1Z2L A;  2XEF A;  3K9T A;  2J9A A;  3TO7 A;  5CBM A;  2ABZ A;  2VZY A;  3K9U A;  4KSA A;  2P6E A;  2D4P A;  4R3L A;  4TNU A;  2PVW A;  4FUU A;  4I49 A;  5THW A;  2EO8 A;  2F8H A;  2ZED A;  3TC8 A;  4A39 A;  3WT4 A;  2NSM A;  5J8F A;  4PSX A;  3PBB A;  5J1Q A;  3DDD A;  2PC1 A;  1AYE A;  5JPH A;  2AFM A;  2GLF A;  3ISX A;  2GE3 A;  3PB9 X;  2ZW7 A;  2PRQ A;  2AFX A;  4ZY1 A;  3PB8 X;  1KWM A;  1QSM A;  2J8N A;  1CP6 A;  4CAW A;  1NMT A;  4L89 A;  2Q4V A;  1MJA A;  3SHP A;  2RB7 A;  3S6H A;  1ARL A;  4RN7 A;  3BJ7 A;  4NGP A;  2V8D A;  4MHY A;  4MY0 A;  2NMT A;  3DSB A;  4ZBG A;  4CAV A;  2C6G A;  1F57 A;  4C2Z A;  2Q4Z A;  4P4I A;  5G21 A;  2V8V A;  3S6F A;  2BSW A;  2HUZ A;  3FXT A;  4PXB A;  4XNH C;  2XEJ A;  2B4D A;  3IFE A;  4NFR A;  4F0Y A;  1Y7R A;  2B5G B;  1B6B A;  2G9D A;  3C26 A;  3D7F A;  4KOT A;  5H86 A;  4EVY A;  3N5F A;  3S9N A;  5F46 A;  2DEA A;  2DXQ A;  2AFZ A;  3F0A A;  1Z9U A;  4PSW A;  3SJG A;  4OC5 A;  3WC6 A;  3W6X A;  4CGP A;  3WR7 A;  1YLO A;  3FJU A;  2R98 A;  4R6T A;  1Z4E A;  1LAN A;  4PXE A;  4Z65 A;  4KSF A;  3FH4 A;  3KZW A;  4M85 A;  2P6F A;  4XPL A;  1TKF A;  1QSR A;  1XEB A;  3KR4 A;  4X2T A;  2Q0Y A;  5JGF A;  2Z3P A;  3CPX A;  3IO1 A;  3NH4 A;  8CPA A;  2ZPA A; 
#chains in the Genus database with same CATH homology
 5FVJ A;  4FD4 A;  4CGL A;  2FCK A;  4NF1 A;  4CS0 B;  4YRH A;  2RC4 A;  3R96 A;  4JD6 A;  4UCP A;  3DR8 A;  4FD5 A;  4KOW A;  1GHE A;  2R1I A;  3T90 A;  2B4D B;  5A28 A;  5I0C A;  4UBR A;  4UWI A;  2DPT A;  1IIC A;  3R1K A;  1S7L A;  4AVA A;  5F48 A;  4KVO E;  1IYK A;  2O28 A;  4B5P A;  2FT0 A;  2VXK A;  4KOY A;  4OAE A;  3R9G A;  5EBV A;  3D2P A;  4HNY B;  4XPK A;  1XIX A;  3JTK A;  2ZW4 A;  4CYQ A;  5AGE A;  2FIW A;  3B8G A;  3BLN A;  2CNM A;  4BMH A;  4KUA A;  2Q4Y A;  3I9S A;  1CJW A;  4AG7 A;  1BO4 A;  4QB9 A;  3S6G A;  3EY5 A;  4IF5 A;  4CAX A;  4UA3 A;  3EXN A;  3OWC A;  4MI4 A;  2PR8 A;  3NE7 A;  1Q2D A;  4CYN A;  3TO6 A;  5JQ4 A;  3W6S A;  2BUE A;  4C2Y A;  2WSA A;  4CGM A;  3FRM A;  2G3T A;  1YK3 A;  2DPS A;  1XMT A;  5IX3 A;  3A9L A;  4B5P B;  4UFX A;  2VZZ A;  1M4I A;  1XF8 A;  3F5B A;  1N71 A;  2YNE A;  4CAF A;  3EC4 A;  4B11 A;  5E96 A;  1YX0 A;  5G1Z A;  4UFV A;  2B5G A;  2PRB A;  3I3G A;  4Q36 A;  3R9F A;  4U5Y A;  5F49 A;  4L8A A;  3TOB A;  2CXA A;  2Z3L A;  1Y9W A;  2CNS A;  1YVK A;  2R8V A;  5KTA A;  4OLL A;  2EUI A;  4A30 A;  4E2A A;  2F5I A;  3CXQ A;  2YNC A;  2ZW6 A;  4RS2 A;  1M4D A;  2JLM A;  1QST A;  2BL1 A;  5AG5 A;  3IWE A;  4B10 A;  4CYO A;  5IB0 A;  3JUW A;  2B3U A;  4X5K A;  4ZGY B;  4AG9 A;  4A33 A;  4PV6 A;  1WK4 A;  3V8I A;  4KLW A;  4NCZ A;  4CGO A;  1P0H A;  1I21 A;  2HV2 A;  1YR0 A;  5KTC A;  1J4J A;  2YGW A;  3ZZI A;  1K4J A;  5F47 A;  4UWJ A;  2FSR A;  2X7B A;  3TE4 A;  2Z0Z A;  5G20 A;  3TO9 A;  4F0X A;  1I1D A;  1MJ9 A;  3DNS A;  3GKR A;  2OZU A;  3R9E A;  1YGH A;  4MFJ A;  1VHS A;  2OH1 A;  2VI7 A;  4QBJ A;  3D2M A;  4MJ8 A;  1TIQ A;  1YLE A;  3EO4 A;  4A31 A;  2G3A A;  3W91 A;  4MFK A;  3IWG A;  2Q04 A;  4R3K A;  2FE7 A;  4UCN A;  2H5M A;  2JEV A;  4YGO A;  4II9 A;  4M3S A;  4KVM E;  3QB8 A;  1YVO A;  3FYN A;  3VWE A;  4PK2 A;  2D4O A;  3TOA A;  2PR1 A;  1KUY A;  4Y49 B;  4QUS A;  1BOB A;  3N7Z A;  1S60 A;  2OZG A;  4NXY A;  4B12 A;  2VBQ A;  4JXQ A;  1WWZ A;  4HNW B;  4BBH A;  2PSW A;  4KOU A;  4MHD A;  5DWN A;  3EFA A;  5CNP A;  5A27 A;  3SXN A;  4IUS A;  4CYP A;  1LRZ A;  3IU2 A;  3FIX A;  4K30 A;  2WUU A;  4H6Z A;  1MK4 A;  4CRZ B;  4KOX A;  4XPD B;  3LD2 A;  3D8P A;  4JJX A;  2I00 A;  2AE6 A;  2OB0 A;  3S6K A;  4KS9 A;  4UFW A;  2J8R A;  2B3V A;  3PGP A;  4ONU A;  3IU1 A;  2J8M A;  2ZXV A;  4KOV A;  1S7N A;  5HMN A;  2YNC C;  3CXP A;  2GIV A;  2QML A;  3E0K A;  1Y9K A;  3QAH A;  4CRY B;  2YND A;  1M44 A;  4LX9 A;  3PZJ A;  5HH1 A;  1IID A;  3KKW A;  4AVC A;  1KZF A;  2C27 A;  5AG7 A;  4PK3 A;  4R87 A;  2FL4 A;  2WPX A;  4NEX A;  1B87 A;  1UFH A;  2BEI A;  4CGN A;  4A95 A;  1CM0 A;  4R9M A;  1Q2C A;  1M1D A;  2K5T A;  3RYO A;  2G0B A;  2HQY A;  2FXF A;  2P0W A;  3P2H A;  3UY5 A;  5KTD A;  2Z3N A;  3ZJ0 A;  2Z3O A;  1R57 A;  4Y49 C;  2R7H A;  2GAN A;  2QEC A;  1I12 A;  3TCV A;  2B4B A;  5H84 A;  1PUA A;  3TFY A;  4A2Z A;  4E0A A;  4B13 A;  2I79 A;  1S5K A;  2Q44 A;  4AB7 A;  4E8O A;  1S7F A;  4XPD C;  5EC4 A;  4J3G A;  2Z3K A;  2REE A;  3GYA A;  2JDC A;  3DR6 A;  1P4N A;  3G8W A;  3P2F A;  1M4G A;  5AG6 A;  4MY3 A;  2OZH A;  5G22 A;  1ZO0 A;  4KLV A;  4QVT A;  1PU9 A;  2PDO A;  5GCN A;  3H5Z A;  4UCM A;  2VQY A;  4FD6 A;  1L0C A;  2Z11 A;  4C2X A;  4C7H A;  1NE9 A;  5DWM A;  3H4Q A;  3CXS A;  4OAD A;  4DNC A;  2ATR A;  3R95 A;  4MFZ A;  1YRE A;  3F8K A;  2REF A;  4KOS A;  2Z10 A;  1MJB A;  1XE4 A;  1QSO A;  4JLY A;  3LOD A;  1OZP A;  2AJ6 A;  4C68 A;  4B14 A;  1KUV A;  1RO5 A;  4U9Z A;  4YFJ A;  2P6G A;  2CNT A;  4LUA A;  4JWP A;  1U6M A;  1Q2Y A;  2FIA A;  1S7K A;  4KVX A;  3TTH A;  2JDD A;  3FB3 A;  4GS4 A;  2ZW5 A;  4F6A A;  2A4N A;  4MBU A;  2Y0M A;  2FS5 A;  4MFQ A;  4FD7 A;  5BWA B;  3FBU A;  3PP9 A;  4NSQ A;  3D3S A;  4MFP A;  5C88 A;  2EVN A;  1V0C A;  1NSL A;  2B58 A;  4QC6 A;  1SQH A;  5IV0 A;  4A32 A;  2Z3M A;  3TT2 A;  2WPW A;  2PQ8 A;  1RXT A;  5AG4 A;  1VKC A;  3SXO A;  2Q7B A;  2IL4 A;  3T9Y A;  4KOR A;  4MFL A;  4XNH B;  1KUX A;  4AVB A;  1FY7 A;  3FNC A;  5C82 A;  4C7I A;  1ON0 A;  4HKF A;  2KCW A;  4R57 A;  4ORF A;  2OU2 A;  4H89 A;  2CY2 A;  3JVN A;  4U9Y A;  1Z4R A;  5ISV A;  2QIR A;  2ARH A;  4KZT A;  3G3S A;  4HNX B;  4Q38 A;  3MGD A;  4H6U A;  5J8C A;  1QSN A;  3GY9 A;  3BJ8 A;  4RI1 A;  4KUB A;  4CAE A;  1S3Z A;  3VWD A;  2VEZ A;  4B5O A;  1IYL A;  1IB1 E;  4JXR A;  3IGR A;  3TO7 A;  2VZY A;  3K9U A;  4KSA A;  2P6E A;  2D4P A;  4R3L A;  4I49 A;  5J8F A;  4PSX A;  3DDD A;  2PC1 A;  5JPH A;  2GE3 A;  2ZW7 A;  1QSM A;  2J8N A;  4CAW A;  1NMT A;  4L89 A;  2Q4V A;  1MJA A;  3SHP A;  3S6H A;  3BJ7 A;  4MY0 A;  2NMT A;  3DSB A;  4ZBG A;  4CAV A;  4C2Z A;  5G21 A;  3S6F A;  2BSW A;  2HUZ A;  3FXT A;  4XNH C;  2B4D A;  4F0Y A;  1Y7R A;  2B5G B;  1B6B A;  3C26 A;  5H86 A;  4KOT A;  4EVY A;  5F46 A;  2DXQ A;  4CGP A;  3F0A A;  1Z9U A;  4PSW A;  3W6X A;  3WR7 A;  2R98 A;  1Z4E A;  4KSF A;  4M85 A;  2P6F A;  4XPL A;  1QSR A;  1XEB A;  2Q0Y A;  2Z3P A;  2ZPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...