1WWZA

Crystal structure of ph1933 from pyrococcus horikoshii ot3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
MDEIKIEKLKKLDKKALNELIDVYMSGYEGLEEYGGEGRDYARNYIKWCWKKASDGFFVAKVGDKIVGFIVCDKDWFSKYEGRIVGAIHEFVVDKKFQGKGIGRKLLITCLDFLGKYNDTIELWVGEKNYGAMNLYEKFGFKKVGKSGIWVRMIKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH1933 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH1933
total genus 50
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1wwzA00
3T90A 5J8CA 2B4DA 4J3GA 4KOUA 4FD4A 1MJAA 1SQHA 3C26A 4XNHB 1Y9KA 1GHEA 5EBVA 4JLYA 3F5BA 4E8OA 3P2HA 2C27A 1R57A 2OH1A 5I0CA 2JDCA 2K5TA 4UWJA 1V0CA 2B5GB 1BO4A 1VHSA 2QECA 3TOBA 4CRZB 2FS5A 4M85A 1RO5A 1YREA 4HNYB 1I12A 4NXYA 4YRHA 4E2AA 1Z4EA 4MJ8A 2ZW6A 4KOYA 3QB8A 2Q7BA 4NSQA 4YFJA 4EVYA 3IWGA 4B5PB 4KOXA 4LX9A 2ZPAA 2R98A 2F5IA 4IF5A 2VEZA 4DNCA 1Q2YA 4MBUA 1RXTA 2X7BA 5KTAA 4FD5A 2IL4A 3I9SA 1U6MA 2FIWA 3V8IA 3S6HA 2DXQA 4R57A 2PRBA 4OADA 5JPHA 4L8AA 4II9A 1QSOA 1K4JA 3G8WA 1TIQA 3VWEA 2P6EA 3JVNA 4AB7A 3D3SA 4U5YA 3S6FA 1S7FA 3FBUA 4QVTA 2R8VA 2D4PA 1Y9WA 2FCKA 3WR7A 5J8FA 2BUEA 2OZGA 2Q4YA 1B87A 4U9ZA 4JWPA 3DSBA 4QUSA 1S60A 4QB9A 4XPKA 2P6GA 1CM0A 4MY0A 3S6GA 3TO7A 3GKRA 1KZFA 2G3TA 3LD2A 2WPWA 4BMHA 5IX3A 2J8RA 2VI7A 4R9MA 4IUSA 2ATRA 4LUAA 1S5KA 2CNTA 2FT0A 3D2MA 1PUAA 1QSRA 4FD6A 2Z11A 2ZXVA 2FXFA 2BEIA 4QC6A 2R1IA 1YR0A 2HQYA 4AVBA 3FXTA 4H6UA 2CNSA 1M44A 2H5MA 4CAWA 1WWZA 5CNPA 4MI4A 2Z0ZA 3FB3A 3GY9A 1S7LA 1P0HA 1YVOA 1S7NA 1YK3A 1L0CA 4M3SA 1I21A 2VXKA 2ZW5A 4CRYB 2REEA 3TOAA 4XNHC 1Q2DA 1IYKA 3BJ7A 4NF1A 4HNWB 4KVOE 3W6SA 4XPDC 3G3SA 3F0AA 1IIDA 3BJ8A 4ONUA 4B5OA 4R87A 4KOVA 4ORFA 3DDDA 3D2PA 2PDOA 3DR8A 2I79A 5H84A 3KKWA 1P4NA 2BL1A 4JJXA 1XEBA 3W6XA 5FVJA 1YX0A 4CAXA 2REFA 1WK4A 3F8KA 5ISVA 2JLMA 2CNMA 2ZW7A 4PSWA 3QAHA 3R9GA 2HV2A 2B3VA 2ARHA 3D8PA 1N71A 3CXSA 3OWCA 2PR8A 3TCVA 2QIRA 1S3ZA 1XIXA 3CXQA 4F0YA 1IICA 1CJWA 1QSTA 4KOWA 3VWDA 4JXRA 5GCNA 2O28A 1KUYA 3FYNA 4CAVA 3W91A 2HUZA 1Q2CA 2B4DB 3FNCA 1NE9A 1M4DA 4UA3A 3BLNA 1M4IA 3EXNA 3TO6A 4AVCA 2CY2A 3I3GA 2OZHA 4AG9A 4KUBA 2VQYA 3RYOA 2GANA 4KORA 2EVNA 3EFAA 5EC4A 2P6FA 2JDDA 2B5GA 1IYLA 4JD6A 1PU9A 4HKFA 2Q4VA 2WPXA 1QSMA 3IGRA 3CXPA 5JQ4A 4XPDB 2B4BA 1YVKA 2B58A 2ZW4A 4PK2A 3B8GA 4KLWA 4B5PA 1FY7A 2EUIA 1M1DA 3TO9A 4AG7A 2OZUA 1MJ9A 2OU2A 5C88A 4NCZA 1XMTA 1XE4A 1KUVA 5C82A 2VBQA 3N7ZA 3PZJA 5DWNA 4KVME 2FSRA 4CS0B 1UFHA 4ZBGA 1LRZA 4R3KA 5F49A 2AJ6A 2FIAA 3GYAA 5KTDA 2KCWA 4AVAA 1NSLA 2NMTA 4OAEA 2J8NA 4RS2A 2R7HA 4KUAA 4U9YA 3K9UA 1VKCA 1J4JA 3R96A 1Y7RA 1B6BA 1IB1E 2JEVA 4X5KA 2Z10A 4XPLA 5IV0A 2PR1A 5KTCA 4FD7A 2G3AA 3S6KA 4MHDA 4KOTA 4KOSA 3ZZIA 3PGPA 4E0AA 2FE7A 3EY5A 4H6ZA 1S7KA 5F46A 4PV6A 2G0BA 1M4GA 2GIVA 5HMNA 2QMLA 1ON0A 3EO4A 1YLEA 4K30A 1KUXA 4F6AA 2PQ8A 5IB0A 3SXOA 4GS4A 1Z4RA 1MJBA 5DWMA 3T9YA 2FL4A 1NMTA 3NE7A 3P2FA 3MGDA 3R1KA 4KVXA 3LODA 1MK4A 4MY3A 2GE3A 2PSWA 2AE6A 3TFYA 2A4NA 5F47A 3FIXA 3DNSA 2Y0MA 3R9EA 1QSNA 2B3UA 2VZYA 4RI1A 4UBRA 2PC1A 4Y49C 3TE4A 5H86A 3TTHA 4UWIA 3SHPA 3R9FA 2P0WA 3DR6A 1XF8A 1YGHA 3FRMA 4L89A 4OLLA 4NEXA 4H89A 2Q44A 2OB0A 3TT2A 4KZTA 2J8MA 1I1DA 4QBJA 2RC4A 3EC4A 1BOBA 4YGOA 2I00A 3ZJ0A 2D4OA 5F48A 3JUWA 3H4QA 5HH1A 4Y49B 4PK3A 3R95A 2Q04A 2BSWA 2Q0YA 3E0KA 3UY5A 3SXNA 4HNXB 4KLVA 2VZZA 4JXQA 1Z9UA 1OZPA 5E96A 4R3LA 4PSXA 3PP9A 4I49A
chains in the Genus database with same CATH superfamily
3T90A 5J8CA 4NJQA 2B4DA 4J3GA 4KOUA 5THWA 4C2ZA 4FD4A 3S9LA 1MJAA 4OC3A 4P4IA 1SQHA 3QAYA 1CPXA 4UEEA 3C26A 3FEDA 2DF5A 2EK8A 4XNHB 3IFEA 4GXHA 7CPAA 1Y9KA 4R8FA 2V8HA 1GHEA 5EBVA 5AG4A 4Z65A 4JLYA 3F5BA 4E8OA 2FVGA 4X2TA 4M6IA 1IGBA 4IHMA 4UFVA 3P2HA 2C27A 1R57A 2OH1A 4CYQA 5I0CA 4A37A 1FNOA 5ELYA 2JDCA 2K5TA 4UWJA 1V0CA 1AUGA 2B5GB 1BO4A 1VHSA 2QECA 4GM5A 4CPAA 3TOBA 4CRZB 2FS5A 1TKHA 4M85A 5LRGA 3TC8A 4M6HA 1RO5A 1VIXA 1YREA 3D66A 4OC1A 4HNYB 1XOVA 1DTDA 4OKOA 1I12A 4NXYA 4YRHA 3IO1A 2CTBA 5D8NA 5LRJA 1HDQA 1AYEA 4YWYA 4A94A 1Z4EA 3CT9A 5AG6A 4E2AA 2PJ5A 4MJ8A 4FUUA 3LACA 4PXBA 4EFDA 2ZW6A 4KOYA 3QB8A 4P44A 1TF9A 4NSQA 4P4BA 2Q7BA 1Z8XA 4YFJA 3IJ3A 4EVYA 1BPNA 1JWQA 3FEEA 3IWGA 4B5PB 5JGFA 4KOXA 4LX9A 4BBHA 2ZPAA 2R98A 2F5IA 1TKFA 2AFUA 3D7HA 4JZ0A 4IF5A 1AMPA 4ZX9A 4EMEA 4OC5A 4KSIA 4ONWA 3FMCA 2NYQA 2VEZA 2ZOFA 4DNCA 1DE4C 3IC1A 1Q2YA 1UWYA 4MBUA 1RXTA 2X7BA 5KTAA 4CGMA 1PYTB 5HVFA 4FD5A 2IL4A 3I9SA 4IAVA 1U6MA 5DS0A 2FIWA 4A32A 3V8IA 3S6HA 2DXQA 2O53A 3SI1A 4R57A 2PRBA 2V8GA 4OADA 5JPHA 4L8AA 4II9A 3WT4A 1QSOA 1K4JA 3CPAA 1XRYA 3G8WA 2ZEFA 3JTKA 1TIQA 2YNEA 2PVVA 2ABZA 3BI1A 4Q7AA 2EK9A 3VWEA 2P6EA 4MFJA 4MCQA 2Z3MA 3JVNA 3PBEA 4AB7A 3D3SA 4U5YA 3S6FA 4C2YA 4WJBA 1Y7EA 1S7FA 3FJUA 3FBUA 3B3TA 4QVTA 3SI0A 1VHEA 3L2NA 3HUVA 2R8VA 2D4PA 2BO9A 1Y9WA 2FCKA 3WR7A 1XMBA 5J8FA 2BUEA 1QQ9A 3V7ZA 4C68A 2GFQA 4O23A 4UCMA 6CPAA 4AXVA 2ANPA 3PB7X 1ELMP 1IU8A 1YMEA 4TNUA 4P4FA 2OZGA 2Q4YA 1B87A 1GYTA 4RN7A 3CPXA 4U9ZA 4JWPA 3DSBA 3IWWA 4QUSA 1S60A 4QB9A 4XPKA 1BAVA 3I1UA 2YNCA 2P6GA 1CM0A 1ZG9A 4MY0A 3S6GA 3RO0A 3TO7A 2ZOGA 1ZLHA 2NSMA 3FH4A 4NGSA 4DYOA 3GKRA 3PFEA 5AGEA 5CBMA 1KZFA 1VGYA 2G3TA 3LD2A 3SJGA 4PXEA 5A28A 2WPWA 4BMHA 5HVHA 2J9AA 1CPSA 5IX3A 2J8RA 4NGTA 4A39A 3KR5A 4NGPA 4C2XA 2VI7A 3K9TA 4CAEA 4R9MA 4UCPA 2O4HA 2ATRA 4IUSA 2JBJA 2AFXA 2C6GA 4LUAA 1S5KA 2CNTA 4P10A 2FT0A 3D2MA 3NA6A 1PUAA 1QSRA 3IU1A 4FD6A 4Q38A 2Z11A 2ZXVA 5AG7A 1XBUA 5K8PA 2PCUA 2FXFA 1R3NA 2AFSA 3D67A 2CTCA 2BEIA 4MHYA 4P45A 4QC6A 2CF4A 3T8WA 2R1IA 1YR0A 2HQYA 2CIJA 4AVBA 3IU2A 3FXTA 4H6UA 2CNSA 2QVPA 4NJRA 1XFOA 2XEIA 3FVLA 1M44A 3PBBA 2AFWA 2H5MA 4FAIA 3A9LA 4CAWA 1WWZA 5CNPA 4MI4A 4EWTA 2Z0ZA 4MFZA 2IMOA 3NH8A 3FB3A 3GY9A 1S7LA 1P0HA 1YW4A 1YVOA 1S7NA 1YK3A 3JRUA 1L0CA 4M3SA 1I21A 2VXKA 2V8DA 1EE3P 2ZW5A 4A31A 2REEA 3TOAA 4CRYB 4XNHC 2Z3LA 4LQGA 1IY7A 1Q2DA 2ZEPA 1ZG7A 4MHPA 1IYKA 3D4UA 1YSJA 1M4LA 3BJ7A 5LRKA 4NF1A 3LWUA 1Z5RA 4HNWB 4KVOE 3KQXA 3W6SA 2DEAA 4UF4A 4XPDC 3G3SA 4K3NA 3B2YA 3F0AA 3D7DA 1IIDA 4HPSA 3BJ8A 3VH9A 2C6PA 4MFPA 4ONUA 1ZO0A 1X10A 2QYVA 2F7VA 5G20A 2GU2A 3KL9A 3PB9X 1XJOA 4B5OA 4MHZA 4R87A 4KOVA 4ZY2A 4ORFA 2XEJA 3DDDA 2WUUA 3WC5A 2PJ1A 1A2ZA 2PDOA 3D2PA 4A33A 3DR8A 4OIWA 2I79A 5H84A 3KKWA 4F8ZA 3S9MA 1IOFA 1P4NA 4NGRA 4BINA 3GLJA 2BL1A 2I3CA 1XEBA 4JJXA 3W6XA 5FVJA 2PJ9A 2XEGA 1YX0A 2ZEEA 4CAXA 4PXDA 2PJBA 2REFA 1WK4A 1ZG8A 3F8KA 3GIUA 4B12A 4UIAA 4X3RA 1F2OA 5ISVA 1TKJA 2PJ7A 3RNZA 2JLMA 2BOAA 4PPZA 2CNMA 2ZW7A 4PSWA 2Z3OA 5JH9A 1VHOA 3QAHA 5G21A 3R9GA 2HV2A 2PE3A 2B3VA 2ARHA 3D8PA 1N71A 3CXSA 3OWCA 2PR8A 3TCVA 2QIRA 5LYLA 1Z2LA 2Z3PA 4BD9A 1S3ZA 1XIXA 3CXQA 3CZXA 4F0YA 3NE8A 5IB9A 1IICA 1CJWA 1QSTA 4KOWA 3VWDA 4MCPA 4JXRA 1ELLP 5GCNA 2O28A 1KUYA 3FYNA 4DUKA 8CPAA 2OR4A 4MFKA 4P4DA 4C7IA 3H5ZA 4CAVA 3W91A 2HUZA 2YNDA 4UEFA 2ZELA 3BHXA 2ODFA 1Q2CA 2B4DB 3FNCA 2PJ3A 5HXDA 1NE9A 2WZNA 4CGLA 3N5FA 1M4DA 4UA3A 3BLNA 1M4IA 3EXNA 3TO6A 4JYWA 1H8LA 4AVCA 3IEHA 1CP7A 2CY2A 2IQ6A 5G1ZA 5K8MA 4ZGYB 1NSAA 2OZHA 2ZENA 3I3GA 3KR4A 2OOTA 1R43A 4AG9A 4KUBA 4PQAA 3PB6X 4UFWA 2EBJA 1TF8A 2HC9A 2VQYA 3RYOA 4Q36A 2GANA 1LCPA 2Q7SA 2YGWA 4KORA 2EVNA 3B3WA 4R7MA 1YW6A 3EFAA 5EC4A 3HLPA 3SJXA 2P6FA 3WC7A 2JDDA 2B5GA 4ZY0A 1IYLA 3DGVA 1CX8A 4JD6A 4TWEA 1PU9A 4HKFA 2Q4VA 2JEWA 3RAMA 2WPXA 3FX6A 1YQEA 1Q7LA 2GREA 1QSMA 3IGRA 3KQZA 4UCNA 3SI2A 4B14A 3CXPA 5JQ4A 4CGNA 4CYNA 5LYIA 2POKA 3H8GA 4P4EA 4XPDB 4UFXA 3WC6A 2B4BA 2JBKA 4A30A 1YVKA 2B58A 2YNCC 2ZW4A 4MXUA 4OIDA 4FBEA 4PK2A 2PRQA 3B8GA 4CAFA 4KLWA 4B5PA 2ZEDA 3NH5A 1CG2A 1FY7A 2EUIA 1M1DA 4LQ6A 4NFRA 4P6YA 3TO9A 4AG7A 2OZUA 4P4JA 1ZLIA 1MJ9A 2HB6A 2OU2A 5K8OA 5C88A 4NCZA 1F2PA 4YU9A 1XMTA 1XE4A 3PB8X 3BXMA 4UEZA 1KUVA 3VATA 5C82A 3KZWA 2VBQA 3N7ZA 3PZJA 4MHNA 1PCAA 5DWNA 4KVME 5HVGA 2FSRA 4CS0B 4F0XA 1UFHA 2Z3NA 4ZBGA 1LRZA 3PB4X 1ARLA 4B10A 5J1QA 1ARMA 2G9DA 3B3CA 3D7FA 3IIBA 4R3KA 5F49A 4F9UA 2AJ6A 4NGQA 2FIAA 3SJFA 2V77A 4WWVA 3H8EA 4MCSA 4CYPA 2GLFA 2PJ8A 3GYAA 4MFQA 4B13A 2DPTA 4ZI6A 2KCWA 5KTDA 1HDUA 4AVAA 3B3VA 2ZEMA 1Z8LA 1NSLA 2PJ6A 2NMTA 4OAEA 2J8NA 4MFLA 4RS2A 2ZEGA 2R7HA 2VL1A 1RTQA 2C6CA 4KUAA 4U9YA 3K9UA 1VKCA 3QNVA 1J4JA 3KHXA 3R96A 4CGOA 4G1PA 3CDXA 1Y7RA 1B6BA 1IB1E 1BLLE 2JEVA 4X5KA 2WSAA 1Z8WA 2Z10A 4XPLA 2AFZA 2PR1A 4M6GA 3RBUA 1QMUA 3PEIA 3NH4A 5IV0A 5KTCA 3KASA 1TXRA 3PRTA 4A2ZA 2V8VA 4ZYQA 4FD7A 2G3AA 2GLJA 1JQGA 4MHDA 4OMEA 4X8IA 5G22A 3S6KA 4KOTA 5CPAA 3SJEA 4MMOA 4KOSA 3ZZIA 3PGPA 4E0AA 2FE7A 3ISZA 5K8NA 3EY5A 4R6TA 4H6ZA 3LMSA 3K2KA 1S7KA 4DJLA 3B7IA 3BI0A 4PV6A 5F46A 3B35A 3GUXA 2G0BA 1M4GA 2GIVA 5HMNA 2QMLA 1ON0A 1CP6A 2RB7A 3DLJA 3D7GA 3EO4A 4OC4A 1YLEA 4K30A 1KUXA 4NGNA 2PQ8A 4MRIA 4F6AA 4ZY1A 5IB0A 4IK2A 2XEFA 5AG5A 2PJ0A 1LAPA 2QJ8A 3SXOA 3NFZA 2PIZA 4GS4A 1LANA 1Z4RA 2ZEOA 1MJBA 5DWMA 1Y0YA 4MCRA 5EMIA 4ZX8A 4B11A 3T9YA 2FL4A 1NMTA 3NE7A 3P2FA 3MGDA 3R1KA 4PXCA 5JM6A 4KSFA 4KVXA 3LODA 1MK4A 4KSAA 4NGMA 2EO8A 2PIYA 4MY3A 2GE3A 2DPSA 2WYRA 2PSWA 2Z3KA 2AE6A 3MN8A 1IOIA 3TX8A 3TFYA 2F8HA 4H2KA 2A4NA 2AFMA 2PJAA 2Q43A 2RFHA 1OBRA 3FIXA 3FF3A 5F47A 3RZAA 3DNSA 2Y0MA 3R9EA 3KGQA 4CYOA 5LYDA 1QSNA 2EWBA 2B3UA 2Q4ZA 3B3SA 2IJZA 2VZYA 4RI1A 4OP4A 4UBRA 2PC1A 5A27A 3ISXA 3MRUA 5I4MA 1BPMA 4W9YA 4Y49C 5H86A 5LYFA 3TE4A 1X12A 1FT7A 3TTHA 4UWIA 3SHPA 4CGPA 4RUHA 3R9FA 2P0WA 1Y0RA 2PJ4A 3DR6A 4FWUA 1XF8A 1CBXA 3D68A 4OC2A 5BWAB 1YGHA 3FRMA 4L89A 2AFOA 4OLLA 4NEXA 5F09A 3H8FA 3PFOA 4H89A 3V38A 1LAMA 2Q44A 4OC0A 1LFWA 1LOKA 4A38A 1Z8TA 2OB0A 2PJ2A 4C7HA 3TT2A 3IWEA 4KZTA 2J8MA 2Q51A 4UIBA 1I1DA 4R76A 2RC4A 3EC4A 4QBJA 1BOBA 3S9NA 1YLOA 2C1CA 4YGOA 2I00A 1KWMA 2PVWA 2PJCA 2D4OA 3ZJ0A 5D29A 5F48A 4F9VA 3JUWA 1F57A 3GB0A 3H4QA 5HH1A 4Y49B 4PK3A 3R95A 2Q04A 2BSWA 3KI9A 4A95A 2Q0YA 3E0KA 3FECA 3KHZA 3UY5A 3SXNA 1HEEA 4HNXB 3VARA 4KLVA 2VZZA 4JXQA 1Z9UA 2CXAA 2ZEHA 4B6ZA 1OZPA 5E96A 4KS9A 4R3LA 2BCOA 4PSXA 3WABA 3PP9A 4I49A
chains in the Genus database with same CATH topology
3T90A 5J8CA 2B4DA 4J3GA 4KOUA 4C2ZA 4FD4A 1MJAA 1SQHA 3C26A 4XNHB 1Y9KA 1GHEA 5EBVA 5AG4A 4JLYA 3F5BA 4E8OA 4UFVA 3P2HA 2C27A 1R57A 2OH1A 4CYQA 5I0CA 2JDCA 2K5TA 4UWJA 1V0CA 2B5GB 1BO4A 1VHSA 2QECA 3TOBA 4CRZB 2FS5A 4M85A 1RO5A 1YREA 4HNYB 1I12A 4NXYA 4YRHA 4E2AA 1Z4EA 5AG6A 4MJ8A 2ZW6A 4KOYA 3QB8A 2Q7BA 4NSQA 4YFJA 4EVYA 3IWGA 4B5PB 4KOXA 4LX9A 4BBHA 2ZPAA 2R98A 2F5IA 4IF5A 2VEZA 4DNCA 1Q2YA 4MBUA 1RXTA 2X7BA 5KTAA 4CGMA 4FD5A 2IL4A 3I9SA 1U6MA 2FIWA 4A32A 3V8IA 3S6HA 2DXQA 4R57A 2PRBA 4OADA 5JPHA 4L8AA 4II9A 1QSOA 1K4JA 3G8WA 3JTKA 1TIQA 2YNEA 3VWEA 2P6EA 4MFJA 2Z3MA 3JVNA 4AB7A 3D3SA 4U5YA 3S6FA 4C2YA 1S7FA 3FBUA 4QVTA 2R8VA 2D4PA 1Y9WA 2FCKA 3WR7A 5J8FA 2BUEA 4C68A 4UCMA 2OZGA 2Q4YA 1B87A 4U9ZA 4JWPA 3DSBA 4QUSA 1S60A 4QB9A 4XPKA 2YNCA 2P6GA 1CM0A 4MY0A 3S6GA 3TO7A 3GKRA 5AGEA 1KZFA 2G3TA 3LD2A 5A28A 2WPWA 4BMHA 5IX3A 2J8RA 4C2XA 2VI7A 4CAEA 4R9MA 4UCPA 4IUSA 2ATRA 4LUAA 1S5KA 2CNTA 2FT0A 3D2MA 1PUAA 1QSRA 3IU1A 4FD6A 4Q38A 2Z11A 2ZXVA 5AG7A 2FXFA 2BEIA 4QC6A 2R1IA 1YR0A 2HQYA 4AVBA 3IU2A 3FXTA 4H6UA 2CNSA 1M44A 2H5MA 3A9LA 4CAWA 1WWZA 5CNPA 4MI4A 2Z0ZA 4MFZA 3FB3A 3GY9A 1S7LA 1P0HA 1YVOA 1S7NA 1YK3A 1L0CA 4M3SA 1I21A 2VXKA 4A31A 2ZW5A 4CRYB 2REEA 3TOAA 4XNHC 2Z3LA 1Q2DA 1IYKA 3BJ7A 4NF1A 4HNWB 4KVOE 3W6SA 4XPDC 3G3SA 3F0AA 1IIDA 3BJ8A 4MFPA 4ONUA 1ZO0A 5G20A 4B5OA 4R87A 4KOVA 4ORFA 3DDDA 2WUUA 3D2PA 2PDOA 4A33A 3DR8A 2I79A 5H84A 3KKWA 1P4NA 2BL1A 4JJXA 1XEBA 3W6XA 5FVJA 1YX0A 4CAXA 2REFA 1WK4A 4B12A 3F8KA 5ISVA 2JLMA 2CNMA 2ZW7A 4PSWA 2Z3OA 3QAHA 5G21A 3R9GA 2HV2A 2B3VA 2ARHA 3D8PA 1N71A 3CXSA 3OWCA 2PR8A 3TCVA 2QIRA 2Z3PA 1S3ZA 1XIXA 3CXQA 4F0YA 1IICA 1CJWA 1QSTA 4KOWA 3VWDA 4JXRA 5GCNA 2O28A 1KUYA 3FYNA 4MFKA 4C7IA 4CAVA 3H5ZA 3W91A 2HUZA 2YNDA 1Q2CA 2B4DB 3FNCA 1NE9A 4CGLA 1M4DA 4UA3A 3BLNA 1M4IA 3EXNA 3TO6A 4AVCA 2CY2A 5G1ZA 4ZGYB 3I3GA 2OZHA 4AG9A 4KUBA 4UFWA 2VQYA 3RYOA 4Q36A 2GANA 2YGWA 4KORA 2EVNA 3EFAA 5EC4A 2P6FA 2JDDA 2B5GA 1IYLA 4JD6A 1PU9A 4HKFA 2Q4VA 2WPXA 1QSMA 3IGRA 4UCNA 4B14A 3CXPA 5JQ4A 4CGNA 4CYNA 4XPDB 4UFXA 2B4BA 4A30A 1YVKA 2B58A 2YNCC 2ZW4A 4PK2A 3B8GA 4CAFA 4KLWA 4B5PA 1FY7A 2EUIA 1M1DA 3TO9A 4AG7A 2OZUA 1MJ9A 2OU2A 5C88A 4NCZA 1XMTA 1XE4A 1KUVA 5C82A 2VBQA 3N7ZA 3PZJA 5DWNA 4KVME 2FSRA 4CS0B 4F0XA 1UFHA 2Z3NA 4ZBGA 1LRZA 4B10A 4R3KA 5F49A 2AJ6A 2FIAA 4CYPA 3GYAA 4MFQA 4B13A 2DPTA 5KTDA 2KCWA 4AVAA 1NSLA 2NMTA 4OAEA 2J8NA 4MFLA 4RS2A 2R7HA 4KUAA 4U9YA 3K9UA 1VKCA 4CGOA 1J4JA 3R96A 1Y7RA 1B6BA 1IB1E 2JEVA 4X5KA 2WSAA 2Z10A 4XPLA 5IV0A 2PR1A 5KTCA 4A2ZA 4FD7A 2G3AA 5G22A 3S6KA 4MHDA 4KOTA 4KOSA 3ZZIA 3PGPA 4E0AA 2FE7A 3EY5A 4H6ZA 1S7KA 5F46A 4PV6A 2G0BA 1M4GA 2GIVA 5HMNA 2QMLA 1ON0A 3EO4A 1YLEA 4K30A 1KUXA 4F6AA 2PQ8A 5IB0A 5AG5A 3SXOA 4GS4A 1Z4RA 1MJBA 5DWMA 4B11A 3T9YA 2FL4A 1NMTA 3NE7A 3P2FA 3MGDA 3R1KA 4KSFA 4KVXA 3LODA 1MK4A 4KSAA 4MY3A 2GE3A 2DPSA 2PSWA 2Z3KA 2AE6A 3TFYA 2A4NA 5F47A 3FIXA 3DNSA 2Y0MA 3R9EA 4CYOA 1QSNA 2B3UA 2VZYA 4RI1A 4UBRA 2PC1A 5A27A 4Y49C 3TE4A 5H86A 3TTHA 4UWIA 3SHPA 4CGPA 3R9FA 2P0WA 3DR6A 1XF8A 5BWAB 1YGHA 3FRMA 4L89A 4OLLA 4NEXA 4H89A 2Q44A 2OB0A 4C7HA 3TT2A 3IWEA 4KZTA 2J8MA 1I1DA 4QBJA 2RC4A 3EC4A 1BOBA 4YGOA 2I00A 3ZJ0A 2D4OA 5F48A 3JUWA 3H4QA 5HH1A 4Y49B 4PK3A 3R95A 2Q04A 2BSWA 4A95A 2Q0YA 3E0KA 3UY5A 3SXNA 4HNXB 4KLVA 2VZZA 4JXQA 1Z9UA 2CXAA 1OZPA 5E96A 4KS9A 4R3LA 4PSXA 3PP9A 4I49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T90 A;  5J8C A;  2B4D A;  4J3G A;  4KOU A;  4FD4 A;  1MJA A;  1SQH A;  3C26 A;  4XNH B;  1Y9K A;  1GHE A;  5EBV A;  4JLY A;  3F5B A;  4E8O A;  3P2H A;  2C27 A;  1R57 A;  2OH1 A;  5I0C A;  2JDC A;  2K5T A;  4UWJ A;  1V0C A;  2B5G B;  1BO4 A;  1VHS A;  2QEC A;  3TOB A;  4CRZ B;  2FS5 A;  4M85 A;  1RO5 A;  1YRE A;  4HNY B;  1I12 A;  4NXY A;  4YRH A;  4E2A A;  1Z4E A;  4MJ8 A;  2ZW6 A;  4KOY A;  3QB8 A;  2Q7B A;  4NSQ A;  4YFJ A;  4EVY A;  3IWG A;  4B5P B;  4KOX A;  4LX9 A;  2ZPA A;  2R98 A;  2F5I A;  4IF5 A;  2VEZ A;  4DNC A;  1Q2Y A;  4MBU A;  1RXT A;  2X7B A;  5KTA A;  4FD5 A;  2IL4 A;  3I9S A;  1U6M A;  2FIW A;  3V8I A;  3S6H A;  2DXQ A;  4R57 A;  2PRB A;  4OAD A;  5JPH A;  4L8A A;  4II9 A;  1QSO A;  1K4J A;  3G8W A;  1TIQ A;  3VWE A;  2P6E A;  3JVN A;  4AB7 A;  3D3S A;  4U5Y A;  3S6F A;  1S7F A;  3FBU A;  4QVT A;  2R8V A;  2D4P A;  1Y9W A;  2FCK A;  3WR7 A;  5J8F A;  2BUE A;  2OZG A;  2Q4Y A;  1B87 A;  4U9Z A;  4JWP A;  3DSB A;  4QUS A;  1S60 A;  4QB9 A;  4XPK A;  2P6G A;  1CM0 A;  4MY0 A;  3S6G A;  3TO7 A;  3GKR A;  1KZF A;  2G3T A;  3LD2 A;  2WPW A;  4BMH A;  5IX3 A;  2J8R A;  2VI7 A;  4R9M A;  4IUS A;  2ATR A;  4LUA A;  1S5K A;  2CNT A;  2FT0 A;  3D2M A;  1PUA A;  1QSR A;  4FD6 A;  2Z11 A;  2ZXV A;  2FXF A;  2BEI A;  4QC6 A;  2R1I A;  1YR0 A;  2HQY A;  4AVB A;  3FXT A;  4H6U A;  2CNS A;  1M44 A;  2H5M A;  4CAW A;  1WWZ A;  5CNP A;  4MI4 A;  2Z0Z A;  3FB3 A;  3GY9 A;  1S7L A;  1P0H A;  1YVO A;  1S7N A;  1YK3 A;  1L0C A;  4M3S A;  1I21 A;  2VXK A;  2ZW5 A;  4CRY B;  2REE A;  3TOA A;  4XNH C;  1Q2D A;  1IYK A;  3BJ7 A;  4NF1 A;  4HNW B;  4KVO E;  3W6S A;  4XPD C;  3G3S A;  3F0A A;  1IID A;  3BJ8 A;  4ONU A;  4B5O A;  4R87 A;  4KOV A;  4ORF A;  3DDD A;  3D2P A;  2PDO A;  3DR8 A;  2I79 A;  5H84 A;  3KKW A;  1P4N A;  2BL1 A;  4JJX A;  1XEB A;  3W6X A;  5FVJ A;  1YX0 A;  4CAX A;  2REF A;  1WK4 A;  3F8K A;  5ISV A;  2JLM A;  2CNM A;  2ZW7 A;  4PSW A;  3QAH A;  3R9G A;  2HV2 A;  2B3V A;  2ARH A;  3D8P A;  1N71 A;  3CXS A;  3OWC A;  2PR8 A;  3TCV A;  2QIR A;  1S3Z A;  1XIX A;  3CXQ A;  4F0Y A;  1IIC A;  1CJW A;  1QST A;  4KOW A;  3VWD A;  4JXR A;  5GCN A;  2O28 A;  1KUY A;  3FYN A;  4CAV A;  3W91 A;  2HUZ A;  1Q2C A;  2B4D B;  3FNC A;  1NE9 A;  1M4D A;  4UA3 A;  3BLN A;  1M4I A;  3EXN A;  3TO6 A;  4AVC A;  2CY2 A;  3I3G A;  2OZH A;  4AG9 A;  4KUB A;  2VQY A;  3RYO A;  2GAN A;  4KOR A;  2EVN A;  3EFA A;  5EC4 A;  2P6F A;  2JDD A;  2B5G A;  1IYL A;  4JD6 A;  1PU9 A;  4HKF A;  2Q4V A;  2WPX A;  1QSM A;  3IGR A;  3CXP A;  5JQ4 A;  4XPD B;  2B4B A;  1YVK A;  2B58 A;  2ZW4 A;  4PK2 A;  3B8G A;  4KLW A;  4B5P A;  1FY7 A;  2EUI A;  1M1D A;  3TO9 A;  4AG7 A;  2OZU A;  1MJ9 A;  2OU2 A;  5C88 A;  4NCZ A;  1XMT A;  1XE4 A;  1KUV A;  5C82 A;  2VBQ A;  3N7Z A;  3PZJ A;  5DWN A;  4KVM E;  2FSR A;  4CS0 B;  1UFH A;  4ZBG A;  1LRZ A;  4R3K A;  5F49 A;  2AJ6 A;  2FIA A;  3GYA A;  5KTD A;  2KCW A;  4AVA A;  1NSL A;  2NMT A;  4OAE A;  2J8N A;  4RS2 A;  2R7H A;  4KUA A;  4U9Y A;  3K9U A;  1VKC A;  1J4J A;  3R96 A;  1Y7R A;  1B6B A;  1IB1 E;  2JEV A;  4X5K A;  2Z10 A;  4XPL A;  5IV0 A;  2PR1 A;  5KTC A;  4FD7 A;  2G3A A;  3S6K A;  4MHD A;  4KOT A;  4KOS A;  3ZZI A;  3PGP A;  4E0A A;  2FE7 A;  3EY5 A;  4H6Z A;  1S7K A;  5F46 A;  4PV6 A;  2G0B A;  1M4G A;  2GIV A;  5HMN A;  2QML A;  1ON0 A;  3EO4 A;  1YLE A;  4K30 A;  1KUX A;  4F6A A;  2PQ8 A;  5IB0 A;  3SXO A;  4GS4 A;  1Z4R A;  1MJB A;  5DWM A;  3T9Y A;  2FL4 A;  1NMT A;  3NE7 A;  3P2F A;  3MGD A;  3R1K A;  4KVX A;  3LOD A;  1MK4 A;  4MY3 A;  2GE3 A;  2PSW A;  2AE6 A;  3TFY A;  2A4N A;  5F47 A;  3FIX A;  3DNS A;  2Y0M A;  3R9E A;  1QSN A;  2B3U A;  2VZY A;  4RI1 A;  4UBR A;  2PC1 A;  4Y49 C;  3TE4 A;  5H86 A;  3TTH A;  4UWI A;  3SHP A;  3R9F A;  2P0W A;  3DR6 A;  1XF8 A;  1YGH A;  3FRM A;  4L89 A;  4OLL A;  4NEX A;  4H89 A;  2Q44 A;  2OB0 A;  3TT2 A;  4KZT A;  2J8M A;  1I1D A;  4QBJ A;  2RC4 A;  3EC4 A;  1BOB A;  4YGO A;  2I00 A;  3ZJ0 A;  2D4O A;  5F48 A;  3JUW A;  3H4Q A;  5HH1 A;  4Y49 B;  4PK3 A;  3R95 A;  2Q04 A;  2BSW A;  2Q0Y A;  3E0K A;  3UY5 A;  3SXN A;  4HNX B;  4KLV A;  2VZZ A;  4JXQ A;  1Z9U A;  1OZP A;  5E96 A;  4R3L A;  4PSX A;  3PP9 A;  4I49 A; 
#chains in the Genus database with same CATH topology
 3T90 A;  5J8C A;  4NJQ A;  2B4D A;  4J3G A;  4KOU A;  5THW A;  4C2Z A;  4FD4 A;  3S9L A;  1MJA A;  4OC3 A;  4P4I A;  1SQH A;  3QAY A;  1CPX A;  4UEE A;  3C26 A;  3FED A;  2DF5 A;  2EK8 A;  4XNH B;  3IFE A;  4GXH A;  7CPA A;  1Y9K A;  4R8F A;  2V8H A;  1GHE A;  5EBV A;  5AG4 A;  4Z65 A;  4JLY A;  3F5B A;  4E8O A;  2FVG A;  4X2T A;  4M6I A;  1IGB A;  4IHM A;  4UFV A;  3P2H A;  2C27 A;  1R57 A;  2OH1 A;  4CYQ A;  5I0C A;  4A37 A;  1FNO A;  5ELY A;  2JDC A;  2K5T A;  4UWJ A;  1V0C A;  1AUG A;  2B5G B;  1BO4 A;  1VHS A;  2QEC A;  4GM5 A;  4CPA A;  3TOB A;  4CRZ B;  2FS5 A;  1TKH A;  4M85 A;  5LRG A;  3TC8 A;  4M6H A;  1RO5 A;  1VIX A;  1YRE A;  3D66 A;  4OC1 A;  4HNY B;  1XOV A;  1DTD A;  4OKO A;  1I12 A;  4NXY A;  4YRH A;  3IO1 A;  2CTB A;  5D8N A;  5LRJ A;  1HDQ A;  1AYE A;  4YWY A;  4A94 A;  1Z4E A;  3CT9 A;  5AG6 A;  4E2A A;  2PJ5 A;  4MJ8 A;  4FUU A;  3LAC A;  4PXB A;  4EFD A;  2ZW6 A;  4KOY A;  3QB8 A;  4P44 A;  1TF9 A;  4NSQ A;  4P4B A;  2Q7B A;  1Z8X A;  4YFJ A;  3IJ3 A;  4EVY A;  1BPN A;  1JWQ A;  3FEE A;  3IWG A;  4B5P B;  5JGF A;  4KOX A;  4LX9 A;  4BBH A;  2ZPA A;  2R98 A;  2F5I A;  1TKF A;  2AFU A;  3D7H A;  4JZ0 A;  4IF5 A;  1AMP A;  4ZX9 A;  4EME A;  4OC5 A;  4KSI A;  4ONW A;  3FMC A;  2NYQ A;  2VEZ A;  2ZOF A;  4DNC A;  1DE4 C;  3IC1 A;  1Q2Y A;  1UWY A;  4MBU A;  1RXT A;  2X7B A;  5KTA A;  4CGM A;  1PYT B;  5HVF A;  4FD5 A;  2IL4 A;  3I9S A;  4IAV A;  1U6M A;  5DS0 A;  2FIW A;  4A32 A;  3V8I A;  3S6H A;  2DXQ A;  2O53 A;  3SI1 A;  4R57 A;  2PRB A;  2V8G A;  4OAD A;  5JPH A;  4L8A A;  4II9 A;  3WT4 A;  1QSO A;  1K4J A;  3CPA A;  1XRY A;  3G8W A;  2ZEF A;  3JTK A;  1TIQ A;  2YNE A;  2PVV A;  2ABZ A;  3BI1 A;  4Q7A A;  2EK9 A;  3VWE A;  2P6E A;  4MFJ A;  4MCQ A;  2Z3M A;  3JVN A;  3PBE A;  4AB7 A;  3D3S A;  4U5Y A;  3S6F A;  4C2Y A;  4WJB A;  1Y7E A;  1S7F A;  3FJU A;  3FBU A;  3B3T A;  4QVT A;  3SI0 A;  1VHE A;  3L2N A;  3HUV A;  2R8V A;  2D4P A;  2BO9 A;  1Y9W A;  2FCK A;  3WR7 A;  1XMB A;  5J8F A;  2BUE A;  1QQ9 A;  3V7Z A;  4C68 A;  2GFQ A;  4O23 A;  4UCM A;  6CPA A;  4AXV A;  2ANP A;  3PB7 X;  1ELM P;  1IU8 A;  1YME A;  4TNU A;  4P4F A;  2OZG A;  2Q4Y A;  1B87 A;  1GYT A;  4RN7 A;  3CPX A;  4U9Z A;  4JWP A;  3DSB A;  3IWW A;  4QUS A;  1S60 A;  4QB9 A;  4XPK A;  1BAV A;  3I1U A;  2YNC A;  2P6G A;  1CM0 A;  1ZG9 A;  4MY0 A;  3S6G A;  3RO0 A;  3TO7 A;  2ZOG A;  1ZLH A;  2NSM A;  3FH4 A;  4NGS A;  4DYO A;  3GKR A;  3PFE A;  5AGE A;  5CBM A;  1KZF A;  1VGY A;  2G3T A;  3LD2 A;  3SJG A;  4PXE A;  5A28 A;  2WPW A;  4BMH A;  5HVH A;  2J9A A;  1CPS A;  5IX3 A;  2J8R A;  4NGT A;  4A39 A;  3KR5 A;  4NGP A;  4C2X A;  2VI7 A;  3K9T A;  4CAE A;  4R9M A;  4UCP A;  2O4H A;  2ATR A;  4IUS A;  2JBJ A;  2AFX A;  2C6G A;  4LUA A;  1S5K A;  2CNT A;  4P10 A;  2FT0 A;  3D2M A;  3NA6 A;  1PUA A;  1QSR A;  3IU1 A;  4FD6 A;  4Q38 A;  2Z11 A;  2ZXV A;  5AG7 A;  1XBU A;  5K8P A;  2PCU A;  2FXF A;  1R3N A;  2AFS A;  3D67 A;  2CTC A;  2BEI A;  4MHY A;  4P45 A;  4QC6 A;  2CF4 A;  3T8W A;  2R1I A;  1YR0 A;  2HQY A;  2CIJ A;  4AVB A;  3IU2 A;  3FXT A;  4H6U A;  2CNS A;  2QVP A;  4NJR A;  1XFO A;  2XEI A;  3FVL A;  1M44 A;  3PBB A;  2AFW A;  2H5M A;  4FAI A;  3A9L A;  4CAW A;  1WWZ A;  5CNP A;  4MI4 A;  4EWT A;  2Z0Z A;  4MFZ A;  2IMO A;  3NH8 A;  3FB3 A;  3GY9 A;  1S7L A;  1P0H A;  1YW4 A;  1YVO A;  1S7N A;  1YK3 A;  3JRU A;  1L0C A;  4M3S A;  1I21 A;  2VXK A;  2V8D A;  1EE3 P;  2ZW5 A;  4A31 A;  2REE A;  3TOA A;  4CRY B;  4XNH C;  2Z3L A;  4LQG A;  1IY7 A;  1Q2D A;  2ZEP A;  1ZG7 A;  4MHP A;  1IYK A;  3D4U A;  1YSJ A;  1M4L A;  3BJ7 A;  5LRK A;  4NF1 A;  3LWU A;  1Z5R A;  4HNW B;  4KVO E;  3KQX A;  3W6S A;  2DEA A;  4UF4 A;  4XPD C;  3G3S A;  4K3N A;  3B2Y A;  3F0A A;  3D7D A;  1IID A;  4HPS A;  3BJ8 A;  3VH9 A;  2C6P A;  4MFP A;  4ONU A;  1ZO0 A;  1X10 A;  2QYV A;  2F7V A;  5G20 A;  2GU2 A;  3KL9 A;  3PB9 X;  1XJO A;  4B5O A;  4MHZ A;  4R87 A;  4KOV A;  4ZY2 A;  4ORF A;  2XEJ A;  3DDD A;  2WUU A;  3WC5 A;  2PJ1 A;  1A2Z A;  2PDO A;  3D2P A;  4A33 A;  3DR8 A;  4OIW A;  2I79 A;  5H84 A;  3KKW A;  4F8Z A;  3S9M A;  1IOF A;  1P4N A;  4NGR A;  4BIN A;  3GLJ A;  2BL1 A;  2I3C A;  1XEB A;  4JJX A;  3W6X A;  5FVJ A;  2PJ9 A;  2XEG A;  1YX0 A;  2ZEE A;  4CAX A;  4PXD A;  2PJB A;  2REF A;  1WK4 A;  1ZG8 A;  3F8K A;  3GIU A;  4B12 A;  4UIA A;  4X3R A;  1F2O A;  5ISV A;  1TKJ A;  2PJ7 A;  3RNZ A;  2JLM A;  2BOA A;  4PPZ A;  2CNM A;  2ZW7 A;  4PSW A;  2Z3O A;  5JH9 A;  1VHO A;  3QAH A;  5G21 A;  3R9G A;  2HV2 A;  2PE3 A;  2B3V A;  2ARH A;  3D8P A;  1N71 A;  3CXS A;  3OWC A;  2PR8 A;  3TCV A;  2QIR A;  5LYL A;  1Z2L A;  2Z3P A;  4BD9 A;  1S3Z A;  1XIX A;  3CXQ A;  3CZX A;  4F0Y A;  3NE8 A;  5IB9 A;  1IIC A;  1CJW A;  1QST A;  4KOW A;  3VWD A;  4MCP A;  4JXR A;  1ELL P;  5GCN A;  2O28 A;  1KUY A;  3FYN A;  4DUK A;  8CPA A;  2OR4 A;  4MFK A;  4P4D A;  4C7I A;  3H5Z A;  4CAV A;  3W91 A;  2HUZ A;  2YND A;  4UEF A;  2ZEL A;  3BHX A;  2ODF A;  1Q2C A;  2B4D B;  3FNC A;  2PJ3 A;  5HXD A;  1NE9 A;  2WZN A;  4CGL A;  3N5F A;  1M4D A;  4UA3 A;  3BLN A;  1M4I A;  3EXN A;  3TO6 A;  4JYW A;  1H8L A;  4AVC A;  3IEH A;  1CP7 A;  2CY2 A;  2IQ6 A;  5G1Z A;  5K8M A;  4ZGY B;  1NSA A;  2OZH A;  2ZEN A;  3I3G A;  3KR4 A;  2OOT A;  1R43 A;  4AG9 A;  4KUB A;  4PQA A;  3PB6 X;  4UFW A;  2EBJ A;  1TF8 A;  2HC9 A;  2VQY A;  3RYO A;  4Q36 A;  2GAN A;  1LCP A;  2Q7S A;  2YGW A;  4KOR A;  2EVN A;  3B3W A;  4R7M A;  1YW6 A;  3EFA A;  5EC4 A;  3HLP A;  3SJX A;  2P6F A;  3WC7 A;  2JDD A;  2B5G A;  4ZY0 A;  1IYL A;  3DGV A;  1CX8 A;  4JD6 A;  4TWE A;  1PU9 A;  4HKF A;  2Q4V A;  2JEW A;  3RAM A;  2WPX A;  3FX6 A;  1YQE A;  1Q7L A;  2GRE A;  1QSM A;  3IGR A;  3KQZ A;  4UCN A;  3SI2 A;  4B14 A;  3CXP A;  5JQ4 A;  4CGN A;  4CYN A;  5LYI A;  2POK A;  3H8G A;  4P4E A;  4XPD B;  4UFX A;  3WC6 A;  2B4B A;  2JBK A;  4A30 A;  1YVK A;  2B58 A;  2YNC C;  2ZW4 A;  4MXU A;  4OID A;  4FBE A;  4PK2 A;  2PRQ A;  3B8G A;  4CAF A;  4KLW A;  4B5P A;  2ZED A;  3NH5 A;  1CG2 A;  1FY7 A;  2EUI A;  1M1D A;  4LQ6 A;  4NFR A;  4P6Y A;  3TO9 A;  4AG7 A;  2OZU A;  4P4J A;  1ZLI A;  1MJ9 A;  2HB6 A;  2OU2 A;  5K8O A;  5C88 A;  4NCZ A;  1F2P A;  4YU9 A;  1XMT A;  1XE4 A;  3PB8 X;  3BXM A;  4UEZ A;  1KUV A;  3VAT A;  5C82 A;  3KZW A;  2VBQ A;  3N7Z A;  3PZJ A;  4MHN A;  1PCA A;  5DWN A;  4KVM E;  5HVG A;  2FSR A;  4CS0 B;  4F0X A;  1UFH A;  2Z3N A;  4ZBG A;  1LRZ A;  3PB4 X;  1ARL A;  4B10 A;  5J1Q A;  1ARM A;  2G9D A;  3B3C A;  3D7F A;  3IIB A;  4R3K A;  5F49 A;  4F9U A;  2AJ6 A;  4NGQ A;  2FIA A;  3SJF A;  2V77 A;  4WWV A;  3H8E A;  4MCS A;  4CYP A;  2GLF A;  2PJ8 A;  3GYA A;  4MFQ A;  4B13 A;  2DPT A;  4ZI6 A;  2KCW A;  5KTD A;  1HDU A;  4AVA A;  3B3V A;  2ZEM A;  1Z8L A;  1NSL A;  2PJ6 A;  2NMT A;  4OAE A;  2J8N A;  4MFL A;  4RS2 A;  2ZEG A;  2R7H A;  2VL1 A;  1RTQ A;  2C6C A;  4KUA A;  4U9Y A;  3K9U A;  1VKC A;  3QNV A;  1J4J A;  3KHX A;  3R96 A;  4CGO A;  4G1P A;  3CDX A;  1Y7R A;  1B6B A;  1IB1 E;  1BLL E;  2JEV A;  4X5K A;  2WSA A;  1Z8W A;  2Z10 A;  4XPL A;  2AFZ A;  2PR1 A;  4M6G A;  3RBU A;  1QMU A;  3PEI A;  3NH4 A;  5IV0 A;  5KTC A;  3KAS A;  1TXR A;  3PRT A;  4A2Z A;  2V8V A;  4ZYQ A;  4FD7 A;  2G3A A;  2GLJ A;  1JQG A;  4MHD A;  4OME A;  4X8I A;  5G22 A;  3S6K A;  4KOT A;  5CPA A;  3SJE A;  4MMO A;  4KOS A;  3ZZI A;  3PGP A;  4E0A A;  2FE7 A;  3ISZ A;  5K8N A;  3EY5 A;  4R6T A;  4H6Z A;  3LMS A;  3K2K A;  1S7K A;  4DJL A;  3B7I A;  3BI0 A;  4PV6 A;  5F46 A;  3B35 A;  3GUX A;  2G0B A;  1M4G A;  2GIV A;  5HMN A;  2QML A;  1ON0 A;  1CP6 A;  2RB7 A;  3DLJ A;  3D7G A;  3EO4 A;  4OC4 A;  1YLE A;  4K30 A;  1KUX A;  4NGN A;  2PQ8 A;  4MRI A;  4F6A A;  4ZY1 A;  5IB0 A;  4IK2 A;  2XEF A;  5AG5 A;  2PJ0 A;  1LAP A;  2QJ8 A;  3SXO A;  3NFZ A;  2PIZ A;  4GS4 A;  1LAN A;  1Z4R A;  2ZEO A;  1MJB A;  5DWM A;  1Y0Y A;  4MCR A;  5EMI A;  4ZX8 A;  4B11 A;  3T9Y A;  2FL4 A;  1NMT A;  3NE7 A;  3P2F A;  3MGD A;  3R1K A;  4PXC A;  5JM6 A;  4KSF A;  4KVX A;  3LOD A;  1MK4 A;  4KSA A;  4NGM A;  2EO8 A;  2PIY A;  4MY3 A;  2GE3 A;  2DPS A;  2WYR A;  2PSW A;  2Z3K A;  2AE6 A;  3MN8 A;  1IOI A;  3TX8 A;  3TFY A;  2F8H A;  4H2K A;  2A4N A;  2AFM A;  2PJA A;  2Q43 A;  2RFH A;  1OBR A;  3FIX A;  3FF3 A;  5F47 A;  3RZA A;  3DNS A;  2Y0M A;  3R9E A;  3KGQ A;  4CYO A;  5LYD A;  1QSN A;  2EWB A;  2B3U A;  2Q4Z A;  3B3S A;  2IJZ A;  2VZY A;  4RI1 A;  4OP4 A;  4UBR A;  2PC1 A;  5A27 A;  3ISX A;  3MRU A;  5I4M A;  1BPM A;  4W9Y A;  4Y49 C;  5H86 A;  5LYF A;  3TE4 A;  1X12 A;  1FT7 A;  3TTH A;  4UWI A;  3SHP A;  4CGP A;  4RUH A;  3R9F A;  2P0W A;  1Y0R A;  2PJ4 A;  3DR6 A;  4FWU A;  1XF8 A;  1CBX A;  3D68 A;  4OC2 A;  5BWA B;  1YGH A;  3FRM A;  4L89 A;  2AFO A;  4OLL A;  4NEX A;  5F09 A;  3H8F A;  3PFO A;  4H89 A;  3V38 A;  1LAM A;  2Q44 A;  4OC0 A;  1LFW A;  1LOK A;  4A38 A;  1Z8T A;  2OB0 A;  2PJ2 A;  4C7H A;  3TT2 A;  3IWE A;  4KZT A;  2J8M A;  2Q51 A;  4UIB A;  1I1D A;  4R76 A;  2RC4 A;  3EC4 A;  4QBJ A;  1BOB A;  3S9N A;  1YLO A;  2C1C A;  4YGO A;  2I00 A;  1KWM A;  2PVW A;  2PJC A;  2D4O A;  3ZJ0 A;  5D29 A;  5F48 A;  4F9V A;  3JUW A;  1F57 A;  3GB0 A;  3H4Q A;  5HH1 A;  4Y49 B;  4PK3 A;  3R95 A;  2Q04 A;  2BSW A;  3KI9 A;  4A95 A;  2Q0Y A;  3E0K A;  3FEC A;  3KHZ A;  3UY5 A;  3SXN A;  1HEE A;  4HNX B;  3VAR A;  4KLV A;  2VZZ A;  4JXQ A;  1Z9U A;  2CXA A;  2ZEH A;  4B6Z A;  1OZP A;  5E96 A;  4KS9 A;  4R3L A;  2BCO A;  4PSX A;  3WAB A;  3PP9 A;  4I49 A; 
#chains in the Genus database with same CATH homology
 3T90 A;  5J8C A;  2B4D A;  4J3G A;  4KOU A;  4C2Z A;  4FD4 A;  1MJA A;  1SQH A;  3C26 A;  4XNH B;  1Y9K A;  1GHE A;  5EBV A;  5AG4 A;  4JLY A;  3F5B A;  4E8O A;  4UFV A;  3P2H A;  2C27 A;  1R57 A;  2OH1 A;  4CYQ A;  5I0C A;  2JDC A;  2K5T A;  4UWJ A;  1V0C A;  2B5G B;  1BO4 A;  1VHS A;  2QEC A;  3TOB A;  4CRZ B;  2FS5 A;  4M85 A;  1RO5 A;  1YRE A;  4HNY B;  1I12 A;  4NXY A;  4YRH A;  4E2A A;  1Z4E A;  5AG6 A;  4MJ8 A;  2ZW6 A;  4KOY A;  3QB8 A;  2Q7B A;  4NSQ A;  4YFJ A;  4EVY A;  3IWG A;  4B5P B;  4KOX A;  4LX9 A;  4BBH A;  2ZPA A;  2R98 A;  2F5I A;  4IF5 A;  2VEZ A;  4DNC A;  1Q2Y A;  4MBU A;  1RXT A;  2X7B A;  5KTA A;  4CGM A;  4FD5 A;  2IL4 A;  3I9S A;  1U6M A;  2FIW A;  4A32 A;  3V8I A;  3S6H A;  2DXQ A;  4R57 A;  2PRB A;  4OAD A;  5JPH A;  4L8A A;  4II9 A;  1QSO A;  1K4J A;  3G8W A;  3JTK A;  1TIQ A;  2YNE A;  3VWE A;  2P6E A;  4MFJ A;  2Z3M A;  3JVN A;  4AB7 A;  3D3S A;  4U5Y A;  3S6F A;  4C2Y A;  1S7F A;  3FBU A;  4QVT A;  2R8V A;  2D4P A;  1Y9W A;  2FCK A;  3WR7 A;  5J8F A;  2BUE A;  4C68 A;  4UCM A;  2OZG A;  2Q4Y A;  1B87 A;  4U9Z A;  4JWP A;  3DSB A;  4QUS A;  1S60 A;  4QB9 A;  4XPK A;  2YNC A;  2P6G A;  1CM0 A;  4MY0 A;  3S6G A;  3TO7 A;  3GKR A;  5AGE A;  1KZF A;  2G3T A;  3LD2 A;  5A28 A;  2WPW A;  4BMH A;  5IX3 A;  2J8R A;  4C2X A;  2VI7 A;  4CAE A;  4R9M A;  4UCP A;  4IUS A;  2ATR A;  4LUA A;  1S5K A;  2CNT A;  2FT0 A;  3D2M A;  1PUA A;  1QSR A;  3IU1 A;  4FD6 A;  4Q38 A;  2Z11 A;  2ZXV A;  5AG7 A;  2FXF A;  2BEI A;  4QC6 A;  2R1I A;  1YR0 A;  2HQY A;  4AVB A;  3IU2 A;  3FXT A;  4H6U A;  2CNS A;  1M44 A;  2H5M A;  3A9L A;  4CAW A;  1WWZ A;  5CNP A;  4MI4 A;  2Z0Z A;  4MFZ A;  3FB3 A;  3GY9 A;  1S7L A;  1P0H A;  1YVO A;  1S7N A;  1YK3 A;  1L0C A;  4M3S A;  1I21 A;  2VXK A;  4A31 A;  2ZW5 A;  4CRY B;  2REE A;  3TOA A;  4XNH C;  2Z3L A;  1Q2D A;  1IYK A;  3BJ7 A;  4NF1 A;  4HNW B;  4KVO E;  3W6S A;  4XPD C;  3G3S A;  3F0A A;  1IID A;  3BJ8 A;  4MFP A;  4ONU A;  1ZO0 A;  5G20 A;  4B5O A;  4R87 A;  4KOV A;  4ORF A;  3DDD A;  2WUU A;  3D2P A;  2PDO A;  4A33 A;  3DR8 A;  2I79 A;  5H84 A;  3KKW A;  1P4N A;  2BL1 A;  4JJX A;  1XEB A;  3W6X A;  5FVJ A;  1YX0 A;  4CAX A;  2REF A;  1WK4 A;  4B12 A;  3F8K A;  5ISV A;  2JLM A;  2CNM A;  2ZW7 A;  4PSW A;  2Z3O A;  3QAH A;  5G21 A;  3R9G A;  2HV2 A;  2B3V A;  2ARH A;  3D8P A;  1N71 A;  3CXS A;  3OWC A;  2PR8 A;  3TCV A;  2QIR A;  2Z3P A;  1S3Z A;  1XIX A;  3CXQ A;  4F0Y A;  1IIC A;  1CJW A;  1QST A;  4KOW A;  3VWD A;  4JXR A;  5GCN A;  2O28 A;  1KUY A;  3FYN A;  4MFK A;  4C7I A;  4CAV A;  3H5Z A;  3W91 A;  2HUZ A;  2YND A;  1Q2C A;  2B4D B;  3FNC A;  1NE9 A;  4CGL A;  1M4D A;  4UA3 A;  3BLN A;  1M4I A;  3EXN A;  3TO6 A;  4AVC A;  2CY2 A;  5G1Z A;  4ZGY B;  3I3G A;  2OZH A;  4AG9 A;  4KUB A;  4UFW A;  2VQY A;  3RYO A;  4Q36 A;  2GAN A;  2YGW A;  4KOR A;  2EVN A;  3EFA A;  5EC4 A;  2P6F A;  2JDD A;  2B5G A;  1IYL A;  4JD6 A;  1PU9 A;  4HKF A;  2Q4V A;  2WPX A;  1QSM A;  3IGR A;  4UCN A;  4B14 A;  3CXP A;  5JQ4 A;  4CGN A;  4CYN A;  4XPD B;  4UFX A;  2B4B A;  4A30 A;  1YVK A;  2B58 A;  2YNC C;  2ZW4 A;  4PK2 A;  3B8G A;  4CAF A;  4KLW A;  4B5P A;  1FY7 A;  2EUI A;  1M1D A;  3TO9 A;  4AG7 A;  2OZU A;  1MJ9 A;  2OU2 A;  5C88 A;  4NCZ A;  1XMT A;  1XE4 A;  1KUV A;  5C82 A;  2VBQ A;  3N7Z A;  3PZJ A;  5DWN A;  4KVM E;  2FSR A;  4CS0 B;  4F0X A;  1UFH A;  2Z3N A;  4ZBG A;  1LRZ A;  4B10 A;  4R3K A;  5F49 A;  2AJ6 A;  2FIA A;  4CYP A;  3GYA A;  4MFQ A;  4B13 A;  2DPT A;  5KTD A;  2KCW A;  4AVA A;  1NSL A;  2NMT A;  4OAE A;  2J8N A;  4MFL A;  4RS2 A;  2R7H A;  4KUA A;  4U9Y A;  3K9U A;  1VKC A;  4CGO A;  1J4J A;  3R96 A;  1Y7R A;  1B6B A;  1IB1 E;  2JEV A;  4X5K A;  2WSA A;  2Z10 A;  4XPL A;  5IV0 A;  2PR1 A;  5KTC A;  4A2Z A;  4FD7 A;  2G3A A;  5G22 A;  3S6K A;  4MHD A;  4KOT A;  4KOS A;  3ZZI A;  3PGP A;  4E0A A;  2FE7 A;  3EY5 A;  4H6Z A;  1S7K A;  5F46 A;  4PV6 A;  2G0B A;  1M4G A;  2GIV A;  5HMN A;  2QML A;  1ON0 A;  3EO4 A;  1YLE A;  4K30 A;  1KUX A;  4F6A A;  2PQ8 A;  5IB0 A;  5AG5 A;  3SXO A;  4GS4 A;  1Z4R A;  1MJB A;  5DWM A;  4B11 A;  3T9Y A;  2FL4 A;  1NMT A;  3NE7 A;  3P2F A;  3MGD A;  3R1K A;  4KSF A;  4KVX A;  3LOD A;  1MK4 A;  4KSA A;  4MY3 A;  2GE3 A;  2DPS A;  2PSW A;  2Z3K A;  2AE6 A;  3TFY A;  2A4N A;  5F47 A;  3FIX A;  3DNS A;  2Y0M A;  3R9E A;  4CYO A;  1QSN A;  2B3U A;  2VZY A;  4RI1 A;  4UBR A;  2PC1 A;  5A27 A;  4Y49 C;  3TE4 A;  5H86 A;  3TTH A;  4UWI A;  3SHP A;  4CGP A;  3R9F A;  2P0W A;  3DR6 A;  1XF8 A;  5BWA B;  1YGH A;  3FRM A;  4L89 A;  4OLL A;  4NEX A;  4H89 A;  2Q44 A;  2OB0 A;  4C7H A;  3TT2 A;  3IWE A;  4KZT A;  2J8M A;  1I1D A;  4QBJ A;  2RC4 A;  3EC4 A;  1BOB A;  4YGO A;  2I00 A;  3ZJ0 A;  2D4O A;  5F48 A;  3JUW A;  3H4Q A;  5HH1 A;  4Y49 B;  4PK3 A;  3R95 A;  2Q04 A;  2BSW A;  4A95 A;  2Q0Y A;  3E0K A;  3UY5 A;  3SXN A;  4HNX B;  4KLV A;  2VZZ A;  4JXQ A;  1Z9U A;  2CXA A;  1OZP A;  5E96 A;  4KS9 A;  4R3L A;  4PSX A;  3PP9 A;  4I49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...