1WWZA

Crystal structure of ph1933 from pyrococcus horikoshii ot3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
MDEIKIEKLKKLDKKALNELIDVYMSGYEGLEEYGGEGRDYARNYIKWCWKKASDGFFVAKVGDKIVGFIVCDKDWFSKYEGRIVGAIHEFVVDKKFQGKGIGRKLLITCLDFLGKYNDTIELWVGEKNYGAMNLYEKFGFKKVGKSGIWVRMIKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1933
publication title Crystal structure of PH1933 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 50
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1wwzA00
3R9FA 1YR0A 1N71A 1P0HA 2G3TA 3EFAA 4B5OA 3B8GA 4R3LA 1Q2YA 2FIWA 2FXFA 3TTHA 4B5PA 1UFHA 4AG7A 5H86A 4IF5A 3C26A 1RO5A 4M85A 3TO9A 1YX0A 3D8PA 3FB3A 5F48A 2QIRA 4UA3A 2ARHA 2P6FA 4H89A 4X5KA 1YGHA 4PSXA 1MJ9A 4I49A 1PU9A 2VZZA 3D3SA 5J8CA 2C27A 2B4DA 4KOXA 4NF1A 3R96A 4DNCA 3S6KA 4EVYA 2HQYA 3IWGA 3NE7A 4NSQA 4AVBA 1QSNA 2JLMA 4HKFA 3LODA 4ZBGA 1QSMA 3PP9A 3H4QA 4LX9A 2OU2A 5C82A 4JLYA 3TFYA 1PUAA 2H5MA 4XPLA 4KOUA 3EO4A 1IICA 3UY5A 4PV6A 4QUSA 4XNHC 2FL4A 4CS0B 1S3ZA 4KORA 5I0CA 4R9MA 4PK2A 3G8WA 4YFJA 3GKRA 3KKWA 1B87A 2VBQA 3W6SA 2Q04A 3DDDA 5F49A 3K9UA 1Z4RA 1XEBA 2VZYA 4KUAA 2HV2A 4KVXA 4JXQA 2GE3A 2CNMA 1YK3A 4IUSA 3N7ZA 3S6FA 4AG9A 1U6MA 5CNPA 1OZPA 4CAWA 2KCWA 2Q7BA 2WPXA 2B58A 1K4JA 2BL1A 2HUZA 2G0BA 2PRBA 1Y9KA 1YREA 3GYAA 4F0YA 3ZZIA 2CY2A 4MI4A 1L0CA 5H84A 4E0AA 2J8NA 2PC1A 3TCVA 1VHSA 1GHEA 2OB0A 3TO7A 4XPKA 3F5BA 5GCNA 4KLWA 3JVNA 3DSBA 5IV0A 2PQ8A 5JPHA 4II9A 2ZW4A 2J8RA 2B5GB 2Z0ZA 2CNSA 2Q4VA 4UWIA 1IIDA 4Y49B 4QVTA 2DXQA 1TIQA 1KUYA 4NCZA 4MY0A 1QSOA 1IB1E 1VKCA 4CAXA 3DNSA 3P2FA 1BO4A 4BMHA 2JDCA 4KOVA 2FE7A 4KOWA 1WWZA 2BEIA 3T90A 4RI1A 2X7BA 3TOBA 4LUAA 4HNWB 2VQYA 5DWMA 1IYKA 4CRYB 2PSWA 4YGOA 2I00A 2CNTA 4E2AA 5EC4A 2OH1A 2QMLA 3SXOA 2AE6A 2VI7A 4QB9A 2FS5A 3I9SA 3T9YA 2ZW7A 1Q2CA 2ATRA 4NEXA 1KUXA 4L8AA 2A4NA 4YRHA 2J8MA 2Z10A 3S6GA 3OWCA 2P0WA 4ORFA 1Y9WA 2JDDA 2FIAA 3TE4A 5JQ4A 1QSTA 1S5KA 1XF8A 2VXKA 3D2MA 3JUWA 2RC4A 3EY5A 3R1KA 1RXTA 2R1IA 2FSRA 1CM0A 1Z4EA 4R87A 3CXSA 2R98A 3GY9A 3F8KA 5HH1A 3ZJ0A 5HMNA 5KTAA 3S6HA 3TO6A 5KTDA 1NMTA 3SHPA 4J3GA 2B3VA 4KLVA 4KOYA 3FBUA 1M1DA 1S60A 3CXPA 5DWNA 1MJBA 4M3SA 1NE9A 1S7NA 4R57A 2ZW5A 2ZXVA 2B5GA 2G3AA 3BLNA 1CJWA 1I12A 3R9GA 3CXQA 2QECA 2B4BA 1M44A 5IB0A 2REEA 4FD5A 4XPDB 1S7FA 4MHDA 4AB7A 4KVME 4U9YA 3DR8A 2PR1A 1J4JA 1YVOA 1MK4A 4KZTA 3I3GA 4JD6A 4JWPA 4CAVA 1Q2DA 4NXYA 3PGPA 1IYLA 1R57A 4KVOE 4Y49C 3RYOA 4HNYB 4FD6A 2REFA 2OZUA 1Y7RA 3LD2A 3EXNA 2EVNA 4OLLA 5FVJA 2JEVA 4QC6A 3IGRA 3WR7A 4R3KA 2FCKA 4FD7A 2Q44A 2NMTA 3F0AA 4JXRA 4E8OA 3FNCA 2GANA 3FXTA 4KUBA 4U9ZA 1I1DA 3R9EA 1SQHA 5C88A 5F47A 4UWJA 1XMTA 2OZHA 2BSWA 2Q4YA 4UBRA 2O28A 3FYNA 4L89A 4CRZB 3V8IA 1M4IA 1S7LA 2ZW6A 5KTCA 3QAHA 2Q0YA 4PSWA 4B5PB 5IX3A 4MJ8A 2ZPAA 1NSLA 1M4DA 3BJ7A 3TT2A 2VEZA 4H6UA 4HNXB 2AJ6A 4AVAA 4PK3A 2P6EA 2K5TA 2PDOA 1S7KA 1WK4A 5EBVA 1YVKA 4KOTA 4AVCA 2F5IA 1Z9UA 3FRMA 2R7HA 3EC4A 3QB8A 4H6ZA 4F6AA 2PR8A 2R8VA 4QBJA 2Z11A 3P2HA 4RS2A 2EUIA 4ONUA 2WPWA 3DR6A 2B4DB 1XIXA 1BOBA 1ON0A 1XE4A 4XNHB 1KZFA 4FD4A 2FT0A 1KUVA 1LRZA 3VWDA 2OZGA 3D2PA 1P4NA 4GS4A 2Y0MA 3PZJA 3MGDA 4MBUA 2D4OA 1V0CA 4XPDC 5E96A 4OAEA 3W6XA 1MJAA 3TOAA 2BUEA 4KOSA 1M4GA 3SXNA 4JJXA 3E0KA 2I79A 2D4PA 1YLEA 3G3SA 4K30A 5J8FA 4MY3A 3VWEA 4U5YA 1QSRA 4OADA 2P6GA 1I21A 2B3UA 5F46A 3BJ8A 1B6BA 2IL4A 3R95A 3W91A 1FY7A 5ISVA 3FIXA 2GIVA
chains in the Genus database with same CATH superfamily
4B13A 2IJZA 1YR0A 3I1UA 3R9FA 1N71A 1P0HA 2G3TA 1NSAA 3D68A 3EFAA 3B8GA 4R3LA 4MCSA 1Q2YA 2FIWA 2FXFA 2AFSA 4UFVA 4OC0A 5LRJA 3TTHA 4RUHA 2C6CA 4B5PA 1UFHA 1XBUA 2ZEFA 5H86A 4IF5A 4AG7A 3C26A 1CP7A 3FEDA 5K8PA 1RO5A 3BI1A 3FECA 4M85A 3TO9A 4M6GA 5LRGA 1Z8WA 1YX0A 3BHXA 3D8PA 3FB3A 5F48A 2QIRA 4UA3A 2ARHA 2P6FA 2ZEEA 4H89A 4X5KA 3IC1A 1YGHA 4PSXA 4IAVA 1MJ9A 3SJEA 1H8LA 3V38A 4I49A 2IQ6A 1PU9A 4NGPA 3NH5A 2VZZA 4YU9A 3D3SA 5J8CA 2C27A 2B4DA 3IWEA 1XMBA 4IHMA 4KOXA 4KSIA 4NF1A 5LYDA 3R96A 3B2YA 5HVHA 2CIJA 2CF4A 3S6KA 4DNCA 4EVYA 2HQYA 5HVGA 1FT7A 3IWGA 4UFWA 4A94A 4A39A 1CPSA 2ZOGA 3NE7A 1TKFA 3DGVA 4O23A 4NSQA 4AVBA 1QSNA 1ZG9A 2JLMA 2RB7A 2Z3KA 1LFWA 3IU1A 1X12A 5G21A 4HKFA 1Y0YA 1TF8A 3LODA 5K8NA 1M4LA 4ZBGA 4FAIA 1QSMA 5JGFA 1VHOA 3PP9A 3GB0A 3VARA 2ZEGA 3H4QA 1ZG8A 4LX9A 2OU2A 4F0XA 4P10A 3WABA 3B7IA 4OMEA 5C82A 5IB9A 1F57A 1TF9A 1VIXA 3A9LA 1LAPA 4JLYA 3TFYA 4ZX8A 4C7HA 1PUAA 2H5MA 2WUUA 4JZ0A 1JWQA 4B14A 8CPAA 4XPLA 4KOUA 2HC9A 3EO4A 1IICA 3UY5A 2AFMA 3KHZA 4PV6A 1YLOA 4QUSA 4XNHC 2FL4A 2PIYA 4CS0B 3PB8X 1S3ZA 4KORA 2RFHA 3TX8A 4MMOA 1ZLIA 3N5FA 4P44A 5I0CA 4R9MA 4PK2A 2PJ4A 3IU2A 3G8WA 4UEZA 4YFJA 2DEAA 3GKRA 3KKWA 4PXDA 1B87A 3SI0A 4P4BA 2VBQA 3W6SA 2Q04A 3DDDA 3IWWA 4CGLA 3KL9A 1UWYA 4CYPA 5F49A 3K9UA 4DYOA 1Z4RA 4UEEA 1XEBA 4PXBA 4ZY1A 2VZYA 4KUAA 2HV2A 4MHZA 5D29A 4KVXA 4OC4A 1ZLHA 2ZEOA 2PJAA 1CX8A 4JXQA 3B3TA 1DTDA 2ABZA 2CNMA 2GE3A 4F8ZA 2DPSA 4M6IA 4UCMA 3T8WA 1YK3A 4IUSA 2AFWA 1BLLE 3N7ZA 4Q38A 4A38A 3S6FA 3NFZA 5A27A 2OR4A 2ZEPA 4OC2A 4AG9A 1U6MA 3RZAA 4NGQA 5CNPA 5AG4A 1OZPA 2XEJA 3WC5A 4CAWA 2KCWA 2Q7BA 4ZYQA 2WPXA 2B58A 1K4JA 3B3CA 3SI1A 2BL1A 2F8HA 3PB4X 1QQ9A 2HUZA 2G0BA 5JH9A 2AFXA 2PRBA 3DLJA 4UIBA 1BPMA 4Q36A 4EFDA 1Y9KA 1YREA 2ZEHA 3GYAA 4A30A 3KQZA 4F0YA 3KASA 2OOTA 1HDUA 4A31A 3ZZIA 4R76A 4DUKA 4C68A 4OC3A 2CY2A 3D7GA 4MI4A 4CGOA 1L0CA 2JBKA 3ISXA 3NH8A 4NGNA 5H84A 4E0AA 3GUXA 2J8NA 1AUGA 4A33A 2PC1A 1CG2A 3TCVA 1VHSA 1GHEA 5I4MA 2OB0A 4DJLA 3TO7A 4XPKA 3GIUA 4A2ZA 4NGTA 3F5BA 2PIZA 3WC6A 3MRUA 4BBHA 5GCNA 2QJ8A 4KLWA 4UCPA 4UF4A 4ZY2A 2PRQA 5AG5A 1F2OA 1LCPA 3JVNA 2PVVA 3DSBA 2FVGA 4HPSA 5IV0A 5LRKA 2PQ8A 5JPHA 3TC8A 2GLJA 5LYFA 4II9A 2J9AA 2ZW4A 5CPAA 3PB6X 2J8RA 3H8GA 2BO9A 2PJ9A 4MFKA 4CGPA 2V8DA 4FBEA 5F09A 2B5GB 2Z0ZA 4CYQA 1Z5RA 2BCOA 2EK9A 2CNSA 2Q4VA 4UWIA 1IIDA 3RNZA 1BAVA 1DE4C 2XEGA 4Y49B 4QVTA 2DXQA 4TNUA 5G22A 1Q7LA 1TIQA 4PQAA 2CTBA 2Q51A 1KUYA 2WSAA 5J1QA 4NCZA 4MY0A 1JQGA 3KI9A 4RN7A 1QSOA 4OIWA 4C7IA 2ZEMA 1IB1E 3K2KA 1VKCA 3LMSA 4MCRA 4CAXA 4BINA 3CDXA 3DNSA 3P2FA 4CYOA 1OBRA 1BO4A 4BMHA 2C6PA 2JDCA 2Q43A 4KOVA 2FE7A 4KOWA 2PJBA 1WWZA 2BEIA 4ZX9A 3RBUA 3T90A 1XRYA 4RI1A 4ZY0A 3D7HA 2X7BA 3RO0A 2AFUA 1QMUA 2YNEA 2QVPA 3TOBA 2XEIA 4MCQA 4LUAA 4HNWB 2C6GA 2VQYA 5DWMA 1IYKA 2VL1A 4CRYB 2PSWA 2V8HA 4YGOA 1Z8TA 2I00A 2CNTA 1YSJA 4E2AA 5EC4A 2OH1A 2QMLA 3SXOA 4C2ZA 4MHYA 3JRUA 2AE6A 2VI7A 4QB9A 2FS5A 3I9SA 4G1PA 2GFQA 4MXUA 2PE3A 3T9YA 4LQ6A 4CAFA 2ZW7A 1Q2CA 4EWTA 1ARLA 2ATRA 1GYTA 1RTQA 2PJ2A 3H8FA 4C2XA 4NEXA 1KUXA 2HB6A 2A4NA 3LWUA 4L8AA 3BI0A 4YRHA 2J8MA 2Z10A 4R7MA 1IOIA 1IGBA 2O53A 2Z3OA 4MFPA 4NGRA 3NE8A 3OWCA 4MFQA 1ELLP 2P0WA 4GXHA 4ORFA 3S6GA 1Y9WA 2JDDA 2FIAA 4X8IA 3TE4A 5JQ4A 1QSTA 2GLFA 1ZO0A 1S5KA 3QNVA 1EE3P 1XF8A 2VXKA 3PRTA 3IO1A 3D2MA 3JUWA 2QYVA 2RC4A 1CBXA 1VHEA 3KR4A 3KQXA 3WT4A 3EY5A 5K8OA 3D4UA 3IJ3A 3R1KA 1RXTA 2R1IA 2FSRA 3ISZA 4KS9A 2WZNA 4ZGYB 1CM0A 4PXEA 1Z8XA 1A2ZA 1Z4EA 4PPZA 5JM6A 2POKA 4R87A 4YWYA 3CXSA 2AFZA 3KGQA 5AG6A 2Q7SA 2R98A 3GY9A 4OC1A 3F8KA 3SJXA 2ZEDA 5HH1A 3ZJ0A 5HMNA 2NYQA 2Q4ZA 3PFOA 5KTAA 4A32A 3S6HA 3TO6A 2GU2A 5KTDA 3V7ZA 1NMTA 3B3VA 4UCNA 4WWVA 4UIAA 3SHPA 4B12A 5BWAB 4J3GA 2B3VA 4KLVA 1PYTB 1ARMA 4KOYA 3FBUA 5AG7A 1M1DA 3K9TA 3PB7X 4A95A 3JTKA 1S60A 3SJGA 3CXPA 1Y7EA 5DWNA 1MJBA 4X2TA 2IMOA 4M3SA 4MHPA 4B6ZA 1NE9A 1S7NA 3MN8A 4A37A 4R57A 1ELMP 2ZW5A 2ZXVA 2B5GA 2G3AA 3D7DA 3BLNA 5CBMA 1CJWA 1I12A 2Z3PA 3R9GA 3CXQA 3FMCA 2QECA 2PJ3A 2B4BA 1M44A 5IB0A 2REEA 4FD5A 2PJ6A 4XPDB 3S9MA 1HDQA 1S7FA 4OKOA 3B3WA 4MHDA 4KVME 4AB7A 1Z8LA 4U9YA 3CPXA 3DR8A 4CAEA 1FNOA 4ZI6A 2PR1A 1J4JA 2EK8A 4Z65A 5G20A 1YVOA 1MK4A 1CPXA 4IK2A 4KZTA 4AXVA 3I3GA 4JD6A 3CZXA 4JWPA 4P4DA 3FVLA 3H8EA 4CAVA 2AFOA 1Q2DA 2V77A 4NXYA 3PGPA 1IYLA 1IU8A 1R57A 4KVOE 4Y49C 3RYOA 2PJ5A 3IFEA 2ANPA 4NGMA 3B3SA 4HNYB 4NGSA 4FD6A 2REFA 2OZUA 2Z3MA 1Y7RA 3NA6A 4K3NA 3LD2A 4BD9A 5HXDA 3EXNA 2EVNA 4OLLA 4P4FA 5FVJA 2PJ8A 2JEVA 4QC6A 3IGRA 3WR7A 4C2YA 4R3KA 2FCKA 1TXRA 2EO8A 2ZOFA 4FD7A 2Q44A 2NMTA 3F0AA 4JXRA 4ONWA 5D8NA 4E8OA 4UEFA 3FNCA 2DPTA 2GANA 2JEWA 3FXTA 5LYLA 4KUBA 2YGWA 4U9ZA 5THWA 3SJFA 2CXAA 2ZENA 1I1DA 1AYEA 1SQHA 2Z3NA 3D7FA 3R9EA 5A28A 5C88A 4Q7AA 5F47A 4UWJA 3FH4A 4CGMA 1Y0RA 1XMTA 4FUUA 2OZHA 4KSAA 4CGNA 1LOKA 2GREA 2F7VA 4P4EA 2BSWA 2Q4YA 3B35A 3VATA 4UBRA 3VH9A 1AMPA 2O28A 3FYNA 4L89A 3FEEA 4CRZB 3V8IA 4OC5A 3HUVA 1F2PA 1M4IA 1S7LA 1YMEA 4CPAA 2ZW6A 5EMIA 3FJUA 5KTCA 1R3NA 3QAHA 2XEFA 2Q0YA 4PSWA 5HVFA 2EWBA 4LQGA 4B5PB 5IX3A 3D66A 4MJ8A 2ZPAA 1TKHA 1Z2LA 4W9YA 1NSLA 2PCUA 1M4DA 3H5ZA 3PB9X 5G1ZA 3BJ7A 3TT2A 2VEZA 1YQEA 4H6UA 1X10A 3PBBA 4HNXB 4MRIA 4B10A 2PJ1A 2AJ6A 4AVAA 1IY7A 3BXMA 2PJCA 4PK3A 1YW6A 2P6EA 2K5TA 2PDOA 1S7KA 1WK4A 4M6HA 1YVKA 2PJ0A 4KOTA 5EBVA 4AVCA 4MFLA 4NFRA 2F5IA 1Z9UA 3FRMA 4P6YA 2R7HA 3EC4A 2DF5A 3QB8A 4H6ZA 4F6AA 2PR8A 2R8VA 2G9DA 4MHNA 4QBJA 2Z11A 3P2HA 4RS2A 4B5OA 2EUIA 3RAMA 4NJQA 4ONUA 1IOFA 2WPWA 3DR6A 2B4DB 4JYWA 5ELYA 1LAMA 3QAYA 1XIXA 2ODFA 1BOBA 1ON0A 1XE4A 5AGEA 4F9VA 4X3RA 4GM5A 4OP4A 3LACA 4XNHB 4MCPA 2PVWA 1KZFA 1PCAA 1CP6A 4FD4A 3IEHA 3SI2A 2I3CA 2FT0A 3L2NA 2O4HA 2WYRA 1KUVA 4CYNA 1LRZA 3VWDA 4KSFA 1XFOA 4P4IA 2OZGA 3D2PA 1YW4A 4OIDA 1P4NA 4EMEA 4GS4A 2C1CA 1FY7A 2Y0MA 1ZG7A 3PZJA 3MGDA 3PEIA 1BPNA 4MBUA 3WC7A 2D4OA 1V0CA 3S9NA 4XPDC 5E96A 2JBJA 4OAEA 3W6XA 2YNCA 4F9UA 3S9LA 2YNDA 2ZELA 2BOAA 1MJAA 3TOAA 3IIBA 2BUEA 4KOSA 4NJRA 4UFXA 1M4GA 3SXNA 4JJXA 3KHXA 3E0KA 2I79A 3KZWA 1LANA 4WJBA 2D4PA 2EBJA 3CPAA 1YLEA 2PJ7A 2Z3LA 3G3SA 3HLPA 4K30A 4TWEA 5J8FA 4MY3A 5DS0A 1XJOA 3PBEA 4R8FA 3VWEA 4U5YA 2V8GA 3GLJA 5LYIA 4B11A 2NSMA 3D67A 1VGYA 1QSRA 4OADA 3NH4A 2V8VA 4PXCA 2CTCA 5K8MA 3FX6A 6CPAA 1HEEA 2P6GA 1I21A 2YNCC 3CT9A 2B3UA 5F46A 4P45A 3BJ8A 1KWMA 4H2KA 4MFJA 1B6BA 2IL4A 4FWUA 4P4JA 3KR5A 3R95A 1R43A 1TKJA 3FF3A 4MFZA 7CPAA 3PFEA 3W91A 1XOVA 5ISVA 4R6TA 3FIXA 2GIVA
chains in the Genus database with same CATH topology
4B13A 3R9FA 1YR0A 1N71A 1P0HA 2G3TA 3EFAA 4B5OA 3B8GA 4R3LA 1Q2YA 2FIWA 2FXFA 4UFVA 3TTHA 4B5PA 1UFHA 4AG7A 5H86A 4IF5A 3C26A 1RO5A 4M85A 3TO9A 1YX0A 3D8PA 3FB3A 5F48A 2QIRA 4UA3A 2ARHA 2P6FA 4H89A 4X5KA 1YGHA 4PSXA 1MJ9A 4I49A 1PU9A 2VZZA 3D3SA 5J8CA 2C27A 2B4DA 3IWEA 4KOXA 4NF1A 3R96A 4DNCA 3S6KA 4EVYA 2HQYA 3IWGA 4UFWA 3NE7A 4NSQA 4AVBA 1QSNA 2Z3KA 2JLMA 3IU1A 5G21A 4HKFA 3LODA 4ZBGA 1QSMA 3PP9A 3H4QA 4LX9A 2OU2A 4F0XA 5C82A 3A9LA 4JLYA 3TFYA 4C7HA 1PUAA 2H5MA 2WUUA 4B14A 4XPLA 4KOUA 3EO4A 1IICA 3UY5A 4PV6A 4QUSA 4XNHC 2FL4A 4CS0B 1S3ZA 4KORA 5I0CA 4R9MA 4PK2A 3IU2A 3G8WA 4YFJA 3GKRA 3KKWA 1B87A 2VBQA 3W6SA 2Q04A 3DDDA 4CGLA 4CYPA 5F49A 3K9UA 1Z4RA 1XEBA 2VZYA 4KUAA 2HV2A 4KVXA 4JXQA 2GE3A 2CNMA 2DPSA 4UCMA 1YK3A 4IUSA 3N7ZA 4Q38A 3S6FA 5A27A 4AG9A 1U6MA 5CNPA 5AG4A 1OZPA 4CAWA 2KCWA 2Q7BA 2WPXA 2B58A 1K4JA 2BL1A 2HUZA 2G0BA 2PRBA 4Q36A 1Y9KA 1YREA 3GYAA 4A30A 4F0YA 4A31A 3ZZIA 4C68A 2CY2A 4MI4A 4CGOA 1L0CA 5H84A 4E0AA 2J8NA 4A33A 2PC1A 3TCVA 1VHSA 1GHEA 2OB0A 3TO7A 4XPKA 4A2ZA 3F5BA 4BBHA 5GCNA 4KLWA 4UCPA 5AG5A 3JVNA 3DSBA 5IV0A 2PQ8A 5JPHA 4II9A 2ZW4A 2J8RA 4MFKA 4CGPA 2B5GB 2Z0ZA 4CYQA 2CNSA 2Q4VA 4UWIA 1IIDA 4Y49B 4QVTA 2DXQA 5G22A 1TIQA 1KUYA 2WSAA 4NCZA 4MY0A 1QSOA 4C7IA 1IB1E 1VKCA 4CAXA 3DNSA 3P2FA 4CYOA 1BO4A 4BMHA 2JDCA 4KOVA 2FE7A 4KOWA 1WWZA 2BEIA 3T90A 4RI1A 2X7BA 2YNEA 3TOBA 4LUAA 4HNWB 2VQYA 5DWMA 1IYKA 4CRYB 2PSWA 4YGOA 2I00A 2CNTA 4E2AA 5EC4A 2OH1A 2QMLA 3SXOA 4C2ZA 2AE6A 2VI7A 4QB9A 2FS5A 3I9SA 3T9YA 4CAFA 2ZW7A 1Q2CA 2ATRA 4C2XA 4NEXA 1KUXA 4L8AA 2A4NA 4YRHA 2J8MA 2Z10A 4MFPA 2Z3OA 3S6GA 3OWCA 4MFQA 2P0WA 4ORFA 1Y9WA 2JDDA 2FIAA 3TE4A 5JQ4A 1QSTA 1ZO0A 1S5KA 1XF8A 2VXKA 3D2MA 3JUWA 2RC4A 3EY5A 3R1KA 1RXTA 2R1IA 2FSRA 4ZGYB 4KS9A 1CM0A 1Z4EA 4R87A 3CXSA 5AG6A 2R98A 3GY9A 3F8KA 5HH1A 3ZJ0A 5HMNA 5KTAA 4A32A 3S6HA 3TO6A 5KTDA 1NMTA 4UCNA 3SHPA 4B12A 5BWAB 4J3GA 2B3VA 4KLVA 4KOYA 3FBUA 5AG7A 1M1DA 4A95A 3JTKA 1S60A 3CXPA 5DWNA 1MJBA 4M3SA 1NE9A 1S7NA 4R57A 2ZW5A 2ZXVA 2B5GA 2G3AA 3BLNA 1CJWA 1I12A 2Z3PA 3R9GA 3CXQA 2QECA 2B4BA 1M44A 5IB0A 2REEA 4FD5A 4XPDB 1S7FA 4MHDA 4AB7A 4KVME 4U9YA 3DR8A 4CAEA 2PR1A 1J4JA 5G20A 1YVOA 1MK4A 4KZTA 3I3GA 4JD6A 4JWPA 4CAVA 1Q2DA 4NXYA 3PGPA 1IYLA 1R57A 4KVOE 4Y49C 3RYOA 4HNYB 4FD6A 2REFA 2OZUA 2Z3MA 1Y7RA 3LD2A 3EXNA 2EVNA 4OLLA 5FVJA 2JEVA 4QC6A 3IGRA 3WR7A 4C2YA 4R3KA 2FCKA 4FD7A 2Q44A 2NMTA 3F0AA 4JXRA 4E8OA 3FNCA 2DPTA 2GANA 3FXTA 4KUBA 2YGWA 4U9ZA 2CXAA 1I1DA 3R9EA 1SQHA 2Z3NA 5A28A 5C88A 5F47A 4UWJA 4CGMA 1XMTA 4KSAA 2OZHA 4CGNA 2BSWA 2Q4YA 4UBRA 2O28A 3FYNA 4L89A 4CRZB 3V8IA 1M4IA 1S7LA 2ZW6A 5KTCA 3QAHA 2Q0YA 4PSWA 4B5PB 5IX3A 4MJ8A 2ZPAA 1NSLA 1M4DA 3H5ZA 5G1ZA 3BJ7A 3TT2A 2VEZA 4H6UA 4HNXB 4B10A 2AJ6A 4AVAA 4PK3A 2P6EA 2K5TA 2PDOA 1S7KA 1WK4A 5EBVA 1YVKA 4KOTA 4AVCA 4MFLA 2F5IA 1Z9UA 3FRMA 2R7HA 3EC4A 3QB8A 4H6ZA 4F6AA 2PR8A 2R8VA 4QBJA 2Z11A 3P2HA 4RS2A 2EUIA 4ONUA 2WPWA 3DR6A 2B4DB 1XIXA 1BOBA 1ON0A 1XE4A 5AGEA 4XNHB 1KZFA 4FD4A 2FT0A 4CYNA 1KUVA 1LRZA 3VWDA 4KSFA 2OZGA 3D2PA 1P4NA 4GS4A 2Y0MA 3PZJA 3MGDA 4MBUA 2D4OA 1V0CA 4XPDC 5E96A 4OAEA 3W6XA 2YNCA 2YNDA 1MJAA 3TOAA 2BUEA 4KOSA 4UFXA 1M4GA 3SXNA 4JJXA 3E0KA 2I79A 2D4PA 1YLEA 2Z3LA 3G3SA 4K30A 5J8FA 4MY3A 3VWEA 4U5YA 4B11A 1QSRA 4OADA 2P6GA 1I21A 2YNCC 2B3UA 5F46A 3BJ8A 4MFJA 1B6BA 2IL4A 3R95A 4MFZA 3W91A 1FY7A 5ISVA 3FIXA 2GIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9F A;  1YR0 A;  1N71 A;  1P0H A;  2G3T A;  3EFA A;  4B5O A;  3B8G A;  4R3L A;  1Q2Y A;  2FIW A;  2FXF A;  3TTH A;  4B5P A;  1UFH A;  4AG7 A;  5H86 A;  4IF5 A;  3C26 A;  1RO5 A;  4M85 A;  3TO9 A;  1YX0 A;  3D8P A;  3FB3 A;  5F48 A;  2QIR A;  4UA3 A;  2ARH A;  2P6F A;  4H89 A;  4X5K A;  1YGH A;  4PSX A;  1MJ9 A;  4I49 A;  1PU9 A;  2VZZ A;  3D3S A;  5J8C A;  2C27 A;  2B4D A;  4KOX A;  4NF1 A;  3R96 A;  4DNC A;  3S6K A;  4EVY A;  2HQY A;  3IWG A;  3NE7 A;  4NSQ A;  4AVB A;  1QSN A;  2JLM A;  4HKF A;  3LOD A;  4ZBG A;  1QSM A;  3PP9 A;  3H4Q A;  4LX9 A;  2OU2 A;  5C82 A;  4JLY A;  3TFY A;  1PUA A;  2H5M A;  4XPL A;  4KOU A;  3EO4 A;  1IIC A;  3UY5 A;  4PV6 A;  4QUS A;  4XNH C;  2FL4 A;  4CS0 B;  1S3Z A;  4KOR A;  5I0C A;  4R9M A;  4PK2 A;  3G8W A;  4YFJ A;  3GKR A;  3KKW A;  1B87 A;  2VBQ A;  3W6S A;  2Q04 A;  3DDD A;  5F49 A;  3K9U A;  1Z4R A;  1XEB A;  2VZY A;  4KUA A;  2HV2 A;  4KVX A;  4JXQ A;  2GE3 A;  2CNM A;  1YK3 A;  4IUS A;  3N7Z A;  3S6F A;  4AG9 A;  1U6M A;  5CNP A;  1OZP A;  4CAW A;  2KCW A;  2Q7B A;  2WPX A;  2B58 A;  1K4J A;  2BL1 A;  2HUZ A;  2G0B A;  2PRB A;  1Y9K A;  1YRE A;  3GYA A;  4F0Y A;  3ZZI A;  2CY2 A;  4MI4 A;  1L0C A;  5H84 A;  4E0A A;  2J8N A;  2PC1 A;  3TCV A;  1VHS A;  1GHE A;  2OB0 A;  3TO7 A;  4XPK A;  3F5B A;  5GCN A;  4KLW A;  3JVN A;  3DSB A;  5IV0 A;  2PQ8 A;  5JPH A;  4II9 A;  2ZW4 A;  2J8R A;  2B5G B;  2Z0Z A;  2CNS A;  2Q4V A;  4UWI A;  1IID A;  4Y49 B;  4QVT A;  2DXQ A;  1TIQ A;  1KUY A;  4NCZ A;  4MY0 A;  1QSO A;  1IB1 E;  1VKC A;  4CAX A;  3DNS A;  3P2F A;  1BO4 A;  4BMH A;  2JDC A;  4KOV A;  2FE7 A;  4KOW A;  1WWZ A;  2BEI A;  3T90 A;  4RI1 A;  2X7B A;  3TOB A;  4LUA A;  4HNW B;  2VQY A;  5DWM A;  1IYK A;  4CRY B;  2PSW A;  4YGO A;  2I00 A;  2CNT A;  4E2A A;  5EC4 A;  2OH1 A;  2QML A;  3SXO A;  2AE6 A;  2VI7 A;  4QB9 A;  2FS5 A;  3I9S A;  3T9Y A;  2ZW7 A;  1Q2C A;  2ATR A;  4NEX A;  1KUX A;  4L8A A;  2A4N A;  4YRH A;  2J8M A;  2Z10 A;  3S6G A;  3OWC A;  2P0W A;  4ORF A;  1Y9W A;  2JDD A;  2FIA A;  3TE4 A;  5JQ4 A;  1QST A;  1S5K A;  1XF8 A;  2VXK A;  3D2M A;  3JUW A;  2RC4 A;  3EY5 A;  3R1K A;  1RXT A;  2R1I A;  2FSR A;  1CM0 A;  1Z4E A;  4R87 A;  3CXS A;  2R98 A;  3GY9 A;  3F8K A;  5HH1 A;  3ZJ0 A;  5HMN A;  5KTA A;  3S6H A;  3TO6 A;  5KTD A;  1NMT A;  3SHP A;  4J3G A;  2B3V A;  4KLV A;  4KOY A;  3FBU A;  1M1D A;  1S60 A;  3CXP A;  5DWN A;  1MJB A;  4M3S A;  1NE9 A;  1S7N A;  4R57 A;  2ZW5 A;  2ZXV A;  2B5G A;  2G3A A;  3BLN A;  1CJW A;  1I12 A;  3R9G A;  3CXQ A;  2QEC A;  2B4B A;  1M44 A;  5IB0 A;  2REE A;  4FD5 A;  4XPD B;  1S7F A;  4MHD A;  4AB7 A;  4KVM E;  4U9Y A;  3DR8 A;  2PR1 A;  1J4J A;  1YVO A;  1MK4 A;  4KZT A;  3I3G A;  4JD6 A;  4JWP A;  4CAV A;  1Q2D A;  4NXY A;  3PGP A;  1IYL A;  1R57 A;  4KVO E;  4Y49 C;  3RYO A;  4HNY B;  4FD6 A;  2REF A;  2OZU A;  1Y7R A;  3LD2 A;  3EXN A;  2EVN A;  4OLL A;  5FVJ A;  2JEV A;  4QC6 A;  3IGR A;  3WR7 A;  4R3K A;  2FCK A;  4FD7 A;  2Q44 A;  2NMT A;  3F0A A;  4JXR A;  4E8O A;  3FNC A;  2GAN A;  3FXT A;  4KUB A;  4U9Z A;  1I1D A;  3R9E A;  1SQH A;  5C88 A;  5F47 A;  4UWJ A;  1XMT A;  2OZH A;  2BSW A;  2Q4Y A;  4UBR A;  2O28 A;  3FYN A;  4L89 A;  4CRZ B;  3V8I A;  1M4I A;  1S7L A;  2ZW6 A;  5KTC A;  3QAH A;  2Q0Y A;  4PSW A;  4B5P B;  5IX3 A;  4MJ8 A;  2ZPA A;  1NSL A;  1M4D A;  3BJ7 A;  3TT2 A;  2VEZ A;  4H6U A;  4HNX B;  2AJ6 A;  4AVA A;  4PK3 A;  2P6E A;  2K5T A;  2PDO A;  1S7K A;  1WK4 A;  5EBV A;  1YVK A;  4KOT A;  4AVC A;  2F5I A;  1Z9U A;  3FRM A;  2R7H A;  3EC4 A;  3QB8 A;  4H6Z A;  4F6A A;  2PR8 A;  2R8V A;  4QBJ A;  2Z11 A;  3P2H A;  4RS2 A;  2EUI A;  4ONU A;  2WPW A;  3DR6 A;  2B4D B;  1XIX A;  1BOB A;  1ON0 A;  1XE4 A;  4XNH B;  1KZF A;  4FD4 A;  2FT0 A;  1KUV A;  1LRZ A;  3VWD A;  2OZG A;  3D2P A;  1P4N A;  4GS4 A;  2Y0M A;  3PZJ A;  3MGD A;  4MBU A;  2D4O A;  1V0C A;  4XPD C;  5E96 A;  4OAE A;  3W6X A;  1MJA A;  3TOA A;  2BUE A;  4KOS A;  1M4G A;  3SXN A;  4JJX A;  3E0K A;  2I79 A;  2D4P A;  1YLE A;  3G3S A;  4K30 A;  5J8F A;  4MY3 A;  3VWE A;  4U5Y A;  1QSR A;  4OAD A;  2P6G A;  1I21 A;  2B3U A;  5F46 A;  3BJ8 A;  1B6B A;  2IL4 A;  3R95 A;  3W91 A;  1FY7 A;  5ISV A;  3FIX A;  2GIV A; 
#chains in the Genus database with same CATH topology
 4B13 A;  2IJZ A;  1YR0 A;  3I1U A;  3R9F A;  1N71 A;  1P0H A;  2G3T A;  1NSA A;  3D68 A;  3EFA A;  3B8G A;  4R3L A;  4MCS A;  1Q2Y A;  2FIW A;  2FXF A;  2AFS A;  4UFV A;  4OC0 A;  5LRJ A;  3TTH A;  4RUH A;  2C6C A;  4B5P A;  1UFH A;  1XBU A;  2ZEF A;  5H86 A;  4IF5 A;  4AG7 A;  3C26 A;  1CP7 A;  3FED A;  5K8P A;  1RO5 A;  3BI1 A;  3FEC A;  4M85 A;  3TO9 A;  4M6G A;  5LRG A;  1Z8W A;  1YX0 A;  3BHX A;  3D8P A;  3FB3 A;  5F48 A;  2QIR A;  4UA3 A;  2ARH A;  2P6F A;  2ZEE A;  4H89 A;  4X5K A;  3IC1 A;  1YGH A;  4PSX A;  4IAV A;  1MJ9 A;  3SJE A;  1H8L A;  3V38 A;  4I49 A;  2IQ6 A;  1PU9 A;  4NGP A;  3NH5 A;  2VZZ A;  4YU9 A;  3D3S A;  5J8C A;  2C27 A;  2B4D A;  3IWE A;  1XMB A;  4IHM A;  4KOX A;  4KSI A;  4NF1 A;  5LYD A;  3R96 A;  3B2Y A;  5HVH A;  2CIJ A;  2CF4 A;  3S6K A;  4DNC A;  4EVY A;  2HQY A;  5HVG A;  1FT7 A;  3IWG A;  4UFW A;  4A94 A;  4A39 A;  1CPS A;  2ZOG A;  3NE7 A;  1TKF A;  3DGV A;  4O23 A;  4NSQ A;  4AVB A;  1QSN A;  1ZG9 A;  2JLM A;  2RB7 A;  2Z3K A;  1LFW A;  3IU1 A;  1X12 A;  5G21 A;  4HKF A;  1Y0Y A;  1TF8 A;  3LOD A;  5K8N A;  1M4L A;  4ZBG A;  4FAI A;  1QSM A;  5JGF A;  1VHO A;  3PP9 A;  3GB0 A;  3VAR A;  2ZEG A;  3H4Q A;  1ZG8 A;  4LX9 A;  2OU2 A;  4F0X A;  4P10 A;  3WAB A;  3B7I A;  4OME A;  5C82 A;  5IB9 A;  1F57 A;  1TF9 A;  1VIX A;  3A9L A;  1LAP A;  4JLY A;  3TFY A;  4ZX8 A;  4C7H A;  1PUA A;  2H5M A;  2WUU A;  4JZ0 A;  1JWQ A;  4B14 A;  8CPA A;  4XPL A;  4KOU A;  2HC9 A;  3EO4 A;  1IIC A;  3UY5 A;  2AFM A;  3KHZ A;  4PV6 A;  1YLO A;  4QUS A;  4XNH C;  2FL4 A;  2PIY A;  4CS0 B;  3PB8 X;  1S3Z A;  4KOR A;  2RFH A;  3TX8 A;  4MMO A;  1ZLI A;  3N5F A;  4P44 A;  5I0C A;  4R9M A;  4PK2 A;  2PJ4 A;  3IU2 A;  3G8W A;  4UEZ A;  4YFJ A;  2DEA A;  3GKR A;  3KKW A;  4PXD A;  1B87 A;  3SI0 A;  4P4B A;  2VBQ A;  3W6S A;  2Q04 A;  3DDD A;  3IWW A;  4CGL A;  3KL9 A;  1UWY A;  4CYP A;  5F49 A;  3K9U A;  4DYO A;  1Z4R A;  4UEE A;  1XEB A;  4PXB A;  4ZY1 A;  2VZY A;  4KUA A;  2HV2 A;  4MHZ A;  5D29 A;  4KVX A;  4OC4 A;  1ZLH A;  2ZEO A;  2PJA A;  1CX8 A;  4JXQ A;  3B3T A;  1DTD A;  2ABZ A;  2CNM A;  2GE3 A;  4F8Z A;  2DPS A;  4M6I A;  4UCM A;  3T8W A;  1YK3 A;  4IUS A;  2AFW A;  1BLL E;  3N7Z A;  4Q38 A;  4A38 A;  3S6F A;  3NFZ A;  5A27 A;  2OR4 A;  2ZEP A;  4OC2 A;  4AG9 A;  1U6M A;  3RZA A;  4NGQ A;  5CNP A;  5AG4 A;  1OZP A;  2XEJ A;  3WC5 A;  4CAW A;  2KCW A;  2Q7B A;  4ZYQ A;  2WPX A;  2B58 A;  1K4J A;  3B3C A;  3SI1 A;  2BL1 A;  2F8H A;  3PB4 X;  1QQ9 A;  2HUZ A;  2G0B A;  5JH9 A;  2AFX A;  2PRB A;  3DLJ A;  4UIB A;  1BPM A;  4Q36 A;  4EFD A;  1Y9K A;  1YRE A;  2ZEH A;  3GYA A;  4A30 A;  3KQZ A;  4F0Y A;  3KAS A;  2OOT A;  1HDU A;  4A31 A;  3ZZI A;  4R76 A;  4DUK A;  4C68 A;  4OC3 A;  2CY2 A;  3D7G A;  4MI4 A;  4CGO A;  1L0C A;  2JBK A;  3ISX A;  3NH8 A;  4NGN A;  5H84 A;  4E0A A;  3GUX A;  2J8N A;  1AUG A;  4A33 A;  2PC1 A;  1CG2 A;  3TCV A;  1VHS A;  1GHE A;  5I4M A;  2OB0 A;  4DJL A;  3TO7 A;  4XPK A;  3GIU A;  4A2Z A;  4NGT A;  3F5B A;  2PIZ A;  3WC6 A;  3MRU A;  4BBH A;  5GCN A;  2QJ8 A;  4KLW A;  4UCP A;  4UF4 A;  4ZY2 A;  2PRQ A;  5AG5 A;  1F2O A;  1LCP A;  3JVN A;  2PVV A;  3DSB A;  2FVG A;  4HPS A;  5IV0 A;  5LRK A;  2PQ8 A;  5JPH A;  3TC8 A;  2GLJ A;  5LYF A;  4II9 A;  2J9A A;  2ZW4 A;  5CPA A;  3PB6 X;  2J8R A;  3H8G A;  2BO9 A;  2PJ9 A;  4MFK A;  4CGP A;  2V8D A;  4FBE A;  5F09 A;  2B5G B;  2Z0Z A;  4CYQ A;  1Z5R A;  2BCO A;  2EK9 A;  2CNS A;  2Q4V A;  4UWI A;  1IID A;  3RNZ A;  1BAV A;  1DE4 C;  2XEG A;  4Y49 B;  4QVT A;  2DXQ A;  4TNU A;  5G22 A;  1Q7L A;  1TIQ A;  4PQA A;  2CTB A;  2Q51 A;  1KUY A;  2WSA A;  5J1Q A;  4NCZ A;  4MY0 A;  1JQG A;  3KI9 A;  4RN7 A;  1QSO A;  4OIW A;  4C7I A;  2ZEM A;  1IB1 E;  3K2K A;  1VKC A;  3LMS A;  4MCR A;  4CAX A;  4BIN A;  3CDX A;  3DNS A;  3P2F A;  4CYO A;  1OBR A;  1BO4 A;  4BMH A;  2C6P A;  2JDC A;  2Q43 A;  4KOV A;  2FE7 A;  4KOW A;  2PJB A;  1WWZ A;  2BEI A;  4ZX9 A;  3RBU A;  3T90 A;  1XRY A;  4RI1 A;  4ZY0 A;  3D7H A;  2X7B A;  3RO0 A;  2AFU A;  1QMU A;  2YNE A;  2QVP A;  3TOB A;  2XEI A;  4MCQ A;  4LUA A;  4HNW B;  2C6G A;  2VQY A;  5DWM A;  1IYK A;  2VL1 A;  4CRY B;  2PSW A;  2V8H A;  4YGO A;  1Z8T A;  2I00 A;  2CNT A;  1YSJ A;  4E2A A;  5EC4 A;  2OH1 A;  2QML A;  3SXO A;  4C2Z A;  4MHY A;  3JRU A;  2AE6 A;  2VI7 A;  4QB9 A;  2FS5 A;  3I9S A;  4G1P A;  2GFQ A;  4MXU A;  2PE3 A;  3T9Y A;  4LQ6 A;  4CAF A;  2ZW7 A;  1Q2C A;  4EWT A;  1ARL A;  2ATR A;  1GYT A;  1RTQ A;  2PJ2 A;  3H8F A;  4C2X A;  4NEX A;  1KUX A;  2HB6 A;  2A4N A;  3LWU A;  4L8A A;  3BI0 A;  4YRH A;  2J8M A;  2Z10 A;  4R7M A;  1IOI A;  1IGB A;  2O53 A;  2Z3O A;  4MFP A;  4NGR A;  3NE8 A;  3OWC A;  4MFQ A;  1ELL P;  2P0W A;  4GXH A;  4ORF A;  3S6G A;  1Y9W A;  2JDD A;  2FIA A;  4X8I A;  3TE4 A;  5JQ4 A;  1QST A;  2GLF A;  1ZO0 A;  1S5K A;  3QNV A;  1EE3 P;  1XF8 A;  2VXK A;  3PRT A;  3IO1 A;  3D2M A;  3JUW A;  2QYV A;  2RC4 A;  1CBX A;  1VHE A;  3KR4 A;  3KQX A;  3WT4 A;  3EY5 A;  5K8O A;  3D4U A;  3IJ3 A;  3R1K A;  1RXT A;  2R1I A;  2FSR A;  3ISZ A;  4KS9 A;  2WZN A;  4ZGY B;  1CM0 A;  4PXE A;  1Z8X A;  1A2Z A;  1Z4E A;  4PPZ A;  5JM6 A;  2POK A;  4R87 A;  4YWY A;  3CXS A;  2AFZ A;  3KGQ A;  5AG6 A;  2Q7S A;  2R98 A;  3GY9 A;  4OC1 A;  3F8K A;  3SJX A;  2ZED A;  5HH1 A;  3ZJ0 A;  5HMN A;  2NYQ A;  2Q4Z A;  3PFO A;  5KTA A;  4A32 A;  3S6H A;  3TO6 A;  2GU2 A;  5KTD A;  3V7Z A;  1NMT A;  3B3V A;  4UCN A;  4WWV A;  4UIA A;  3SHP A;  4B12 A;  5BWA B;  4J3G A;  2B3V A;  4KLV A;  1PYT B;  1ARM A;  4KOY A;  3FBU A;  5AG7 A;  1M1D A;  3K9T A;  3PB7 X;  4A95 A;  3JTK A;  1S60 A;  3SJG A;  3CXP A;  1Y7E A;  5DWN A;  1MJB A;  4X2T A;  2IMO A;  4M3S A;  4MHP A;  4B6Z A;  1NE9 A;  1S7N A;  3MN8 A;  4A37 A;  4R57 A;  1ELM P;  2ZW5 A;  2ZXV A;  2B5G A;  2G3A A;  3D7D A;  3BLN A;  5CBM A;  1CJW A;  1I12 A;  2Z3P A;  3R9G A;  3CXQ A;  3FMC A;  2QEC A;  2PJ3 A;  2B4B A;  1M44 A;  5IB0 A;  2REE A;  4FD5 A;  2PJ6 A;  4XPD B;  3S9M A;  1HDQ A;  1S7F A;  4OKO A;  3B3W A;  4MHD A;  4KVM E;  4AB7 A;  1Z8L A;  4U9Y A;  3CPX A;  3DR8 A;  4CAE A;  1FNO A;  4ZI6 A;  2PR1 A;  1J4J A;  2EK8 A;  4Z65 A;  5G20 A;  1YVO A;  1MK4 A;  1CPX A;  4IK2 A;  4KZT A;  4AXV A;  3I3G A;  4JD6 A;  3CZX A;  4JWP A;  4P4D A;  3FVL A;  3H8E A;  4CAV A;  2AFO A;  1Q2D A;  2V77 A;  4NXY A;  3PGP A;  1IYL A;  1IU8 A;  1R57 A;  4KVO E;  4Y49 C;  3RYO A;  2PJ5 A;  3IFE A;  2ANP A;  4NGM A;  3B3S A;  4HNY B;  4NGS A;  4FD6 A;  2REF A;  2OZU A;  2Z3M A;  1Y7R A;  3NA6 A;  4K3N A;  3LD2 A;  4BD9 A;  5HXD A;  3EXN A;  2EVN A;  4OLL A;  4P4F A;  5FVJ A;  2PJ8 A;  2JEV A;  4QC6 A;  3IGR A;  3WR7 A;  4C2Y A;  4R3K A;  2FCK A;  1TXR A;  2EO8 A;  2ZOF A;  4FD7 A;  2Q44 A;  2NMT A;  3F0A A;  4JXR A;  4ONW A;  5D8N A;  4E8O A;  4UEF A;  3FNC A;  2DPT A;  2GAN A;  2JEW A;  3FXT A;  5LYL A;  4KUB A;  2YGW A;  4U9Z A;  5THW A;  3SJF A;  2CXA A;  2ZEN A;  1I1D A;  1AYE A;  1SQH A;  2Z3N A;  3D7F A;  3R9E A;  5A28 A;  5C88 A;  4Q7A A;  5F47 A;  4UWJ A;  3FH4 A;  4CGM A;  1Y0R A;  1XMT A;  4FUU A;  2OZH A;  4KSA A;  4CGN A;  1LOK A;  2GRE A;  2F7V A;  4P4E A;  2BSW A;  2Q4Y A;  3B35 A;  3VAT A;  4UBR A;  3VH9 A;  1AMP A;  2O28 A;  3FYN A;  4L89 A;  3FEE A;  4CRZ B;  3V8I A;  4OC5 A;  3HUV A;  1F2P A;  1M4I A;  1S7L A;  1YME A;  4CPA A;  2ZW6 A;  5EMI A;  3FJU A;  5KTC A;  1R3N A;  3QAH A;  2XEF A;  2Q0Y A;  4PSW A;  5HVF A;  2EWB A;  4LQG A;  4B5P B;  5IX3 A;  3D66 A;  4MJ8 A;  2ZPA A;  1TKH A;  1Z2L A;  4W9Y A;  1NSL A;  2PCU A;  1M4D A;  3H5Z A;  3PB9 X;  5G1Z A;  3BJ7 A;  3TT2 A;  2VEZ A;  1YQE A;  4H6U A;  1X10 A;  3PBB A;  4HNX B;  4MRI A;  4B10 A;  2PJ1 A;  2AJ6 A;  4AVA A;  1IY7 A;  3BXM A;  2PJC A;  4PK3 A;  1YW6 A;  2P6E A;  2K5T A;  2PDO A;  1S7K A;  1WK4 A;  4M6H A;  1YVK A;  2PJ0 A;  4KOT A;  5EBV A;  4AVC A;  4MFL A;  4NFR A;  2F5I A;  1Z9U A;  3FRM A;  4P6Y A;  2R7H A;  3EC4 A;  2DF5 A;  3QB8 A;  4H6Z A;  4F6A A;  2PR8 A;  2R8V A;  2G9D A;  4MHN A;  4QBJ A;  2Z11 A;  3P2H A;  4RS2 A;  4B5O A;  2EUI A;  3RAM A;  4NJQ A;  4ONU A;  1IOF A;  2WPW A;  3DR6 A;  2B4D B;  4JYW A;  5ELY A;  1LAM A;  3QAY A;  1XIX A;  2ODF A;  1BOB A;  1ON0 A;  1XE4 A;  5AGE A;  4F9V A;  4X3R A;  4GM5 A;  4OP4 A;  3LAC A;  4XNH B;  4MCP A;  2PVW A;  1KZF A;  1PCA A;  1CP6 A;  4FD4 A;  3IEH A;  3SI2 A;  2I3C A;  2FT0 A;  3L2N A;  2O4H A;  2WYR A;  1KUV A;  4CYN A;  1LRZ A;  3VWD A;  4KSF A;  1XFO A;  4P4I A;  2OZG A;  3D2P A;  1YW4 A;  4OID A;  1P4N A;  4EME A;  4GS4 A;  2C1C A;  1FY7 A;  2Y0M A;  1ZG7 A;  3PZJ A;  3MGD A;  3PEI A;  1BPN A;  4MBU A;  3WC7 A;  2D4O A;  1V0C A;  3S9N A;  4XPD C;  5E96 A;  2JBJ A;  4OAE A;  3W6X A;  2YNC A;  4F9U A;  3S9L A;  2YND A;  2ZEL A;  2BOA A;  1MJA A;  3TOA A;  3IIB A;  2BUE A;  4KOS A;  4NJR A;  4UFX A;  1M4G A;  3SXN A;  4JJX A;  3KHX A;  3E0K A;  2I79 A;  3KZW A;  1LAN A;  4WJB A;  2D4P A;  2EBJ A;  3CPA A;  1YLE A;  2PJ7 A;  2Z3L A;  3G3S A;  3HLP A;  4K30 A;  4TWE A;  5J8F A;  4MY3 A;  5DS0 A;  1XJO A;  3PBE A;  4R8F A;  3VWE A;  4U5Y A;  2V8G A;  3GLJ A;  5LYI A;  4B11 A;  2NSM A;  3D67 A;  1VGY A;  1QSR A;  4OAD A;  3NH4 A;  2V8V A;  4PXC A;  2CTC A;  5K8M A;  3FX6 A;  6CPA A;  1HEE A;  2P6G A;  1I21 A;  2YNC C;  3CT9 A;  2B3U A;  5F46 A;  4P45 A;  3BJ8 A;  1KWM A;  4H2K A;  4MFJ A;  1B6B A;  2IL4 A;  4FWU A;  4P4J A;  3KR5 A;  3R95 A;  1R43 A;  1TKJ A;  3FF3 A;  4MFZ A;  7CPA A;  3PFE A;  3W91 A;  1XOV A;  5ISV A;  4R6T A;  3FIX A;  2GIV A; 
#chains in the Genus database with same CATH homology
 4B13 A;  3R9F A;  1YR0 A;  1N71 A;  1P0H A;  2G3T A;  3EFA A;  4B5O A;  3B8G A;  4R3L A;  1Q2Y A;  2FIW A;  2FXF A;  4UFV A;  3TTH A;  4B5P A;  1UFH A;  4AG7 A;  5H86 A;  4IF5 A;  3C26 A;  1RO5 A;  4M85 A;  3TO9 A;  1YX0 A;  3D8P A;  3FB3 A;  5F48 A;  2QIR A;  4UA3 A;  2ARH A;  2P6F A;  4H89 A;  4X5K A;  1YGH A;  4PSX A;  1MJ9 A;  4I49 A;  1PU9 A;  2VZZ A;  3D3S A;  5J8C A;  2C27 A;  2B4D A;  3IWE A;  4KOX A;  4NF1 A;  3R96 A;  4DNC A;  3S6K A;  4EVY A;  2HQY A;  3IWG A;  4UFW A;  3NE7 A;  4NSQ A;  4AVB A;  1QSN A;  2Z3K A;  2JLM A;  3IU1 A;  5G21 A;  4HKF A;  3LOD A;  4ZBG A;  1QSM A;  3PP9 A;  3H4Q A;  4LX9 A;  2OU2 A;  4F0X A;  5C82 A;  3A9L A;  4JLY A;  3TFY A;  4C7H A;  1PUA A;  2H5M A;  2WUU A;  4B14 A;  4XPL A;  4KOU A;  3EO4 A;  1IIC A;  3UY5 A;  4PV6 A;  4QUS A;  4XNH C;  2FL4 A;  4CS0 B;  1S3Z A;  4KOR A;  5I0C A;  4R9M A;  4PK2 A;  3IU2 A;  3G8W A;  4YFJ A;  3GKR A;  3KKW A;  1B87 A;  2VBQ A;  3W6S A;  2Q04 A;  3DDD A;  4CGL A;  4CYP A;  5F49 A;  3K9U A;  1Z4R A;  1XEB A;  2VZY A;  4KUA A;  2HV2 A;  4KVX A;  4JXQ A;  2GE3 A;  2CNM A;  2DPS A;  4UCM A;  1YK3 A;  4IUS A;  3N7Z A;  4Q38 A;  3S6F A;  5A27 A;  4AG9 A;  1U6M A;  5CNP A;  5AG4 A;  1OZP A;  4CAW A;  2KCW A;  2Q7B A;  2WPX A;  2B58 A;  1K4J A;  2BL1 A;  2HUZ A;  2G0B A;  2PRB A;  4Q36 A;  1Y9K A;  1YRE A;  3GYA A;  4A30 A;  4F0Y A;  4A31 A;  3ZZI A;  4C68 A;  2CY2 A;  4MI4 A;  4CGO A;  1L0C A;  5H84 A;  4E0A A;  2J8N A;  4A33 A;  2PC1 A;  3TCV A;  1VHS A;  1GHE A;  2OB0 A;  3TO7 A;  4XPK A;  4A2Z A;  3F5B A;  4BBH A;  5GCN A;  4KLW A;  4UCP A;  5AG5 A;  3JVN A;  3DSB A;  5IV0 A;  2PQ8 A;  5JPH A;  4II9 A;  2ZW4 A;  2J8R A;  4MFK A;  4CGP A;  2B5G B;  2Z0Z A;  4CYQ A;  2CNS A;  2Q4V A;  4UWI A;  1IID A;  4Y49 B;  4QVT A;  2DXQ A;  5G22 A;  1TIQ A;  1KUY A;  2WSA A;  4NCZ A;  4MY0 A;  1QSO A;  4C7I A;  1IB1 E;  1VKC A;  4CAX A;  3DNS A;  3P2F A;  4CYO A;  1BO4 A;  4BMH A;  2JDC A;  4KOV A;  2FE7 A;  4KOW A;  1WWZ A;  2BEI A;  3T90 A;  4RI1 A;  2X7B A;  2YNE A;  3TOB A;  4LUA A;  4HNW B;  2VQY A;  5DWM A;  1IYK A;  4CRY B;  2PSW A;  4YGO A;  2I00 A;  2CNT A;  4E2A A;  5EC4 A;  2OH1 A;  2QML A;  3SXO A;  4C2Z A;  2AE6 A;  2VI7 A;  4QB9 A;  2FS5 A;  3I9S A;  3T9Y A;  4CAF A;  2ZW7 A;  1Q2C A;  2ATR A;  4C2X A;  4NEX A;  1KUX A;  4L8A A;  2A4N A;  4YRH A;  2J8M A;  2Z10 A;  4MFP A;  2Z3O A;  3S6G A;  3OWC A;  4MFQ A;  2P0W A;  4ORF A;  1Y9W A;  2JDD A;  2FIA A;  3TE4 A;  5JQ4 A;  1QST A;  1ZO0 A;  1S5K A;  1XF8 A;  2VXK A;  3D2M A;  3JUW A;  2RC4 A;  3EY5 A;  3R1K A;  1RXT A;  2R1I A;  2FSR A;  4ZGY B;  4KS9 A;  1CM0 A;  1Z4E A;  4R87 A;  3CXS A;  5AG6 A;  2R98 A;  3GY9 A;  3F8K A;  5HH1 A;  3ZJ0 A;  5HMN A;  5KTA A;  4A32 A;  3S6H A;  3TO6 A;  5KTD A;  1NMT A;  4UCN A;  3SHP A;  4B12 A;  5BWA B;  4J3G A;  2B3V A;  4KLV A;  4KOY A;  3FBU A;  5AG7 A;  1M1D A;  4A95 A;  3JTK A;  1S60 A;  3CXP A;  5DWN A;  1MJB A;  4M3S A;  1NE9 A;  1S7N A;  4R57 A;  2ZW5 A;  2ZXV A;  2B5G A;  2G3A A;  3BLN A;  1CJW A;  1I12 A;  2Z3P A;  3R9G A;  3CXQ A;  2QEC A;  2B4B A;  1M44 A;  5IB0 A;  2REE A;  4FD5 A;  4XPD B;  1S7F A;  4MHD A;  4AB7 A;  4KVM E;  4U9Y A;  3DR8 A;  4CAE A;  2PR1 A;  1J4J A;  5G20 A;  1YVO A;  1MK4 A;  4KZT A;  3I3G A;  4JD6 A;  4JWP A;  4CAV A;  1Q2D A;  4NXY A;  3PGP A;  1IYL A;  1R57 A;  4KVO E;  4Y49 C;  3RYO A;  4HNY B;  4FD6 A;  2REF A;  2OZU A;  2Z3M A;  1Y7R A;  3LD2 A;  3EXN A;  2EVN A;  4OLL A;  5FVJ A;  2JEV A;  4QC6 A;  3IGR A;  3WR7 A;  4C2Y A;  4R3K A;  2FCK A;  4FD7 A;  2Q44 A;  2NMT A;  3F0A A;  4JXR A;  4E8O A;  3FNC A;  2DPT A;  2GAN A;  3FXT A;  4KUB A;  2YGW A;  4U9Z A;  2CXA A;  1I1D A;  3R9E A;  1SQH A;  2Z3N A;  5A28 A;  5C88 A;  5F47 A;  4UWJ A;  4CGM A;  1XMT A;  4KSA A;  2OZH A;  4CGN A;  2BSW A;  2Q4Y A;  4UBR A;  2O28 A;  3FYN A;  4L89 A;  4CRZ B;  3V8I A;  1M4I A;  1S7L A;  2ZW6 A;  5KTC A;  3QAH A;  2Q0Y A;  4PSW A;  4B5P B;  5IX3 A;  4MJ8 A;  2ZPA A;  1NSL A;  1M4D A;  3H5Z A;  5G1Z A;  3BJ7 A;  3TT2 A;  2VEZ A;  4H6U A;  4HNX B;  4B10 A;  2AJ6 A;  4AVA A;  4PK3 A;  2P6E A;  2K5T A;  2PDO A;  1S7K A;  1WK4 A;  5EBV A;  1YVK A;  4KOT A;  4AVC A;  4MFL A;  2F5I A;  1Z9U A;  3FRM A;  2R7H A;  3EC4 A;  3QB8 A;  4H6Z A;  4F6A A;  2PR8 A;  2R8V A;  4QBJ A;  2Z11 A;  3P2H A;  4RS2 A;  2EUI A;  4ONU A;  2WPW A;  3DR6 A;  2B4D B;  1XIX A;  1BOB A;  1ON0 A;  1XE4 A;  5AGE A;  4XNH B;  1KZF A;  4FD4 A;  2FT0 A;  4CYN A;  1KUV A;  1LRZ A;  3VWD A;  4KSF A;  2OZG A;  3D2P A;  1P4N A;  4GS4 A;  2Y0M A;  3PZJ A;  3MGD A;  4MBU A;  2D4O A;  1V0C A;  4XPD C;  5E96 A;  4OAE A;  3W6X A;  2YNC A;  2YND A;  1MJA A;  3TOA A;  2BUE A;  4KOS A;  4UFX A;  1M4G A;  3SXN A;  4JJX A;  3E0K A;  2I79 A;  2D4P A;  1YLE A;  2Z3L A;  3G3S A;  4K30 A;  5J8F A;  4MY3 A;  3VWE A;  4U5Y A;  4B11 A;  1QSR A;  4OAD A;  2P6G A;  1I21 A;  2YNC C;  2B3U A;  5F46 A;  3BJ8 A;  4MFJ A;  1B6B A;  2IL4 A;  3R95 A;  4MFZ A;  3W91 A;  1FY7 A;  5ISV A;  3FIX A;  2GIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...