1WWZA

Crystal structure of ph1933 from pyrococcus horikoshii ot3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
b'MDEIKIEKLKKLDKKALNELIDVYMSGYEGLEEYGGEGRDYARNYIKWCWKKASDGFFVAKVGDKIVGFIVCDKDWFSKYEGRIVGAIHEFVVDKKFQGKGIGRKLLITCLDFLGKYNDTIELWVGEKNYGAMNLYEKFGFKKVGKSGIWVRMIKRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1933
publication title Crystal structure of PH1933 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 50
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1wwzA00
1ON0A 2CNMA 4NF1A 3F0AA 1KUVA 2G3AA 1IICA 1CM0A 4KUBA 5KTAA 2Q0YA 3SXOA 1MJ9A 1GHEA 5J8FA 4ORFA 2OZUA 2BUEA 1IYKA 2DXQA 4OADA 5H86A 4KOWA 3BJ7A 3SHPA 4U9YA 1P0HA 2B5GB 3BLNA 4R9MA 3TOBA 1YREA 3TE4A 4X5KA 4U5YA 4UA3A 2HQYA 4EVYA 5E96A 1I12A 2PDOA 3ZJ0A 2R8VA 4CRZB 4LUAA 1M4GA 3E0KA 1MJAA 2B58A 2QIRA 4UBRA 4YGOA 4AVAA 3TOAA 3TCVA 4HNXB 4QUSA 4PSXA 4NCZA 3GY9A 1QSMA 1V0CA 2AE6A 4FD7A 1YK3A 4MI4A 3FB3A 1YVKA 3R9GA 2WPXA 2B3VA 2B4BA 4KUAA 1M4DA 4XPLA 1KZFA 2GANA 1MJBA 3NE7A 1U6MA 1IIDA 2P6EA 1Q2YA 3I9SA 3FNCA 3JVNA 2ZPAA 4F6AA 2P6FA 1R57A 2ZXVA 2PSWA 1I1DA 3D2MA 3QAHA 2VZZA 2FE7A 1S5KA 4JJXA 4XNHC 3S6GA 1XE4A 4CAXA 4HNYB 1J4JA 3R1KA 3PGPA 4PK2A 5C88A 4KZTA 1XF8A 2R98A 1MK4A 3C26A 4MBUA 3ZZIA 1VKCA 1S7KA 1I21A 5KTCA 3S6FA 5IB0A 1XMTA 4DNCA 2P6GA 2BSWA 2NMTA 2CNSA 5F49A 3LODA 2REEA 4CS0B 2B4DA 2FXFA 5C82A 5CNPA 2VXKA 4NEXA 3K9UA 1BO4A 3CXQA 4QB9A 1Z4EA 3VWDA 2G3TA 4XPDB 2KCWA 3V8IA 4CRYB 4HNWB 3D2PA 4H6UA 3DDDA 4XPKA 1YGHA 4JLYA 1QSTA 1K4JA 2ATRA 5EC4A 5GCNA 2D4OA 2VQYA 3GYAA 5IV0A 1SQHA 2JLMA 4CAWA 4U9ZA 2PR8A 2FIAA 3G3SA 1LRZA 1QSNA 2ARHA 4MY3A 4J3GA 2ZW6A 4OAEA 2OU2A 4YRHA 1YVOA 1B87A 1Q2DA 2CY2A 4L89A 1YR0A 2H5MA 2OZGA 3IGRA 4LX9A 1P4NA 3I3GA 2JDCA 5KTDA 3DR8A 4KOXA 4KVOE 1S7LA 3TTHA 4UWJA 1Q2CA 3FRMA 1OZPA 4YFJA 4E2AA 5IX3A 5DWNA 2REFA 3MGDA 4KOSA 2I00A 4IF5A 3R9FA 4B5PB 4GS4A 3R96A 2B4DB 4QBJA 4AVCA 4XPDC 5EBVA 4II9A 5HMNA 4KOVA 4FD6A 3TFYA 2Q04A 2BL1A 1S7FA 1Y9KA 4UWIA 3KKWA 3QB8A 1RO5A 3EC4A 3H4QA 4KOYA 3WR7A 1QSRA 3BJ8A 2B3UA 4PK3A 2I79A 4CAVA 4R3KA 3SXNA 3IWGA 2R7HA 3EY5A 4NXYA 3T9YA 2PR1A 2GE3A 4RI1A 3W6XA 3P2HA 3CXSA 2K5TA 3UY5A 2FCKA 2Z11A 4PV6A 2PRBA 2Z10A 4B5PA 2Q44A 5F48A 2PC1A 3D3SA 4NSQA 4KLWA 2ZW4A 3VWEA 2FIWA 4AG9A 1QSOA 4KOUA 3DNSA 3B8GA 1S3ZA 4AG7A 4BMHA 3PP9A 4MHDA 2X7BA 1YX0A 4JWPA 2R1IA 4JD6A 2EUIA 2VI7A 5J8CA 3S6HA 4L8AA 5DWMA 1BOBA 4M85A 1WWZA 1M1DA 5FVJA 2PQ8A 3FXTA 2CNTA 3FIXA 3PZJA 4KOTA 2VBQA 2FSRA 2JEVA 4Y49B 2Y0MA 2HV2A 4AVBA 1VHSA 1NMTA 4FD5A 4H6ZA 5JQ4A 1YLEA 4JXQA 2G0BA 3EO4A 4HKFA 4KLVA 1IB1E 3TO9A 3JUWA 4OLLA 1RXTA 4I49A 1FY7A 2Q4YA 4KVME 1Y7RA 2Z0ZA 3S6KA 2RC4A 2AJ6A 2J8NA 1KUYA 5F47A 3DR6A 5ISVA 4E8OA 3W91A 5H84A 3GKRA 1L0CA 4ONUA 2Q4VA 2VZYA 4MY0A 3OWCA 2FL4A 3D8PA 4R87A 3W6SA 4H89A 1NE9A 1XEBA 2QECA 2QMLA 2O28A 2FT0A 4QC6A 1M44A 4MJ8A 1NSLA 3N7ZA 4FD4A 1WK4A 4RS2A 1Y9WA 1IYLA 1M4IA 2OB0A 4KORA 2Q7BA 4IUSA 2ZW7A 1S7NA 4F0YA 3FYNA 4R3LA 2B5GA 2BEIA 2C27A 2WPWA 2VEZA 2J8RA 2EVNA 4ZBGA 4KVXA 4B5OA 2ZW5A 1S60A 3DSBA 3RYOA 1N71A 1TIQA 3G8WA 4R57A 4Y49C 3EXNA 1KUXA 3F5BA 1B6BA 4E0AA 1PU9A 3TO6A 4PSWA 2GIVA 4JXRA 4M3SA 3TT2A 1UFHA 5HH1A 3FBUA 5I0CA 3T90A 5F46A 5JPHA 2OH1A 2OZHA 3P2FA 4AB7A 1CJWA 2A4NA 2HUZA 3LD2A 2J8MA 2FS5A 4K30A 3EFAA 1XIXA 1PUAA 2F5IA 2D4PA 2IL4A 4QVTA 2P0WA 1Z4RA 2JDDA 1Z9UA 3CXPA 3R95A 3R9EA 3F8KA 4XNHB 3TO7A
chains in the Genus database with same CATH superfamily
2CXAA 3H8FA 1ON0A 2CNMA 4NF1A 2Q51A 3F0AA 1KUVA 4X3RA 2G3AA 1IICA 3V38A 4ZX9A 1CM0A 4RN7A 2V77A 4KUBA 4A31A 1Z8WA 5KTAA 2Q0YA 3SXOA 1MJ9A 1GHEA 5J8FA 4ORFA 3IU2A 2OZUA 4B6ZA 1CP7A 2BUEA 4NGRA 3IIBA 3N5FA 1IYKA 2GLFA 4UCNA 3IEHA 2DXQA 4OADA 5H86A 3ISZA 3D7FA 2PJ2A 4NGPA 4P4DA 4C2XA 4KOWA 4C2YA 3BJ7A 3SHPA 4U9YA 1Y0YA 4CPAA 1P0HA 2B5GB 3BLNA 3SJFA 4R9MA 3TOBA 2V8GA 1YREA 3PB9X 3TE4A 4X5KA 4U5YA 4UA3A 2HQYA 5AG6A 4B10A 1LANA 4EVYA 1PYTB 5E96A 1I12A 5G20A 2Z3KA 3LWUA 2QJ8A 1AMPA 2PDOA 3KZWA 1R3NA 3ZJ0A 1PCAA 2PJ0A 2O53A 2CIJA 2R8VA 2XEIA 4CRZB 2JBJA 5G22A 2CF4A 4LUAA 2CTBA 5I4MA 1M4GA 3E0KA 1MJAA 2XEFA 2YGWA 4UCPA 2B58A 2QIRA 4UBRA 8CPAA 4YWYA 1Z8TA 4YGOA 4AVAA 1YSJA 3TOAA 3B2YA 2ZOFA 3TCVA 4HNXB 4QUSA 4C68A 4PSXA 4NCZA 3GY9A 2EO8A 5AGEA 3SJGA 1QSMA 1V0CA 2AE6A 4FD7A 3IO1A 1YK3A 4MI4A 3KR5A 3FB3A 3NFZA 1BLLE 1BPNA 1YVKA 3R9GA 4A39A 4PXCA 2WPXA 2B3VA 2B4BA 4KUAA 4X8IA 4AXVA 1M4DA 2DEAA 2HB6A 2V8VA 1IGBA 2ZEGA 2C6PA 1LOKA 2PJ7A 4XPLA 2GANA 1A2ZA 1DTDA 1KZFA 1MJBA 1U6MA 3GIUA 1IIDA 3NE7A 4NFRA 1Z8XA 4P6YA 2BCOA 2P6EA 1Q2YA 3H5ZA 3I9SA 3FNCA 4MCSA 3JVNA 2ZPAA 4F6AA 3H8EA 2P6FA 1R57A 2ZXVA 4NJRA 4ZYQA 2PSWA 3NA6A 5LYDA 1I1DA 2AFZA 3D2MA 3GUXA 4CGNA 3CDXA 3QAHA 2VZZA 2FE7A 3CPAA 3D7DA 5ELYA 1S5KA 3IU1A 1ZG9A 4JJXA 1EE3P 2Q7SA 4OC4A 4XNHC 3S6GA 1XE4A 4CAXA 3NH8A 4HNYB 1ZG8A 4GXHA 1J4JA 2IQ6A 3B3CA 3R1KA 3PGPA 4JYWA 4PK2A 1XOVA 2PJBA 1QQ9A 4F9UA 5C88A 4KZTA 3BI0A 1XF8A 1UWYA 2R98A 1MK4A 3C26A 4MBUA 3ZZIA 1VHOA 3KHXA 1VKCA 1S7KA 1I21A 3PB6X 2WUUA 4CYQA 5KTCA 3WC7A 3S6FA 4A94A 2PVWA 4JZ0A 5IB0A 2PCUA 1XMTA 1QMUA 2VL1A 4DNCA 4ZI6A 4EMEA 2Z3NA 4HPSA 2P6GA 3RAMA 4CGPA 2BSWA 1M4LA 2NMTA 2CNSA 1CX8A 5F49A 3LODA 1XMBA 4TNUA 1TF8A 4PPZA 2REEA 4CS0B 4IK2A 5THWA 4P4JA 2B4DA 4UEEA 2FXFA 5C82A 2YNCC 5LYLA 1TKJA 5CNPA 2VXKA 3WABA 3D7GA 4NEXA 3K9UA 1BO4A 3CXQA 4MFQA 4P44A 4QB9A 1Z4EA 3VWDA 2G3TA 4XPDB 2KCWA 3V8IA 2PIZA 1Z8LA 3FEDA 1GYTA 1XFOA 1CG2A 4GM5A 3TC8A 3SI0A 5JGFA 4CRYB 4HNWB 3D2PA 3IJ3A 1X10A 4NJQA 3B7IA 4H6UA 2I3CA 1R43A 1XRYA 3D68A 3DDDA 4DUKA 4XPKA 1YGHA 4JLYA 1IU8A 2ZEEA 1QSTA 4MHZA 4B11A 1Y7EA 1K4JA 4LQ6A 4R76A 4A30A 4ZY2A 4M6GA 4P4BA 2ATRA 4P4FA 5EC4A 1CP6A 3MRUA 4EWTA 3FECA 5GCNA 4UFXA 2D4OA 1LAMA 2VQYA 1VHEA 3GYAA 3JTKA 3KGQA 3KL9A 4Z65A 5IV0A 1SQHA 4A38A 2V8HA 2WYRA 4NGNA 4FUUA 4CAEA 2JLMA 4CAWA 5LRJA 4U9ZA 5HXDA 2DPTA 4K3NA 3KR4A 2PR8A 2FIAA 3G3SA 1LRZA 1QSNA 2ARHA 4MY3A 2CTCA 2PRQA 4J3GA 1VIXA 2XEJA 5J1QA 2PVVA 1ARMA 2ZW6A 3VH9A 5BWAB 4OAEA 4WJBA 4P10A 1CBXA 4PQAA 2Z3OA 2OU2A 4CYNA 1AYEA 4YRHA 1YVOA 1ZLHA 1B87A 1Q2DA 3B3WA 2RFHA 1ARLA 2CY2A 4L89A 1YR0A 3A9LA 1YMEA 3QAYA 2H5MA 4TWEA 2OZGA 4O23A 1XBUA 3IGRA 3PB4X 4W9YA 4LX9A 1P4NA 4X2TA 1IOIA 3I3GA 2JDCA 1BPMA 4P45A 4G1PA 4MHYA 5KTDA 4P4EA 2G9DA 2O4HA 4UF4A 1AUGA 3DR8A 5G1ZA 4CAFA 3ISXA 4KOXA 3CZXA 3HUVA 4KVOE 1S7LA 3TTHA 2AFOA 4UWJA 1F57A 3KQXA 1Q2CA 3FRMA 1TKHA 1OZPA 3D67A 2EWBA 4YFJA 1HDUA 4ZX8A 3DLJA 3S9MA 4LQGA 4E2AA 5IX3A 1XJOA 5DWNA 3B3TA 2J9AA 2REFA 2I00A 3MGDA 4KOSA 2DPSA 4IF5A 2IJZA 2Z3MA 3I1UA 2DF5A 4WWVA 3R9FA 4B5PB 4GS4A 3R96A 2B4DB 4QBJA 1YLOA 1OBRA 1ZLIA 4OC3A 4AVCA 4XPDC 1DE4C 5EBVA 5LYFA 4II9A 5HMNA 4KSAA 3PEIA 2F7VA 4OKOA 4KOVA 4FD6A 2ZOGA 5AG7A 2Q04A 3TFYA 2BL1A 1S7FA 4M6HA 4MCRA 4KS9A 1Y9KA 2V8DA 5K8MA 4UWIA 2PJAA 3KKWA 3QB8A 1RO5A 2JBKA 3EC4A 3H4QA 2PE3A 2ZENA 3QNVA 4KOYA 2ZEFA 3WR7A 1QSRA 1LFWA 2JEWA 3BJ8A 4MFLA 4OIWA 2ZEHA 5HVFA 2B3UA 4PK3A 3KHZA 4R7MA 6CPAA 2BOAA 2I79A 3K9TA 4Q7AA 3FX6A 4R3KA 4CAVA 5A27A 2ZELA 3SXNA 3IWGA 2R7HA 4C7IA 3BHXA 2HC9A 3EY5A 4MMOA 1ELMP 1JQGA 3B3VA 4NXYA 1HEEA 2QVPA 3T9YA 4F0XA 2GU2A 1F2OA 2PR1A 2GE3A 4ZY0A 2C1CA 4UIBA 2GFQA 2PJ1A 4RI1A 4DYOA 3W6XA 4CGOA 1ZO0A 3FH4A 2ABZA 3P2HA 3CXSA 3MN8A 2K5TA 3UY5A 2FCKA 2Z11A 3PFOA 3KI9A 4PV6A 2PRBA 2Z10A 4B5PA 2Q44A 5F48A 4PXDA 5LRKA 3D66A 1Q7LA 2PC1A 3D3SA 4NSQA 4KLWA 2ZW4A 2F8HA 3VWEA 4B12A 2FIWA 4FAIA 2EK8A 3NE8A 2Z3PA 4AG9A 1QSOA 2AFSA 3KQZA 4KOUA 4F8ZA 3DNSA 2EK9A 3B8GA 3NH4A 3RO0A 4CGMA 1S3ZA 4AG7A 4BMHA 5D29A 3PP9A 4UEFA 4B14A 2ZEDA 4MHDA 3IFEA 2X7BA 1YX0A 4JWPA 2ODFA 3WC6A 2R1IA 4JD6A 3TX8A 3KASA 2EUIA 2VI7A 5JH9A 1YW6A 4MRIA 4UFWA 1Z5RA 4YU9A 2PJ4A 5J8CA 3S6HA 2NSMA 4OIDA 4L8AA 3FEEA 4ZGYB 4BD9A 5DWMA 1BOBA 4M85A 1WWZA 1M1DA 5FVJA 3VATA 2PQ8A 2AFMA 4M6IA 3FXTA 4MHPA 2FVGA 2PJ3A 4FBEA 3SJEA 2CNTA 3FIXA 4BBHA 3PZJA 5AG4A 4KOTA 7CPAA 2VBQA 2FSRA 2JEVA 4Y49B 2Y0MA 2HV2A 4AVBA 1VHSA 1NMTA 4FD5A 4H6ZA 3RNZA 5JQ4A 2YNEA 4MXUA 4Q36A 1YLEA 2AFWA 3S9NA 4JXQA 3DGVA 3PBEA 3S9LA 4MHNA 4NGMA 2G0BA 3EO4A 4HKFA 4KLVA 1IB1E 4UEZA 3JUWA 3TO9A 2OR4A 4OLLA 5EMIA 1RXTA 4I49A 1FY7A 5HVHA 2Q4YA 4R6TA 1Y7RA 4KVME 4OC5A 2OOTA 2Z0ZA 3BI1A 5K8OA 4MCPA 3S6KA 4CYOA 2RC4A 3D7HA 2AJ6A 2J8NA 1KUYA 5F47A 3CT9A 4RUHA 1HDQA 3DR6A 5ISVA 2QYVA 4E8OA 3PB7X 2POKA 4UCMA 3W91A 5H84A 2GREA 3GKRA 1L0CA 4ONUA 4EFDA 3LMSA 2Q4VA 2VZYA 4MY0A 2NYQA 4PXEA 3OWCA 3FVLA 2PJ8A 2FL4A 2PJ5A 3D8PA 4R87A 3W6SA 3WT4A 1FT7A 4H89A 3SI2A 1LCPA 3WC5A 1NE9A 1LAPA 2BO9A 3IWEA 3RZAA 1XEBA 4H2KA 5G21A 4A37A 2QECA 2QMLA 4ZY1A 3FJUA 2ZEPA 5A28A 2O28A 5IB9A 1CPSA 2FT0A 4QC6A 1M44A 1CPXA 2EBJA 3IC1A 4MJ8A 4BINA 1NSLA 2ZEOA 4MFPA 3N7ZA 4FD4A 1WK4A 1X12A 2C6GA 2Z3LA 3H8GA 4A32A 5HVGA 4NGSA 4RS2A 1Y9WA 1IYLA 1M4IA 3V7ZA 4DJLA 1IOFA 3IWWA 1BAVA 2OB0A 4KORA 3GLJA 4IUSA 1FNOA 4Q38A 2Q7BA 5AG5A 1TF9A 2ZW7A 1S7NA 4PXBA 5K8NA 3L2NA 2Q4ZA 4C7HA 4F0YA 1YQEA 3FYNA 3GB0A 3HLPA 4R3LA 3SJXA 2B5GA 3T8WA 5LRGA 1KWMA 2BEIA 1Z2LA 2C27A 3LACA 2AFUA 3JRUA 1H8LA 2WPWA 4KSFA 2VEZA 2J8RA 2EVNA 4ZBGA 5F09A 2YNCA 2WSAA 1RTQA 2PIYA 1YW4A 3B35A 4KVXA 4B5OA 2ZW5A 1S60A 3DSBA 2ANPA 2YNDA 1F2PA 5CPAA 3RYOA 1N71A 1TIQA 2PJ6A 3G8WA 2WZNA 4OC0A 5DS0A 4R57A 4Y49C 4ONWA 2XEGA 1ZG7A 3EXNA 2RB7A 4C2ZA 1KUXA 3VARA 4FWUA 4R8FA 1IY7A 5K8PA 3F5BA 1B6BA 3PRTA 4P4IA 4OC2A 5JM6A 4E0AA 2GLJA 1PU9A 3BXMA 3K2KA 3TO6A 4PSWA 4CYPA 4CGLA 2GIVA 2Q43A 4JXRA 4M3SA 3TT2A 4F9VA 1TKFA 4OMEA 1UFHA 1Y0RA 3CPXA 4KSIA 3D4UA 5D8NA 4MFKA 5HH1A 5LYIA 3FBUA 5I0CA 3T90A 5F46A 5JPHA 2OH1A 2OZHA 4A95A 3P2FA 4AB7A 4NGTA 4MCQA 3FF3A 4MFZA 1VGYA 2ZEMA 4MFJA 1CJWA 2A4NA 2HUZA 1JWQA 4IAVA 3RBUA 3NH5A 3LD2A 2J8MA 4B13A 2AFXA 3SI1A 2FS5A 4K30A 3PFEA 3EFAA 1XIXA 3PB8X 4UFVA 1PUAA 5CBMA 2PJ9A 3B3SA 3PBBA 2F5IA 2D4PA 2IL4A 4QVTA 2P0WA 4NGQA 4OP4A 1Z4RA 4A2ZA 2JDDA 1ELLP 1Z9UA 3CXPA 4A33A 4UIAA 4OC1A 1NSAA 3FMCA 3R95A 2IMOA 3F8KA 3R9EA 2C6CA 4IHMA 4XNHB 3TO7A 1TXRA 2PJCA
chains in the Genus database with same CATH topology
2CXAA 1ON0A 2CNMA 4NF1A 3F0AA 1KUVA 2G3AA 1IICA 1CM0A 4KUBA 4A31A 5KTAA 2Q0YA 3SXOA 1MJ9A 1GHEA 5J8FA 4ORFA 3IU2A 2OZUA 2BUEA 1IYKA 4UCNA 2DXQA 4OADA 5H86A 4C2XA 4KOWA 4C2YA 3BJ7A 3SHPA 4U9YA 1P0HA 2B5GB 3BLNA 4R9MA 3TOBA 1YREA 3TE4A 4X5KA 4U5YA 4UA3A 2HQYA 5AG6A 4B10A 4EVYA 5E96A 1I12A 5G20A 2Z3KA 2PDOA 3ZJ0A 2R8VA 4CRZB 5G22A 4LUAA 1M4GA 3E0KA 1MJAA 2YGWA 4UCPA 2B58A 2QIRA 4UBRA 4YGOA 4AVAA 3TOAA 3TCVA 4HNXB 4QUSA 4C68A 4PSXA 4NCZA 3GY9A 5AGEA 1QSMA 1V0CA 2AE6A 4FD7A 1YK3A 4MI4A 3FB3A 1YVKA 3R9GA 2WPXA 2B3VA 2B4BA 4KUAA 1M4DA 4XPLA 1KZFA 2GANA 1MJBA 3NE7A 1U6MA 1IIDA 2P6EA 1Q2YA 3H5ZA 3I9SA 3FNCA 3JVNA 2ZPAA 4F6AA 2P6FA 1R57A 2ZXVA 2PSWA 1I1DA 4CGNA 3D2MA 3QAHA 2VZZA 2FE7A 1S5KA 3IU1A 4JJXA 4XNHC 3S6GA 1XE4A 4CAXA 4HNYB 1J4JA 3R1KA 3PGPA 4PK2A 5C88A 4KZTA 1XF8A 2R98A 1MK4A 3C26A 4MBUA 3ZZIA 1VKCA 1S7KA 1I21A 4CYQA 2WUUA 5KTCA 3S6FA 5IB0A 1XMTA 4DNCA 2Z3NA 2P6GA 4CGPA 2BSWA 2NMTA 2CNSA 5F49A 3LODA 2REEA 4CS0B 2B4DA 2FXFA 5C82A 2YNCC 5CNPA 2VXKA 4NEXA 3K9UA 1BO4A 3CXQA 4MFQA 4QB9A 1Z4EA 3VWDA 2G3TA 4XPDB 2KCWA 3V8IA 4CRYB 4HNWB 3D2PA 4H6UA 3DDDA 4XPKA 1YGHA 4JLYA 1QSTA 4B11A 1K4JA 4A30A 2ATRA 5EC4A 5GCNA 4UFXA 2D4OA 2VQYA 3GYAA 3JTKA 5IV0A 1SQHA 4CAEA 2JLMA 4CAWA 4U9ZA 2DPTA 2PR8A 2FIAA 3G3SA 1LRZA 1QSNA 2ARHA 4MY3A 4J3GA 2ZW6A 5BWAB 4OAEA 2Z3OA 2OU2A 4CYNA 4YRHA 1YVOA 1B87A 1Q2DA 2CY2A 4L89A 1YR0A 3A9LA 2H5MA 2OZGA 3IGRA 4LX9A 1P4NA 3I3GA 2JDCA 5KTDA 5G1ZA 3DR8A 4CAFA 4KOXA 4KVOE 1S7LA 3TTHA 4UWJA 1Q2CA 3FRMA 1OZPA 4YFJA 4E2AA 5IX3A 5DWNA 2REFA 3MGDA 2I00A 4KOSA 4IF5A 2DPSA 2Z3MA 3R9FA 4B5PB 4GS4A 3R96A 2B4DB 4QBJA 4AVCA 4XPDC 5EBVA 4II9A 5HMNA 4KSAA 4KOVA 4FD6A 5AG7A 2Q04A 3TFYA 2BL1A 1S7FA 4KS9A 1Y9KA 4UWIA 3KKWA 3QB8A 1RO5A 3EC4A 3H4QA 4KOYA 3WR7A 1QSRA 3BJ8A 4MFLA 2B3UA 4PK3A 2I79A 4CAVA 5A27A 4R3KA 3SXNA 3IWGA 2R7HA 4C7IA 3EY5A 5A28A 4NXYA 4F0XA 3T9YA 2PR1A 2GE3A 4RI1A 3W6XA 4CGOA 1ZO0A 3P2HA 3CXSA 2K5TA 3UY5A 2FCKA 2Z11A 4PV6A 2PRBA 2Z10A 4B5PA 2Q44A 5F48A 2PC1A 3D3SA 4NSQA 4KLWA 2ZW4A 3VWEA 4B12A 2FIWA 2Z3PA 4AG9A 1QSOA 4KOUA 3DNSA 3B8GA 4CGMA 1S3ZA 4AG7A 4BMHA 3PP9A 4B14A 4MHDA 2X7BA 1YX0A 4JWPA 2R1IA 4JD6A 2EUIA 2VI7A 5J8CA 4UFWA 3S6HA 4L8AA 4ZGYB 5DWMA 1BOBA 4M85A 1WWZA 1M1DA 5FVJA 2PQ8A 3FXTA 2CNTA 3FIXA 4BBHA 3PZJA 5AG4A 4KOTA 2VBQA 2FSRA 2JEVA 4Y49B 2Y0MA 2HV2A 4AVBA 1VHSA 1NMTA 4FD5A 4H6ZA 5JQ4A 2YNEA 4Q36A 1YLEA 4JXQA 2G0BA 3EO4A 4HKFA 4KLVA 1IB1E 3TO9A 3JUWA 4OLLA 1RXTA 4I49A 1FY7A 2Q4YA 1Y7RA 4KVME 2Z0ZA 3S6KA 4CYOA 2RC4A 2AJ6A 2J8NA 1KUYA 5F47A 3DR6A 5ISVA 4E8OA 4UCMA 3W91A 5H84A 3GKRA 1L0CA 4ONUA 2Q4VA 2VZYA 4MY0A 3OWCA 2FL4A 3D8PA 4R87A 3W6SA 4H89A 1NE9A 3IWEA 1XEBA 5G21A 2QECA 2QMLA 2O28A 2FT0A 4QC6A 1M44A 4MJ8A 1NSLA 4MFPA 3N7ZA 4FD4A 1WK4A 2Z3LA 4A32A 4RS2A 1Y9WA 1IYLA 1M4IA 2OB0A 4KORA 2Q7BA 4IUSA 4Q38A 5AG5A 2ZW7A 1S7NA 4C7HA 4F0YA 3FYNA 4R3LA 2B5GA 2BEIA 2C27A 2WPWA 4KSFA 2VEZA 2J8RA 2EVNA 4ZBGA 2YNCA 2WSAA 4KVXA 4B5OA 2ZW5A 1S60A 3DSBA 2YNDA 3RYOA 1N71A 1TIQA 3G8WA 4R57A 4Y49C 3EXNA 4C2ZA 1KUXA 3F5BA 1B6BA 4E0AA 1PU9A 3TO6A 4PSWA 4CYPA 4CGLA 2GIVA 4JXRA 4M3SA 3TT2A 1UFHA 5HH1A 4MFKA 3FBUA 5I0CA 3T90A 5F46A 5JPHA 2OH1A 2OZHA 4A95A 3P2FA 4AB7A 4MFZA 4MFJA 1CJWA 2A4NA 2HUZA 3LD2A 2J8MA 4B13A 2FS5A 4K30A 3EFAA 1XIXA 4UFVA 1PUAA 2F5IA 2D4PA 2IL4A 4QVTA 2P0WA 1Z4RA 4A2ZA 2JDDA 1Z9UA 3CXPA 4A33A 3R95A 3R9EA 3F8KA 4XNHB 3TO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ON0 A;  2CNM A;  4NF1 A;  3F0A A;  1KUV A;  2G3A A;  1IIC A;  1CM0 A;  4KUB A;  5KTA A;  2Q0Y A;  3SXO A;  1MJ9 A;  1GHE A;  5J8F A;  4ORF A;  2OZU A;  2BUE A;  1IYK A;  2DXQ A;  4OAD A;  5H86 A;  4KOW A;  3BJ7 A;  3SHP A;  4U9Y A;  1P0H A;  2B5G B;  3BLN A;  4R9M A;  3TOB A;  1YRE A;  3TE4 A;  4X5K A;  4U5Y A;  4UA3 A;  2HQY A;  4EVY A;  5E96 A;  1I12 A;  2PDO A;  3ZJ0 A;  2R8V A;  4CRZ B;  4LUA A;  1M4G A;  3E0K A;  1MJA A;  2B58 A;  2QIR A;  4UBR A;  4YGO A;  4AVA A;  3TOA A;  3TCV A;  4HNX B;  4QUS A;  4PSX A;  4NCZ A;  3GY9 A;  1QSM A;  1V0C A;  2AE6 A;  4FD7 A;  1YK3 A;  4MI4 A;  3FB3 A;  1YVK A;  3R9G A;  2WPX A;  2B3V A;  2B4B A;  4KUA A;  1M4D A;  4XPL A;  1KZF A;  2GAN A;  1MJB A;  3NE7 A;  1U6M A;  1IID A;  2P6E A;  1Q2Y A;  3I9S A;  3FNC A;  3JVN A;  2ZPA A;  4F6A A;  2P6F A;  1R57 A;  2ZXV A;  2PSW A;  1I1D A;  3D2M A;  3QAH A;  2VZZ A;  2FE7 A;  1S5K A;  4JJX A;  4XNH C;  3S6G A;  1XE4 A;  4CAX A;  4HNY B;  1J4J A;  3R1K A;  3PGP A;  4PK2 A;  5C88 A;  4KZT A;  1XF8 A;  2R98 A;  1MK4 A;  3C26 A;  4MBU A;  3ZZI A;  1VKC A;  1S7K A;  1I21 A;  5KTC A;  3S6F A;  5IB0 A;  1XMT A;  4DNC A;  2P6G A;  2BSW A;  2NMT A;  2CNS A;  5F49 A;  3LOD A;  2REE A;  4CS0 B;  2B4D A;  2FXF A;  5C82 A;  5CNP A;  2VXK A;  4NEX A;  3K9U A;  1BO4 A;  3CXQ A;  4QB9 A;  1Z4E A;  3VWD A;  2G3T A;  4XPD B;  2KCW A;  3V8I A;  4CRY B;  4HNW B;  3D2P A;  4H6U A;  3DDD A;  4XPK A;  1YGH A;  4JLY A;  1QST A;  1K4J A;  2ATR A;  5EC4 A;  5GCN A;  2D4O A;  2VQY A;  3GYA A;  5IV0 A;  1SQH A;  2JLM A;  4CAW A;  4U9Z A;  2PR8 A;  2FIA A;  3G3S A;  1LRZ A;  1QSN A;  2ARH A;  4MY3 A;  4J3G A;  2ZW6 A;  4OAE A;  2OU2 A;  4YRH A;  1YVO A;  1B87 A;  1Q2D A;  2CY2 A;  4L89 A;  1YR0 A;  2H5M A;  2OZG A;  3IGR A;  4LX9 A;  1P4N A;  3I3G A;  2JDC A;  5KTD A;  3DR8 A;  4KOX A;  4KVO E;  1S7L A;  3TTH A;  4UWJ A;  1Q2C A;  3FRM A;  1OZP A;  4YFJ A;  4E2A A;  5IX3 A;  5DWN A;  2REF A;  3MGD A;  4KOS A;  2I00 A;  4IF5 A;  3R9F A;  4B5P B;  4GS4 A;  3R96 A;  2B4D B;  4QBJ A;  4AVC A;  4XPD C;  5EBV A;  4II9 A;  5HMN A;  4KOV A;  4FD6 A;  3TFY A;  2Q04 A;  2BL1 A;  1S7F A;  1Y9K A;  4UWI A;  3KKW A;  3QB8 A;  1RO5 A;  3EC4 A;  3H4Q A;  4KOY A;  3WR7 A;  1QSR A;  3BJ8 A;  2B3U A;  4PK3 A;  2I79 A;  4CAV A;  4R3K A;  3SXN A;  3IWG A;  2R7H A;  3EY5 A;  4NXY A;  3T9Y A;  2PR1 A;  2GE3 A;  4RI1 A;  3W6X A;  3P2H A;  3CXS A;  2K5T A;  3UY5 A;  2FCK A;  2Z11 A;  4PV6 A;  2PRB A;  2Z10 A;  4B5P A;  2Q44 A;  5F48 A;  2PC1 A;  3D3S A;  4NSQ A;  4KLW A;  2ZW4 A;  3VWE A;  2FIW A;  4AG9 A;  1QSO A;  4KOU A;  3DNS A;  3B8G A;  1S3Z A;  4AG7 A;  4BMH A;  3PP9 A;  4MHD A;  2X7B A;  1YX0 A;  4JWP A;  2R1I A;  4JD6 A;  2EUI A;  2VI7 A;  5J8C A;  3S6H A;  4L8A A;  5DWM A;  1BOB A;  4M85 A;  1WWZ A;  1M1D A;  5FVJ A;  2PQ8 A;  3FXT A;  2CNT A;  3FIX A;  3PZJ A;  4KOT A;  2VBQ A;  2FSR A;  2JEV A;  4Y49 B;  2Y0M A;  2HV2 A;  4AVB A;  1VHS A;  1NMT A;  4FD5 A;  4H6Z A;  5JQ4 A;  1YLE A;  4JXQ A;  2G0B A;  3EO4 A;  4HKF A;  4KLV A;  1IB1 E;  3TO9 A;  3JUW A;  4OLL A;  1RXT A;  4I49 A;  1FY7 A;  2Q4Y A;  4KVM E;  1Y7R A;  2Z0Z A;  3S6K A;  2RC4 A;  2AJ6 A;  2J8N A;  1KUY A;  5F47 A;  3DR6 A;  5ISV A;  4E8O A;  3W91 A;  5H84 A;  3GKR A;  1L0C A;  4ONU A;  2Q4V A;  2VZY A;  4MY0 A;  3OWC A;  2FL4 A;  3D8P A;  4R87 A;  3W6S A;  4H89 A;  1NE9 A;  1XEB A;  2QEC A;  2QML A;  2O28 A;  2FT0 A;  4QC6 A;  1M44 A;  4MJ8 A;  1NSL A;  3N7Z A;  4FD4 A;  1WK4 A;  4RS2 A;  1Y9W A;  1IYL A;  1M4I A;  2OB0 A;  4KOR A;  2Q7B A;  4IUS A;  2ZW7 A;  1S7N A;  4F0Y A;  3FYN A;  4R3L A;  2B5G A;  2BEI A;  2C27 A;  2WPW A;  2VEZ A;  2J8R A;  2EVN A;  4ZBG A;  4KVX A;  4B5O A;  2ZW5 A;  1S60 A;  3DSB A;  3RYO A;  1N71 A;  1TIQ A;  3G8W A;  4R57 A;  4Y49 C;  3EXN A;  1KUX A;  3F5B A;  1B6B A;  4E0A A;  1PU9 A;  3TO6 A;  4PSW A;  2GIV A;  4JXR A;  4M3S A;  3TT2 A;  1UFH A;  5HH1 A;  3FBU A;  5I0C A;  3T90 A;  5F46 A;  5JPH A;  2OH1 A;  2OZH A;  3P2F A;  4AB7 A;  1CJW A;  2A4N A;  2HUZ A;  3LD2 A;  2J8M A;  2FS5 A;  4K30 A;  3EFA A;  1XIX A;  1PUA A;  2F5I A;  2D4P A;  2IL4 A;  4QVT A;  2P0W A;  1Z4R A;  2JDD A;  1Z9U A;  3CXP A;  3R95 A;  3R9E A;  3F8K A;  4XNH B;  3TO7 A; 
#chains in the Genus database with same CATH topology
 2CXA A;  3H8F A;  1ON0 A;  2CNM A;  4NF1 A;  2Q51 A;  3F0A A;  1KUV A;  4X3R A;  2G3A A;  1IIC A;  3V38 A;  4ZX9 A;  1CM0 A;  4RN7 A;  2V77 A;  4KUB A;  4A31 A;  1Z8W A;  5KTA A;  2Q0Y A;  3SXO A;  1MJ9 A;  1GHE A;  5J8F A;  4ORF A;  3IU2 A;  2OZU A;  4B6Z A;  1CP7 A;  2BUE A;  4NGR A;  3IIB A;  3N5F A;  1IYK A;  2GLF A;  4UCN A;  3IEH A;  2DXQ A;  4OAD A;  5H86 A;  3ISZ A;  3D7F A;  2PJ2 A;  4NGP A;  4P4D A;  4C2X A;  4KOW A;  4C2Y A;  3BJ7 A;  3SHP A;  4U9Y A;  1Y0Y A;  4CPA A;  1P0H A;  2B5G B;  3BLN A;  3SJF A;  4R9M A;  3TOB A;  2V8G A;  1YRE A;  3PB9 X;  3TE4 A;  4X5K A;  4U5Y A;  4UA3 A;  2HQY A;  5AG6 A;  4B10 A;  1LAN A;  4EVY A;  1PYT B;  5E96 A;  1I12 A;  5G20 A;  2Z3K A;  3LWU A;  2QJ8 A;  1AMP A;  2PDO A;  3KZW A;  1R3N A;  3ZJ0 A;  1PCA A;  2PJ0 A;  2O53 A;  2CIJ A;  2R8V A;  2XEI A;  4CRZ B;  2JBJ A;  5G22 A;  2CF4 A;  4LUA A;  2CTB A;  5I4M A;  1M4G A;  3E0K A;  1MJA A;  2XEF A;  2YGW A;  4UCP A;  2B58 A;  2QIR A;  4UBR A;  8CPA A;  4YWY A;  1Z8T A;  4YGO A;  4AVA A;  1YSJ A;  3TOA A;  3B2Y A;  2ZOF A;  3TCV A;  4HNX B;  4QUS A;  4C68 A;  4PSX A;  4NCZ A;  3GY9 A;  2EO8 A;  5AGE A;  3SJG A;  1QSM A;  1V0C A;  2AE6 A;  4FD7 A;  3IO1 A;  1YK3 A;  4MI4 A;  3KR5 A;  3FB3 A;  3NFZ A;  1BLL E;  1BPN A;  1YVK A;  3R9G A;  4A39 A;  4PXC A;  2WPX A;  2B3V A;  2B4B A;  4KUA A;  4X8I A;  4AXV A;  1M4D A;  2DEA A;  2HB6 A;  2V8V A;  1IGB A;  2ZEG A;  2C6P A;  1LOK A;  2PJ7 A;  4XPL A;  2GAN A;  1A2Z A;  1DTD A;  1KZF A;  1MJB A;  1U6M A;  3GIU A;  1IID A;  3NE7 A;  4NFR A;  1Z8X A;  4P6Y A;  2BCO A;  2P6E A;  1Q2Y A;  3H5Z A;  3I9S A;  3FNC A;  4MCS A;  3JVN A;  2ZPA A;  4F6A A;  3H8E A;  2P6F A;  1R57 A;  2ZXV A;  4NJR A;  4ZYQ A;  2PSW A;  3NA6 A;  5LYD A;  1I1D A;  2AFZ A;  3D2M A;  3GUX A;  4CGN A;  3CDX A;  3QAH A;  2VZZ A;  2FE7 A;  3CPA A;  3D7D A;  5ELY A;  1S5K A;  3IU1 A;  1ZG9 A;  4JJX A;  1EE3 P;  2Q7S A;  4OC4 A;  4XNH C;  3S6G A;  1XE4 A;  4CAX A;  3NH8 A;  4HNY B;  1ZG8 A;  4GXH A;  1J4J A;  2IQ6 A;  3B3C A;  3R1K A;  3PGP A;  4JYW A;  4PK2 A;  1XOV A;  2PJB A;  1QQ9 A;  4F9U A;  5C88 A;  4KZT A;  3BI0 A;  1XF8 A;  1UWY A;  2R98 A;  1MK4 A;  3C26 A;  4MBU A;  3ZZI A;  1VHO A;  3KHX A;  1VKC A;  1S7K A;  1I21 A;  3PB6 X;  2WUU A;  4CYQ A;  5KTC A;  3WC7 A;  3S6F A;  4A94 A;  2PVW A;  4JZ0 A;  5IB0 A;  2PCU A;  1XMT A;  1QMU A;  2VL1 A;  4DNC A;  4ZI6 A;  4EME A;  2Z3N A;  4HPS A;  2P6G A;  3RAM A;  4CGP A;  2BSW A;  1M4L A;  2NMT A;  2CNS A;  1CX8 A;  5F49 A;  3LOD A;  1XMB A;  4TNU A;  1TF8 A;  4PPZ A;  2REE A;  4CS0 B;  4IK2 A;  5THW A;  4P4J A;  2B4D A;  4UEE A;  2FXF A;  5C82 A;  2YNC C;  5LYL A;  1TKJ A;  5CNP A;  2VXK A;  3WAB A;  3D7G A;  4NEX A;  3K9U A;  1BO4 A;  3CXQ A;  4MFQ A;  4P44 A;  4QB9 A;  1Z4E A;  3VWD A;  2G3T A;  4XPD B;  2KCW A;  3V8I A;  2PIZ A;  1Z8L A;  3FED A;  1GYT A;  1XFO A;  1CG2 A;  4GM5 A;  3TC8 A;  3SI0 A;  5JGF A;  4CRY B;  4HNW B;  3D2P A;  3IJ3 A;  1X10 A;  4NJQ A;  3B7I A;  4H6U A;  2I3C A;  1R43 A;  1XRY A;  3D68 A;  3DDD A;  4DUK A;  4XPK A;  1YGH A;  4JLY A;  1IU8 A;  2ZEE A;  1QST A;  4MHZ A;  4B11 A;  1Y7E A;  1K4J A;  4LQ6 A;  4R76 A;  4A30 A;  4ZY2 A;  4M6G A;  4P4B A;  2ATR A;  4P4F A;  5EC4 A;  1CP6 A;  3MRU A;  4EWT A;  3FEC A;  5GCN A;  4UFX A;  2D4O A;  1LAM A;  2VQY A;  1VHE A;  3GYA A;  3JTK A;  3KGQ A;  3KL9 A;  4Z65 A;  5IV0 A;  1SQH A;  4A38 A;  2V8H A;  2WYR A;  4NGN A;  4FUU A;  4CAE A;  2JLM A;  4CAW A;  5LRJ A;  4U9Z A;  5HXD A;  2DPT A;  4K3N A;  3KR4 A;  2PR8 A;  2FIA A;  3G3S A;  1LRZ A;  1QSN A;  2ARH A;  4MY3 A;  2CTC A;  2PRQ A;  4J3G A;  1VIX A;  2XEJ A;  5J1Q A;  2PVV A;  1ARM A;  2ZW6 A;  3VH9 A;  5BWA B;  4OAE A;  4WJB A;  4P10 A;  1CBX A;  4PQA A;  2Z3O A;  2OU2 A;  4CYN A;  1AYE A;  4YRH A;  1YVO A;  1ZLH A;  1B87 A;  1Q2D A;  3B3W A;  2RFH A;  1ARL A;  2CY2 A;  4L89 A;  1YR0 A;  3A9L A;  1YME A;  3QAY A;  2H5M A;  4TWE A;  2OZG A;  4O23 A;  1XBU A;  3IGR A;  3PB4 X;  4W9Y A;  4LX9 A;  1P4N A;  4X2T A;  1IOI A;  3I3G A;  2JDC A;  1BPM A;  4P45 A;  4G1P A;  4MHY A;  5KTD A;  4P4E A;  2G9D A;  2O4H A;  4UF4 A;  1AUG A;  3DR8 A;  5G1Z A;  4CAF A;  3ISX A;  4KOX A;  3CZX A;  3HUV A;  4KVO E;  1S7L A;  3TTH A;  2AFO A;  4UWJ A;  1F57 A;  3KQX A;  1Q2C A;  3FRM A;  1TKH A;  1OZP A;  3D67 A;  2EWB A;  4YFJ A;  1HDU A;  4ZX8 A;  3DLJ A;  3S9M A;  4LQG A;  4E2A A;  5IX3 A;  1XJO A;  5DWN A;  3B3T A;  2J9A A;  2REF A;  2I00 A;  3MGD A;  4KOS A;  2DPS A;  4IF5 A;  2IJZ A;  2Z3M A;  3I1U A;  2DF5 A;  4WWV A;  3R9F A;  4B5P B;  4GS4 A;  3R96 A;  2B4D B;  4QBJ A;  1YLO A;  1OBR A;  1ZLI A;  4OC3 A;  4AVC A;  4XPD C;  1DE4 C;  5EBV A;  5LYF A;  4II9 A;  5HMN A;  4KSA A;  3PEI A;  2F7V A;  4OKO A;  4KOV A;  4FD6 A;  2ZOG A;  5AG7 A;  2Q04 A;  3TFY A;  2BL1 A;  1S7F A;  4M6H A;  4MCR A;  4KS9 A;  1Y9K A;  2V8D A;  5K8M A;  4UWI A;  2PJA A;  3KKW A;  3QB8 A;  1RO5 A;  2JBK A;  3EC4 A;  3H4Q A;  2PE3 A;  2ZEN A;  3QNV A;  4KOY A;  2ZEF A;  3WR7 A;  1QSR A;  1LFW A;  2JEW A;  3BJ8 A;  4MFL A;  4OIW A;  2ZEH A;  5HVF A;  2B3U A;  4PK3 A;  3KHZ A;  4R7M A;  6CPA A;  2BOA A;  2I79 A;  3K9T A;  4Q7A A;  3FX6 A;  4R3K A;  4CAV A;  5A27 A;  2ZEL A;  3SXN A;  3IWG A;  2R7H A;  4C7I A;  3BHX A;  2HC9 A;  3EY5 A;  4MMO A;  1ELM P;  1JQG A;  3B3V A;  4NXY A;  1HEE A;  2QVP A;  3T9Y A;  4F0X A;  2GU2 A;  1F2O A;  2PR1 A;  2GE3 A;  4ZY0 A;  2C1C A;  4UIB A;  2GFQ A;  2PJ1 A;  4RI1 A;  4DYO A;  3W6X A;  4CGO A;  1ZO0 A;  3FH4 A;  2ABZ A;  3P2H A;  3CXS A;  3MN8 A;  2K5T A;  3UY5 A;  2FCK A;  2Z11 A;  3PFO A;  3KI9 A;  4PV6 A;  2PRB A;  2Z10 A;  4B5P A;  2Q44 A;  5F48 A;  4PXD A;  5LRK A;  3D66 A;  1Q7L A;  2PC1 A;  3D3S A;  4NSQ A;  4KLW A;  2ZW4 A;  2F8H A;  3VWE A;  4B12 A;  2FIW A;  4FAI A;  2EK8 A;  3NE8 A;  2Z3P A;  4AG9 A;  1QSO A;  2AFS A;  3KQZ A;  4KOU A;  4F8Z A;  3DNS A;  2EK9 A;  3B8G A;  3NH4 A;  3RO0 A;  4CGM A;  1S3Z A;  4AG7 A;  4BMH A;  5D29 A;  3PP9 A;  4UEF A;  4B14 A;  2ZED A;  4MHD A;  3IFE A;  2X7B A;  1YX0 A;  4JWP A;  2ODF A;  3WC6 A;  2R1I A;  4JD6 A;  3TX8 A;  3KAS A;  2EUI A;  2VI7 A;  5JH9 A;  1YW6 A;  4MRI A;  4UFW A;  1Z5R A;  4YU9 A;  2PJ4 A;  5J8C A;  3S6H A;  2NSM A;  4OID A;  4L8A A;  3FEE A;  4ZGY B;  4BD9 A;  5DWM A;  1BOB A;  4M85 A;  1WWZ A;  1M1D A;  5FVJ A;  3VAT A;  2PQ8 A;  2AFM A;  4M6I A;  3FXT A;  4MHP A;  2FVG A;  2PJ3 A;  4FBE A;  3SJE A;  2CNT A;  3FIX A;  4BBH A;  3PZJ A;  5AG4 A;  4KOT A;  7CPA A;  2VBQ A;  2FSR A;  2JEV A;  4Y49 B;  2Y0M A;  2HV2 A;  4AVB A;  1VHS A;  1NMT A;  4FD5 A;  4H6Z A;  3RNZ A;  5JQ4 A;  2YNE A;  4MXU A;  4Q36 A;  1YLE A;  2AFW A;  3S9N A;  4JXQ A;  3DGV A;  3PBE A;  3S9L A;  4MHN A;  4NGM A;  2G0B A;  3EO4 A;  4HKF A;  4KLV A;  1IB1 E;  4UEZ A;  3JUW A;  3TO9 A;  2OR4 A;  4OLL A;  5EMI A;  1RXT A;  4I49 A;  1FY7 A;  5HVH A;  2Q4Y A;  4R6T A;  1Y7R A;  4KVM E;  4OC5 A;  2OOT A;  2Z0Z A;  3BI1 A;  5K8O A;  4MCP A;  3S6K A;  4CYO A;  2RC4 A;  3D7H A;  2AJ6 A;  2J8N A;  1KUY A;  5F47 A;  3CT9 A;  4RUH A;  1HDQ A;  3DR6 A;  5ISV A;  2QYV A;  4E8O A;  3PB7 X;  2POK A;  4UCM A;  3W91 A;  5H84 A;  2GRE A;  3GKR A;  1L0C A;  4ONU A;  4EFD A;  3LMS A;  2Q4V A;  2VZY A;  4MY0 A;  2NYQ A;  4PXE A;  3OWC A;  3FVL A;  2PJ8 A;  2FL4 A;  2PJ5 A;  3D8P A;  4R87 A;  3W6S A;  3WT4 A;  1FT7 A;  4H89 A;  3SI2 A;  1LCP A;  3WC5 A;  1NE9 A;  1LAP A;  2BO9 A;  3IWE A;  3RZA A;  1XEB A;  4H2K A;  5G21 A;  4A37 A;  2QEC A;  2QML A;  4ZY1 A;  3FJU A;  2ZEP A;  5A28 A;  2O28 A;  5IB9 A;  1CPS A;  2FT0 A;  4QC6 A;  1M44 A;  1CPX A;  2EBJ A;  3IC1 A;  4MJ8 A;  4BIN A;  1NSL A;  2ZEO A;  4MFP A;  3N7Z A;  4FD4 A;  1WK4 A;  1X12 A;  2C6G A;  2Z3L A;  3H8G A;  4A32 A;  5HVG A;  4NGS A;  4RS2 A;  1Y9W A;  1IYL A;  1M4I A;  3V7Z A;  4DJL A;  1IOF A;  3IWW A;  1BAV A;  2OB0 A;  4KOR A;  3GLJ A;  4IUS A;  1FNO A;  4Q38 A;  2Q7B A;  5AG5 A;  1TF9 A;  2ZW7 A;  1S7N A;  4PXB A;  5K8N A;  3L2N A;  2Q4Z A;  4C7H A;  4F0Y A;  1YQE A;  3FYN A;  3GB0 A;  3HLP A;  4R3L A;  3SJX A;  2B5G A;  3T8W A;  5LRG A;  1KWM A;  2BEI A;  1Z2L A;  2C27 A;  3LAC A;  2AFU A;  3JRU A;  1H8L A;  2WPW A;  4KSF A;  2VEZ A;  2J8R A;  2EVN A;  4ZBG A;  5F09 A;  2YNC A;  2WSA A;  1RTQ A;  2PIY A;  1YW4 A;  3B35 A;  4KVX A;  4B5O A;  2ZW5 A;  1S60 A;  3DSB A;  2ANP A;  2YND A;  1F2P A;  5CPA A;  3RYO A;  1N71 A;  1TIQ A;  2PJ6 A;  3G8W A;  2WZN A;  4OC0 A;  5DS0 A;  4R57 A;  4Y49 C;  4ONW A;  2XEG A;  1ZG7 A;  3EXN A;  2RB7 A;  4C2Z A;  1KUX A;  3VAR A;  4FWU A;  4R8F A;  1IY7 A;  5K8P A;  3F5B A;  1B6B A;  3PRT A;  4P4I A;  4OC2 A;  5JM6 A;  4E0A A;  2GLJ A;  1PU9 A;  3BXM A;  3K2K A;  3TO6 A;  4PSW A;  4CYP A;  4CGL A;  2GIV A;  2Q43 A;  4JXR A;  4M3S A;  3TT2 A;  4F9V A;  1TKF A;  4OME A;  1UFH A;  1Y0R A;  3CPX A;  4KSI A;  3D4U A;  5D8N A;  4MFK A;  5HH1 A;  5LYI A;  3FBU A;  5I0C A;  3T90 A;  5F46 A;  5JPH A;  2OH1 A;  2OZH A;  4A95 A;  3P2F A;  4AB7 A;  4NGT A;  4MCQ A;  3FF3 A;  4MFZ A;  1VGY A;  2ZEM A;  4MFJ A;  1CJW A;  2A4N A;  2HUZ A;  1JWQ A;  4IAV A;  3RBU A;  3NH5 A;  3LD2 A;  2J8M A;  4B13 A;  2AFX A;  3SI1 A;  2FS5 A;  4K30 A;  3PFE A;  3EFA A;  1XIX A;  3PB8 X;  4UFV A;  1PUA A;  5CBM A;  2PJ9 A;  3B3S A;  3PBB A;  2F5I A;  2D4P A;  2IL4 A;  4QVT A;  2P0W A;  4NGQ A;  4OP4 A;  1Z4R A;  4A2Z A;  2JDD A;  1ELL P;  1Z9U A;  3CXP A;  4A33 A;  4UIA A;  4OC1 A;  1NSA A;  3FMC A;  3R95 A;  2IMO A;  3F8K A;  3R9E A;  2C6C A;  4IHM A;  4XNH B;  3TO7 A;  1TXR A;  2PJC A; 
#chains in the Genus database with same CATH homology
 2CXA A;  1ON0 A;  2CNM A;  4NF1 A;  3F0A A;  1KUV A;  2G3A A;  1IIC A;  1CM0 A;  4KUB A;  4A31 A;  5KTA A;  2Q0Y A;  3SXO A;  1MJ9 A;  1GHE A;  5J8F A;  4ORF A;  3IU2 A;  2OZU A;  2BUE A;  1IYK A;  4UCN A;  2DXQ A;  4OAD A;  5H86 A;  4C2X A;  4KOW A;  4C2Y A;  3BJ7 A;  3SHP A;  4U9Y A;  1P0H A;  2B5G B;  3BLN A;  4R9M A;  3TOB A;  1YRE A;  3TE4 A;  4X5K A;  4U5Y A;  4UA3 A;  2HQY A;  5AG6 A;  4B10 A;  4EVY A;  5E96 A;  1I12 A;  5G20 A;  2Z3K A;  2PDO A;  3ZJ0 A;  2R8V A;  4CRZ B;  5G22 A;  4LUA A;  1M4G A;  3E0K A;  1MJA A;  2YGW A;  4UCP A;  2B58 A;  2QIR A;  4UBR A;  4YGO A;  4AVA A;  3TOA A;  3TCV A;  4HNX B;  4QUS A;  4C68 A;  4PSX A;  4NCZ A;  3GY9 A;  5AGE A;  1QSM A;  1V0C A;  2AE6 A;  4FD7 A;  1YK3 A;  4MI4 A;  3FB3 A;  1YVK A;  3R9G A;  2WPX A;  2B3V A;  2B4B A;  4KUA A;  1M4D A;  4XPL A;  1KZF A;  2GAN A;  1MJB A;  3NE7 A;  1U6M A;  1IID A;  2P6E A;  1Q2Y A;  3H5Z A;  3I9S A;  3FNC A;  3JVN A;  2ZPA A;  4F6A A;  2P6F A;  1R57 A;  2ZXV A;  2PSW A;  1I1D A;  4CGN A;  3D2M A;  3QAH A;  2VZZ A;  2FE7 A;  1S5K A;  3IU1 A;  4JJX A;  4XNH C;  3S6G A;  1XE4 A;  4CAX A;  4HNY B;  1J4J A;  3R1K A;  3PGP A;  4PK2 A;  5C88 A;  4KZT A;  1XF8 A;  2R98 A;  1MK4 A;  3C26 A;  4MBU A;  3ZZI A;  1VKC A;  1S7K A;  1I21 A;  4CYQ A;  2WUU A;  5KTC A;  3S6F A;  5IB0 A;  1XMT A;  4DNC A;  2Z3N A;  2P6G A;  4CGP A;  2BSW A;  2NMT A;  2CNS A;  5F49 A;  3LOD A;  2REE A;  4CS0 B;  2B4D A;  2FXF A;  5C82 A;  2YNC C;  5CNP A;  2VXK A;  4NEX A;  3K9U A;  1BO4 A;  3CXQ A;  4MFQ A;  4QB9 A;  1Z4E A;  3VWD A;  2G3T A;  4XPD B;  2KCW A;  3V8I A;  4CRY B;  4HNW B;  3D2P A;  4H6U A;  3DDD A;  4XPK A;  1YGH A;  4JLY A;  1QST A;  4B11 A;  1K4J A;  4A30 A;  2ATR A;  5EC4 A;  5GCN A;  4UFX A;  2D4O A;  2VQY A;  3GYA A;  3JTK A;  5IV0 A;  1SQH A;  4CAE A;  2JLM A;  4CAW A;  4U9Z A;  2DPT A;  2PR8 A;  2FIA A;  3G3S A;  1LRZ A;  1QSN A;  2ARH A;  4MY3 A;  4J3G A;  2ZW6 A;  5BWA B;  4OAE A;  2Z3O A;  2OU2 A;  4CYN A;  4YRH A;  1YVO A;  1B87 A;  1Q2D A;  2CY2 A;  4L89 A;  1YR0 A;  3A9L A;  2H5M A;  2OZG A;  3IGR A;  4LX9 A;  1P4N A;  3I3G A;  2JDC A;  5KTD A;  5G1Z A;  3DR8 A;  4CAF A;  4KOX A;  4KVO E;  1S7L A;  3TTH A;  4UWJ A;  1Q2C A;  3FRM A;  1OZP A;  4YFJ A;  4E2A A;  5IX3 A;  5DWN A;  2REF A;  3MGD A;  2I00 A;  4KOS A;  4IF5 A;  2DPS A;  2Z3M A;  3R9F A;  4B5P B;  4GS4 A;  3R96 A;  2B4D B;  4QBJ A;  4AVC A;  4XPD C;  5EBV A;  4II9 A;  5HMN A;  4KSA A;  4KOV A;  4FD6 A;  5AG7 A;  2Q04 A;  3TFY A;  2BL1 A;  1S7F A;  4KS9 A;  1Y9K A;  4UWI A;  3KKW A;  3QB8 A;  1RO5 A;  3EC4 A;  3H4Q A;  4KOY A;  3WR7 A;  1QSR A;  3BJ8 A;  4MFL A;  2B3U A;  4PK3 A;  2I79 A;  4CAV A;  5A27 A;  4R3K A;  3SXN A;  3IWG A;  2R7H A;  4C7I A;  3EY5 A;  5A28 A;  4NXY A;  4F0X A;  3T9Y A;  2PR1 A;  2GE3 A;  4RI1 A;  3W6X A;  4CGO A;  1ZO0 A;  3P2H A;  3CXS A;  2K5T A;  3UY5 A;  2FCK A;  2Z11 A;  4PV6 A;  2PRB A;  2Z10 A;  4B5P A;  2Q44 A;  5F48 A;  2PC1 A;  3D3S A;  4NSQ A;  4KLW A;  2ZW4 A;  3VWE A;  4B12 A;  2FIW A;  2Z3P A;  4AG9 A;  1QSO A;  4KOU A;  3DNS A;  3B8G A;  4CGM A;  1S3Z A;  4AG7 A;  4BMH A;  3PP9 A;  4B14 A;  4MHD A;  2X7B A;  1YX0 A;  4JWP A;  2R1I A;  4JD6 A;  2EUI A;  2VI7 A;  5J8C A;  4UFW A;  3S6H A;  4L8A A;  4ZGY B;  5DWM A;  1BOB A;  4M85 A;  1WWZ A;  1M1D A;  5FVJ A;  2PQ8 A;  3FXT A;  2CNT A;  3FIX A;  4BBH A;  3PZJ A;  5AG4 A;  4KOT A;  2VBQ A;  2FSR A;  2JEV A;  4Y49 B;  2Y0M A;  2HV2 A;  4AVB A;  1VHS A;  1NMT A;  4FD5 A;  4H6Z A;  5JQ4 A;  2YNE A;  4Q36 A;  1YLE A;  4JXQ A;  2G0B A;  3EO4 A;  4HKF A;  4KLV A;  1IB1 E;  3TO9 A;  3JUW A;  4OLL A;  1RXT A;  4I49 A;  1FY7 A;  2Q4Y A;  1Y7R A;  4KVM E;  2Z0Z A;  3S6K A;  4CYO A;  2RC4 A;  2AJ6 A;  2J8N A;  1KUY A;  5F47 A;  3DR6 A;  5ISV A;  4E8O A;  4UCM A;  3W91 A;  5H84 A;  3GKR A;  1L0C A;  4ONU A;  2Q4V A;  2VZY A;  4MY0 A;  3OWC A;  2FL4 A;  3D8P A;  4R87 A;  3W6S A;  4H89 A;  1NE9 A;  3IWE A;  1XEB A;  5G21 A;  2QEC A;  2QML A;  2O28 A;  2FT0 A;  4QC6 A;  1M44 A;  4MJ8 A;  1NSL A;  4MFP A;  3N7Z A;  4FD4 A;  1WK4 A;  2Z3L A;  4A32 A;  4RS2 A;  1Y9W A;  1IYL A;  1M4I A;  2OB0 A;  4KOR A;  2Q7B A;  4IUS A;  4Q38 A;  5AG5 A;  2ZW7 A;  1S7N A;  4C7H A;  4F0Y A;  3FYN A;  4R3L A;  2B5G A;  2BEI A;  2C27 A;  2WPW A;  4KSF A;  2VEZ A;  2J8R A;  2EVN A;  4ZBG A;  2YNC A;  2WSA A;  4KVX A;  4B5O A;  2ZW5 A;  1S60 A;  3DSB A;  2YND A;  3RYO A;  1N71 A;  1TIQ A;  3G8W A;  4R57 A;  4Y49 C;  3EXN A;  4C2Z A;  1KUX A;  3F5B A;  1B6B A;  4E0A A;  1PU9 A;  3TO6 A;  4PSW A;  4CYP A;  4CGL A;  2GIV A;  4JXR A;  4M3S A;  3TT2 A;  1UFH A;  5HH1 A;  4MFK A;  3FBU A;  5I0C A;  3T90 A;  5F46 A;  5JPH A;  2OH1 A;  2OZH A;  4A95 A;  3P2F A;  4AB7 A;  4MFZ A;  4MFJ A;  1CJW A;  2A4N A;  2HUZ A;  3LD2 A;  2J8M A;  4B13 A;  2FS5 A;  4K30 A;  3EFA A;  1XIX A;  4UFV A;  1PUA A;  2F5I A;  2D4P A;  2IL4 A;  4QVT A;  2P0W A;  1Z4R A;  4A2Z A;  2JDD A;  1Z9U A;  3CXP A;  4A33 A;  3R95 A;  3R9E A;  3F8K A;  4XNH B;  3TO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...