2CNSA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with acetylcoa.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
b'MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
molecule tags Transferase
source organism Salmonella typhimurium lt2
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
total genus 45
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnsA00
3D8PA 3IGRA 4YRHA 3BLNA 2Z10A 2J8RA 5H84A 3H4QA 1QSOA 2OZHA 1RO5A 5HH1A 1S7LA 4EVYA 4NCZA 3T9YA 3TO9A 3EXNA 2B4DB 2P6EA 3S6GA 2VQYA 2AJ6A 3QAHA 1YX0A 4KVOE 1S7KA 4CRZB 5E96A 1Y9KA 3W91A 1IIDA 4M85A 4JLYA 4MBUA 1S7FA 2B5GA 4R9MA 1M44A 4M3SA 1S7NA 1YVOA 2FE7A 4PK3A 2Z11A 4YGOA 2ATRA 2CY2A 4RI1A 4LX9A 4U5YA 3K9UA 3DR8A 4AVAA 1YREA 1WK4A 3QB8A 4R3LA 3F8KA 2Y0MA 3BJ8A 1YR0A 4QVTA 1KZFA 1IYKA 3S6KA 2BEIA 2Q0YA 2GE3A 4MI4A 1S60A 2ZW4A 2JLMA 4R57A 2DXQA 1Z9UA 4CAXA 1KUVA 4H6UA 2ZW7A 1IYLA 1MK4A 1K4JA 4PV6A 4OAEA 2Q7BA 2J8MA 3S6HA 2Q04A 1NE9A 3GYAA 1PU9A 4JJXA 1I12A 2REFA 2CNMA 4XPDC 1XF8A 3FRMA 4ZBGA 4XNHB 3CXPA 3R95A 3UY5A 2OU2A 4UBRA 3P2HA 5CNPA 2K5TA 2P6GA 1SQHA 1QSNA 1Q2DA 2J8NA 2HUZA 1QSTA 2QIRA 2VEZA 2IL4A 4CS0B 3G8WA 4R87A 3SHPA 4LUAA 2FIWA 4KZTA 4L8AA 3JUWA 2B58A 4PSXA 1U6MA 1MJ9A 5F46A 3WR7A 2R98A 4AG9A 3EO4A 2B3UA 1VKCA 3EFAA 2ZW5A 2PRBA 4E2AA 3PP9A 1BO4A 1P0HA 1PUAA 4KUAA 4KOSA 2I00A 2VBQA 1L0CA 3CXSA 4KLWA 1NMTA 3V8IA 3KKWA 1XE4A 2FS5A 2R7HA 4MY0A 1CM0A 2OB0A 4CRYB 1YK3A 2PC1A 1J4JA 5C88A 2BL1A 4KOVA 4UWJA 3TCVA 4XPKA 3LODA 1Q2YA 3FXTA 1TIQA 3G3SA 3B8GA 2O28A 2WPWA 5IV0A 2FXFA 5HMNA 2REEA 3C26A 2A4NA 2H5MA 2RC4A 2X7BA 4U9ZA 4GS4A 3MGDA 4F6AA 2VXKA 3FIXA 3FB3A 5H86A 3IWGA 3VWEA 1M4IA 4L89A 5DWNA 4I49A 4YFJA 3ZJ0A 3W6SA 2JDDA 2PSWA 5F49A 4IUSA 4QBJA 3OWCA 3NE7A 2EUIA 2HQYA 3GY9A 3TOBA 3TE4A 3JVNA 4HNYB 2CNSA 2NMTA 1WWZA 5F48A 3T90A 2G0BA 4RS2A 4QUSA 4E8OA 1Y9WA 2PQ8A 4E0AA 4KOXA 2PDOA 1LRZA 4NF1A 1M1DA 5EBVA 1MJBA 4FD7A 1Y7RA 3D2MA 3EY5A 1XMTA 3VWDA 4JXQA 5F47A 1P4NA 2FIAA 1YVKA 3TTHA 2I79A 5IB0A 2ARHA 1GHEA 2Q4YA 4II9A 4NSQA 2B5GB 5KTDA 3E0KA 4QC6A 3F5BA 3SXOA 1FY7A 3CXQA 2KCWA 4Y49B 4DNCA 4X5KA 3RYOA 2PR8A 4CAVA 2D4OA 4UWIA 2B4DA 2D4PA 4PK2A 3P2FA 4XNHC 4H6ZA 2JEVA 2ZW6A 4Y49C 4H89A 4MHDA 4XPLA 3S6FA 2C27A 3R96A 3TFYA 4K30A 1XIXA 2FT0A 1M4DA 1B6BA 2HV2A 3ZZIA 4IF5A 5I0CA 2GANA 5GCNA 2CNTA 4MY3A 4FD5A 2BSWA 3PGPA 4NXYA 4KUBA 1V0CA 1Z4EA 3D2PA 5J8CA 4B5PA 1UFHA 4ONUA 4JXRA 3PZJA 2FL4A 2QECA 3R9FA 2AE6A 1R57A 4PSWA 5DWMA 3D3SA 4KVXA 4U9YA 2R1IA 3F0AA 4JD6A 4CAWA 5C82A 4HKFA 4MJ8A 3BJ7A 4KOYA 1CJWA 3I3GA 3DNSA 3FNCA 3W6XA 1KUYA 2P0WA 4KVME 1ON0A 4QB9A 4BMHA 1I21A 2EVNA 3EC4A 2Q4VA 1RXTA 5KTAA 3TT2A 4FD4A 2ZPAA 3I9SA 5FVJA 5IX3A 2PR1A 1KUXA 4ORFA 1B87A 1OZPA 4FD6A 1Q2CA 4AVCA 4B5OA 1S5KA 4KLVA 5J8FA 2B3VA 3DR6A 2G3TA 1N71A 2F5IA 1S3ZA 2ZXVA 3TO6A 2FCKA 3TO7A 2VZYA 2Z0ZA 3LD2A 2GIVA 1QSRA 4OLLA 5EC4A 5JQ4A 4B5PB 4F0YA 1IB1E 5ISVA 4XPDB 2P6FA 2OZGA 2VI7A 2OH1A 4JWPA 3FBUA 4KOUA 2FSRA 4R3KA 2QMLA 2VZZA 3DSBA 4AVBA 1YGHA 3R1KA 2R8VA 1M4GA 1NSLA 1VHSA 4AG7A 2WPXA 1IICA 4AB7A 1Z4RA 5KTCA 2B4BA 4OADA 4KOTA 3R9GA 2Q44A 4UA3A 2OZUA 3N7ZA 4KORA 3TOAA 4NEXA 1I1DA 1MJAA 3DDDA 2BUEA 3R9EA 3FYNA 4KOWA 4HNXB 1QSMA 5JPHA 3SXNA 1XEBA 2JDCA 1YLEA 4HNWB 2G3AA 4J3GA 3GKRA 1BOBA
chains in the Genus database with same CATH superfamily
4UIBA 4OC0A 3D8PA 1ZG9A 2POKA 1TXRA 3IGRA 1Z8TA 4M6GA 5JM6A 4YRHA 2O4HA 3BLNA 4A95A 1LANA 2Z10A 4EMEA 1CX8A 2F8HA 2J8RA 5H84A 3H4QA 1BPNA 3D68A 2FVGA 2IMOA 3FJUA 3V38A 4KSAA 1BPMA 1QSOA 2OZHA 3LACA 1RO5A 2GLFA 3FEDA 2G9DA 5HH1A 1S7LA 4EVYA 4NCZA 3T9YA 1LFWA 3TO9A 3VARA 3EXNA 2XEJA 1BAVA 2B4DB 2P6EA 3S6GA 1IY7A 3KR4A 2C1CA 1AYEA 5LRJA 5K8MA 2VQYA 2AJ6A 3QAHA 1YX0A 4KVOE 1S7KA 2ZENA 4NGQA 2Q7SA 4UIAA 2C6CA 4CRZB 5E96A 5AG4A 1Y9KA 3B3WA 3W91A 5A27A 3ISXA 1IIDA 4P4FA 4M85A 1EE3P 4JLYA 4MBUA 1XJOA 1S7FA 4UCPA 2B5GA 1R3NA 4R9MA 4A2ZA 5LYDA 1M44A 1XOVA 4M3SA 1S7NA 5LYLA 1KWMA 3MRUA 3ISZA 3H8FA 1YVOA 3PB9X 2FE7A 4PK3A 2Z11A 5G22A 1Z2LA 4GXHA 2ZEDA 4NGMA 4YGOA 4A37A 2ATRA 1LAPA 2CY2A 1VIXA 2PJ8A 4LX9A 3K9UA 1CPSA 4RI1A 4U5YA 4A38A 3DGVA 1R43A 3DR8A 4DYOA 3D7HA 4ZY2A 3VATA 4OC3A 1ELMP 5ELYA 4C2ZA 1DTDA 4AVAA 2Z3PA 1YREA 1WK4A 3QB8A 4R3LA 2DEAA 3F8KA 4JYWA 2Y0MA 3BJ8A 3LMSA 1YR0A 4QVTA 1KZFA 1IYKA 3S6KA 2ODFA 2YGWA 4MFPA 2BEIA 2Q0YA 2GE3A 4MI4A 1S60A 2ZW4A 1HDUA 3D7GA 2JLMA 4R57A 2DXQA 1Z9UA 4CAXA 2DPSA 1KUVA 3CZXA 1CG2A 2EBJA 3GKRA 4H6UA 4CAEA 3HLPA 1Q7LA 1VHOA 5LRGA 3PEIA 2ZW7A 4ZI6A 4LQ6A 1IYLA 2WYRA 1MK4A 1K4JA 3B3TA 3BXMA 3JRUA 2PJAA 4TWEA 4PV6A 2Z3LA 2V8HA 4OAEA 2Q7BA 2PJ3A 2BCOA 2J8MA 4FBEA 2PRQA 3S6HA 2Q04A 4P4EA 1NE9A 2AFSA 3GYAA 1PU9A 4JJXA 4DUKA 1CP7A 1I12A 4X2TA 2REFA 3H8EA 2CNMA 4MFZA 4ZX8A 4XPDC 1XF8A 4UEZA 3PBEA 4MHYA 4O23A 3FRMA 4ZBGA 4XNHB 3PB8X 1IGBA 4NGSA 4C7HA 4CGOA 3CXPA 4NFRA 3R95A 1Z8LA 2BO9A 2RFHA 1QQ9A 4GM5A 3UY5A 2OU2A 4UBRA 3P2HA 4MFJA 5CNPA 3FX6A 3IIBA 4A39A 4F0XA 2K5TA 4OIWA 4EWTA 2P6GA 3BI0A 4RN7A 5AG7A 4P10A 1SQHA 1QSNA 1Q2DA 1TF8A 2JBKA 1Z8XA 3RBUA 2HC9A 3VH9A 2J8NA 2HUZA 4P45A 4P4JA 4A31A 1QSTA 2QIRA 2VEZA 3D4UA 2IL4A 2ZEPA 3RAMA 4CS0B 3G8WA 4KSIA 4R87A 4ZY0A 3H8GA 3IJ3A 2PJ4A 3SHPA 2OR4A 4LUAA 3IO1A 2PJ2A 2FIWA 4AXVA 2PCUA 4B14A 3KQZA 1Y0YA 4KZTA 4L8AA 3IU1A 4CYPA 3JUWA 4B11A 2ZEGA 3GLJA 2B58A 4PSXA 1U6MA 1MJ9A 5F46A 2EK8A 4MRIA 3WR7A 2R98A 1CP6A 4ZGYB 4AG9A 3EO4A 4BBHA 3B3VA 2B3UA 3IU2A 1VKCA 3EFAA 1CPXA 2J9AA 2ZW5A 3PFOA 1AUGA 4A30A 2PRBA 5G21A 2XEIA 2PE3A 4E2AA 3PP9A 1BO4A 2IJZA 2AFMA 2PIZA 3GIUA 1P0HA 1PUAA 1IOFA 4MCRA 3WABA 4KUAA 3T8WA 4IHMA 4EFDA 1A2ZA 3S9LA 2WUUA 2GFQA 4KOSA 4YWYA 3KASA 2ZOFA 1FT7A 1Y0RA 3KHZA 3K2KA 4OC2A 2I00A 2VBQA 1L0CA 3I1UA 5LYFA 4FWUA 3CXSA 4KLWA 1NMTA 3H5ZA 3NE8A 4CGLA 3V8IA 3KKWA 1XE4A 2FS5A 5LYIA 2R7HA 1OBRA 4MY0A 2YNEA 1CM0A 1XRYA 4FUUA 2OB0A 4CRYB 2PC1A 1YK3A 1J4JA 5C88A 2JBJA 2NSMA 5JGFA 3WC7A 1H8LA 4CAFA 2BL1A 4KOVA 4MHPA 3JTKA 5LRKA 4UWJA 3TCVA 4XPKA 3LODA 2BOAA 2YNCC 1TKHA 1Q2YA 4FAIA 1ZO0A 3FXTA 2DF5A 1TIQA 5F09A 3G3SA 3B8GA 1Y7EA 2O28A 2Z3OA 2WPWA 4MCQA 1PYTB 3NH4A 5IV0A 3SJFA 2FXFA 5HMNA 2REEA 5JH9A 2CXAA 3C26A 4P4DA 2A4NA 4B13A 2PVVA 2H5MA 2RC4A 2X7BA 4OP4A 2PVWA 1YQEA 4U9ZA 2ANPA 4GS4A 3MGDA 3IWEA 4F6AA 3SJXA 2VXKA 6CPAA 3FIXA 4Z65A 3PB7X 1VHEA 3FB3A 5CBMA 1XMBA 2CIJA 5H86A 3IWGA 3VWEA 1M4IA 4L89A 4UF4A 5DWNA 1PCAA 4I49A 4YFJA 8CPAA 3ZJ0A 3D7DA 3W6SA 5K8NA 2JDDA 2PSWA 5K8PA 2GREA 5G20A 3CPXA 1TF9A 4UEFA 4ZY1A 3FVLA 5F49A 3BI1A 3FEEA 4IUSA 1QMUA 4IAVA 2ZEOA 4QBJA 3OWCA 3NE7A 2Z3KA 4JZ0A 2EUIA 2C6PA 1ZLIA 2GU2A 2HQYA 4G1PA 3GY9A 5DS0A 4B6ZA 4X3RA 2ZELA 4W9YA 3PBBA 1X10A 4MMOA 2PIYA 4M6IA 4PPZA 3TOBA 3K9TA 3TE4A 3JVNA 2PJBA 3SJEA 4HNYB 1DE4C 1LAMA 1ZG8A 4C68A 2CNSA 2NMTA 4OC5A 1WWZA 4TNUA 5F48A 3DLJA 4NGNA 3T90A 2G0BA 3MN8A 4RS2A 4QUSA 4E8OA 1Y9WA 2PQ8A 2ZEEA 3CDXA 4E0AA 1IU8A 4KOXA 2PDOA 5BWAB 1IOIA 3D66A 2F7VA 1LRZA 2V8DA 5AGEA 4NF1A 1M1DA 1CBXA 5EBVA 1AMPA 1FNOA 1MJBA 4FD7A 1Y7RA 3D2MA 3EY5A 1M4LA 1XMTA 2DPTA 4UFXA 3VWDA 3TC8A 1TKFA 2HB6A 3CT9A 4JXQA 4OC4A 4R76A 5F47A 3SJGA 1P4NA 5HVFA 2YNCA 4ZX9A 3KHXA 2WZNA 2FIAA 1YVKA 4PXEA 4RUHA 1BOBA 3TTHA 2I79A 5IB0A 2ARHA 1GHEA 2JEWA 2Q4YA 4NSQA 4II9A 2B5GB 3KL9A 4C7IA 3FMCA 3PRTA 5KTDA 4CYNA 3E0KA 5A28A 4QC6A 2XEGA 3D7FA 3F5BA 3RO0A 1YMEA 4LQGA 3SXOA 1FY7A 1F57A 1HDQA 3CXQA 2KCWA 4Y49B 2PJ5A 4MHNA 2YNDA 4DNCA 4PXBA 1LCPA 4P4BA 4X5KA 3RYOA 2PR8A 1YW4A 4CAVA 2D4OA 3B2YA 4UWIA 2B4DA 4Q7AA 2EO8A 2QJ8A 3IWWA 1RTQA 2D4PA 3PB6X 4PK2A 3P2FA 4XNHC 4H6ZA 2RB7A 5G1ZA 3WC6A 1HEEA 2ABZA 2JEVA 2ZW6A 4KSFA 3PFEA 4H89A 2PJCA 4Y49C 4MHDA 4PQAA 4XPLA 5EMIA 3S6FA 3WC5A 2C27A 4WJBA 4IK2A 4MXUA 3IC1A 3R96A 3TFYA 4K30A 3N5FA 1XIXA 2FT0A 1M4DA 3SI0A 3KR5A 3S9NA 1B6BA 4H2KA 2HV2A 4OC1A 5AG6A 1NSAA 3ZZIA 4IF5A 3B7IA 3NH8A 2AFOA 5I0CA 5GCNA 2ZEFA 2CNTA 4MY3A 4CGPA 4FD5A 2BSWA 3PGPA 4NXYA 4A33A 7CPAA 4ZYQA 2QVPA 5CPAA 4KUBA 5D8NA 4CPAA 1Z8WA 3B3CA 3BHXA 2ZEMA 3LWUA 1V0CA 1Z4EA 3NA6A 3D2PA 3QNVA 5J8CA 4B5PA 1GYTA 1UFHA 3CPAA 2ZEHA 2V8GA 4ONUA 5THWA 4A94A 5J1QA 4MFKA 2OOTA 4JXRA 3PZJA 2FL4A 2QECA 1ZLHA 2ZOGA 4P6YA 2C6GA 4CGNA 3R9FA 2AE6A 1R57A 4PSWA 5DWMA 2AFWA 3RNZA 3SI1A 3D3SA 4KVXA 2Z3MA 4U9YA 2R1IA 3F0AA 4CYQA 3NH5A 4JD6A 4CAWA 4HKFA 5C82A 2Q51A 4MJ8A 3BJ7A 2PJ7A 2PJ1A 1CJWA 3FH4A 3L2NA 3I3GA 4KOYA 4OMEA 4PXDA 3DNSA 2VL1A 3FNCA 1XFOA 3W6XA 1YSJA 2AFXA 1KUYA 2P0WA 5HVHA 3V7ZA 4NJQA 4K3NA 1ARLA 4MFLA 1BLLE 4KVME 4WWVA 1ON0A 4QB9A 4BMHA 1I21A 2EVNA 4C2YA 3EC4A 3GB0A 2Q4VA 1RXTA 4BD9A 5KTAA 3TT2A 1ELLP 2CTBA 4FD4A 2PJ6A 2ZPAA 1TKJA 3I9SA 5FVJA 1F2OA 5IX3A 2O53A 3D67A 2PR1A 4B10A 1KUXA 4ORFA 1B87A 1OZPA 4FD6A 1Q2CA 2Z3NA 4AVCA 4B5OA 1S5KA 4KLVA 4NGTA 5J8FA 1VGYA 4UFWA 1ZG7A 2B3VA 3DR6A 4BINA 3FECA 3PB4X 4NGPA 3FF3A 2G3TA 4P4IA 4DJLA 4ONWA 3KI9A 2WSAA 2XEFA 4UCNA 5D29A 4MHZA 2EWBA 1N71A 4NGRA 1JWQA 2CTCA 4Q38A 2F5IA 1S3ZA 4CYOA 2ZXVA 3KGQA 3TO6A 2FCKA 3TO7A 2VZYA 2Z0ZA 3IFEA 3KQXA 4M6HA 3A9LA 5K8OA 3B3SA 3LD2A 2CF4A 2GIVA 3B35A 4PXCA 4HPSA 5I4MA 1QSRA 4MFQA 2PJ0A 3NFZA 4OLLA 2EK9A 5EC4A 1Z5RA 5JQ4A 4B5PB 4F0YA 1IB1E 1UWYA 4F9VA 5ISVA 1JQGA 2V77A 4XPDB 2P6FA 2OZGA 2VI7A 3SI2A 2OH1A 3IEHA 4JWPA 3FBUA 4KOUA 2FSRA 4R3KA 2QMLA 2VZZA 3DSBA 1X12A 2Q4ZA 2Q43A 1XBUA 2GLJA 4F8ZA 5HVGA 5HXDA 4AVBA 4KS9A 3WT4A 2V8VA 1YGHA 3R1KA 2R8VA 4A32A 4R7MA 1M4GA 1YLOA 2AFUA 3QAYA 4MCPA 4UEEA 4R8FA 1NSLA 2QYVA 4R6TA 1VHSA 3GUXA 2PJ9A 4AG7A 4C2XA 1LOKA 2WPXA 4F9UA 5AG5A 1IICA 4AB7A 1Z4RA 2I3CA 4X8IA 5KTCA 2B4BA 4OADA 4KOTA 4YU9A 3R9GA 2Q44A 4UA3A 2OZUA 3N7ZA 4Q36A 5IB9A 4KORA 3TOAA 4NJRA 4UCMA 3TX8A 4NEXA 2AFZA 1I1DA 4UFVA 1MJAA 1YW6A 3DDDA 4P44A 2BUEA 3R9EA 3FYNA 4MCSA 4OIDA 3KZWA 4KOWA 1F2PA 4HNXB 1ARMA 1QSMA 3S9MA 5JPHA 4CGMA 4OKOA 3RZAA 3SXNA 1XEBA 2JDCA 2NYQA 4B12A 1YLEA 3HUVA 4HNWB 2G3AA 4J3GA 2GANA 2IQ6A
chains in the Genus database with same CATH topology
3D8PA 3IGRA 4YRHA 3BLNA 4A95A 2Z10A 2J8RA 5H84A 3H4QA 4KSAA 1QSOA 2OZHA 1RO5A 5HH1A 1S7LA 4EVYA 4NCZA 3T9YA 3TO9A 3EXNA 2B4DB 2P6EA 3S6GA 2VQYA 2AJ6A 3QAHA 1YX0A 4KVOE 1S7KA 4CRZB 5E96A 5AG4A 1Y9KA 3W91A 5A27A 1IIDA 4M85A 4JLYA 4MBUA 1S7FA 4UCPA 2B5GA 4R9MA 4A2ZA 1M44A 4M3SA 1S7NA 1YVOA 2FE7A 4PK3A 2Z11A 5G22A 4YGOA 2ATRA 2CY2A 4RI1A 4LX9A 4U5YA 3K9UA 3DR8A 4C2ZA 4AVAA 2Z3PA 1YREA 1WK4A 3QB8A 4R3LA 3F8KA 2Y0MA 3BJ8A 1YR0A 4QVTA 1KZFA 1IYKA 3S6KA 4MFPA 2YGWA 2BEIA 2Q0YA 2GE3A 4MI4A 1S60A 2ZW4A 2JLMA 4R57A 2DXQA 1Z9UA 4CAXA 2DPSA 1KUVA 4H6UA 4CAEA 2ZW7A 1IYLA 1MK4A 1K4JA 4PV6A 2Z3LA 4OAEA 2Q7BA 2J8MA 3S6HA 2Q04A 1NE9A 3GYAA 1PU9A 4JJXA 1I12A 2REFA 2CNMA 4MFZA 4XPDC 1XF8A 3FRMA 4ZBGA 4XNHB 4C7HA 4CGOA 3CXPA 3R95A 3UY5A 2OU2A 4UBRA 3P2HA 4MFJA 5CNPA 4F0XA 2K5TA 2P6GA 5AG7A 1SQHA 1QSNA 1Q2DA 2J8NA 2HUZA 4A31A 1QSTA 2QIRA 2VEZA 2IL4A 4CS0B 3G8WA 4R87A 3SHPA 4LUAA 2FIWA 4B14A 4KZTA 4L8AA 3IU1A 4CYPA 3JUWA 4B11A 2B58A 4PSXA 1U6MA 1MJ9A 5F46A 3WR7A 2R98A 4ZGYB 4AG9A 3EO4A 4BBHA 2B3UA 3IU2A 1VKCA 3EFAA 2ZW5A 4A30A 2PRBA 5G21A 4E2AA 3PP9A 1BO4A 1P0HA 1PUAA 4KUAA 2WUUA 4KOSA 2I00A 2VBQA 1L0CA 3CXSA 4KLWA 1NMTA 3H5ZA 4CGLA 3V8IA 3KKWA 1XE4A 2FS5A 2R7HA 4MY0A 2YNEA 1CM0A 2OB0A 4CRYB 1YK3A 2PC1A 1J4JA 5C88A 4CAFA 2BL1A 4KOVA 3JTKA 4UWJA 3TCVA 4XPKA 3LODA 2YNCC 1Q2YA 1ZO0A 3FXTA 1TIQA 3G3SA 3B8GA 2O28A 2Z3OA 2WPWA 5IV0A 2FXFA 5HMNA 2REEA 2CXAA 3C26A 2A4NA 4B13A 2H5MA 2RC4A 2X7BA 4U9ZA 4GS4A 3MGDA 3IWEA 4F6AA 2VXKA 3FIXA 3FB3A 5H86A 3IWGA 3VWEA 1M4IA 4L89A 5DWNA 4I49A 4YFJA 3ZJ0A 3W6SA 2JDDA 2PSWA 5G20A 5F49A 4IUSA 4QBJA 3OWCA 3NE7A 2Z3KA 2EUIA 2HQYA 3GY9A 3TOBA 3TE4A 3JVNA 4HNYB 4C68A 2CNSA 2NMTA 1WWZA 5F48A 3T90A 2G0BA 4RS2A 4QUSA 4E8OA 1Y9WA 2PQ8A 4E0AA 4KOXA 2PDOA 5BWAB 5AGEA 1LRZA 4NF1A 1M1DA 5EBVA 1MJBA 4FD7A 1Y7RA 3D2MA 3EY5A 1XMTA 3VWDA 2DPTA 4UFXA 4JXQA 5F47A 1P4NA 2YNCA 2FIAA 1YVKA 3TTHA 2I79A 5IB0A 2ARHA 1GHEA 2Q4YA 4II9A 4NSQA 2B5GB 4C7IA 5KTDA 4CYNA 3E0KA 5A28A 4QC6A 3F5BA 3SXOA 1FY7A 3CXQA 2KCWA 4Y49B 2YNDA 4DNCA 4X5KA 3RYOA 2PR8A 4CAVA 2D4OA 4UWIA 2B4DA 2D4PA 4PK2A 3P2FA 4XNHC 4H6ZA 5G1ZA 2JEVA 2ZW6A 4KSFA 4H89A 4Y49C 4MHDA 4XPLA 3S6FA 2C27A 3R96A 3TFYA 4K30A 1XIXA 2FT0A 1M4DA 1B6BA 2HV2A 5AG6A 3ZZIA 4IF5A 5I0CA 2GANA 5GCNA 2CNTA 4MY3A 4CGPA 4FD5A 2BSWA 3PGPA 4NXYA 4A33A 4KUBA 1V0CA 1Z4EA 3D2PA 5J8CA 4B5PA 1UFHA 4ONUA 4MFKA 4JXRA 3PZJA 2FL4A 2QECA 4CGNA 3R9FA 2AE6A 1R57A 4PSWA 5DWMA 3D3SA 4KVXA 2Z3MA 4U9YA 2R1IA 3F0AA 4CYQA 4JD6A 4CAWA 5C82A 4HKFA 4MJ8A 3BJ7A 4KOYA 1CJWA 3I3GA 3DNSA 3FNCA 3W6XA 1KUYA 2P0WA 4MFLA 4KVME 1ON0A 4QB9A 4BMHA 1I21A 2EVNA 4C2YA 3EC4A 2Q4VA 1RXTA 5KTAA 3TT2A 4FD4A 2ZPAA 3I9SA 5FVJA 5IX3A 2PR1A 4B10A 1KUXA 4ORFA 1B87A 1OZPA 4FD6A 1Q2CA 2Z3NA 4AVCA 4B5OA 1S5KA 4KLVA 5J8FA 4UFWA 2B3VA 3DR6A 2G3TA 4UCNA 2WSAA 1N71A 4CYOA 4Q38A 2F5IA 1S3ZA 2ZXVA 3TO6A 2FCKA 3TO7A 2VZYA 2Z0ZA 3A9LA 3LD2A 2GIVA 1QSRA 4MFQA 4OLLA 5EC4A 5JQ4A 4B5PB 4F0YA 1IB1E 5ISVA 4XPDB 2P6FA 2OZGA 2VI7A 2OH1A 4JWPA 3FBUA 4KOUA 2FSRA 4R3KA 2QMLA 2VZZA 3DSBA 4AVBA 4KS9A 1YGHA 3R1KA 2R8VA 4A32A 1M4GA 1NSLA 1VHSA 4AG7A 4C2XA 2WPXA 5AG5A 1IICA 4AB7A 1Z4RA 5KTCA 2B4BA 4OADA 4KOTA 3R9GA 2Q44A 4UA3A 2OZUA 3N7ZA 4Q36A 4KORA 3TOAA 4UCMA 4NEXA 1I1DA 4UFVA 1MJAA 3DDDA 2BUEA 3R9EA 3FYNA 4KOWA 4HNXB 1QSMA 5JPHA 4CGMA 3SXNA 1XEBA 2JDCA 4B12A 1YLEA 4HNWB 2G3AA 4J3GA 3GKRA 1BOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8P A;  3IGR A;  4YRH A;  3BLN A;  2Z10 A;  2J8R A;  5H84 A;  3H4Q A;  1QSO A;  2OZH A;  1RO5 A;  5HH1 A;  1S7L A;  4EVY A;  4NCZ A;  3T9Y A;  3TO9 A;  3EXN A;  2B4D B;  2P6E A;  3S6G A;  2VQY A;  2AJ6 A;  3QAH A;  1YX0 A;  4KVO E;  1S7K A;  4CRZ B;  5E96 A;  1Y9K A;  3W91 A;  1IID A;  4M85 A;  4JLY A;  4MBU A;  1S7F A;  2B5G A;  4R9M A;  1M44 A;  4M3S A;  1S7N A;  1YVO A;  2FE7 A;  4PK3 A;  2Z11 A;  4YGO A;  2ATR A;  2CY2 A;  4RI1 A;  4LX9 A;  4U5Y A;  3K9U A;  3DR8 A;  4AVA A;  1YRE A;  1WK4 A;  3QB8 A;  4R3L A;  3F8K A;  2Y0M A;  3BJ8 A;  1YR0 A;  4QVT A;  1KZF A;  1IYK A;  3S6K A;  2BEI A;  2Q0Y A;  2GE3 A;  4MI4 A;  1S60 A;  2ZW4 A;  2JLM A;  4R57 A;  2DXQ A;  1Z9U A;  4CAX A;  1KUV A;  4H6U A;  2ZW7 A;  1IYL A;  1MK4 A;  1K4J A;  4PV6 A;  4OAE A;  2Q7B A;  2J8M A;  3S6H A;  2Q04 A;  1NE9 A;  3GYA A;  1PU9 A;  4JJX A;  1I12 A;  2REF A;  2CNM A;  4XPD C;  1XF8 A;  3FRM A;  4ZBG A;  4XNH B;  3CXP A;  3R95 A;  3UY5 A;  2OU2 A;  4UBR A;  3P2H A;  5CNP A;  2K5T A;  2P6G A;  1SQH A;  1QSN A;  1Q2D A;  2J8N A;  2HUZ A;  1QST A;  2QIR A;  2VEZ A;  2IL4 A;  4CS0 B;  3G8W A;  4R87 A;  3SHP A;  4LUA A;  2FIW A;  4KZT A;  4L8A A;  3JUW A;  2B58 A;  4PSX A;  1U6M A;  1MJ9 A;  5F46 A;  3WR7 A;  2R98 A;  4AG9 A;  3EO4 A;  2B3U A;  1VKC A;  3EFA A;  2ZW5 A;  2PRB A;  4E2A A;  3PP9 A;  1BO4 A;  1P0H A;  1PUA A;  4KUA A;  4KOS A;  2I00 A;  2VBQ A;  1L0C A;  3CXS A;  4KLW A;  1NMT A;  3V8I A;  3KKW A;  1XE4 A;  2FS5 A;  2R7H A;  4MY0 A;  1CM0 A;  2OB0 A;  4CRY B;  1YK3 A;  2PC1 A;  1J4J A;  5C88 A;  2BL1 A;  4KOV A;  4UWJ A;  3TCV A;  4XPK A;  3LOD A;  1Q2Y A;  3FXT A;  1TIQ A;  3G3S A;  3B8G A;  2O28 A;  2WPW A;  5IV0 A;  2FXF A;  5HMN A;  2REE A;  3C26 A;  2A4N A;  2H5M A;  2RC4 A;  2X7B A;  4U9Z A;  4GS4 A;  3MGD A;  4F6A A;  2VXK A;  3FIX A;  3FB3 A;  5H86 A;  3IWG A;  3VWE A;  1M4I A;  4L89 A;  5DWN A;  4I49 A;  4YFJ A;  3ZJ0 A;  3W6S A;  2JDD A;  2PSW A;  5F49 A;  4IUS A;  4QBJ A;  3OWC A;  3NE7 A;  2EUI A;  2HQY A;  3GY9 A;  3TOB A;  3TE4 A;  3JVN A;  4HNY B;  2CNS A;  2NMT A;  1WWZ A;  5F48 A;  3T90 A;  2G0B A;  4RS2 A;  4QUS A;  4E8O A;  1Y9W A;  2PQ8 A;  4E0A A;  4KOX A;  2PDO A;  1LRZ A;  4NF1 A;  1M1D A;  5EBV A;  1MJB A;  4FD7 A;  1Y7R A;  3D2M A;  3EY5 A;  1XMT A;  3VWD A;  4JXQ A;  5F47 A;  1P4N A;  2FIA A;  1YVK A;  3TTH A;  2I79 A;  5IB0 A;  2ARH A;  1GHE A;  2Q4Y A;  4II9 A;  4NSQ A;  2B5G B;  5KTD A;  3E0K A;  4QC6 A;  3F5B A;  3SXO A;  1FY7 A;  3CXQ A;  2KCW A;  4Y49 B;  4DNC A;  4X5K A;  3RYO A;  2PR8 A;  4CAV A;  2D4O A;  4UWI A;  2B4D A;  2D4P A;  4PK2 A;  3P2F A;  4XNH C;  4H6Z A;  2JEV A;  2ZW6 A;  4Y49 C;  4H89 A;  4MHD A;  4XPL A;  3S6F A;  2C27 A;  3R96 A;  3TFY A;  4K30 A;  1XIX A;  2FT0 A;  1M4D A;  1B6B A;  2HV2 A;  3ZZI A;  4IF5 A;  5I0C A;  2GAN A;  5GCN A;  2CNT A;  4MY3 A;  4FD5 A;  2BSW A;  3PGP A;  4NXY A;  4KUB A;  1V0C A;  1Z4E A;  3D2P A;  5J8C A;  4B5P A;  1UFH A;  4ONU A;  4JXR A;  3PZJ A;  2FL4 A;  2QEC A;  3R9F A;  2AE6 A;  1R57 A;  4PSW A;  5DWM A;  3D3S A;  4KVX A;  4U9Y A;  2R1I A;  3F0A A;  4JD6 A;  4CAW A;  5C82 A;  4HKF A;  4MJ8 A;  3BJ7 A;  4KOY A;  1CJW A;  3I3G A;  3DNS A;  3FNC A;  3W6X A;  1KUY A;  2P0W A;  4KVM E;  1ON0 A;  4QB9 A;  4BMH A;  1I21 A;  2EVN A;  3EC4 A;  2Q4V A;  1RXT A;  5KTA A;  3TT2 A;  4FD4 A;  2ZPA A;  3I9S A;  5FVJ A;  5IX3 A;  2PR1 A;  1KUX A;  4ORF A;  1B87 A;  1OZP A;  4FD6 A;  1Q2C A;  4AVC A;  4B5O A;  1S5K A;  4KLV A;  5J8F A;  2B3V A;  3DR6 A;  2G3T A;  1N71 A;  2F5I A;  1S3Z A;  2ZXV A;  3TO6 A;  2FCK A;  3TO7 A;  2VZY A;  2Z0Z A;  3LD2 A;  2GIV A;  1QSR A;  4OLL A;  5EC4 A;  5JQ4 A;  4B5P B;  4F0Y A;  1IB1 E;  5ISV A;  4XPD B;  2P6F A;  2OZG A;  2VI7 A;  2OH1 A;  4JWP A;  3FBU A;  4KOU A;  2FSR A;  4R3K A;  2QML A;  2VZZ A;  3DSB A;  4AVB A;  1YGH A;  3R1K A;  2R8V A;  1M4G A;  1NSL A;  1VHS A;  4AG7 A;  2WPX A;  1IIC A;  4AB7 A;  1Z4R A;  5KTC A;  2B4B A;  4OAD A;  4KOT A;  3R9G A;  2Q44 A;  4UA3 A;  2OZU A;  3N7Z A;  4KOR A;  3TOA A;  4NEX A;  1I1D A;  1MJA A;  3DDD A;  2BUE A;  3R9E A;  3FYN A;  4KOW A;  4HNX B;  1QSM A;  5JPH A;  3SXN A;  1XEB A;  2JDC A;  1YLE A;  4HNW B;  2G3A A;  4J3G A;  3GKR A;  1BOB A; 
#chains in the Genus database with same CATH topology
 4UIB A;  4OC0 A;  3D8P A;  1ZG9 A;  2POK A;  1TXR A;  3IGR A;  1Z8T A;  4M6G A;  5JM6 A;  4YRH A;  2O4H A;  3BLN A;  4A95 A;  1LAN A;  2Z10 A;  4EME A;  1CX8 A;  2F8H A;  2J8R A;  5H84 A;  3H4Q A;  1BPN A;  3D68 A;  2FVG A;  2IMO A;  3FJU A;  3V38 A;  4KSA A;  1BPM A;  1QSO A;  2OZH A;  3LAC A;  1RO5 A;  2GLF A;  3FED A;  2G9D A;  5HH1 A;  1S7L A;  4EVY A;  4NCZ A;  3T9Y A;  1LFW A;  3TO9 A;  3VAR A;  3EXN A;  2XEJ A;  1BAV A;  2B4D B;  2P6E A;  3S6G A;  1IY7 A;  3KR4 A;  2C1C A;  1AYE A;  5LRJ A;  5K8M A;  2VQY A;  2AJ6 A;  3QAH A;  1YX0 A;  4KVO E;  1S7K A;  2ZEN A;  4NGQ A;  2Q7S A;  4UIA A;  2C6C A;  4CRZ B;  5E96 A;  5AG4 A;  1Y9K A;  3B3W A;  3W91 A;  5A27 A;  3ISX A;  1IID A;  4P4F A;  4M85 A;  1EE3 P;  4JLY A;  4MBU A;  1XJO A;  1S7F A;  4UCP A;  2B5G A;  1R3N A;  4R9M A;  4A2Z A;  5LYD A;  1M44 A;  1XOV A;  4M3S A;  1S7N A;  5LYL A;  1KWM A;  3MRU A;  3ISZ A;  3H8F A;  1YVO A;  3PB9 X;  2FE7 A;  4PK3 A;  2Z11 A;  5G22 A;  1Z2L A;  4GXH A;  2ZED A;  4NGM A;  4YGO A;  4A37 A;  2ATR A;  1LAP A;  2CY2 A;  1VIX A;  2PJ8 A;  4LX9 A;  3K9U A;  1CPS A;  4RI1 A;  4U5Y A;  4A38 A;  3DGV A;  1R43 A;  3DR8 A;  4DYO A;  3D7H A;  4ZY2 A;  3VAT A;  4OC3 A;  1ELM P;  5ELY A;  4C2Z A;  1DTD A;  4AVA A;  2Z3P A;  1YRE A;  1WK4 A;  3QB8 A;  4R3L A;  2DEA A;  3F8K A;  4JYW A;  2Y0M A;  3BJ8 A;  3LMS A;  1YR0 A;  4QVT A;  1KZF A;  1IYK A;  3S6K A;  2ODF A;  2YGW A;  4MFP A;  2BEI A;  2Q0Y A;  2GE3 A;  4MI4 A;  1S60 A;  2ZW4 A;  1HDU A;  3D7G A;  2JLM A;  4R57 A;  2DXQ A;  1Z9U A;  4CAX A;  2DPS A;  1KUV A;  3CZX A;  1CG2 A;  2EBJ A;  3GKR A;  4H6U A;  4CAE A;  3HLP A;  1Q7L A;  1VHO A;  5LRG A;  3PEI A;  2ZW7 A;  4ZI6 A;  4LQ6 A;  1IYL A;  2WYR A;  1MK4 A;  1K4J A;  3B3T A;  3BXM A;  3JRU A;  2PJA A;  4TWE A;  4PV6 A;  2Z3L A;  2V8H A;  4OAE A;  2Q7B A;  2PJ3 A;  2BCO A;  2J8M A;  4FBE A;  2PRQ A;  3S6H A;  2Q04 A;  4P4E A;  1NE9 A;  2AFS A;  3GYA A;  1PU9 A;  4JJX A;  4DUK A;  1CP7 A;  1I12 A;  4X2T A;  2REF A;  3H8E A;  2CNM A;  4MFZ A;  4ZX8 A;  4XPD C;  1XF8 A;  4UEZ A;  3PBE A;  4MHY A;  4O23 A;  3FRM A;  4ZBG A;  4XNH B;  3PB8 X;  1IGB A;  4NGS A;  4C7H A;  4CGO A;  3CXP A;  4NFR A;  3R95 A;  1Z8L A;  2BO9 A;  2RFH A;  1QQ9 A;  4GM5 A;  3UY5 A;  2OU2 A;  4UBR A;  3P2H A;  4MFJ A;  5CNP A;  3FX6 A;  3IIB A;  4A39 A;  4F0X A;  2K5T A;  4OIW A;  4EWT A;  2P6G A;  3BI0 A;  4RN7 A;  5AG7 A;  4P10 A;  1SQH A;  1QSN A;  1Q2D A;  1TF8 A;  2JBK A;  1Z8X A;  3RBU A;  2HC9 A;  3VH9 A;  2J8N A;  2HUZ A;  4P45 A;  4P4J A;  4A31 A;  1QST A;  2QIR A;  2VEZ A;  3D4U A;  2IL4 A;  2ZEP A;  3RAM A;  4CS0 B;  3G8W A;  4KSI A;  4R87 A;  4ZY0 A;  3H8G A;  3IJ3 A;  2PJ4 A;  3SHP A;  2OR4 A;  4LUA A;  3IO1 A;  2PJ2 A;  2FIW A;  4AXV A;  2PCU A;  4B14 A;  3KQZ A;  1Y0Y A;  4KZT A;  4L8A A;  3IU1 A;  4CYP A;  3JUW A;  4B11 A;  2ZEG A;  3GLJ A;  2B58 A;  4PSX A;  1U6M A;  1MJ9 A;  5F46 A;  2EK8 A;  4MRI A;  3WR7 A;  2R98 A;  1CP6 A;  4ZGY B;  4AG9 A;  3EO4 A;  4BBH A;  3B3V A;  2B3U A;  3IU2 A;  1VKC A;  3EFA A;  1CPX A;  2J9A A;  2ZW5 A;  3PFO A;  1AUG A;  4A30 A;  2PRB A;  5G21 A;  2XEI A;  2PE3 A;  4E2A A;  3PP9 A;  1BO4 A;  2IJZ A;  2AFM A;  2PIZ A;  3GIU A;  1P0H A;  1PUA A;  1IOF A;  4MCR A;  3WAB A;  4KUA A;  3T8W A;  4IHM A;  4EFD A;  1A2Z A;  3S9L A;  2WUU A;  2GFQ A;  4KOS A;  4YWY A;  3KAS A;  2ZOF A;  1FT7 A;  1Y0R A;  3KHZ A;  3K2K A;  4OC2 A;  2I00 A;  2VBQ A;  1L0C A;  3I1U A;  5LYF A;  4FWU A;  3CXS A;  4KLW A;  1NMT A;  3H5Z A;  3NE8 A;  4CGL A;  3V8I A;  3KKW A;  1XE4 A;  2FS5 A;  5LYI A;  2R7H A;  1OBR A;  4MY0 A;  2YNE A;  1CM0 A;  1XRY A;  4FUU A;  2OB0 A;  4CRY B;  2PC1 A;  1YK3 A;  1J4J A;  5C88 A;  2JBJ A;  2NSM A;  5JGF A;  3WC7 A;  1H8L A;  4CAF A;  2BL1 A;  4KOV A;  4MHP A;  3JTK A;  5LRK A;  4UWJ A;  3TCV A;  4XPK A;  3LOD A;  2BOA A;  2YNC C;  1TKH A;  1Q2Y A;  4FAI A;  1ZO0 A;  3FXT A;  2DF5 A;  1TIQ A;  5F09 A;  3G3S A;  3B8G A;  1Y7E A;  2O28 A;  2Z3O A;  2WPW A;  4MCQ A;  1PYT B;  3NH4 A;  5IV0 A;  3SJF A;  2FXF A;  5HMN A;  2REE A;  5JH9 A;  2CXA A;  3C26 A;  4P4D A;  2A4N A;  4B13 A;  2PVV A;  2H5M A;  2RC4 A;  2X7B A;  4OP4 A;  2PVW A;  1YQE A;  4U9Z A;  2ANP A;  4GS4 A;  3MGD A;  3IWE A;  4F6A A;  3SJX A;  2VXK A;  6CPA A;  3FIX A;  4Z65 A;  3PB7 X;  1VHE A;  3FB3 A;  5CBM A;  1XMB A;  2CIJ A;  5H86 A;  3IWG A;  3VWE A;  1M4I A;  4L89 A;  4UF4 A;  5DWN A;  1PCA A;  4I49 A;  4YFJ A;  8CPA A;  3ZJ0 A;  3D7D A;  3W6S A;  5K8N A;  2JDD A;  2PSW A;  5K8P A;  2GRE A;  5G20 A;  3CPX A;  1TF9 A;  4UEF A;  4ZY1 A;  3FVL A;  5F49 A;  3BI1 A;  3FEE A;  4IUS A;  1QMU A;  4IAV A;  2ZEO A;  4QBJ A;  3OWC A;  3NE7 A;  2Z3K A;  4JZ0 A;  2EUI A;  2C6P A;  1ZLI A;  2GU2 A;  2HQY A;  4G1P A;  3GY9 A;  5DS0 A;  4B6Z A;  4X3R A;  2ZEL A;  4W9Y A;  3PBB A;  1X10 A;  4MMO A;  2PIY A;  4M6I A;  4PPZ A;  3TOB A;  3K9T A;  3TE4 A;  3JVN A;  2PJB A;  3SJE A;  4HNY B;  1DE4 C;  1LAM A;  1ZG8 A;  4C68 A;  2CNS A;  2NMT A;  4OC5 A;  1WWZ A;  4TNU A;  5F48 A;  3DLJ A;  4NGN A;  3T90 A;  2G0B A;  3MN8 A;  4RS2 A;  4QUS A;  4E8O A;  1Y9W A;  2PQ8 A;  2ZEE A;  3CDX A;  4E0A A;  1IU8 A;  4KOX A;  2PDO A;  5BWA B;  1IOI A;  3D66 A;  2F7V A;  1LRZ A;  2V8D A;  5AGE A;  4NF1 A;  1M1D A;  1CBX A;  5EBV A;  1AMP A;  1FNO A;  1MJB A;  4FD7 A;  1Y7R A;  3D2M A;  3EY5 A;  1M4L A;  1XMT A;  2DPT A;  4UFX A;  3VWD A;  3TC8 A;  1TKF A;  2HB6 A;  3CT9 A;  4JXQ A;  4OC4 A;  4R76 A;  5F47 A;  3SJG A;  1P4N A;  5HVF A;  2YNC A;  4ZX9 A;  3KHX A;  2WZN A;  2FIA A;  1YVK A;  4PXE A;  4RUH A;  1BOB A;  3TTH A;  2I79 A;  5IB0 A;  2ARH A;  1GHE A;  2JEW A;  2Q4Y A;  4NSQ A;  4II9 A;  2B5G B;  3KL9 A;  4C7I A;  3FMC A;  3PRT A;  5KTD A;  4CYN A;  3E0K A;  5A28 A;  4QC6 A;  2XEG A;  3D7F A;  3F5B A;  3RO0 A;  1YME A;  4LQG A;  3SXO A;  1FY7 A;  1F57 A;  1HDQ A;  3CXQ A;  2KCW A;  4Y49 B;  2PJ5 A;  4MHN A;  2YND A;  4DNC A;  4PXB A;  1LCP A;  4P4B A;  4X5K A;  3RYO A;  2PR8 A;  1YW4 A;  4CAV A;  2D4O A;  3B2Y A;  4UWI A;  2B4D A;  4Q7A A;  2EO8 A;  2QJ8 A;  3IWW A;  1RTQ A;  2D4P A;  3PB6 X;  4PK2 A;  3P2F A;  4XNH C;  4H6Z A;  2RB7 A;  5G1Z A;  3WC6 A;  1HEE A;  2ABZ A;  2JEV A;  2ZW6 A;  4KSF A;  3PFE A;  4H89 A;  2PJC A;  4Y49 C;  4MHD A;  4PQA A;  4XPL A;  5EMI A;  3S6F A;  3WC5 A;  2C27 A;  4WJB A;  4IK2 A;  4MXU A;  3IC1 A;  3R96 A;  3TFY A;  4K30 A;  3N5F A;  1XIX A;  2FT0 A;  1M4D A;  3SI0 A;  3KR5 A;  3S9N A;  1B6B A;  4H2K A;  2HV2 A;  4OC1 A;  5AG6 A;  1NSA A;  3ZZI A;  4IF5 A;  3B7I A;  3NH8 A;  2AFO A;  5I0C A;  5GCN A;  2ZEF A;  2CNT A;  4MY3 A;  4CGP A;  4FD5 A;  2BSW A;  3PGP A;  4NXY A;  4A33 A;  7CPA A;  4ZYQ A;  2QVP A;  5CPA A;  4KUB A;  5D8N A;  4CPA A;  1Z8W A;  3B3C A;  3BHX A;  2ZEM A;  3LWU A;  1V0C A;  1Z4E A;  3NA6 A;  3D2P A;  3QNV A;  5J8C A;  4B5P A;  1GYT A;  1UFH A;  3CPA A;  2ZEH A;  2V8G A;  4ONU A;  5THW A;  4A94 A;  5J1Q A;  4MFK A;  2OOT A;  4JXR A;  3PZJ A;  2FL4 A;  2QEC A;  1ZLH A;  2ZOG A;  4P6Y A;  2C6G A;  4CGN A;  3R9F A;  2AE6 A;  1R57 A;  4PSW A;  5DWM A;  2AFW A;  3RNZ A;  3SI1 A;  3D3S A;  4KVX A;  2Z3M A;  4U9Y A;  2R1I A;  3F0A A;  4CYQ A;  3NH5 A;  4JD6 A;  4CAW A;  4HKF A;  5C82 A;  2Q51 A;  4MJ8 A;  3BJ7 A;  2PJ7 A;  2PJ1 A;  1CJW A;  3FH4 A;  3L2N A;  3I3G A;  4KOY A;  4OME A;  4PXD A;  3DNS A;  2VL1 A;  3FNC A;  1XFO A;  3W6X A;  1YSJ A;  2AFX A;  1KUY A;  2P0W A;  5HVH A;  3V7Z A;  4NJQ A;  4K3N A;  1ARL A;  4MFL A;  1BLL E;  4KVM E;  4WWV A;  1ON0 A;  4QB9 A;  4BMH A;  1I21 A;  2EVN A;  4C2Y A;  3EC4 A;  3GB0 A;  2Q4V A;  1RXT A;  4BD9 A;  5KTA A;  3TT2 A;  1ELL P;  2CTB A;  4FD4 A;  2PJ6 A;  2ZPA A;  1TKJ A;  3I9S A;  5FVJ A;  1F2O A;  5IX3 A;  2O53 A;  3D67 A;  2PR1 A;  4B10 A;  1KUX A;  4ORF A;  1B87 A;  1OZP A;  4FD6 A;  1Q2C A;  2Z3N A;  4AVC A;  4B5O A;  1S5K A;  4KLV A;  4NGT A;  5J8F A;  1VGY A;  4UFW A;  1ZG7 A;  2B3V A;  3DR6 A;  4BIN A;  3FEC A;  3PB4 X;  4NGP A;  3FF3 A;  2G3T A;  4P4I A;  4DJL A;  4ONW A;  3KI9 A;  2WSA A;  2XEF A;  4UCN A;  5D29 A;  4MHZ A;  2EWB A;  1N71 A;  4NGR A;  1JWQ A;  2CTC A;  4Q38 A;  2F5I A;  1S3Z A;  4CYO A;  2ZXV A;  3KGQ A;  3TO6 A;  2FCK A;  3TO7 A;  2VZY A;  2Z0Z A;  3IFE A;  3KQX A;  4M6H A;  3A9L A;  5K8O A;  3B3S A;  3LD2 A;  2CF4 A;  2GIV A;  3B35 A;  4PXC A;  4HPS A;  5I4M A;  1QSR A;  4MFQ A;  2PJ0 A;  3NFZ A;  4OLL A;  2EK9 A;  5EC4 A;  1Z5R A;  5JQ4 A;  4B5P B;  4F0Y A;  1IB1 E;  1UWY A;  4F9V A;  5ISV A;  1JQG A;  2V77 A;  4XPD B;  2P6F A;  2OZG A;  2VI7 A;  3SI2 A;  2OH1 A;  3IEH A;  4JWP A;  3FBU A;  4KOU A;  2FSR A;  4R3K A;  2QML A;  2VZZ A;  3DSB A;  1X12 A;  2Q4Z A;  2Q43 A;  1XBU A;  2GLJ A;  4F8Z A;  5HVG A;  5HXD A;  4AVB A;  4KS9 A;  3WT4 A;  2V8V A;  1YGH A;  3R1K A;  2R8V A;  4A32 A;  4R7M A;  1M4G A;  1YLO A;  2AFU A;  3QAY A;  4MCP A;  4UEE A;  4R8F A;  1NSL A;  2QYV A;  4R6T A;  1VHS A;  3GUX A;  2PJ9 A;  4AG7 A;  4C2X A;  1LOK A;  2WPX A;  4F9U A;  5AG5 A;  1IIC A;  4AB7 A;  1Z4R A;  2I3C A;  4X8I A;  5KTC A;  2B4B A;  4OAD A;  4KOT A;  4YU9 A;  3R9G A;  2Q44 A;  4UA3 A;  2OZU A;  3N7Z A;  4Q36 A;  5IB9 A;  4KOR A;  3TOA A;  4NJR A;  4UCM A;  3TX8 A;  4NEX A;  2AFZ A;  1I1D A;  4UFV A;  1MJA A;  1YW6 A;  3DDD A;  4P44 A;  2BUE A;  3R9E A;  3FYN A;  4MCS A;  4OID A;  3KZW A;  4KOW A;  1F2P A;  4HNX B;  1ARM A;  1QSM A;  3S9M A;  5JPH A;  4CGM A;  4OKO A;  3RZA A;  3SXN A;  1XEB A;  2JDC A;  2NYQ A;  4B12 A;  1YLE A;  3HUV A;  4HNW B;  2G3A A;  4J3G A;  2GAN A;  2IQ6 A; 
#chains in the Genus database with same CATH homology
 3D8P A;  3IGR A;  4YRH A;  3BLN A;  4A95 A;  2Z10 A;  2J8R A;  5H84 A;  3H4Q A;  4KSA A;  1QSO A;  2OZH A;  1RO5 A;  5HH1 A;  1S7L A;  4EVY A;  4NCZ A;  3T9Y A;  3TO9 A;  3EXN A;  2B4D B;  2P6E A;  3S6G A;  2VQY A;  2AJ6 A;  3QAH A;  1YX0 A;  4KVO E;  1S7K A;  4CRZ B;  5E96 A;  5AG4 A;  1Y9K A;  3W91 A;  5A27 A;  1IID A;  4M85 A;  4JLY A;  4MBU A;  1S7F A;  4UCP A;  2B5G A;  4R9M A;  4A2Z A;  1M44 A;  4M3S A;  1S7N A;  1YVO A;  2FE7 A;  4PK3 A;  2Z11 A;  5G22 A;  4YGO A;  2ATR A;  2CY2 A;  4RI1 A;  4LX9 A;  4U5Y A;  3K9U A;  3DR8 A;  4C2Z A;  4AVA A;  2Z3P A;  1YRE A;  1WK4 A;  3QB8 A;  4R3L A;  3F8K A;  2Y0M A;  3BJ8 A;  1YR0 A;  4QVT A;  1KZF A;  1IYK A;  3S6K A;  4MFP A;  2YGW A;  2BEI A;  2Q0Y A;  2GE3 A;  4MI4 A;  1S60 A;  2ZW4 A;  2JLM A;  4R57 A;  2DXQ A;  1Z9U A;  4CAX A;  2DPS A;  1KUV A;  4H6U A;  4CAE A;  2ZW7 A;  1IYL A;  1MK4 A;  1K4J A;  4PV6 A;  2Z3L A;  4OAE A;  2Q7B A;  2J8M A;  3S6H A;  2Q04 A;  1NE9 A;  3GYA A;  1PU9 A;  4JJX A;  1I12 A;  2REF A;  2CNM A;  4MFZ A;  4XPD C;  1XF8 A;  3FRM A;  4ZBG A;  4XNH B;  4C7H A;  4CGO A;  3CXP A;  3R95 A;  3UY5 A;  2OU2 A;  4UBR A;  3P2H A;  4MFJ A;  5CNP A;  4F0X A;  2K5T A;  2P6G A;  5AG7 A;  1SQH A;  1QSN A;  1Q2D A;  2J8N A;  2HUZ A;  4A31 A;  1QST A;  2QIR A;  2VEZ A;  2IL4 A;  4CS0 B;  3G8W A;  4R87 A;  3SHP A;  4LUA A;  2FIW A;  4B14 A;  4KZT A;  4L8A A;  3IU1 A;  4CYP A;  3JUW A;  4B11 A;  2B58 A;  4PSX A;  1U6M A;  1MJ9 A;  5F46 A;  3WR7 A;  2R98 A;  4ZGY B;  4AG9 A;  3EO4 A;  4BBH A;  2B3U A;  3IU2 A;  1VKC A;  3EFA A;  2ZW5 A;  4A30 A;  2PRB A;  5G21 A;  4E2A A;  3PP9 A;  1BO4 A;  1P0H A;  1PUA A;  4KUA A;  2WUU A;  4KOS A;  2I00 A;  2VBQ A;  1L0C A;  3CXS A;  4KLW A;  1NMT A;  3H5Z A;  4CGL A;  3V8I A;  3KKW A;  1XE4 A;  2FS5 A;  2R7H A;  4MY0 A;  2YNE A;  1CM0 A;  2OB0 A;  4CRY B;  1YK3 A;  2PC1 A;  1J4J A;  5C88 A;  4CAF A;  2BL1 A;  4KOV A;  3JTK A;  4UWJ A;  3TCV A;  4XPK A;  3LOD A;  2YNC C;  1Q2Y A;  1ZO0 A;  3FXT A;  1TIQ A;  3G3S A;  3B8G A;  2O28 A;  2Z3O A;  2WPW A;  5IV0 A;  2FXF A;  5HMN A;  2REE A;  2CXA A;  3C26 A;  2A4N A;  4B13 A;  2H5M A;  2RC4 A;  2X7B A;  4U9Z A;  4GS4 A;  3MGD A;  3IWE A;  4F6A A;  2VXK A;  3FIX A;  3FB3 A;  5H86 A;  3IWG A;  3VWE A;  1M4I A;  4L89 A;  5DWN A;  4I49 A;  4YFJ A;  3ZJ0 A;  3W6S A;  2JDD A;  2PSW A;  5G20 A;  5F49 A;  4IUS A;  4QBJ A;  3OWC A;  3NE7 A;  2Z3K A;  2EUI A;  2HQY A;  3GY9 A;  3TOB A;  3TE4 A;  3JVN A;  4HNY B;  4C68 A;  2CNS A;  2NMT A;  1WWZ A;  5F48 A;  3T90 A;  2G0B A;  4RS2 A;  4QUS A;  4E8O A;  1Y9W A;  2PQ8 A;  4E0A A;  4KOX A;  2PDO A;  5BWA B;  5AGE A;  1LRZ A;  4NF1 A;  1M1D A;  5EBV A;  1MJB A;  4FD7 A;  1Y7R A;  3D2M A;  3EY5 A;  1XMT A;  3VWD A;  2DPT A;  4UFX A;  4JXQ A;  5F47 A;  1P4N A;  2YNC A;  2FIA A;  1YVK A;  3TTH A;  2I79 A;  5IB0 A;  2ARH A;  1GHE A;  2Q4Y A;  4II9 A;  4NSQ A;  2B5G B;  4C7I A;  5KTD A;  4CYN A;  3E0K A;  5A28 A;  4QC6 A;  3F5B A;  3SXO A;  1FY7 A;  3CXQ A;  2KCW A;  4Y49 B;  2YND A;  4DNC A;  4X5K A;  3RYO A;  2PR8 A;  4CAV A;  2D4O A;  4UWI A;  2B4D A;  2D4P A;  4PK2 A;  3P2F A;  4XNH C;  4H6Z A;  5G1Z A;  2JEV A;  2ZW6 A;  4KSF A;  4H89 A;  4Y49 C;  4MHD A;  4XPL A;  3S6F A;  2C27 A;  3R96 A;  3TFY A;  4K30 A;  1XIX A;  2FT0 A;  1M4D A;  1B6B A;  2HV2 A;  5AG6 A;  3ZZI A;  4IF5 A;  5I0C A;  2GAN A;  5GCN A;  2CNT A;  4MY3 A;  4CGP A;  4FD5 A;  2BSW A;  3PGP A;  4NXY A;  4A33 A;  4KUB A;  1V0C A;  1Z4E A;  3D2P A;  5J8C A;  4B5P A;  1UFH A;  4ONU A;  4MFK A;  4JXR A;  3PZJ A;  2FL4 A;  2QEC A;  4CGN A;  3R9F A;  2AE6 A;  1R57 A;  4PSW A;  5DWM A;  3D3S A;  4KVX A;  2Z3M A;  4U9Y A;  2R1I A;  3F0A A;  4CYQ A;  4JD6 A;  4CAW A;  5C82 A;  4HKF A;  4MJ8 A;  3BJ7 A;  4KOY A;  1CJW A;  3I3G A;  3DNS A;  3FNC A;  3W6X A;  1KUY A;  2P0W A;  4MFL A;  4KVM E;  1ON0 A;  4QB9 A;  4BMH A;  1I21 A;  2EVN A;  4C2Y A;  3EC4 A;  2Q4V A;  1RXT A;  5KTA A;  3TT2 A;  4FD4 A;  2ZPA A;  3I9S A;  5FVJ A;  5IX3 A;  2PR1 A;  4B10 A;  1KUX A;  4ORF A;  1B87 A;  1OZP A;  4FD6 A;  1Q2C A;  2Z3N A;  4AVC A;  4B5O A;  1S5K A;  4KLV A;  5J8F A;  4UFW A;  2B3V A;  3DR6 A;  2G3T A;  4UCN A;  2WSA A;  1N71 A;  4CYO A;  4Q38 A;  2F5I A;  1S3Z A;  2ZXV A;  3TO6 A;  2FCK A;  3TO7 A;  2VZY A;  2Z0Z A;  3A9L A;  3LD2 A;  2GIV A;  1QSR A;  4MFQ A;  4OLL A;  5EC4 A;  5JQ4 A;  4B5P B;  4F0Y A;  1IB1 E;  5ISV A;  4XPD B;  2P6F A;  2OZG A;  2VI7 A;  2OH1 A;  4JWP A;  3FBU A;  4KOU A;  2FSR A;  4R3K A;  2QML A;  2VZZ A;  3DSB A;  4AVB A;  4KS9 A;  1YGH A;  3R1K A;  2R8V A;  4A32 A;  1M4G A;  1NSL A;  1VHS A;  4AG7 A;  4C2X A;  2WPX A;  5AG5 A;  1IIC A;  4AB7 A;  1Z4R A;  5KTC A;  2B4B A;  4OAD A;  4KOT A;  3R9G A;  2Q44 A;  4UA3 A;  2OZU A;  3N7Z A;  4Q36 A;  4KOR A;  3TOA A;  4UCM A;  4NEX A;  1I1D A;  4UFV A;  1MJA A;  3DDD A;  2BUE A;  3R9E A;  3FYN A;  4KOW A;  4HNX B;  1QSM A;  5JPH A;  4CGM A;  3SXN A;  1XEB A;  2JDC A;  4B12 A;  1YLE A;  4HNW B;  2G3A A;  4J3G A;  3GKR A;  1BOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...