2CNSA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with acetylcoa.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
total genus 45
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnsA00
2R8VA 3FBUA 1KZFA 3SXOA 4KVXA 1MK4A 4JXRA 2FE7A 3VWDA 1TIQA 4JLYA 3MGDA 3PZJA 3W6XA 2CNMA 2B4BA 5C82A 3I3GA 3VWEA 1B87A 1Z4EA 5H86A 3BJ7A 2ZPAA 3F5BA 4YGOA 2OU2A 1XF8A 3T9YA 2Q44A 2NMTA 4PSWA 4M3SA 1M1DA 4QC6A 2DXQA 4LX9A 3WR7A 3TTHA 2J8RA 3K9UA 4CAWA 3PGPA 3D8PA 3QB8A 5FVJA 2P6EA 2J8MA 1CJWA 4H6ZA 1I1DA 4J3GA 2OZGA 3B8GA 3W6SA 2FS5A 3F0AA 4L8AA 3S6GA 3LD2A 4PK2A 1XIXA 2A4NA 2Z10A 4M85A 4CRZB 4BMHA 2CNSA 2G3AA 2C27A 1YR0A 5GCNA 3D2MA 4B5OA 2CY2A 4KOSA 3JUWA 3S6FA 1S3ZA 1Y9KA 4I49A 4OAEA 2PR8A 5F47A 3TCVA 4AG7A 1Q2CA 1V0CA 3DR6A 4H89A 3P2HA 2VQYA 3CXSA 4IUSA 2REEA 1IICA 5E96A 4R3KA 2BUEA 4XPLA 2VBQA 4MY0A 1K4JA 5IB0A 3LODA 4R9MA 3FNCA 3G3SA 4L89A 2FCKA 4Y49B 3GYAA 2PRBA 2OZUA 4KUAA 5F46A 2JDDA 4PV6A 3SHPA 4KLWA 3EFAA 2O28A 3R9FA 2FXFA 2B5GB 1OZPA 1KUYA 4KOTA 4AVCA 1YLEA 2OB0A 3KKWA 4KOVA 2G0BA 1Z9UA 2P6GA 4R57A 3PP9A 2GIVA 2PC1A 4AVAA 3CXPA 2IL4A 4HNWB 2D4PA 3D3SA 5KTCA 5HMNA 1Y9WA 2GANA 5DWMA 4R3LA 1Q2YA 1QSTA 2Q7BA 1YGHA 3EC4A 3I9SA 4CS0B 2EVNA 2FIAA 2BSWA 3TE4A 2ZW6A 2Z11A 2PSWA 2QECA 2ARHA 1RO5A 1S5KA 2JEVA 4X5KA 4QVTA 4AB7A 3CXQA 4II9A 1S7LA 2GE3A 3TO6A 3ZZIA 2PDOA 4UWJA 4F0YA 3DR8A 1WK4A 4RI1A 1QSMA 5H84A 1BOBA 5HH1A 1L0CA 2BL1A 2QIRA 3TT2A 3R95A 2VI7A 4FD5A 1IYLA 5F49A 5J8CA 2HV2A 2FT0A 2R98A 4HNYB 2B4DB 4U9YA 5DWNA 4LUAA 4JXQA 1NMTA 1IB1E 2ATRA 2KCWA 4XPDB 2JLMA 1S7NA 3TOAA 3BJ8A 4R87A 5I0CA 4B5PB 3S6KA 4MBUA 3GY9A 1UFHA 3P2FA 4KZTA 3FXTA 1GHEA 2F5IA 2R7HA 2WPWA 4KOYA 4U5YA 4Y49C 4NF1A 4CAVA 5ISVA 3QAHA 2G3TA 1YK3A 1KUXA 3R9EA 4E2AA 4OADA 1YREA 2B5GA 2VXKA 3EY5A 1QSRA 2ZXVA 1Q2DA 4KUBA 5IV0A 1M4IA 3W91A 3EXNA 3DSBA 1M4GA 1KUVA 2FSRA 4YRHA 4AVBA 2AE6A 3V8IA 3FB3A 3FYNA 3FIXA 1B6BA 5JQ4A 2Q4YA 3TO7A 4KOUA 2PR1A 1FY7A 1M44A 3BLNA 4MJ8A 2I79A 4FD6A 1Z4RA 2B58A 2P0WA 2CNTA 4XPKA 2WPXA 1RXTA 2REFA 1PU9A 3NE7A 4KVOE 1VKCA 3TOBA 3ZJ0A 2ZW4A 1BO4A 2Q04A 4MHDA 4F6AA 4GS4A 2FIWA 3E0KA 4NSQA 1Y7RA 2BEIA 3OWCA 4QUSA 3DDDA 1M4DA 3EO4A 4ORFA 5F48A 1NE9A 3IGRA 4NXYA 4CAXA 1QSNA 2B4DA 4NCZA 1I21A 4FD7A 4EVYA 5KTDA 1N71A 1VHSA 2R1IA 1XEBA 2X7BA 4QB9A 3H4QA 2QMLA 4MI4A 4B5PA 4HNXB 4XPDC 4XNHB 4HKFA 4E8OA 1MJAA 4YFJA 5J8FA 3D2PA 2Q4VA 5CNPA 1I12A 1S60A 1U6MA 4PK3A 5KTAA 4UWIA 2JDCA 3T90A 1ON0A 5C88A 2Q0YA 3N7ZA 2VZYA 2P6FA 4PSXA 2OH1A 1S7KA 4KVME 4KOXA 2Y0MA 1YVKA 3GKRA 1IYKA 4ZBGA 4JJXA 2RC4A 4UBRA 1P4NA 1P0HA 3IWGA 3UY5A 2B3VA 1QSOA 1XE4A 1YVOA 4E0AA 4NEXA 3F8KA 4QBJA 4K30A 2ZW5A 3SXNA 4ONUA 4KORA 1NSLA 3RYOA 2VEZA 2FL4A 4JWPA 2OZHA 2Z0ZA 4DNCA 4FD4A 2HQYA 1LRZA 4CRYB 1S7FA 2I00A 1MJ9A 3R1KA 1YX0A 2H5MA 3JVNA 3G8WA 5IX3A 2D4OA 4U9ZA 1WWZA 2B3UA 1R57A 2EUIA 4OLLA 4MY3A 4H6UA 1SQHA 4KLVA 4RS2A 3TO9A 2ZW7A 3R9GA 3FRMA 4UA3A 4AG9A 4JD6A 4IF5A 3R96A 3C26A 3DNSA 2K5TA 4KOWA 5EBVA 1XMTA 1IIDA 1MJBA 2PQ8A 2J8NA 2AJ6A 1CM0A 2VZZA 4XNHC 2HUZA 3TFYA 5EC4A 1PUAA 3S6HA 5JPHA 1J4JA
chains in the Genus database with same CATH superfamily
3RAMA 5JGFA 4R6TA 3FVLA 1F2OA 4EWTA 2R8VA 3FBUA 1KZFA 2AFZA 3SXOA 4KVXA 1YLOA 4F0XA 5A28A 4CGMA 1MK4A 5BWAB 4JXRA 1ARMA 2FE7A 4Q7AA 3VWDA 1TIQA 4JLYA 4CGNA 3MGDA 3PZJA 4ZX8A 3W6XA 4MCSA 3KI9A 2CNMA 2AFWA 4X3RA 1YQEA 2B4BA 3GLJA 4NGQA 5C82A 3I3GA 1TKHA 2V8VA 1QMUA 3T8WA 1XJOA 4M6HA 4MHPA 1B87A 3VWEA 1Z4EA 2EK8A 3SJEA 5H86A 3BJ7A 2RFHA 2ZPAA 3F5BA 3QAYA 3QNVA 4YGOA 2OU2A 3VARA 1IY7A 1F2PA 1XF8A 3T9YA 4OC0A 2Q44A 3KR4A 4B14A 2NMTA 4PSWA 4UFVA 4M3SA 1M1DA 4CYNA 4QC6A 1BAVA 4FWUA 2YNDA 1Z8LA 2DXQA 2PJCA 4LX9A 1ZG9A 2GU2A 3WR7A 4CAEA 3TTHA 2J8RA 3K9UA 4OIDA 3H8EA 2YGWA 4CAWA 4BD9A 3PGPA 4A31A 3D8PA 4KSIA 3QB8A 2O53A 5FVJA 2ZELA 4B12A 2P6EA 2J8MA 5K8MA 4OC5A 1CJWA 3B35A 4H6ZA 1IOFA 1I1DA 4J3GA 2OZGA 2HC9A 3BI1A 3SI0A 3B8GA 4LQ6A 3W6SA 2FS5A 3F0AA 5G21A 4L8AA 3S6GA 3LD2A 4PK2A 1XIXA 2A4NA 2PRQA 2Z10A 4M85A 4CRZB 2PE3A 3I1UA 4M6GA 2WSAA 4BMHA 2PIYA 2CNSA 1Z2LA 2G3AA 2C27A 3GB0A 1YR0A 5GCNA 2PJ0A 5LRGA 5KTDA 3D2MA 4B5OA 2CY2A 4NGSA 4UEZA 5AG4A 4KOSA 1KWMA 1VGYA 3IIBA 3JUWA 3S6FA 1S3ZA 1Y9KA 3CDXA 3PBBA 3PFEA 4I49A 5IB9A 5JH9A 3KQZA 5LRJA 4C7HA 4OAEA 4HPSA 2PR8A 2IQ6A 3SI2A 8CPAA 4MCPA 3SJGA 5F47A 3TCVA 1TXRA 2EWBA 1BPNA 4AG7A 2ZOGA 1Q2CA 1V0CA 2ZEGA 3DR6A 2JBJA 2BCOA 4H89A 4NGRA 3P2HA 2VQYA 2FVGA 2HB6A 3CXSA 4IUSA 2REEA 1CG2A 2EK9A 2PIZA 1XBUA 2C6GA 1IICA 1ZLIA 5E96A 3WC5A 3KGQA 4R3KA 2BUEA 3V38A 3PB8X 3FMCA 2F7VA 1BPMA 2DPSA 2PJ6A 5AG5A 4GM5A 3PB9X 4XPLA 2VBQA 4MY0A 1K4JA 1Y0YA 4Q38A 5IB0A 1TKFA 4NGNA 3LODA 3B2YA 3WT4A 2ABZA 4NFRA 4R9MA 2CF4A 3BI0A 3FNCA 2PJAA 2Z3NA 1R43A 3G3SA 5G22A 4L89A 2PJ9A 2FCKA 4IHMA 1OBRA 1CPSA 2IMOA 2ZEEA 4Y49B 3GYAA 4BBHA 2PRBA 2PJBA 1ZLHA 4MHYA 2OZUA 1YW4A 1AMPA 4KUAA 2JDDA 4JYWA 3V7ZA 5F46A 5K8PA 5LRKA 7CPAA 6CPAA 2Q4ZA 4PV6A 1ZG7A 4WJBA 3NH4A 3SHPA 4P4IA 4R8FA 1NSAA 4KLWA 3EFAA 2C1CA 2O28A 4OIWA 2PJ5A 3SJXA 3R9FA 2GLJA 1HDUA 2WZNA 3KASA 4P4EA 2AFXA 2FXFA 2B5GB 2JBKA 1OZPA 1KUYA 4KOTA 4MMOA 1BLLE 4AVCA 2ZOFA 2YNCA 1YLEA 2OB0A 3KKWA 4KOVA 2G0BA 3S9NA 3RO0A 1Z9UA 2ZEFA 2P6GA 3PB7X 4R57A 3FF3A 3HLPA 2F8HA 2YNCC 3PP9A 3B7IA 1HEEA 4MFPA 2GIVA 1TKJA 2PC1A 2DF5A 3MN8A 3CXPA 2IL4A 3NH8A 4HNWB 4X2TA 3TX8A 2PVVA 4AVAA 2D4PA 3D3SA 4CPAA 4GXHA 5KTCA 4Q36A 5HMNA 1Y9WA 2GANA 5DWMA 5AGEA 5DS0A 4R3LA 4FAIA 1Q2YA 1QSTA 2G9DA 3DGVA 3IJ3A 1YGHA 1XRYA 4R76A 2Q7BA 3TC8A 5LYLA 1ZO0A 3IU1A 3EC4A 3I9SA 4CS0B 2EVNA 2FIAA 1YW6A 5J1QA 2BSWA 1TF8A 2XEGA 2ZW6A 5F09A 2Z11A 3TE4A 2PSWA 2XEFA 3LWUA 4R7MA 3PRTA 2QECA 2V77A 2ARHA 2PJ8A 1R3NA 5LYFA 5JM6A 4UIAA 4A39A 3H8FA 1RO5A 1S5KA 2JEVA 4X5KA 4KSAA 4QVTA 4CYQA 4AB7A 4CGPA 2EBJA 2Z3PA 3CXQA 4II9A 1S7LA 2GE3A 3TO6A 1CP6A 3MRUA 1X10A 3ZZIA 2PDOA 4UWJA 1EE3P 3IU2A 4W9YA 4F0YA 3DR8A 1WK4A 4RI1A 4P4FA 1QSMA 5H84A 4A30A 1Z5RA 1BOBA 2AFUA 1A2ZA 5HH1A 1L0CA 2BL1A 2QIRA 4A33A 1QQ9A 3WC6A 4P4JA 3R95A 1PYTB 3TT2A 2VI7A 4FD5A 1IYLA 5F49A 4YU9A 5ELYA 5J8CA 2HV2A 2V8DA 2FT0A 2ZEHA 2R98A 3D66A 2B4DB 4HNYB 4U9YA 5D29A 5DWNA 4LUAA 4ZGYB 4JXQA 1VIXA 1F57A 4MRIA 4NJRA 4MFQA 1NMTA 1IB1E 3KQXA 2WYRA 2ATRA 2KCWA 4XPDB 2JLMA 1S7NA 4ZY0A 1LOKA 2Z3LA 4CAFA 3BHXA 3TOAA 2Q43A 3BJ8A 4R87A 2C6CA 5I0CA 1Z8WA 4B5PB 1Z8TA 3S6KA 4MBUA 3FECA 3GY9A 1Y0RA 1UFHA 3P2FA 3PB4X 4KZTA 3FXTA 1GHEA 2F5IA 2R7HA 2WPWA 4KOYA 1LAPA 4U5YA 4PXDA 2CTBA 4Y49C 4NF1A 3B3CA 3PFOA 5CPAA 4CAVA 3S9LA 5ISVA 4ZY2A 3N5FA 4A37A 4UEEA 3QAHA 4C68A 2G3TA 4UCPA 1YK3A 3SI1A 3B3WA 3LMSA 1KUXA 3R9EA 1CP7A 4E2AA 4OADA 1YREA 2B5GA 2VXKA 3EY5A 3NH5A 4C7IA 1QSRA 2ZXVA 1Q2DA 4KUBA 2VL1A 4UCMA 2ZEOA 2O4HA 5IV0A 1M4IA 4RUHA 3H8GA 4WWVA 3EXNA 3VH9A 3W91A 4EFDA 2PVWA 1H8LA 3DSBA 1M4GA 3IC1A 1Q7LA 4P45A 2J9AA 4AXVA 1KUVA 1Y7EA 2FSRA 4YRHA 4AVBA 2AE6A 3IWEA 3D7FA 2GLFA 4IK2A 3V8IA 3FB3A 4DUKA 4OC4A 3FYNA 3FIXA 4OC3A 5I4MA 5G1ZA 4FBEA 1B6BA 5HXDA 4NGTA 2Q4YA 5JQ4A 3TO7A 4KOUA 2C6PA 2PR1A 1FY7A 2GFQA 3S9MA 2XEJA 3WABA 2CIJA 1M44A 3BLNA 4MJ8A 2I79A 4FD6A 4OKOA 4PQAA 1Z4RA 4B11A 4UFWA 2B58A 2P0WA 3RNZA 2CNTA 5G20A 4XPKA 2WPXA 1RXTA 1AUGA 1JWQA 1M4LA 1PU9A 2REFA 3IO1A 3NE7A 1VKCA 3PB6X 4KVOE 5LYDA 3A9LA 2PJ4A 2CXAA 4CYOA 3TOBA 3ZJ0A 2ZW4A 1BO4A 2Q04A 4MHDA 1PCAA 3RZAA 1YMEA 5K8NA 4A38A 3CZXA 3KHXA 3CT9A 4A94A 4F6AA 4NJQA 4OMEA 1FNOA 3PBEA 4GS4A 2FIWA 3E0KA 5D8NA 4NSQA 1Y7RA 4P4BA 4ZI6A 2BEIA 3OWCA 4QUSA 3KHZA 2ZEDA 3BXMA 3DDDA 1IU8A 1HDQA 1M4DA 4OC2A 4TNUA 2Z3OA 2DEAA 3EO4A 4A32A 4C2YA 4F9UA 4Z65A 4TWEA 4ORFA 5F48A 3KL9A 4B10A 1NE9A 3IGRA 4KS9A 4NXYA 4FUUA 4CAXA 1QSNA 2B4DA 3D67A 3NFZA 4UCNA 4NCZA 1CBXA 1I21A 1Z8XA 4ONWA 4B6ZA 4FD7A 4EVYA 2GREA 4G1PA 3K9TA 1N71A 1VHSA 2R1IA 1XEBA 2X7BA 4QB9A 3H4QA 5AG6A 2OOTA 1LCPA 5HVHA 2V8GA 5CBMA 1JQGA 3SJFA 2QMLA 4MI4A 4B5PA 3D7GA 4HNXB 4EMEA 1CPXA 2ZENA 2RB7A 3CPAA 4XPDC 3WC7A 4XNHB 4HKFA 4E8OA 2AFMA 3JTKA 4BINA 1MJAA 1UWYA 4F8ZA 4YFJA 2QVPA 5J8FA 3D2PA 2Q4VA 4OC1A 5CNPA 1GYTA 1I12A 2CTCA 1S60A 1U6MA 2PJ2A 4H2KA 4IAVA 3ISXA 4PK3A 4C2ZA 4F9VA 3FX6A 3JRUA 4P44A 4UIBA 5KTAA 3KR5A 4X8IA 1DTDA 4UWIA 2JDCA 4P6YA 3T90A 1FT7A 1ON0A 2BO9A 3NA6A 4CYPA 3FEDA 5C88A 3GUXA 2Q0YA 3N7ZA 2VZYA 1ELLP 2P6FA 2AFOA 4KSFA 4PSXA 2OH1A 2AFSA 1S7KA 3D68A 4KVME 4KOXA 4LQGA 4MXUA 4NGPA 2PCUA 1YVKA 2IJZA 2Y0MA 3GKRA 1IYKA 1ZG8A 2V8HA 3FH4A 4ZBGA 4JJXA 4MFZA 3KZWA 4K3NA 2RC4A 4NGMA 4UBRA 5EMIA 4O23A 1P4NA 4DYOA 1P0HA 3B3VA 4PXBA 3IWGA 2NSMA 3IEHA 3UY5A 2B3VA 1QSOA 1XOVA 2I3CA 4MFKA 1XE4A 1YVOA 5AG7A 1VHEA 4ZYQA 4E0AA 4ZY1A 2ZEMA 2PJ1A 4NEXA 3F8KA 4UF4A 4QBJA 4K30A 2ZW5A 3SXNA 4ONUA 4MFLA 1LFWA 4KORA 3D7HA 4UEFA 3RBUA 2DPTA 1NSLA 1LAMA 2WUUA 3FEEA 2VEZA 3RYOA 2FL4A 3ISZA 3DLJA 4JWPA 4B13A 2OZHA 3K2KA 3D4UA 4CGOA 1YSJA 1X12A 4DJLA 2Z0ZA 1VHOA 2OR4A 4FD4A 4DNCA 4YWYA 2HQYA 4RN7A 1LRZA 3LACA 2Z3MA 4CRYB 1S7FA 2I00A 1MJ9A 5THWA 3B3SA 3HUVA 3R1KA 1YX0A 3D7DA 2H5MA 1LANA 2Z3KA 3JVNA 3G8WA 5IX3A 4CGLA 1ARLA 2D4OA 1DE4C 2QYVA 4U9ZA 1WWZA 2QJ8A 3IFEA 4C2XA 2ZEPA 4M6IA 1TF9A 2PJ3A 4P4DA 4PXCA 2B3UA 1R57A 2EUIA 2JEWA 3L2NA 2Q7SA 4MY3A 4OLLA 4UFXA 4JZ0A 4H6UA 4MCQA 4ZX9A 1SQHA 2Q51A 4KLVA 1AYEA 2YNEA 4RS2A 3TO9A 5HVFA 1IOIA 5A27A 1CX8A 2ZW7A 4MHZA 2PJ7A 4PPZA 4P10A 3R9GA 3CPXA 3IWWA 3FRMA 2NYQA 4UA3A 4AG9A 1XFOA 4JD6A 3B3TA 4IF5A 4MCRA 3R96A 3C26A 3DNSA 3NE8A 3GIUA 2K5TA 4KOWA 4MFJA 5EBVA 1XMTA 1IIDA 1MJBA 2BOAA 1XMBA 2PQ8A 3VATA 5HVGA 3FJUA 2POKA 1RTQA 1IGBA 4PXEA 2J8NA 4MHNA 2AJ6A 1CM0A 2VZZA 4A2ZA 4XNHC 2HUZA 3TFYA 3PEIA 5K8OA 4A95A 5EC4A 1PUAA 2ODFA 1ELMP 3S6HA 5JPHA 3H5ZA 2EO8A 4OP4A 2XEIA 1J4JA 2ANPA 5LYIA
chains in the Genus database with same CATH topology
2R8VA 3FBUA 1KZFA 3SXOA 4KVXA 4F0XA 5A28A 4CGMA 1MK4A 5BWAB 4JXRA 2FE7A 3VWDA 1TIQA 4JLYA 4CGNA 3MGDA 3PZJA 3W6XA 2CNMA 2B4BA 5C82A 3I3GA 3VWEA 1B87A 1Z4EA 5H86A 3BJ7A 2ZPAA 3F5BA 4YGOA 2OU2A 1XF8A 3T9YA 2Q44A 4B14A 2NMTA 4PSWA 4UFVA 4M3SA 1M1DA 4CYNA 4QC6A 2YNDA 2DXQA 4LX9A 3WR7A 4CAEA 3TTHA 2J8RA 3K9UA 4CAWA 2YGWA 3PGPA 4A31A 3D8PA 3QB8A 5FVJA 2P6EA 2J8MA 1CJWA 4H6ZA 1I1DA 4J3GA 2OZGA 3B8GA 3W6SA 2FS5A 3F0AA 5G21A 4L8AA 3S6GA 3LD2A 4PK2A 1XIXA 2A4NA 2Z10A 4M85A 4CRZB 4BMHA 2WSAA 2CNSA 2G3AA 2C27A 1YR0A 5GCNA 3D2MA 4B5OA 2CY2A 5AG4A 4KOSA 3JUWA 3S6FA 1S3ZA 1Y9KA 4I49A 4C7HA 4OAEA 2PR8A 5F47A 3TCVA 4AG7A 1Q2CA 1V0CA 3DR6A 4H89A 3P2HA 2VQYA 3CXSA 4IUSA 2REEA 1IICA 5E96A 4R3KA 2BUEA 2DPSA 5AG5A 4XPLA 2VBQA 4MY0A 1K4JA 4Q38A 5IB0A 3LODA 4R9MA 3FNCA 2Z3NA 3G3SA 5G22A 4L89A 2FCKA 4Y49B 3GYAA 4BBHA 2PRBA 2OZUA 4KUAA 5F46A 2JDDA 4PV6A 3SHPA 4KLWA 3EFAA 2O28A 3R9FA 2FXFA 2B5GB 1OZPA 1KUYA 4KOTA 4AVCA 2YNCA 1YLEA 2OB0A 3KKWA 4KOVA 2G0BA 1Z9UA 2P6GA 4R57A 2YNCC 3PP9A 4MFPA 2GIVA 2PC1A 4B12A 4AVAA 3CXPA 2IL4A 4HNWB 2D4PA 3D3SA 5KTCA 4Q36A 5HMNA 1Y9WA 2GANA 5DWMA 5AGEA 4R3LA 1Q2YA 1QSTA 2Q7BA 1YGHA 1ZO0A 3IU1A 3EC4A 3I9SA 4CS0B 2EVNA 2FIAA 2BSWA 3TE4A 2ZW6A 2Z11A 2PSWA 2QECA 2ARHA 1RO5A 1S5KA 2JEVA 4X5KA 4KSAA 4QVTA 4CYQA 4AB7A 4CGPA 2Z3PA 3CXQA 4II9A 1S7LA 2GE3A 3TO6A 3ZZIA 2PDOA 4UWJA 3IU2A 4F0YA 3DR8A 1WK4A 4RI1A 1QSMA 5H84A 4A30A 1BOBA 5HH1A 1L0CA 2BL1A 2QIRA 4A33A 3TT2A 3R95A 2VI7A 4FD5A 1IYLA 5F49A 5J8CA 2HV2A 2FT0A 2R98A 4HNYB 2B4DB 4U9YA 5DWNA 4LUAA 4ZGYB 4JXQA 4MFQA 1NMTA 1IB1E 2ATRA 2KCWA 4XPDB 2JLMA 1S7NA 2Z3LA 4CAFA 3TOAA 3BJ8A 4R87A 5I0CA 4B5PB 3S6KA 4MBUA 3GY9A 1UFHA 3P2FA 4KZTA 3FXTA 1GHEA 2F5IA 2R7HA 2WPWA 4KOYA 4U5YA 4Y49C 4NF1A 4CAVA 5ISVA 3QAHA 4C68A 2G3TA 4UCPA 1YK3A 1KUXA 3R9EA 4E2AA 4OADA 1YREA 2B5GA 2VXKA 3EY5A 4C7IA 1QSRA 2ZXVA 1Q2DA 4KUBA 4UCMA 5IV0A 1M4IA 3W91A 3EXNA 3DSBA 1M4GA 1KUVA 2FSRA 4YRHA 4AVBA 2AE6A 3IWEA 3V8IA 3FB3A 3FYNA 3FIXA 5G1ZA 1B6BA 5JQ4A 2Q4YA 3TO7A 4KOUA 2PR1A 1FY7A 1M44A 3BLNA 4MJ8A 2I79A 4FD6A 4B11A 1Z4RA 4UFWA 2B58A 2P0WA 2CNTA 5G20A 4XPKA 2WPXA 1RXTA 2REFA 1PU9A 3NE7A 4KVOE 1VKCA 3A9LA 2CXAA 4CYOA 3TOBA 3ZJ0A 2ZW4A 1BO4A 2Q04A 4MHDA 4F6AA 4GS4A 2FIWA 3E0KA 4NSQA 1Y7RA 2BEIA 3OWCA 4QUSA 3DDDA 1M4DA 2Z3OA 3EO4A 4A32A 4C2YA 4ORFA 5F48A 4B10A 1NE9A 3IGRA 4KS9A 4NXYA 4CAXA 1QSNA 2B4DA 4UCNA 4NCZA 1I21A 4FD7A 4EVYA 5AG6A 5KTDA 1N71A 1VHSA 2R1IA 1XEBA 2X7BA 4QB9A 3H4QA 2QMLA 4MI4A 4B5PA 4HNXB 4XPDC 4XNHB 4HKFA 4E8OA 3JTKA 1MJAA 4YFJA 5J8FA 3D2PA 2Q4VA 5CNPA 1I12A 1S60A 1U6MA 4PK3A 4C2ZA 5KTAA 4UWIA 2JDCA 3T90A 1ON0A 4CYPA 5C88A 2Q0YA 3N7ZA 2VZYA 2P6FA 4KSFA 4PSXA 2OH1A 1S7KA 4KVME 4KOXA 2Y0MA 1YVKA 3GKRA 1IYKA 4ZBGA 4JJXA 4MFZA 2RC4A 4UBRA 1P4NA 1P0HA 3IWGA 3UY5A 2B3VA 1QSOA 4MFKA 1XE4A 1YVOA 5AG7A 4E0AA 4NEXA 3F8KA 4QBJA 4K30A 2ZW5A 3SXNA 4ONUA 4MFLA 4KORA 2DPTA 1NSLA 2WUUA 3RYOA 2VEZA 2FL4A 4JWPA 4B13A 2OZHA 4CGOA 2Z0ZA 4DNCA 4FD4A 2HQYA 1LRZA 2Z3MA 4CRYB 1S7FA 2I00A 1MJ9A 3R1KA 1YX0A 2H5MA 2Z3KA 3JVNA 3G8WA 5IX3A 4CGLA 2D4OA 4U9ZA 4C2XA 1WWZA 4A95A 2B3UA 1R57A 2EUIA 4OLLA 4MY3A 4UFXA 4H6UA 1SQHA 4KLVA 2YNEA 4RS2A 3TO9A 5A27A 2ZW7A 3R9GA 3FRMA 4UA3A 4AG9A 4JD6A 4IF5A 3R96A 3C26A 3DNSA 4MFJA 2K5TA 4KOWA 5EBVA 1XMTA 1IIDA 1MJBA 2PQ8A 2J8NA 2AJ6A 1CM0A 2VZZA 4A2ZA 4XNHC 2HUZA 3TFYA 5EC4A 1PUAA 3S6HA 5JPHA 3H5ZA 1J4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8V A;  3FBU A;  1KZF A;  3SXO A;  4KVX A;  1MK4 A;  4JXR A;  2FE7 A;  3VWD A;  1TIQ A;  4JLY A;  3MGD A;  3PZJ A;  3W6X A;  2CNM A;  2B4B A;  5C82 A;  3I3G A;  3VWE A;  1B87 A;  1Z4E A;  5H86 A;  3BJ7 A;  2ZPA A;  3F5B A;  4YGO A;  2OU2 A;  1XF8 A;  3T9Y A;  2Q44 A;  2NMT A;  4PSW A;  4M3S A;  1M1D A;  4QC6 A;  2DXQ A;  4LX9 A;  3WR7 A;  3TTH A;  2J8R A;  3K9U A;  4CAW A;  3PGP A;  3D8P A;  3QB8 A;  5FVJ A;  2P6E A;  2J8M A;  1CJW A;  4H6Z A;  1I1D A;  4J3G A;  2OZG A;  3B8G A;  3W6S A;  2FS5 A;  3F0A A;  4L8A A;  3S6G A;  3LD2 A;  4PK2 A;  1XIX A;  2A4N A;  2Z10 A;  4M85 A;  4CRZ B;  4BMH A;  2CNS A;  2G3A A;  2C27 A;  1YR0 A;  5GCN A;  3D2M A;  4B5O A;  2CY2 A;  4KOS A;  3JUW A;  3S6F A;  1S3Z A;  1Y9K A;  4I49 A;  4OAE A;  2PR8 A;  5F47 A;  3TCV A;  4AG7 A;  1Q2C A;  1V0C A;  3DR6 A;  4H89 A;  3P2H A;  2VQY A;  3CXS A;  4IUS A;  2REE A;  1IIC A;  5E96 A;  4R3K A;  2BUE A;  4XPL A;  2VBQ A;  4MY0 A;  1K4J A;  5IB0 A;  3LOD A;  4R9M A;  3FNC A;  3G3S A;  4L89 A;  2FCK A;  4Y49 B;  3GYA A;  2PRB A;  2OZU A;  4KUA A;  5F46 A;  2JDD A;  4PV6 A;  3SHP A;  4KLW A;  3EFA A;  2O28 A;  3R9F A;  2FXF A;  2B5G B;  1OZP A;  1KUY A;  4KOT A;  4AVC A;  1YLE A;  2OB0 A;  3KKW A;  4KOV A;  2G0B A;  1Z9U A;  2P6G A;  4R57 A;  3PP9 A;  2GIV A;  2PC1 A;  4AVA A;  3CXP A;  2IL4 A;  4HNW B;  2D4P A;  3D3S A;  5KTC A;  5HMN A;  1Y9W A;  2GAN A;  5DWM A;  4R3L A;  1Q2Y A;  1QST A;  2Q7B A;  1YGH A;  3EC4 A;  3I9S A;  4CS0 B;  2EVN A;  2FIA A;  2BSW A;  3TE4 A;  2ZW6 A;  2Z11 A;  2PSW A;  2QEC A;  2ARH A;  1RO5 A;  1S5K A;  2JEV A;  4X5K A;  4QVT A;  4AB7 A;  3CXQ A;  4II9 A;  1S7L A;  2GE3 A;  3TO6 A;  3ZZI A;  2PDO A;  4UWJ A;  4F0Y A;  3DR8 A;  1WK4 A;  4RI1 A;  1QSM A;  5H84 A;  1BOB A;  5HH1 A;  1L0C A;  2BL1 A;  2QIR A;  3TT2 A;  3R95 A;  2VI7 A;  4FD5 A;  1IYL A;  5F49 A;  5J8C A;  2HV2 A;  2FT0 A;  2R98 A;  4HNY B;  2B4D B;  4U9Y A;  5DWN A;  4LUA A;  4JXQ A;  1NMT A;  1IB1 E;  2ATR A;  2KCW A;  4XPD B;  2JLM A;  1S7N A;  3TOA A;  3BJ8 A;  4R87 A;  5I0C A;  4B5P B;  3S6K A;  4MBU A;  3GY9 A;  1UFH A;  3P2F A;  4KZT A;  3FXT A;  1GHE A;  2F5I A;  2R7H A;  2WPW A;  4KOY A;  4U5Y A;  4Y49 C;  4NF1 A;  4CAV A;  5ISV A;  3QAH A;  2G3T A;  1YK3 A;  1KUX A;  3R9E A;  4E2A A;  4OAD A;  1YRE A;  2B5G A;  2VXK A;  3EY5 A;  1QSR A;  2ZXV A;  1Q2D A;  4KUB A;  5IV0 A;  1M4I A;  3W91 A;  3EXN A;  3DSB A;  1M4G A;  1KUV A;  2FSR A;  4YRH A;  4AVB A;  2AE6 A;  3V8I A;  3FB3 A;  3FYN A;  3FIX A;  1B6B A;  5JQ4 A;  2Q4Y A;  3TO7 A;  4KOU A;  2PR1 A;  1FY7 A;  1M44 A;  3BLN A;  4MJ8 A;  2I79 A;  4FD6 A;  1Z4R A;  2B58 A;  2P0W A;  2CNT A;  4XPK A;  2WPX A;  1RXT A;  2REF A;  1PU9 A;  3NE7 A;  4KVO E;  1VKC A;  3TOB A;  3ZJ0 A;  2ZW4 A;  1BO4 A;  2Q04 A;  4MHD A;  4F6A A;  4GS4 A;  2FIW A;  3E0K A;  4NSQ A;  1Y7R A;  2BEI A;  3OWC A;  4QUS A;  3DDD A;  1M4D A;  3EO4 A;  4ORF A;  5F48 A;  1NE9 A;  3IGR A;  4NXY A;  4CAX A;  1QSN A;  2B4D A;  4NCZ A;  1I21 A;  4FD7 A;  4EVY A;  5KTD A;  1N71 A;  1VHS A;  2R1I A;  1XEB A;  2X7B A;  4QB9 A;  3H4Q A;  2QML A;  4MI4 A;  4B5P A;  4HNX B;  4XPD C;  4XNH B;  4HKF A;  4E8O A;  1MJA A;  4YFJ A;  5J8F A;  3D2P A;  2Q4V A;  5CNP A;  1I12 A;  1S60 A;  1U6M A;  4PK3 A;  5KTA A;  4UWI A;  2JDC A;  3T90 A;  1ON0 A;  5C88 A;  2Q0Y A;  3N7Z A;  2VZY A;  2P6F A;  4PSX A;  2OH1 A;  1S7K A;  4KVM E;  4KOX A;  2Y0M A;  1YVK A;  3GKR A;  1IYK A;  4ZBG A;  4JJX A;  2RC4 A;  4UBR A;  1P4N A;  1P0H A;  3IWG A;  3UY5 A;  2B3V A;  1QSO A;  1XE4 A;  1YVO A;  4E0A A;  4NEX A;  3F8K A;  4QBJ A;  4K30 A;  2ZW5 A;  3SXN A;  4ONU A;  4KOR A;  1NSL A;  3RYO A;  2VEZ A;  2FL4 A;  4JWP A;  2OZH A;  2Z0Z A;  4DNC A;  4FD4 A;  2HQY A;  1LRZ A;  4CRY B;  1S7F A;  2I00 A;  1MJ9 A;  3R1K A;  1YX0 A;  2H5M A;  3JVN A;  3G8W A;  5IX3 A;  2D4O A;  4U9Z A;  1WWZ A;  2B3U A;  1R57 A;  2EUI A;  4OLL A;  4MY3 A;  4H6U A;  1SQH A;  4KLV A;  4RS2 A;  3TO9 A;  2ZW7 A;  3R9G A;  3FRM A;  4UA3 A;  4AG9 A;  4JD6 A;  4IF5 A;  3R96 A;  3C26 A;  3DNS A;  2K5T A;  4KOW A;  5EBV A;  1XMT A;  1IID A;  1MJB A;  2PQ8 A;  2J8N A;  2AJ6 A;  1CM0 A;  2VZZ A;  4XNH C;  2HUZ A;  3TFY A;  5EC4 A;  1PUA A;  3S6H A;  5JPH A;  1J4J A; 
#chains in the Genus database with same CATH topology
 3RAM A;  5JGF A;  4R6T A;  3FVL A;  1F2O A;  4EWT A;  2R8V A;  3FBU A;  1KZF A;  2AFZ A;  3SXO A;  4KVX A;  1YLO A;  4F0X A;  5A28 A;  4CGM A;  1MK4 A;  5BWA B;  4JXR A;  1ARM A;  2FE7 A;  4Q7A A;  3VWD A;  1TIQ A;  4JLY A;  4CGN A;  3MGD A;  3PZJ A;  4ZX8 A;  3W6X A;  4MCS A;  3KI9 A;  2CNM A;  2AFW A;  4X3R A;  1YQE A;  2B4B A;  3GLJ A;  4NGQ A;  5C82 A;  3I3G A;  1TKH A;  2V8V A;  1QMU A;  3T8W A;  1XJO A;  4M6H A;  4MHP A;  1B87 A;  3VWE A;  1Z4E A;  2EK8 A;  3SJE A;  5H86 A;  3BJ7 A;  2RFH A;  2ZPA A;  3F5B A;  3QAY A;  3QNV A;  4YGO A;  2OU2 A;  3VAR A;  1IY7 A;  1F2P A;  1XF8 A;  3T9Y A;  4OC0 A;  2Q44 A;  3KR4 A;  4B14 A;  2NMT A;  4PSW A;  4UFV A;  4M3S A;  1M1D A;  4CYN A;  4QC6 A;  1BAV A;  4FWU A;  2YND A;  1Z8L A;  2DXQ A;  2PJC A;  4LX9 A;  1ZG9 A;  2GU2 A;  3WR7 A;  4CAE A;  3TTH A;  2J8R A;  3K9U A;  4OID A;  3H8E A;  2YGW A;  4CAW A;  4BD9 A;  3PGP A;  4A31 A;  3D8P A;  4KSI A;  3QB8 A;  2O53 A;  5FVJ A;  2ZEL A;  4B12 A;  2P6E A;  2J8M A;  5K8M A;  4OC5 A;  1CJW A;  3B35 A;  4H6Z A;  1IOF A;  1I1D A;  4J3G A;  2OZG A;  2HC9 A;  3BI1 A;  3SI0 A;  3B8G A;  4LQ6 A;  3W6S A;  2FS5 A;  3F0A A;  5G21 A;  4L8A A;  3S6G A;  3LD2 A;  4PK2 A;  1XIX A;  2A4N A;  2PRQ A;  2Z10 A;  4M85 A;  4CRZ B;  2PE3 A;  3I1U A;  4M6G A;  2WSA A;  4BMH A;  2PIY A;  2CNS A;  1Z2L A;  2G3A A;  2C27 A;  3GB0 A;  1YR0 A;  5GCN A;  2PJ0 A;  5LRG A;  5KTD A;  3D2M A;  4B5O A;  2CY2 A;  4NGS A;  4UEZ A;  5AG4 A;  4KOS A;  1KWM A;  1VGY A;  3IIB A;  3JUW A;  3S6F A;  1S3Z A;  1Y9K A;  3CDX A;  3PBB A;  3PFE A;  4I49 A;  5IB9 A;  5JH9 A;  3KQZ A;  5LRJ A;  4C7H A;  4OAE A;  4HPS A;  2PR8 A;  2IQ6 A;  3SI2 A;  8CPA A;  4MCP A;  3SJG A;  5F47 A;  3TCV A;  1TXR A;  2EWB A;  1BPN A;  4AG7 A;  2ZOG A;  1Q2C A;  1V0C A;  2ZEG A;  3DR6 A;  2JBJ A;  2BCO A;  4H89 A;  4NGR A;  3P2H A;  2VQY A;  2FVG A;  2HB6 A;  3CXS A;  4IUS A;  2REE A;  1CG2 A;  2EK9 A;  2PIZ A;  1XBU A;  2C6G A;  1IIC A;  1ZLI A;  5E96 A;  3WC5 A;  3KGQ A;  4R3K A;  2BUE A;  3V38 A;  3PB8 X;  3FMC A;  2F7V A;  1BPM A;  2DPS A;  2PJ6 A;  5AG5 A;  4GM5 A;  3PB9 X;  4XPL A;  2VBQ A;  4MY0 A;  1K4J A;  1Y0Y A;  4Q38 A;  5IB0 A;  1TKF A;  4NGN A;  3LOD A;  3B2Y A;  3WT4 A;  2ABZ A;  4NFR A;  4R9M A;  2CF4 A;  3BI0 A;  3FNC A;  2PJA A;  2Z3N A;  1R43 A;  3G3S A;  5G22 A;  4L89 A;  2PJ9 A;  2FCK A;  4IHM A;  1OBR A;  1CPS A;  2IMO A;  2ZEE A;  4Y49 B;  3GYA A;  4BBH A;  2PRB A;  2PJB A;  1ZLH A;  4MHY A;  2OZU A;  1YW4 A;  1AMP A;  4KUA A;  2JDD A;  4JYW A;  3V7Z A;  5F46 A;  5K8P A;  5LRK A;  7CPA A;  6CPA A;  2Q4Z A;  4PV6 A;  1ZG7 A;  4WJB A;  3NH4 A;  3SHP A;  4P4I A;  4R8F A;  1NSA A;  4KLW A;  3EFA A;  2C1C A;  2O28 A;  4OIW A;  2PJ5 A;  3SJX A;  3R9F A;  2GLJ A;  1HDU A;  2WZN A;  3KAS A;  4P4E A;  2AFX A;  2FXF A;  2B5G B;  2JBK A;  1OZP A;  1KUY A;  4KOT A;  4MMO A;  1BLL E;  4AVC A;  2ZOF A;  2YNC A;  1YLE A;  2OB0 A;  3KKW A;  4KOV A;  2G0B A;  3S9N A;  3RO0 A;  1Z9U A;  2ZEF A;  2P6G A;  3PB7 X;  4R57 A;  3FF3 A;  3HLP A;  2F8H A;  2YNC C;  3PP9 A;  3B7I A;  1HEE A;  4MFP A;  2GIV A;  1TKJ A;  2PC1 A;  2DF5 A;  3MN8 A;  3CXP A;  2IL4 A;  3NH8 A;  4HNW B;  4X2T A;  3TX8 A;  2PVV A;  4AVA A;  2D4P A;  3D3S A;  4CPA A;  4GXH A;  5KTC A;  4Q36 A;  5HMN A;  1Y9W A;  2GAN A;  5DWM A;  5AGE A;  5DS0 A;  4R3L A;  4FAI A;  1Q2Y A;  1QST A;  2G9D A;  3DGV A;  3IJ3 A;  1YGH A;  1XRY A;  4R76 A;  2Q7B A;  3TC8 A;  5LYL A;  1ZO0 A;  3IU1 A;  3EC4 A;  3I9S A;  4CS0 B;  2EVN A;  2FIA A;  1YW6 A;  5J1Q A;  2BSW A;  1TF8 A;  2XEG A;  2ZW6 A;  5F09 A;  2Z11 A;  3TE4 A;  2PSW A;  2XEF A;  3LWU A;  4R7M A;  3PRT A;  2QEC A;  2V77 A;  2ARH A;  2PJ8 A;  1R3N A;  5LYF A;  5JM6 A;  4UIA A;  4A39 A;  3H8F A;  1RO5 A;  1S5K A;  2JEV A;  4X5K A;  4KSA A;  4QVT A;  4CYQ A;  4AB7 A;  4CGP A;  2EBJ A;  2Z3P A;  3CXQ A;  4II9 A;  1S7L A;  2GE3 A;  3TO6 A;  1CP6 A;  3MRU A;  1X10 A;  3ZZI A;  2PDO A;  4UWJ A;  1EE3 P;  3IU2 A;  4W9Y A;  4F0Y A;  3DR8 A;  1WK4 A;  4RI1 A;  4P4F A;  1QSM A;  5H84 A;  4A30 A;  1Z5R A;  1BOB A;  2AFU A;  1A2Z A;  5HH1 A;  1L0C A;  2BL1 A;  2QIR A;  4A33 A;  1QQ9 A;  3WC6 A;  4P4J A;  3R95 A;  1PYT B;  3TT2 A;  2VI7 A;  4FD5 A;  1IYL A;  5F49 A;  4YU9 A;  5ELY A;  5J8C A;  2HV2 A;  2V8D A;  2FT0 A;  2ZEH A;  2R98 A;  3D66 A;  2B4D B;  4HNY B;  4U9Y A;  5D29 A;  5DWN A;  4LUA A;  4ZGY B;  4JXQ A;  1VIX A;  1F57 A;  4MRI A;  4NJR A;  4MFQ A;  1NMT A;  1IB1 E;  3KQX A;  2WYR A;  2ATR A;  2KCW A;  4XPD B;  2JLM A;  1S7N A;  4ZY0 A;  1LOK A;  2Z3L A;  4CAF A;  3BHX A;  3TOA A;  2Q43 A;  3BJ8 A;  4R87 A;  2C6C A;  5I0C A;  1Z8W A;  4B5P B;  1Z8T A;  3S6K A;  4MBU A;  3FEC A;  3GY9 A;  1Y0R A;  1UFH A;  3P2F A;  3PB4 X;  4KZT A;  3FXT A;  1GHE A;  2F5I A;  2R7H A;  2WPW A;  4KOY A;  1LAP A;  4U5Y A;  4PXD A;  2CTB A;  4Y49 C;  4NF1 A;  3B3C A;  3PFO A;  5CPA A;  4CAV A;  3S9L A;  5ISV A;  4ZY2 A;  3N5F A;  4A37 A;  4UEE A;  3QAH A;  4C68 A;  2G3T A;  4UCP A;  1YK3 A;  3SI1 A;  3B3W A;  3LMS A;  1KUX A;  3R9E A;  1CP7 A;  4E2A A;  4OAD A;  1YRE A;  2B5G A;  2VXK A;  3EY5 A;  3NH5 A;  4C7I A;  1QSR A;  2ZXV A;  1Q2D A;  4KUB A;  2VL1 A;  4UCM A;  2ZEO A;  2O4H A;  5IV0 A;  1M4I A;  4RUH A;  3H8G A;  4WWV A;  3EXN A;  3VH9 A;  3W91 A;  4EFD A;  2PVW A;  1H8L A;  3DSB A;  1M4G A;  3IC1 A;  1Q7L A;  4P45 A;  2J9A A;  4AXV A;  1KUV A;  1Y7E A;  2FSR A;  4YRH A;  4AVB A;  2AE6 A;  3IWE A;  3D7F A;  2GLF A;  4IK2 A;  3V8I A;  3FB3 A;  4DUK A;  4OC4 A;  3FYN A;  3FIX A;  4OC3 A;  5I4M A;  5G1Z A;  4FBE A;  1B6B A;  5HXD A;  4NGT A;  2Q4Y A;  5JQ4 A;  3TO7 A;  4KOU A;  2C6P A;  2PR1 A;  1FY7 A;  2GFQ A;  3S9M A;  2XEJ A;  3WAB A;  2CIJ A;  1M44 A;  3BLN A;  4MJ8 A;  2I79 A;  4FD6 A;  4OKO A;  4PQA A;  1Z4R A;  4B11 A;  4UFW A;  2B58 A;  2P0W A;  3RNZ A;  2CNT A;  5G20 A;  4XPK A;  2WPX A;  1RXT A;  1AUG A;  1JWQ A;  1M4L A;  1PU9 A;  2REF A;  3IO1 A;  3NE7 A;  1VKC A;  3PB6 X;  4KVO E;  5LYD A;  3A9L A;  2PJ4 A;  2CXA A;  4CYO A;  3TOB A;  3ZJ0 A;  2ZW4 A;  1BO4 A;  2Q04 A;  4MHD A;  1PCA A;  3RZA A;  1YME A;  5K8N A;  4A38 A;  3CZX A;  3KHX A;  3CT9 A;  4A94 A;  4F6A A;  4NJQ A;  4OME A;  1FNO A;  3PBE A;  4GS4 A;  2FIW A;  3E0K A;  5D8N A;  4NSQ A;  1Y7R A;  4P4B A;  4ZI6 A;  2BEI A;  3OWC A;  4QUS A;  3KHZ A;  2ZED A;  3BXM A;  3DDD A;  1IU8 A;  1HDQ A;  1M4D A;  4OC2 A;  4TNU A;  2Z3O A;  2DEA A;  3EO4 A;  4A32 A;  4C2Y A;  4F9U A;  4Z65 A;  4TWE A;  4ORF A;  5F48 A;  3KL9 A;  4B10 A;  1NE9 A;  3IGR A;  4KS9 A;  4NXY A;  4FUU A;  4CAX A;  1QSN A;  2B4D A;  3D67 A;  3NFZ A;  4UCN A;  4NCZ A;  1CBX A;  1I21 A;  1Z8X A;  4ONW A;  4B6Z A;  4FD7 A;  4EVY A;  2GRE A;  4G1P A;  3K9T A;  1N71 A;  1VHS A;  2R1I A;  1XEB A;  2X7B A;  4QB9 A;  3H4Q A;  5AG6 A;  2OOT A;  1LCP A;  5HVH A;  2V8G A;  5CBM A;  1JQG A;  3SJF A;  2QML A;  4MI4 A;  4B5P A;  3D7G A;  4HNX B;  4EME A;  1CPX A;  2ZEN A;  2RB7 A;  3CPA A;  4XPD C;  3WC7 A;  4XNH B;  4HKF A;  4E8O A;  2AFM A;  3JTK A;  4BIN A;  1MJA A;  1UWY A;  4F8Z A;  4YFJ A;  2QVP A;  5J8F A;  3D2P A;  2Q4V A;  4OC1 A;  5CNP A;  1GYT A;  1I12 A;  2CTC A;  1S60 A;  1U6M A;  2PJ2 A;  4H2K A;  4IAV A;  3ISX A;  4PK3 A;  4C2Z A;  4F9V A;  3FX6 A;  3JRU A;  4P44 A;  4UIB A;  5KTA A;  3KR5 A;  4X8I A;  1DTD A;  4UWI A;  2JDC A;  4P6Y A;  3T90 A;  1FT7 A;  1ON0 A;  2BO9 A;  3NA6 A;  4CYP A;  3FED A;  5C88 A;  3GUX A;  2Q0Y A;  3N7Z A;  2VZY A;  1ELL P;  2P6F A;  2AFO A;  4KSF A;  4PSX A;  2OH1 A;  2AFS A;  1S7K A;  3D68 A;  4KVM E;  4KOX A;  4LQG A;  4MXU A;  4NGP A;  2PCU A;  1YVK A;  2IJZ A;  2Y0M A;  3GKR A;  1IYK A;  1ZG8 A;  2V8H A;  3FH4 A;  4ZBG A;  4JJX A;  4MFZ A;  3KZW A;  4K3N A;  2RC4 A;  4NGM A;  4UBR A;  5EMI A;  4O23 A;  1P4N A;  4DYO A;  1P0H A;  3B3V A;  4PXB A;  3IWG A;  2NSM A;  3IEH A;  3UY5 A;  2B3V A;  1QSO A;  1XOV A;  2I3C A;  4MFK A;  1XE4 A;  1YVO A;  5AG7 A;  1VHE A;  4ZYQ A;  4E0A A;  4ZY1 A;  2ZEM A;  2PJ1 A;  4NEX A;  3F8K A;  4UF4 A;  4QBJ A;  4K30 A;  2ZW5 A;  3SXN A;  4ONU A;  4MFL A;  1LFW A;  4KOR A;  3D7H A;  4UEF A;  3RBU A;  2DPT A;  1NSL A;  1LAM A;  2WUU A;  3FEE A;  2VEZ A;  3RYO A;  2FL4 A;  3ISZ A;  3DLJ A;  4JWP A;  4B13 A;  2OZH A;  3K2K A;  3D4U A;  4CGO A;  1YSJ A;  1X12 A;  4DJL A;  2Z0Z A;  1VHO A;  2OR4 A;  4FD4 A;  4DNC A;  4YWY A;  2HQY A;  4RN7 A;  1LRZ A;  3LAC A;  2Z3M A;  4CRY B;  1S7F A;  2I00 A;  1MJ9 A;  5THW A;  3B3S A;  3HUV A;  3R1K A;  1YX0 A;  3D7D A;  2H5M A;  1LAN A;  2Z3K A;  3JVN A;  3G8W A;  5IX3 A;  4CGL A;  1ARL A;  2D4O A;  1DE4 C;  2QYV A;  4U9Z A;  1WWZ A;  2QJ8 A;  3IFE A;  4C2X A;  2ZEP A;  4M6I A;  1TF9 A;  2PJ3 A;  4P4D A;  4PXC A;  2B3U A;  1R57 A;  2EUI A;  2JEW A;  3L2N A;  2Q7S A;  4MY3 A;  4OLL A;  4UFX A;  4JZ0 A;  4H6U A;  4MCQ A;  4ZX9 A;  1SQH A;  2Q51 A;  4KLV A;  1AYE A;  2YNE A;  4RS2 A;  3TO9 A;  5HVF A;  1IOI A;  5A27 A;  1CX8 A;  2ZW7 A;  4MHZ A;  2PJ7 A;  4PPZ A;  4P10 A;  3R9G A;  3CPX A;  3IWW A;  3FRM A;  2NYQ A;  4UA3 A;  4AG9 A;  1XFO A;  4JD6 A;  3B3T A;  4IF5 A;  4MCR A;  3R96 A;  3C26 A;  3DNS A;  3NE8 A;  3GIU A;  2K5T A;  4KOW A;  4MFJ A;  5EBV A;  1XMT A;  1IID A;  1MJB A;  2BOA A;  1XMB A;  2PQ8 A;  3VAT A;  5HVG A;  3FJU A;  2POK A;  1RTQ A;  1IGB A;  4PXE A;  2J8N A;  4MHN A;  2AJ6 A;  1CM0 A;  2VZZ A;  4A2Z A;  4XNH C;  2HUZ A;  3TFY A;  3PEI A;  5K8O A;  4A95 A;  5EC4 A;  1PUA A;  2ODF A;  1ELM P;  3S6H A;  5JPH A;  3H5Z A;  2EO8 A;  4OP4 A;  2XEI A;  1J4J A;  2ANP A;  5LYI A; 
#chains in the Genus database with same CATH homology
 2R8V A;  3FBU A;  1KZF A;  3SXO A;  4KVX A;  4F0X A;  5A28 A;  4CGM A;  1MK4 A;  5BWA B;  4JXR A;  2FE7 A;  3VWD A;  1TIQ A;  4JLY A;  4CGN A;  3MGD A;  3PZJ A;  3W6X A;  2CNM A;  2B4B A;  5C82 A;  3I3G A;  3VWE A;  1B87 A;  1Z4E A;  5H86 A;  3BJ7 A;  2ZPA A;  3F5B A;  4YGO A;  2OU2 A;  1XF8 A;  3T9Y A;  2Q44 A;  4B14 A;  2NMT A;  4PSW A;  4UFV A;  4M3S A;  1M1D A;  4CYN A;  4QC6 A;  2YND A;  2DXQ A;  4LX9 A;  3WR7 A;  4CAE A;  3TTH A;  2J8R A;  3K9U A;  4CAW A;  2YGW A;  3PGP A;  4A31 A;  3D8P A;  3QB8 A;  5FVJ A;  2P6E A;  2J8M A;  1CJW A;  4H6Z A;  1I1D A;  4J3G A;  2OZG A;  3B8G A;  3W6S A;  2FS5 A;  3F0A A;  5G21 A;  4L8A A;  3S6G A;  3LD2 A;  4PK2 A;  1XIX A;  2A4N A;  2Z10 A;  4M85 A;  4CRZ B;  4BMH A;  2WSA A;  2CNS A;  2G3A A;  2C27 A;  1YR0 A;  5GCN A;  3D2M A;  4B5O A;  2CY2 A;  5AG4 A;  4KOS A;  3JUW A;  3S6F A;  1S3Z A;  1Y9K A;  4I49 A;  4C7H A;  4OAE A;  2PR8 A;  5F47 A;  3TCV A;  4AG7 A;  1Q2C A;  1V0C A;  3DR6 A;  4H89 A;  3P2H A;  2VQY A;  3CXS A;  4IUS A;  2REE A;  1IIC A;  5E96 A;  4R3K A;  2BUE A;  2DPS A;  5AG5 A;  4XPL A;  2VBQ A;  4MY0 A;  1K4J A;  4Q38 A;  5IB0 A;  3LOD A;  4R9M A;  3FNC A;  2Z3N A;  3G3S A;  5G22 A;  4L89 A;  2FCK A;  4Y49 B;  3GYA A;  4BBH A;  2PRB A;  2OZU A;  4KUA A;  5F46 A;  2JDD A;  4PV6 A;  3SHP A;  4KLW A;  3EFA A;  2O28 A;  3R9F A;  2FXF A;  2B5G B;  1OZP A;  1KUY A;  4KOT A;  4AVC A;  2YNC A;  1YLE A;  2OB0 A;  3KKW A;  4KOV A;  2G0B A;  1Z9U A;  2P6G A;  4R57 A;  2YNC C;  3PP9 A;  4MFP A;  2GIV A;  2PC1 A;  4B12 A;  4AVA A;  3CXP A;  2IL4 A;  4HNW B;  2D4P A;  3D3S A;  5KTC A;  4Q36 A;  5HMN A;  1Y9W A;  2GAN A;  5DWM A;  5AGE A;  4R3L A;  1Q2Y A;  1QST A;  2Q7B A;  1YGH A;  1ZO0 A;  3IU1 A;  3EC4 A;  3I9S A;  4CS0 B;  2EVN A;  2FIA A;  2BSW A;  3TE4 A;  2ZW6 A;  2Z11 A;  2PSW A;  2QEC A;  2ARH A;  1RO5 A;  1S5K A;  2JEV A;  4X5K A;  4KSA A;  4QVT A;  4CYQ A;  4AB7 A;  4CGP A;  2Z3P A;  3CXQ A;  4II9 A;  1S7L A;  2GE3 A;  3TO6 A;  3ZZI A;  2PDO A;  4UWJ A;  3IU2 A;  4F0Y A;  3DR8 A;  1WK4 A;  4RI1 A;  1QSM A;  5H84 A;  4A30 A;  1BOB A;  5HH1 A;  1L0C A;  2BL1 A;  2QIR A;  4A33 A;  3TT2 A;  3R95 A;  2VI7 A;  4FD5 A;  1IYL A;  5F49 A;  5J8C A;  2HV2 A;  2FT0 A;  2R98 A;  4HNY B;  2B4D B;  4U9Y A;  5DWN A;  4LUA A;  4ZGY B;  4JXQ A;  4MFQ A;  1NMT A;  1IB1 E;  2ATR A;  2KCW A;  4XPD B;  2JLM A;  1S7N A;  2Z3L A;  4CAF A;  3TOA A;  3BJ8 A;  4R87 A;  5I0C A;  4B5P B;  3S6K A;  4MBU A;  3GY9 A;  1UFH A;  3P2F A;  4KZT A;  3FXT A;  1GHE A;  2F5I A;  2R7H A;  2WPW A;  4KOY A;  4U5Y A;  4Y49 C;  4NF1 A;  4CAV A;  5ISV A;  3QAH A;  4C68 A;  2G3T A;  4UCP A;  1YK3 A;  1KUX A;  3R9E A;  4E2A A;  4OAD A;  1YRE A;  2B5G A;  2VXK A;  3EY5 A;  4C7I A;  1QSR A;  2ZXV A;  1Q2D A;  4KUB A;  4UCM A;  5IV0 A;  1M4I A;  3W91 A;  3EXN A;  3DSB A;  1M4G A;  1KUV A;  2FSR A;  4YRH A;  4AVB A;  2AE6 A;  3IWE A;  3V8I A;  3FB3 A;  3FYN A;  3FIX A;  5G1Z A;  1B6B A;  5JQ4 A;  2Q4Y A;  3TO7 A;  4KOU A;  2PR1 A;  1FY7 A;  1M44 A;  3BLN A;  4MJ8 A;  2I79 A;  4FD6 A;  4B11 A;  1Z4R A;  4UFW A;  2B58 A;  2P0W A;  2CNT A;  5G20 A;  4XPK A;  2WPX A;  1RXT A;  2REF A;  1PU9 A;  3NE7 A;  4KVO E;  1VKC A;  3A9L A;  2CXA A;  4CYO A;  3TOB A;  3ZJ0 A;  2ZW4 A;  1BO4 A;  2Q04 A;  4MHD A;  4F6A A;  4GS4 A;  2FIW A;  3E0K A;  4NSQ A;  1Y7R A;  2BEI A;  3OWC A;  4QUS A;  3DDD A;  1M4D A;  2Z3O A;  3EO4 A;  4A32 A;  4C2Y A;  4ORF A;  5F48 A;  4B10 A;  1NE9 A;  3IGR A;  4KS9 A;  4NXY A;  4CAX A;  1QSN A;  2B4D A;  4UCN A;  4NCZ A;  1I21 A;  4FD7 A;  4EVY A;  5AG6 A;  5KTD A;  1N71 A;  1VHS A;  2R1I A;  1XEB A;  2X7B A;  4QB9 A;  3H4Q A;  2QML A;  4MI4 A;  4B5P A;  4HNX B;  4XPD C;  4XNH B;  4HKF A;  4E8O A;  3JTK A;  1MJA A;  4YFJ A;  5J8F A;  3D2P A;  2Q4V A;  5CNP A;  1I12 A;  1S60 A;  1U6M A;  4PK3 A;  4C2Z A;  5KTA A;  4UWI A;  2JDC A;  3T90 A;  1ON0 A;  4CYP A;  5C88 A;  2Q0Y A;  3N7Z A;  2VZY A;  2P6F A;  4KSF A;  4PSX A;  2OH1 A;  1S7K A;  4KVM E;  4KOX A;  2Y0M A;  1YVK A;  3GKR A;  1IYK A;  4ZBG A;  4JJX A;  4MFZ A;  2RC4 A;  4UBR A;  1P4N A;  1P0H A;  3IWG A;  3UY5 A;  2B3V A;  1QSO A;  4MFK A;  1XE4 A;  1YVO A;  5AG7 A;  4E0A A;  4NEX A;  3F8K A;  4QBJ A;  4K30 A;  2ZW5 A;  3SXN A;  4ONU A;  4MFL A;  4KOR A;  2DPT A;  1NSL A;  2WUU A;  3RYO A;  2VEZ A;  2FL4 A;  4JWP A;  4B13 A;  2OZH A;  4CGO A;  2Z0Z A;  4DNC A;  4FD4 A;  2HQY A;  1LRZ A;  2Z3M A;  4CRY B;  1S7F A;  2I00 A;  1MJ9 A;  3R1K A;  1YX0 A;  2H5M A;  2Z3K A;  3JVN A;  3G8W A;  5IX3 A;  4CGL A;  2D4O A;  4U9Z A;  4C2X A;  1WWZ A;  4A95 A;  2B3U A;  1R57 A;  2EUI A;  4OLL A;  4MY3 A;  4UFX A;  4H6U A;  1SQH A;  4KLV A;  2YNE A;  4RS2 A;  3TO9 A;  5A27 A;  2ZW7 A;  3R9G A;  3FRM A;  4UA3 A;  4AG9 A;  4JD6 A;  4IF5 A;  3R96 A;  3C26 A;  3DNS A;  4MFJ A;  2K5T A;  4KOW A;  5EBV A;  1XMT A;  1IID A;  1MJB A;  2PQ8 A;  2J8N A;  2AJ6 A;  1CM0 A;  2VZZ A;  4A2Z A;  4XNH C;  2HUZ A;  3TFY A;  5EC4 A;  1PUA A;  3S6H A;  5JPH A;  3H5Z A;  1J4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...