2CNSA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with acetylcoa.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
b'MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
source organism Salmonella typhimurium lt2
molecule tags Transferase
total genus 45
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnsA00
4KORA 3DSBA 5C88A 4QVTA 2Q7BA 4UWJA 4LX9A 1K4JA 1Q2CA 4KOYA 3R1KA 4CS0B 2WPXA 2QECA 3TT2A 3EO4A 4ZBGA 1M4GA 2H5MA 2J8NA 2R1IA 3PGPA 1YREA 2I79A 2PC1A 5IB0A 4HNXB 2FE7A 5JPHA 3CXPA 1VHSA 2HQYA 1V0CA 4UBRA 4ORFA 2B5GA 4FD5A 4NEXA 1GHEA 1M4DA 2PDOA 5FVJA 3R95A 1IYKA 2C27A 2VEZA 3PZJA 1SQHA 1P0HA 2CNTA 4AB7A 4FD6A 3C26A 2O28A 2B5GB 1LRZA 3VWDA 3WR7A 4JD6A 1IIDA 4PV6A 3GYAA 2D4OA 2B4DB 5E96A 2BUEA 3KKWA 3W6XA 4HKFA 3DDDA 2B58A 5F49A 3G8WA 3D8PA 2Q0YA 4OAEA 3TE4A 1QSNA 1PUAA 5J8CA 4XPDC 1IB1E 3R9GA 2HV2A 4PSXA 1QSTA 1Y9WA 1NSLA 4JJXA 2OB0A 2KCWA 4RI1A 4KVXA 2B3VA 4XNHB 3W6SA 4B5PA 2OZHA 2R8VA 4RS2A 1M1DA 3DR8A 4CRZB 4E8OA 1OZPA 2GE3A 3SXOA 4K30A 2B3UA 1Q2DA 3FB3A 4MI4A 2GANA 5IV0A 1VKCA 2ZXVA 4AVAA 4EVYA 4R57A 1NMTA 4KVME 2F5IA 3SXNA 2ARHA 1YGHA 2PRBA 2AE6A 4QC6A 4H89A 5JQ4A 2EUIA 1S3ZA 4KVOE 2P0WA 4MY0A 4XPKA 4AG9A 2VZYA 1M44A 4MJ8A 1IYLA 1XE4A 1I12A 4KUAA 3OWCA 3FYNA 4B5OA 2Q04A 2FSRA 3EC4A 3P2FA 3R9FA 3V8IA 2P6EA 2VQYA 4L8AA 2PQ8A 2Z10A 2RC4A 2PSWA 3LD2A 2ZW7A 2REEA 4M85A 3DNSA 2B4DA 3UY5A 4IF5A 3CXQA 4YGOA 2D4PA 2CNMA 3TO9A 3BJ8A 2PR1A 1XMTA 1M4IA 1B6BA 5KTDA 2Z0ZA 2K5TA 4J3GA 4MY3A 4U5YA 2NMTA 3N7ZA 1QSOA 2G3TA 2Q4YA 4XPLA 1S5KA 3FRMA 3ZZIA 1PU9A 3BLNA 1KUYA 4II9A 3B8GA 1Z4EA 2VBQA 1MK4A 1P4NA 2Y0MA 2IL4A 4CRYB 5I0CA 3I3GA 4YFJA 4BMHA 3EXNA 4OLLA 4QB9A 4KOSA 3F0AA 1I21A 3LODA 4XPDB 4JXRA 4QUSA 1FY7A 3D2PA 2QMLA 3IGRA 2QIRA 5F48A 1QSMA 4CAWA 3JVNA 3H4QA 1S7NA 2VXKA 3PP9A 2R98A 4UWIA 5H84A 4AVBA 4MBUA 4ONUA 2HUZA 1KUXA 4KOVA 4M3SA 5F47A 4KLVA 1S7KA 4KZTA 2VZZA 2AJ6A 1R57A 2REFA 3F8KA 2ZW6A 3FNCA 2ZW5A 1WWZA 2G0BA 2VI7A 4YRHA 1YVKA 4LUAA 2BEIA 3TOBA 4I49A 3NE7A 2Q4VA 3TO6A 3D2MA 1YLEA 1XIXA 1S60A 3QAHA 5C82A 3E0KA 4AG7A 4JWPA 4E2AA 1Y7RA 3FXTA 1YK3A 2JDDA 3TFYA 5KTCA 3S6HA 1QSRA 1Z4RA 1MJ9A 1RXTA 5DWNA 2P6GA 3JUWA 2OU2A 2I00A 2FXFA 1TIQA 2WPWA 3K9UA 1I1DA 4OADA 4R9MA 5KTAA 4KUBA 4CAXA 2PR8A 1J4JA 4HNYB 1WK4A 1BOBA 1KUVA 2Z11A 4F6AA 1Q2YA 1IICA 4R3KA 4H6ZA 1Z9UA 4FD4A 4FD7A 1XEBA 2OZUA 4JXQA 2JLMA 2ZPAA 3R96A 3W91A 1BO4A 2J8RA 2R7HA 4QBJA 3R9EA 1CM0A 1U6MA 4KOTA 3MGDA 4IUSA 3BJ7A 1XF8A 4L89A 4U9YA 2A4NA 2DXQA 2OZGA 3F5BA 4KOXA 4CAVA 2B4BA 4KOUA 5CNPA 1NE9A 5DWMA 1YX0A 2G3AA 2CY2A 4AVCA 2CNSA 4NSQA 3DR6A 5ISVA 4R3LA 1Y9KA 3GKRA 1CJWA 3GY9A 4Y49C 3D3SA 4DNCA 2FCKA 5J8FA 1MJAA 3TO7A 2BL1A 3S6FA 4UA3A 3T90A 1RO5A 2J8MA 3S6KA 3G3SA 4R87A 4Y49B 3TCVA 3EFAA 1KZFA 4U9ZA 2ATRA 3IWGA 3P2HA 4NCZA 4H6UA 4XNHC 1N71A 3VWEA 5HMNA 1S7LA 2FS5A 2FIAA 3FBUA 2EVNA 5GCNA 2ZW4A 1B87A 4F0YA 3RYOA 5EC4A 2FT0A 3ZJ0A 4E0AA 5F46A 4GS4A 3QB8A 3TTHA 4JLYA 3EY5A 4PK3A 5IX3A 2JDCA 5EBVA 1YVOA 3CXSA 4NF1A 4NXYA 3S6GA 1MJBA 2BSWA 3FIXA 2Q44A 3SHPA 5H86A 4MHDA 4B5PB 2X7BA 4X5KA 1S7FA 2JEVA 4PK2A 2P6FA 5HH1A 1ON0A 3T9YA 2FL4A 4PSWA 4KLWA 4KOWA 2OH1A 4HNWB 1L0CA 1UFHA 3I9SA 2GIVA 2FIWA 3TOAA 1YR0A
chains in the Genus database with same CATH superfamily
3IU1A 1Z8TA 4KORA 3DSBA 4UCPA 4CYNA 1XBUA 5C88A 4B11A 5IB9A 3NFZA 4QVTA 1XOVA 2Q7BA 4UWJA 5J1QA 1X10A 3IJ3A 3PBBA 4LX9A 4UFXA 1K4JA 4RN7A 1Q2CA 4KOYA 4NGNA 4P4JA 3SJXA 7CPAA 2Q4ZA 2PJ8A 3RZAA 3QAYA 3R1KA 4CS0B 5HVGA 4MHNA 2WPXA 2QECA 3D4UA 3B3SA 3TT2A 1ELMP 2YNEA 3EO4A 3IFEA 2AFZA 4PXCA 2O53A 4ZBGA 1M4GA 3SJGA 2H5MA 2J8NA 2XEGA 1VHEA 2R1IA 3PGPA 3JTKA 1YREA 5G1ZA 2I79A 2PC1A 2WUUA 5IB0A 4HNXB 2FE7A 5AG7A 4OC0A 3PB9X 3CXPA 1VHSA 2HQYA 4UEFA 4C2ZA 1V0CA 5JPHA 4UBRA 1R3NA 4EMEA 2IQ6A 3PFOA 4F8ZA 4ORFA 2B5GA 1CP6A 2IJZA 1GHEA 4FD5A 4LQGA 4NEXA 4MHPA 5THWA 3KR5A 1M4DA 3D67A 4Q38A 3IIBA 2PDOA 4WWVA 5FVJA 3VARA 1CG2A 3R95A 1Z2LA 1IYKA 1TKHA 2ANPA 2Z3PA 2C27A 3IWWA 2VEZA 3PZJA 4MHZA 1TKJA 1SQHA 1P0HA 2CNTA 1VIXA 2EK8A 2PJ1A 4AB7A 4FD6A 1CBXA 3C26A 4X2TA 2O28A 4C68A 2B5GB 4UIAA 1LRZA 3VWDA 3WR7A 4JD6A 1IIDA 4PV6A 3GYAA 2D4OA 3HUVA 2EBJA 2Z3MA 4B6ZA 2B4DB 2ZEGA 5E96A 1YMEA 2BUEA 2PJAA 3FEEA 4Z65A 4KSAA 3KKWA 3KHXA 1IGBA 3W6XA 3HLPA 4X8IA 2C6GA 4ONWA 4HKFA 4FAIA 4TWEA 1IU8A 1FNOA 2RFHA 4H2KA 3IWEA 3DDDA 2B58A 2ZOGA 4NGRA 2ABZA 3IO1A 5F49A 5G21A 4A30A 2IMOA 3G8WA 5JM6A 3D8PA 3RBUA 2Q0YA 4OAEA 2PIYA 1LCPA 3TE4A 1QSNA 1PUAA 4MHYA 5J8CA 2V8DA 4XPDC 4P45A 4G1PA 1IB1E 3R9GA 2HV2A 2PVVA 4PSXA 1QSTA 4A33A 4A94A 5K8NA 4EWTA 1Y9WA 1NSLA 4A39A 4A2ZA 3PB8X 4JJXA 1BAVA 2OB0A 4F9VA 4BD9A 3BXMA 2PE3A 2CF4A 4B14A 4OC2A 3PB7X 2KCWA 1YW4A 4KVXA 4RI1A 1BLLE 2B3VA 4DUKA 1XFOA 4XNHB 3W6SA 4B5PA 1Y0YA 2DPTA 2OZHA 2PJBA 2R8VA 2YNCC 4RS2A 4W9YA 3KASA 5K8OA 4AXVA 4P44A 5CPAA 1M1DA 1Y0RA 3NE8A 3DR8A 4CRZB 2CTBA 4E8OA 1OZPA 2GE3A 4FBEA 2GFQA 1VGYA 3BHXA 2YGWA 1VHOA 4K30A 2B3UA 4MFKA 3SXOA 1Q2DA 3FB3A 4MI4A 2AFSA 2Q7SA 3PBEA 4IK2A 2GANA 3FECA 5IV0A 1VKCA 2ZXVA 1HDQA 3LACA 4AVAA 4EVYA 4MMOA 4R6TA 4R57A 1NMTA 4KVME 2F5IA 4HPSA 3SXNA 2ARHA 1YGHA 2PRBA 2AE6A 1FT7A 3CZXA 4QC6A 5LRGA 2PJ6A 4H89A 1F2PA 3NA6A 5JQ4A 1CPXA 3MN8A 2EUIA 4CYQA 1S3ZA 2BCOA 1TXRA 2C1CA 2P0WA 3B3CA 4KVOE 3D68A 4EFDA 3MRUA 1CP7A 3PEIA 4Q7AA 4MY0A 2QYVA 2CTCA 1ZG7A 1Q7LA 4XPKA 2HB6A 4AG9A 5D8NA 2VZYA 5DS0A 1M44A 4MJ8A 2OOTA 3FF3A 4MCPA 1IYLA 1XE4A 1I12A 2F8HA 3OWCA 4KUAA 4X3RA 4UEZA 4MFPA 3FYNA 1YLOA 2GU2A 2PJ3A 4B5OA 2Q04A 3T8WA 2XEIA 2FSRA 4UIBA 4NJRA 5LYLA 3EC4A 3FX6A 2WZNA 2C6PA 4NFRA 3P2FA 3IC1A 1YQEA 3R9FA 4ZGYB 4CGOA 3V8IA 2P6EA 4BINA 2BOAA 2VQYA 4L8AA 2PQ8A 2Z10A 2RC4A 2PSWA 3B7IA 3DGVA 2CXAA 2PJ5A 5LRKA 3LD2A 2ZW7A 3N5FA 2F7VA 3DLJA 2REEA 5BWAB 4M85A 3DNSA 2B4DA 4NGMA 3D66A 5K8PA 3PFEA 3UY5A 1ZO0A 3KR4A 4IF5A 3CXQA 4YGOA 4Q36A 4R76A 4B12A 2D4PA 2CNMA 4CAFA 3TO9A 3BJ8A 4ZYQA 2PR1A 4NGTA 3I1UA 1XMTA 2ZEHA 1CX8A 3B35A 1M4IA 1B6BA 5KTDA 2Z0ZA 4FUUA 2K5TA 2QVPA 4PXDA 4J3GA 4P6YA 4MY3A 4U5YA 2NMTA 4B13A 3N7ZA 2GLFA 1LOKA 1QSOA 1YW6A 2ODFA 3VH9A 5EMIA 2G3TA 2Q4YA 4KSIA 4XPLA 1JQGA 4F0XA 1S5KA 3FRMA 4P4DA 2Z3NA 1PU9A 2FVGA 3BLNA 1KUYA 3ZZIA 1HEEA 3B8GA 4A32A 1Z4EA 2VBQA 4II9A 5AG4A 4OMEA 1EE3P 1AMPA 2EK9A 4MXUA 2GLJA 2NSMA 4P4IA 5JH9A 5LYFA 1MK4A 3LWUA 4M6IA 2QJ8A 1P4NA 4P4FA 2PRQA 4NJQA 2AFMA 5LYIA 3PRTA 2Y0MA 4BBHA 2IL4A 5G22A 5LRJA 4CRYB 1ZG8A 4PXBA 1R43A 4DJLA 3GIUA 3KHZA 5I0CA 4MFLA 4CGLA 4JZ0A 2VL1A 3RNZA 4C2XA 8CPAA 3B3WA 3I3GA 3KL9A 2PCUA 3RAMA 4CYOA 4YFJA 4BMHA 2ZENA 1DTDA 3EXNA 4OLLA 1GYTA 1PYTB 4KOSA 3F0AA 1I21A 3LODA 1HDUA 2POKA 4QB9A 4XPDB 4ZY2A 4JXRA 4F9UA 3H8GA 4QUSA 1FY7A 2ZEPA 3D2PA 2HC9A 5HXDA 3H5ZA 2QMLA 3IGRA 5D29A 2Z3KA 4WJBA 4CYPA 3ISXA 2YNCA 1OBRA 2QIRA 4OC5A 3SI2A 5F48A 1QSMA 3PB4X 3H8FA 4A95A 4CAWA 3S9NA 3WABA 1H8LA 2DF5A 3JVNA 4MFZA 4CGMA 3H4QA 1S7NA 3KQXA 2Z3LA 2VXKA 3PP9A 2RB7A 4YWYA 4M6HA 2R98A 4UWIA 4CGPA 4ZY0A 3PB6X 1QQ9A 3K9TA 5H84A 3WC5A 4AVBA 4CAEA 4MBUA 1ZLHA 4ONUA 3VATA 5I4MA 2HUZA 3TC8A 1KUXA 4KOVA 4M3SA 5F47A 4KLVA 1S7KA 2Z3OA 4KZTA 4OC4A 4C2YA 2VZZA 2AJ6A 1R57A 3B2YA 2REFA 4GM5A 4UCNA 3F8KA 2PJ0A 2PVWA 2ZW6A 4KS9A 4OIWA 6CPAA 3FNCA 2ZW5A 1JWQA 1WWZA 3KZWA 2G0BA 2EWBA 4P10A 1Y7EA 2AFXA 1BPMA 1F2OA 1YVKA 1Z8WA 2VI7A 3ISZA 4LUAA 2PJ7A 4YRHA 2BEIA 3WC6A 4A31A 3SJEA 3TOBA 3JRUA 3KGQA 3NE7A 4I49A 1TF8A 2ZEMA 2Q4VA 4TNUA 3TO6A 3D2MA 1YLEA 1XIXA 1S60A 3QAHA 3FH4A 5C82A 1LFWA 3E0KA 5AG5A 4AG7A 2ZELA 4JWPA 1Y7RA 4E2AA 1NSAA 3FXTA 1YK3A 2JDDA 3TFYA 1X12A 5KTCA 3S6HA 1QSRA 5K8MA 4UCMA 5CBMA 4PPZA 5JGFA 1Z4RA 1MJ9A 5HVFA 1RXTA 5DWNA 1IOFA 2P6GA 3JUWA 2OU2A 2I00A 2FXFA 1TIQA 1Z8LA 2WPWA 2V8GA 3K9UA 1I1DA 2BO9A 5HVHA 4OADA 4R9MA 1ELLP 1XJOA 2XEFA 2EO8A 5AGEA 5KTAA 4P4BA 4KUBA 4CAXA 2PR8A 1J4JA 4HNYB 4C7IA 2PIZA 4MCRA 1WK4A 4OP4A 1BOBA 1KUVA 2Z11A 4PXEA 1IOIA 4F6AA 1Q2YA 2ZEOA 1BPNA 1IICA 5A27A 3D7GA 4R3KA 2PJCA 3CPXA 2I3CA 4OC1A 3BI1A 4NGSA 4H6ZA 4GXHA 4UEEA 1KWMA 1RTQA 1Z9UA 3IEHA 4FD4A 3TX8A 4FD7A 1XEBA 2GREA 1LAPA 2OZUA 4JXQA 2JLMA 2ZPAA 3R96A 2G9DA 3A9LA 2AFUA 2XEJA 3NH4A 4UF4A 1LANA 2WSAA 3W91A 1BO4A 2J8RA 4YU9A 4ZX8A 1F57A 2R7HA 4QBJA 3KQZA 1XRYA 3R9EA 3GB0A 1CM0A 4MRIA 1U6MA 4KOTA 2Q43A 1AYEA 3LMSA 3MGDA 4IUSA 1Z5RA 3BJ7A 3H8EA 4MCQA 1XF8A 3L2NA 3NH8A 4L89A 4U9YA 2A4NA 4UFWA 1DE4C 3SJFA 2DXQA 2J9AA 2OZGA 3F5BA 3CT9A 3FJUA 3FVLA 4KOXA 4CAVA 2B4BA 4A38A 1TKFA 4KOUA 5CNPA 1NE9A 3BI0A 5DWMA 1YX0A 2G3AA 4CGNA 2CY2A 4AVCA 2AFWA 4MFJA 2PJ2A 1LAMA 2CNSA 4NSQA 3SI1A 1UWYA 3DR6A 5F09A 4IAVA 4DYOA 5ISVA 4R3LA 1Y9KA 2JEWA 2C6CA 3GKRA 2CIJA 1CJWA 3B3VA 3GY9A 4ZY1A 4Y49C 1CPSA 3D3SA 4DNCA 4MCSA 2FCKA 2ZEDA 1MJAA 2ZOFA 3TO7A 5J8FA 2BL1A 4NGPA 3S6FA 5ELYA 3S9MA 3IU2A 3WC7A 4UA3A 1ARLA 3T90A 2JBKA 1RO5A 2V77A 2J8MA 4O23A 3CDXA 1Z8XA 3S6KA 3G3SA 1ARMA 1YSJA 4R87A 3FMCA 4Y49B 3TCVA 2WYRA 3EFAA 2JBJA 1KZFA 4K3NA 4ZI6A 1XMBA 4U9ZA 4M6GA 2NYQA 2ATRA 2AFOA 3S9LA 3IWGA 3P2HA 3NH5A 4NCZA 4H6UA 4R8FA 3KI9A 1A2ZA 4XNHC 1N71A 3SI0A 3VWEA 4P4EA 1S7LA 5HMNA 3D7FA 2FS5A 2FIAA 2PJ4A 2EVNA 3FBUA 5G20A 2Q51A 1IY7A 3GUXA 2O4HA 2ZW4A 1B87A 5GCNA 4F0YA 4KSFA 4OKOA 3RYOA 2DPSA 4ZX9A 3V7ZA 3CPAA 3K2KA 5EC4A 2FT0A 3ZJ0A 3V38A 4E0AA 4OIDA 5F46A 2DEAA 4GS4A 2ZEEA 3QB8A 4JLYA 3TTHA 3EY5A 4PK3A 2V8HA 5A28A 5IX3A 1TF9A 2JDCA 4JYWA 4NGQA 5EBVA 4RUHA 4PQAA 1YVOA 3CXSA 4NF1A 4NXYA 1M4LA 4IHMA 3S6GA 1MJBA 4CPAA 2BSWA 3FIXA 4UFVA 3RO0A 2Q44A 3SHPA 4C7HA 5H86A 4MHDA 5AG6A 4B5PB 2X7BA 2YNDA 4FWUA 4X5KA 1S7FA 2JEVA 3D7DA 4PK2A 4OC3A 2P6FA 4A37A 1PCAA 1ON0A 5HH1A 3D7HA 3GLJA 3T9YA 4R7MA 3WT4A 1AUGA 2FL4A 4PSWA 3FEDA 4KLWA 1QMUA 1ZLIA 4KOWA 2V8VA 2OH1A 4HNWB 4LQ6A 1ZG9A 2ZEFA 5LYDA 1L0CA 4B10A 1UFHA 2OR4A 3I9SA 2PJ9A 3QNVA 2GIVA 2FIWA 3B3TA 4MFQA 3TOAA 1YR0A
chains in the Genus database with same CATH topology
3IU1A 4KORA 3DSBA 4UCPA 4CYNA 5C88A 4B11A 4QVTA 2Q7BA 4UWJA 4LX9A 4UFXA 1K4JA 1Q2CA 4KOYA 3R1KA 4CS0B 2WPXA 2QECA 3TT2A 2YNEA 3EO4A 4ZBGA 1M4GA 2H5MA 2J8NA 2R1IA 3PGPA 3JTKA 1YREA 5G1ZA 2I79A 2PC1A 2WUUA 5IB0A 4HNXB 2FE7A 5AG7A 5JPHA 3CXPA 1VHSA 2HQYA 4C2ZA 1V0CA 4UBRA 4ORFA 2B5GA 4FD5A 4NEXA 1GHEA 1M4DA 4Q38A 2PDOA 5FVJA 3R95A 2Z3PA 1IYKA 2C27A 2VEZA 3PZJA 1SQHA 1P0HA 2CNTA 4AB7A 4FD6A 3C26A 2O28A 4C68A 2B5GB 1LRZA 3VWDA 3WR7A 4JD6A 1IIDA 4PV6A 3GYAA 2D4OA 2Z3MA 2B4DB 5E96A 2BUEA 4KSAA 3KKWA 3W6XA 4HKFA 3IWEA 3DDDA 2B58A 5F49A 5G21A 4A30A 3G8WA 3D8PA 2Q0YA 4OAEA 3TE4A 1QSNA 1PUAA 5J8CA 4XPDC 1IB1E 3R9GA 2HV2A 4PSXA 1QSTA 4A33A 1Y9WA 1NSLA 4A2ZA 4JJXA 2OB0A 4B14A 2KCWA 4RI1A 4KVXA 2B3VA 4XNHB 3W6SA 4B5PA 4CGPA 2DPTA 2OZHA 2R8VA 2YNCC 4RS2A 1M1DA 3DR8A 4CRZB 4E8OA 1OZPA 2GE3A 2YGWA 4K30A 4MFKA 2B3UA 3SXOA 1Q2DA 3FB3A 4MI4A 2GANA 5IV0A 1VKCA 2ZXVA 4AVAA 4EVYA 4R57A 1NMTA 4KVME 2F5IA 3SXNA 2ARHA 1YGHA 2PRBA 2AE6A 4QC6A 4H89A 5JQ4A 2EUIA 4CYQA 1S3ZA 4KVOE 2P0WA 4MY0A 4XPKA 4AG9A 2VZYA 1M44A 4MJ8A 1IYLA 1XE4A 1I12A 4KUAA 3OWCA 4MFPA 3FYNA 4B5OA 2Q04A 2FSRA 3EC4A 3P2FA 3R9FA 4ZGYB 4CGOA 3V8IA 2P6EA 2VQYA 4L8AA 2PQ8A 2Z10A 2RC4A 2PSWA 2CXAA 3LD2A 2ZW7A 2REEA 5BWAB 4M85A 3DNSA 2B4DA 3UY5A 1ZO0A 4IF5A 3CXQA 4YGOA 4Q36A 4B12A 2D4PA 2CNMA 4CAFA 3TO9A 3BJ8A 2PR1A 1XMTA 1M4IA 1B6BA 5KTDA 2Z0ZA 2K5TA 4J3GA 4MY3A 4U5YA 2NMTA 4B13A 3N7ZA 1QSOA 2G3TA 2Q4YA 4XPLA 4F0XA 1S5KA 3FRMA 2Z3NA 1PU9A 3ZZIA 3BLNA 1KUYA 4A32A 3B8GA 4II9A 1Z4EA 2VBQA 5AG4A 1MK4A 1P4NA 2Y0MA 4BBHA 2IL4A 5G22A 4CRYB 5I0CA 4MFLA 4CGLA 4C2XA 3I3GA 4YFJA 4CYOA 4BMHA 3EXNA 4OLLA 4QB9A 4KOSA 3F0AA 1I21A 3LODA 4XPDB 4JXRA 4QUSA 1FY7A 3D2PA 3H5ZA 2QMLA 3IGRA 2Z3KA 4CYPA 2YNCA 2QIRA 4A95A 5F48A 1QSMA 4CAWA 4MFZA 3JVNA 4CGMA 3H4QA 1S7NA 2Z3LA 2VXKA 3PP9A 2R98A 4UWIA 5H84A 4AVBA 4CAEA 4MBUA 4ONUA 2HUZA 1KUXA 4KOVA 4M3SA 5F47A 4KLVA 1S7KA 2Z3OA 4KZTA 4C2YA 2VZZA 2AJ6A 1R57A 4UCNA 2REFA 3F8KA 2ZW6A 4KS9A 3FNCA 2ZW5A 1WWZA 2G0BA 2VI7A 4YRHA 1YVKA 4LUAA 2BEIA 4A31A 3TOBA 4I49A 3NE7A 2Q4VA 3TO6A 3D2MA 1YLEA 1XIXA 1S60A 3QAHA 5C82A 3E0KA 5AG5A 4AG7A 4JWPA 4E2AA 1Y7RA 3FXTA 1YK3A 2JDDA 3TFYA 5KTCA 3S6HA 1QSRA 4UCMA 1Z4RA 1MJ9A 1RXTA 5DWNA 2P6GA 3JUWA 2OU2A 2I00A 2FXFA 1TIQA 2WPWA 3K9UA 1I1DA 4OADA 4R9MA 5AGEA 5KTAA 4KUBA 4CAXA 2PR8A 1J4JA 4HNYB 4C7IA 1WK4A 1BOBA 1KUVA 2Z11A 4F6AA 1Q2YA 1IICA 5A27A 4R3KA 4H6ZA 1Z9UA 4FD4A 4FD7A 1XEBA 2OZUA 4JXQA 2JLMA 2ZPAA 3R96A 3A9LA 2WSAA 3W91A 1BO4A 2J8RA 2R7HA 4QBJA 3R9EA 1CM0A 1U6MA 4KOTA 3MGDA 4IUSA 3BJ7A 1XF8A 4L89A 4U9YA 2A4NA 4UFWA 2DXQA 2OZGA 3F5BA 4KOXA 4CAVA 2B4BA 4KOUA 5CNPA 1NE9A 5DWMA 1YX0A 2G3AA 4CGNA 2CY2A 4AVCA 4MFJA 2CNSA 4NSQA 3DR6A 5ISVA 4R3LA 1Y9KA 3GKRA 1CJWA 3GY9A 4Y49C 3D3SA 4DNCA 2FCKA 5J8FA 1MJAA 3TO7A 2BL1A 3S6FA 3IU2A 4UA3A 3T90A 1RO5A 2J8MA 3S6KA 3G3SA 4R87A 4Y49B 3TCVA 3EFAA 1KZFA 4U9ZA 2ATRA 3IWGA 3P2HA 4NCZA 4H6UA 4XNHC 1N71A 3VWEA 5HMNA 1S7LA 2FS5A 2FIAA 3FBUA 2EVNA 5G20A 5GCNA 2ZW4A 1B87A 4F0YA 4KSFA 3RYOA 2DPSA 5EC4A 2FT0A 3ZJ0A 4E0AA 5F46A 4GS4A 3QB8A 3TTHA 4JLYA 3EY5A 4PK3A 5A28A 5IX3A 2JDCA 5EBVA 1YVOA 3CXSA 4NF1A 4NXYA 3S6GA 1MJBA 2BSWA 3FIXA 4UFVA 2Q44A 3SHPA 4C7HA 5H86A 4MHDA 5AG6A 4B5PB 2X7BA 2YNDA 4X5KA 1S7FA 2JEVA 4PK2A 2P6FA 5HH1A 1ON0A 3T9YA 2FL4A 4PSWA 4KLWA 4KOWA 2OH1A 4HNWB 1L0CA 4B10A 1UFHA 3I9SA 2GIVA 2FIWA 4MFQA 3TOAA 1YR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOR A;  3DSB A;  5C88 A;  4QVT A;  2Q7B A;  4UWJ A;  4LX9 A;  1K4J A;  1Q2C A;  4KOY A;  3R1K A;  4CS0 B;  2WPX A;  2QEC A;  3TT2 A;  3EO4 A;  4ZBG A;  1M4G A;  2H5M A;  2J8N A;  2R1I A;  3PGP A;  1YRE A;  2I79 A;  2PC1 A;  5IB0 A;  4HNX B;  2FE7 A;  5JPH A;  3CXP A;  1VHS A;  2HQY A;  1V0C A;  4UBR A;  4ORF A;  2B5G A;  4FD5 A;  4NEX A;  1GHE A;  1M4D A;  2PDO A;  5FVJ A;  3R95 A;  1IYK A;  2C27 A;  2VEZ A;  3PZJ A;  1SQH A;  1P0H A;  2CNT A;  4AB7 A;  4FD6 A;  3C26 A;  2O28 A;  2B5G B;  1LRZ A;  3VWD A;  3WR7 A;  4JD6 A;  1IID A;  4PV6 A;  3GYA A;  2D4O A;  2B4D B;  5E96 A;  2BUE A;  3KKW A;  3W6X A;  4HKF A;  3DDD A;  2B58 A;  5F49 A;  3G8W A;  3D8P A;  2Q0Y A;  4OAE A;  3TE4 A;  1QSN A;  1PUA A;  5J8C A;  4XPD C;  1IB1 E;  3R9G A;  2HV2 A;  4PSX A;  1QST A;  1Y9W A;  1NSL A;  4JJX A;  2OB0 A;  2KCW A;  4RI1 A;  4KVX A;  2B3V A;  4XNH B;  3W6S A;  4B5P A;  2OZH A;  2R8V A;  4RS2 A;  1M1D A;  3DR8 A;  4CRZ B;  4E8O A;  1OZP A;  2GE3 A;  3SXO A;  4K30 A;  2B3U A;  1Q2D A;  3FB3 A;  4MI4 A;  2GAN A;  5IV0 A;  1VKC A;  2ZXV A;  4AVA A;  4EVY A;  4R57 A;  1NMT A;  4KVM E;  2F5I A;  3SXN A;  2ARH A;  1YGH A;  2PRB A;  2AE6 A;  4QC6 A;  4H89 A;  5JQ4 A;  2EUI A;  1S3Z A;  4KVO E;  2P0W A;  4MY0 A;  4XPK A;  4AG9 A;  2VZY A;  1M44 A;  4MJ8 A;  1IYL A;  1XE4 A;  1I12 A;  4KUA A;  3OWC A;  3FYN A;  4B5O A;  2Q04 A;  2FSR A;  3EC4 A;  3P2F A;  3R9F A;  3V8I A;  2P6E A;  2VQY A;  4L8A A;  2PQ8 A;  2Z10 A;  2RC4 A;  2PSW A;  3LD2 A;  2ZW7 A;  2REE A;  4M85 A;  3DNS A;  2B4D A;  3UY5 A;  4IF5 A;  3CXQ A;  4YGO A;  2D4P A;  2CNM A;  3TO9 A;  3BJ8 A;  2PR1 A;  1XMT A;  1M4I A;  1B6B A;  5KTD A;  2Z0Z A;  2K5T A;  4J3G A;  4MY3 A;  4U5Y A;  2NMT A;  3N7Z A;  1QSO A;  2G3T A;  2Q4Y A;  4XPL A;  1S5K A;  3FRM A;  3ZZI A;  1PU9 A;  3BLN A;  1KUY A;  4II9 A;  3B8G A;  1Z4E A;  2VBQ A;  1MK4 A;  1P4N A;  2Y0M A;  2IL4 A;  4CRY B;  5I0C A;  3I3G A;  4YFJ A;  4BMH A;  3EXN A;  4OLL A;  4QB9 A;  4KOS A;  3F0A A;  1I21 A;  3LOD A;  4XPD B;  4JXR A;  4QUS A;  1FY7 A;  3D2P A;  2QML A;  3IGR A;  2QIR A;  5F48 A;  1QSM A;  4CAW A;  3JVN A;  3H4Q A;  1S7N A;  2VXK A;  3PP9 A;  2R98 A;  4UWI A;  5H84 A;  4AVB A;  4MBU A;  4ONU A;  2HUZ A;  1KUX A;  4KOV A;  4M3S A;  5F47 A;  4KLV A;  1S7K A;  4KZT A;  2VZZ A;  2AJ6 A;  1R57 A;  2REF A;  3F8K A;  2ZW6 A;  3FNC A;  2ZW5 A;  1WWZ A;  2G0B A;  2VI7 A;  4YRH A;  1YVK A;  4LUA A;  2BEI A;  3TOB A;  4I49 A;  3NE7 A;  2Q4V A;  3TO6 A;  3D2M A;  1YLE A;  1XIX A;  1S60 A;  3QAH A;  5C82 A;  3E0K A;  4AG7 A;  4JWP A;  4E2A A;  1Y7R A;  3FXT A;  1YK3 A;  2JDD A;  3TFY A;  5KTC A;  3S6H A;  1QSR A;  1Z4R A;  1MJ9 A;  1RXT A;  5DWN A;  2P6G A;  3JUW A;  2OU2 A;  2I00 A;  2FXF A;  1TIQ A;  2WPW A;  3K9U A;  1I1D A;  4OAD A;  4R9M A;  5KTA A;  4KUB A;  4CAX A;  2PR8 A;  1J4J A;  4HNY B;  1WK4 A;  1BOB A;  1KUV A;  2Z11 A;  4F6A A;  1Q2Y A;  1IIC A;  4R3K A;  4H6Z A;  1Z9U A;  4FD4 A;  4FD7 A;  1XEB A;  2OZU A;  4JXQ A;  2JLM A;  2ZPA A;  3R96 A;  3W91 A;  1BO4 A;  2J8R A;  2R7H A;  4QBJ A;  3R9E A;  1CM0 A;  1U6M A;  4KOT A;  3MGD A;  4IUS A;  3BJ7 A;  1XF8 A;  4L89 A;  4U9Y A;  2A4N A;  2DXQ A;  2OZG A;  3F5B A;  4KOX A;  4CAV A;  2B4B A;  4KOU A;  5CNP A;  1NE9 A;  5DWM A;  1YX0 A;  2G3A A;  2CY2 A;  4AVC A;  2CNS A;  4NSQ A;  3DR6 A;  5ISV A;  4R3L A;  1Y9K A;  3GKR A;  1CJW A;  3GY9 A;  4Y49 C;  3D3S A;  4DNC A;  2FCK A;  5J8F A;  1MJA A;  3TO7 A;  2BL1 A;  3S6F A;  4UA3 A;  3T90 A;  1RO5 A;  2J8M A;  3S6K A;  3G3S A;  4R87 A;  4Y49 B;  3TCV A;  3EFA A;  1KZF A;  4U9Z A;  2ATR A;  3IWG A;  3P2H A;  4NCZ A;  4H6U A;  4XNH C;  1N71 A;  3VWE A;  5HMN A;  1S7L A;  2FS5 A;  2FIA A;  3FBU A;  2EVN A;  5GCN A;  2ZW4 A;  1B87 A;  4F0Y A;  3RYO A;  5EC4 A;  2FT0 A;  3ZJ0 A;  4E0A A;  5F46 A;  4GS4 A;  3QB8 A;  3TTH A;  4JLY A;  3EY5 A;  4PK3 A;  5IX3 A;  2JDC A;  5EBV A;  1YVO A;  3CXS A;  4NF1 A;  4NXY A;  3S6G A;  1MJB A;  2BSW A;  3FIX A;  2Q44 A;  3SHP A;  5H86 A;  4MHD A;  4B5P B;  2X7B A;  4X5K A;  1S7F A;  2JEV A;  4PK2 A;  2P6F A;  5HH1 A;  1ON0 A;  3T9Y A;  2FL4 A;  4PSW A;  4KLW A;  4KOW A;  2OH1 A;  4HNW B;  1L0C A;  1UFH A;  3I9S A;  2GIV A;  2FIW A;  3TOA A;  1YR0 A; 
#chains in the Genus database with same CATH topology
 3IU1 A;  1Z8T A;  4KOR A;  3DSB A;  4UCP A;  4CYN A;  1XBU A;  5C88 A;  4B11 A;  5IB9 A;  3NFZ A;  4QVT A;  1XOV A;  2Q7B A;  4UWJ A;  5J1Q A;  1X10 A;  3IJ3 A;  3PBB A;  4LX9 A;  4UFX A;  1K4J A;  4RN7 A;  1Q2C A;  4KOY A;  4NGN A;  4P4J A;  3SJX A;  7CPA A;  2Q4Z A;  2PJ8 A;  3RZA A;  3QAY A;  3R1K A;  4CS0 B;  5HVG A;  4MHN A;  2WPX A;  2QEC A;  3D4U A;  3B3S A;  3TT2 A;  1ELM P;  2YNE A;  3EO4 A;  3IFE A;  2AFZ A;  4PXC A;  2O53 A;  4ZBG A;  1M4G A;  3SJG A;  2H5M A;  2J8N A;  2XEG A;  1VHE A;  2R1I A;  3PGP A;  3JTK A;  1YRE A;  5G1Z A;  2I79 A;  2PC1 A;  2WUU A;  5IB0 A;  4HNX B;  2FE7 A;  5AG7 A;  4OC0 A;  3PB9 X;  3CXP A;  1VHS A;  2HQY A;  4UEF A;  4C2Z A;  1V0C A;  5JPH A;  4UBR A;  1R3N A;  4EME A;  2IQ6 A;  3PFO A;  4F8Z A;  4ORF A;  2B5G A;  1CP6 A;  2IJZ A;  1GHE A;  4FD5 A;  4LQG A;  4NEX A;  4MHP A;  5THW A;  3KR5 A;  1M4D A;  3D67 A;  4Q38 A;  3IIB A;  2PDO A;  4WWV A;  5FVJ A;  3VAR A;  1CG2 A;  3R95 A;  1Z2L A;  1IYK A;  1TKH A;  2ANP A;  2Z3P A;  2C27 A;  3IWW A;  2VEZ A;  3PZJ A;  4MHZ A;  1TKJ A;  1SQH A;  1P0H A;  2CNT A;  1VIX A;  2EK8 A;  2PJ1 A;  4AB7 A;  4FD6 A;  1CBX A;  3C26 A;  4X2T A;  2O28 A;  4C68 A;  2B5G B;  4UIA A;  1LRZ A;  3VWD A;  3WR7 A;  4JD6 A;  1IID A;  4PV6 A;  3GYA A;  2D4O A;  3HUV A;  2EBJ A;  2Z3M A;  4B6Z A;  2B4D B;  2ZEG A;  5E96 A;  1YME A;  2BUE A;  2PJA A;  3FEE A;  4Z65 A;  4KSA A;  3KKW A;  3KHX A;  1IGB A;  3W6X A;  3HLP A;  4X8I A;  2C6G A;  4ONW A;  4HKF A;  4FAI A;  4TWE A;  1IU8 A;  1FNO A;  2RFH A;  4H2K A;  3IWE A;  3DDD A;  2B58 A;  2ZOG A;  4NGR A;  2ABZ A;  3IO1 A;  5F49 A;  5G21 A;  4A30 A;  2IMO A;  3G8W A;  5JM6 A;  3D8P A;  3RBU A;  2Q0Y A;  4OAE A;  2PIY A;  1LCP A;  3TE4 A;  1QSN A;  1PUA A;  4MHY A;  5J8C A;  2V8D A;  4XPD C;  4P45 A;  4G1P A;  1IB1 E;  3R9G A;  2HV2 A;  2PVV A;  4PSX A;  1QST A;  4A33 A;  4A94 A;  5K8N A;  4EWT A;  1Y9W A;  1NSL A;  4A39 A;  4A2Z A;  3PB8 X;  4JJX A;  1BAV A;  2OB0 A;  4F9V A;  4BD9 A;  3BXM A;  2PE3 A;  2CF4 A;  4B14 A;  4OC2 A;  3PB7 X;  2KCW A;  1YW4 A;  4KVX A;  4RI1 A;  1BLL E;  2B3V A;  4DUK A;  1XFO A;  4XNH B;  3W6S A;  4B5P A;  1Y0Y A;  2DPT A;  2OZH A;  2PJB A;  2R8V A;  2YNC C;  4RS2 A;  4W9Y A;  3KAS A;  5K8O A;  4AXV A;  4P44 A;  5CPA A;  1M1D A;  1Y0R A;  3NE8 A;  3DR8 A;  4CRZ B;  2CTB A;  4E8O A;  1OZP A;  2GE3 A;  4FBE A;  2GFQ A;  1VGY A;  3BHX A;  2YGW A;  1VHO A;  4K30 A;  2B3U A;  4MFK A;  3SXO A;  1Q2D A;  3FB3 A;  4MI4 A;  2AFS A;  2Q7S A;  3PBE A;  4IK2 A;  2GAN A;  3FEC A;  5IV0 A;  1VKC A;  2ZXV A;  1HDQ A;  3LAC A;  4AVA A;  4EVY A;  4MMO A;  4R6T A;  4R57 A;  1NMT A;  4KVM E;  2F5I A;  4HPS A;  3SXN A;  2ARH A;  1YGH A;  2PRB A;  2AE6 A;  1FT7 A;  3CZX A;  4QC6 A;  5LRG A;  2PJ6 A;  4H89 A;  1F2P A;  3NA6 A;  5JQ4 A;  1CPX A;  3MN8 A;  2EUI A;  4CYQ A;  1S3Z A;  2BCO A;  1TXR A;  2C1C A;  2P0W A;  3B3C A;  4KVO E;  3D68 A;  4EFD A;  3MRU A;  1CP7 A;  3PEI A;  4Q7A A;  4MY0 A;  2QYV A;  2CTC A;  1ZG7 A;  1Q7L A;  4XPK A;  2HB6 A;  4AG9 A;  5D8N A;  2VZY A;  5DS0 A;  1M44 A;  4MJ8 A;  2OOT A;  3FF3 A;  4MCP A;  1IYL A;  1XE4 A;  1I12 A;  2F8H A;  3OWC A;  4KUA A;  4X3R A;  4UEZ A;  4MFP A;  3FYN A;  1YLO A;  2GU2 A;  2PJ3 A;  4B5O A;  2Q04 A;  3T8W A;  2XEI A;  2FSR A;  4UIB A;  4NJR A;  5LYL A;  3EC4 A;  3FX6 A;  2WZN A;  2C6P A;  4NFR A;  3P2F A;  3IC1 A;  1YQE A;  3R9F A;  4ZGY B;  4CGO A;  3V8I A;  2P6E A;  4BIN A;  2BOA A;  2VQY A;  4L8A A;  2PQ8 A;  2Z10 A;  2RC4 A;  2PSW A;  3B7I A;  3DGV A;  2CXA A;  2PJ5 A;  5LRK A;  3LD2 A;  2ZW7 A;  3N5F A;  2F7V A;  3DLJ A;  2REE A;  5BWA B;  4M85 A;  3DNS A;  2B4D A;  4NGM A;  3D66 A;  5K8P A;  3PFE A;  3UY5 A;  1ZO0 A;  3KR4 A;  4IF5 A;  3CXQ A;  4YGO A;  4Q36 A;  4R76 A;  4B12 A;  2D4P A;  2CNM A;  4CAF A;  3TO9 A;  3BJ8 A;  4ZYQ A;  2PR1 A;  4NGT A;  3I1U A;  1XMT A;  2ZEH A;  1CX8 A;  3B35 A;  1M4I A;  1B6B A;  5KTD A;  2Z0Z A;  4FUU A;  2K5T A;  2QVP A;  4PXD A;  4J3G A;  4P6Y A;  4MY3 A;  4U5Y A;  2NMT A;  4B13 A;  3N7Z A;  2GLF A;  1LOK A;  1QSO A;  1YW6 A;  2ODF A;  3VH9 A;  5EMI A;  2G3T A;  2Q4Y A;  4KSI A;  4XPL A;  1JQG A;  4F0X A;  1S5K A;  3FRM A;  4P4D A;  2Z3N A;  1PU9 A;  2FVG A;  3BLN A;  1KUY A;  3ZZI A;  1HEE A;  3B8G A;  4A32 A;  1Z4E A;  2VBQ A;  4II9 A;  5AG4 A;  4OME A;  1EE3 P;  1AMP A;  2EK9 A;  4MXU A;  2GLJ A;  2NSM A;  4P4I A;  5JH9 A;  5LYF A;  1MK4 A;  3LWU A;  4M6I A;  2QJ8 A;  1P4N A;  4P4F A;  2PRQ A;  4NJQ A;  2AFM A;  5LYI A;  3PRT A;  2Y0M A;  4BBH A;  2IL4 A;  5G22 A;  5LRJ A;  4CRY B;  1ZG8 A;  4PXB A;  1R43 A;  4DJL A;  3GIU A;  3KHZ A;  5I0C A;  4MFL A;  4CGL A;  4JZ0 A;  2VL1 A;  3RNZ A;  4C2X A;  8CPA A;  3B3W A;  3I3G A;  3KL9 A;  2PCU A;  3RAM A;  4CYO A;  4YFJ A;  4BMH A;  2ZEN A;  1DTD A;  3EXN A;  4OLL A;  1GYT A;  1PYT B;  4KOS A;  3F0A A;  1I21 A;  3LOD A;  1HDU A;  2POK A;  4QB9 A;  4XPD B;  4ZY2 A;  4JXR A;  4F9U A;  3H8G A;  4QUS A;  1FY7 A;  2ZEP A;  3D2P A;  2HC9 A;  5HXD A;  3H5Z A;  2QML A;  3IGR A;  5D29 A;  2Z3K A;  4WJB A;  4CYP A;  3ISX A;  2YNC A;  1OBR A;  2QIR A;  4OC5 A;  3SI2 A;  5F48 A;  1QSM A;  3PB4 X;  3H8F A;  4A95 A;  4CAW A;  3S9N A;  3WAB A;  1H8L A;  2DF5 A;  3JVN A;  4MFZ A;  4CGM A;  3H4Q A;  1S7N A;  3KQX A;  2Z3L A;  2VXK A;  3PP9 A;  2RB7 A;  4YWY A;  4M6H A;  2R98 A;  4UWI A;  4CGP A;  4ZY0 A;  3PB6 X;  1QQ9 A;  3K9T A;  5H84 A;  3WC5 A;  4AVB A;  4CAE A;  4MBU A;  1ZLH A;  4ONU A;  3VAT A;  5I4M A;  2HUZ A;  3TC8 A;  1KUX A;  4KOV A;  4M3S A;  5F47 A;  4KLV A;  1S7K A;  2Z3O A;  4KZT A;  4OC4 A;  4C2Y A;  2VZZ A;  2AJ6 A;  1R57 A;  3B2Y A;  2REF A;  4GM5 A;  4UCN A;  3F8K A;  2PJ0 A;  2PVW A;  2ZW6 A;  4KS9 A;  4OIW A;  6CPA A;  3FNC A;  2ZW5 A;  1JWQ A;  1WWZ A;  3KZW A;  2G0B A;  2EWB A;  4P10 A;  1Y7E A;  2AFX A;  1BPM A;  1F2O A;  1YVK A;  1Z8W A;  2VI7 A;  3ISZ A;  4LUA A;  2PJ7 A;  4YRH A;  2BEI A;  3WC6 A;  4A31 A;  3SJE A;  3TOB A;  3JRU A;  3KGQ A;  3NE7 A;  4I49 A;  1TF8 A;  2ZEM A;  2Q4V A;  4TNU A;  3TO6 A;  3D2M A;  1YLE A;  1XIX A;  1S60 A;  3QAH A;  3FH4 A;  5C82 A;  1LFW A;  3E0K A;  5AG5 A;  4AG7 A;  2ZEL A;  4JWP A;  1Y7R A;  4E2A A;  1NSA A;  3FXT A;  1YK3 A;  2JDD A;  3TFY A;  1X12 A;  5KTC A;  3S6H A;  1QSR A;  5K8M A;  4UCM A;  5CBM A;  4PPZ A;  5JGF A;  1Z4R A;  1MJ9 A;  5HVF A;  1RXT A;  5DWN A;  1IOF A;  2P6G A;  3JUW A;  2OU2 A;  2I00 A;  2FXF A;  1TIQ A;  1Z8L A;  2WPW A;  2V8G A;  3K9U A;  1I1D A;  2BO9 A;  5HVH A;  4OAD A;  4R9M A;  1ELL P;  1XJO A;  2XEF A;  2EO8 A;  5AGE A;  5KTA A;  4P4B A;  4KUB A;  4CAX A;  2PR8 A;  1J4J A;  4HNY B;  4C7I A;  2PIZ A;  4MCR A;  1WK4 A;  4OP4 A;  1BOB A;  1KUV A;  2Z11 A;  4PXE A;  1IOI A;  4F6A A;  1Q2Y A;  2ZEO A;  1BPN A;  1IIC A;  5A27 A;  3D7G A;  4R3K A;  2PJC A;  3CPX A;  2I3C A;  4OC1 A;  3BI1 A;  4NGS A;  4H6Z A;  4GXH A;  4UEE A;  1KWM A;  1RTQ A;  1Z9U A;  3IEH A;  4FD4 A;  3TX8 A;  4FD7 A;  1XEB A;  2GRE A;  1LAP A;  2OZU A;  4JXQ A;  2JLM A;  2ZPA A;  3R96 A;  2G9D A;  3A9L A;  2AFU A;  2XEJ A;  3NH4 A;  4UF4 A;  1LAN A;  2WSA A;  3W91 A;  1BO4 A;  2J8R A;  4YU9 A;  4ZX8 A;  1F57 A;  2R7H A;  4QBJ A;  3KQZ A;  1XRY A;  3R9E A;  3GB0 A;  1CM0 A;  4MRI A;  1U6M A;  4KOT A;  2Q43 A;  1AYE A;  3LMS A;  3MGD A;  4IUS A;  1Z5R A;  3BJ7 A;  3H8E A;  4MCQ A;  1XF8 A;  3L2N A;  3NH8 A;  4L89 A;  4U9Y A;  2A4N A;  4UFW A;  1DE4 C;  3SJF A;  2DXQ A;  2J9A A;  2OZG A;  3F5B A;  3CT9 A;  3FJU A;  3FVL A;  4KOX A;  4CAV A;  2B4B A;  4A38 A;  1TKF A;  4KOU A;  5CNP A;  1NE9 A;  3BI0 A;  5DWM A;  1YX0 A;  2G3A A;  4CGN A;  2CY2 A;  4AVC A;  2AFW A;  4MFJ A;  2PJ2 A;  1LAM A;  2CNS A;  4NSQ A;  3SI1 A;  1UWY A;  3DR6 A;  5F09 A;  4IAV A;  4DYO A;  5ISV A;  4R3L A;  1Y9K A;  2JEW A;  2C6C A;  3GKR A;  2CIJ A;  1CJW A;  3B3V A;  3GY9 A;  4ZY1 A;  4Y49 C;  1CPS A;  3D3S A;  4DNC A;  4MCS A;  2FCK A;  2ZED A;  1MJA A;  2ZOF A;  3TO7 A;  5J8F A;  2BL1 A;  4NGP A;  3S6F A;  5ELY A;  3S9M A;  3IU2 A;  3WC7 A;  4UA3 A;  1ARL A;  3T90 A;  2JBK A;  1RO5 A;  2V77 A;  2J8M A;  4O23 A;  3CDX A;  1Z8X A;  3S6K A;  3G3S A;  1ARM A;  1YSJ A;  4R87 A;  3FMC A;  4Y49 B;  3TCV A;  2WYR A;  3EFA A;  2JBJ A;  1KZF A;  4K3N A;  4ZI6 A;  1XMB A;  4U9Z A;  4M6G A;  2NYQ A;  2ATR A;  2AFO A;  3S9L A;  3IWG A;  3P2H A;  3NH5 A;  4NCZ A;  4H6U A;  4R8F A;  3KI9 A;  1A2Z A;  4XNH C;  1N71 A;  3SI0 A;  3VWE A;  4P4E A;  1S7L A;  5HMN A;  3D7F A;  2FS5 A;  2FIA A;  2PJ4 A;  2EVN A;  3FBU A;  5G20 A;  2Q51 A;  1IY7 A;  3GUX A;  2O4H A;  2ZW4 A;  1B87 A;  5GCN A;  4F0Y A;  4KSF A;  4OKO A;  3RYO A;  2DPS A;  4ZX9 A;  3V7Z A;  3CPA A;  3K2K A;  5EC4 A;  2FT0 A;  3ZJ0 A;  3V38 A;  4E0A A;  4OID A;  5F46 A;  2DEA A;  4GS4 A;  2ZEE A;  3QB8 A;  4JLY A;  3TTH A;  3EY5 A;  4PK3 A;  2V8H A;  5A28 A;  5IX3 A;  1TF9 A;  2JDC A;  4JYW A;  4NGQ A;  5EBV A;  4RUH A;  4PQA A;  1YVO A;  3CXS A;  4NF1 A;  4NXY A;  1M4L A;  4IHM A;  3S6G A;  1MJB A;  4CPA A;  2BSW A;  3FIX A;  4UFV A;  3RO0 A;  2Q44 A;  3SHP A;  4C7H A;  5H86 A;  4MHD A;  5AG6 A;  4B5P B;  2X7B A;  2YND A;  4FWU A;  4X5K A;  1S7F A;  2JEV A;  3D7D A;  4PK2 A;  4OC3 A;  2P6F A;  4A37 A;  1PCA A;  1ON0 A;  5HH1 A;  3D7H A;  3GLJ A;  3T9Y A;  4R7M A;  3WT4 A;  1AUG A;  2FL4 A;  4PSW A;  3FED A;  4KLW A;  1QMU A;  1ZLI A;  4KOW A;  2V8V A;  2OH1 A;  4HNW B;  4LQ6 A;  1ZG9 A;  2ZEF A;  5LYD A;  1L0C A;  4B10 A;  1UFH A;  2OR4 A;  3I9S A;  2PJ9 A;  3QNV A;  2GIV A;  2FIW A;  3B3T A;  4MFQ A;  3TOA A;  1YR0 A; 
#chains in the Genus database with same CATH homology
 3IU1 A;  4KOR A;  3DSB A;  4UCP A;  4CYN A;  5C88 A;  4B11 A;  4QVT A;  2Q7B A;  4UWJ A;  4LX9 A;  4UFX A;  1K4J A;  1Q2C A;  4KOY A;  3R1K A;  4CS0 B;  2WPX A;  2QEC A;  3TT2 A;  2YNE A;  3EO4 A;  4ZBG A;  1M4G A;  2H5M A;  2J8N A;  2R1I A;  3PGP A;  3JTK A;  1YRE A;  5G1Z A;  2I79 A;  2PC1 A;  2WUU A;  5IB0 A;  4HNX B;  2FE7 A;  5AG7 A;  5JPH A;  3CXP A;  1VHS A;  2HQY A;  4C2Z A;  1V0C A;  4UBR A;  4ORF A;  2B5G A;  4FD5 A;  4NEX A;  1GHE A;  1M4D A;  4Q38 A;  2PDO A;  5FVJ A;  3R95 A;  2Z3P A;  1IYK A;  2C27 A;  2VEZ A;  3PZJ A;  1SQH A;  1P0H A;  2CNT A;  4AB7 A;  4FD6 A;  3C26 A;  2O28 A;  4C68 A;  2B5G B;  1LRZ A;  3VWD A;  3WR7 A;  4JD6 A;  1IID A;  4PV6 A;  3GYA A;  2D4O A;  2Z3M A;  2B4D B;  5E96 A;  2BUE A;  4KSA A;  3KKW A;  3W6X A;  4HKF A;  3IWE A;  3DDD A;  2B58 A;  5F49 A;  5G21 A;  4A30 A;  3G8W A;  3D8P A;  2Q0Y A;  4OAE A;  3TE4 A;  1QSN A;  1PUA A;  5J8C A;  4XPD C;  1IB1 E;  3R9G A;  2HV2 A;  4PSX A;  1QST A;  4A33 A;  1Y9W A;  1NSL A;  4A2Z A;  4JJX A;  2OB0 A;  4B14 A;  2KCW A;  4RI1 A;  4KVX A;  2B3V A;  4XNH B;  3W6S A;  4B5P A;  4CGP A;  2DPT A;  2OZH A;  2R8V A;  2YNC C;  4RS2 A;  1M1D A;  3DR8 A;  4CRZ B;  4E8O A;  1OZP A;  2GE3 A;  2YGW A;  4K30 A;  4MFK A;  2B3U A;  3SXO A;  1Q2D A;  3FB3 A;  4MI4 A;  2GAN A;  5IV0 A;  1VKC A;  2ZXV A;  4AVA A;  4EVY A;  4R57 A;  1NMT A;  4KVM E;  2F5I A;  3SXN A;  2ARH A;  1YGH A;  2PRB A;  2AE6 A;  4QC6 A;  4H89 A;  5JQ4 A;  2EUI A;  4CYQ A;  1S3Z A;  4KVO E;  2P0W A;  4MY0 A;  4XPK A;  4AG9 A;  2VZY A;  1M44 A;  4MJ8 A;  1IYL A;  1XE4 A;  1I12 A;  4KUA A;  3OWC A;  4MFP A;  3FYN A;  4B5O A;  2Q04 A;  2FSR A;  3EC4 A;  3P2F A;  3R9F A;  4ZGY B;  4CGO A;  3V8I A;  2P6E A;  2VQY A;  4L8A A;  2PQ8 A;  2Z10 A;  2RC4 A;  2PSW A;  2CXA A;  3LD2 A;  2ZW7 A;  2REE A;  5BWA B;  4M85 A;  3DNS A;  2B4D A;  3UY5 A;  1ZO0 A;  4IF5 A;  3CXQ A;  4YGO A;  4Q36 A;  4B12 A;  2D4P A;  2CNM A;  4CAF A;  3TO9 A;  3BJ8 A;  2PR1 A;  1XMT A;  1M4I A;  1B6B A;  5KTD A;  2Z0Z A;  2K5T A;  4J3G A;  4MY3 A;  4U5Y A;  2NMT A;  4B13 A;  3N7Z A;  1QSO A;  2G3T A;  2Q4Y A;  4XPL A;  4F0X A;  1S5K A;  3FRM A;  2Z3N A;  1PU9 A;  3ZZI A;  3BLN A;  1KUY A;  4A32 A;  3B8G A;  4II9 A;  1Z4E A;  2VBQ A;  5AG4 A;  1MK4 A;  1P4N A;  2Y0M A;  4BBH A;  2IL4 A;  5G22 A;  4CRY B;  5I0C A;  4MFL A;  4CGL A;  4C2X A;  3I3G A;  4YFJ A;  4CYO A;  4BMH A;  3EXN A;  4OLL A;  4QB9 A;  4KOS A;  3F0A A;  1I21 A;  3LOD A;  4XPD B;  4JXR A;  4QUS A;  1FY7 A;  3D2P A;  3H5Z A;  2QML A;  3IGR A;  2Z3K A;  4CYP A;  2YNC A;  2QIR A;  4A95 A;  5F48 A;  1QSM A;  4CAW A;  4MFZ A;  3JVN A;  4CGM A;  3H4Q A;  1S7N A;  2Z3L A;  2VXK A;  3PP9 A;  2R98 A;  4UWI A;  5H84 A;  4AVB A;  4CAE A;  4MBU A;  4ONU A;  2HUZ A;  1KUX A;  4KOV A;  4M3S A;  5F47 A;  4KLV A;  1S7K A;  2Z3O A;  4KZT A;  4C2Y A;  2VZZ A;  2AJ6 A;  1R57 A;  4UCN A;  2REF A;  3F8K A;  2ZW6 A;  4KS9 A;  3FNC A;  2ZW5 A;  1WWZ A;  2G0B A;  2VI7 A;  4YRH A;  1YVK A;  4LUA A;  2BEI A;  4A31 A;  3TOB A;  4I49 A;  3NE7 A;  2Q4V A;  3TO6 A;  3D2M A;  1YLE A;  1XIX A;  1S60 A;  3QAH A;  5C82 A;  3E0K A;  5AG5 A;  4AG7 A;  4JWP A;  4E2A A;  1Y7R A;  3FXT A;  1YK3 A;  2JDD A;  3TFY A;  5KTC A;  3S6H A;  1QSR A;  4UCM A;  1Z4R A;  1MJ9 A;  1RXT A;  5DWN A;  2P6G A;  3JUW A;  2OU2 A;  2I00 A;  2FXF A;  1TIQ A;  2WPW A;  3K9U A;  1I1D A;  4OAD A;  4R9M A;  5AGE A;  5KTA A;  4KUB A;  4CAX A;  2PR8 A;  1J4J A;  4HNY B;  4C7I A;  1WK4 A;  1BOB A;  1KUV A;  2Z11 A;  4F6A A;  1Q2Y A;  1IIC A;  5A27 A;  4R3K A;  4H6Z A;  1Z9U A;  4FD4 A;  4FD7 A;  1XEB A;  2OZU A;  4JXQ A;  2JLM A;  2ZPA A;  3R96 A;  3A9L A;  2WSA A;  3W91 A;  1BO4 A;  2J8R A;  2R7H A;  4QBJ A;  3R9E A;  1CM0 A;  1U6M A;  4KOT A;  3MGD A;  4IUS A;  3BJ7 A;  1XF8 A;  4L89 A;  4U9Y A;  2A4N A;  4UFW A;  2DXQ A;  2OZG A;  3F5B A;  4KOX A;  4CAV A;  2B4B A;  4KOU A;  5CNP A;  1NE9 A;  5DWM A;  1YX0 A;  2G3A A;  4CGN A;  2CY2 A;  4AVC A;  4MFJ A;  2CNS A;  4NSQ A;  3DR6 A;  5ISV A;  4R3L A;  1Y9K A;  3GKR A;  1CJW A;  3GY9 A;  4Y49 C;  3D3S A;  4DNC A;  2FCK A;  5J8F A;  1MJA A;  3TO7 A;  2BL1 A;  3S6F A;  3IU2 A;  4UA3 A;  3T90 A;  1RO5 A;  2J8M A;  3S6K A;  3G3S A;  4R87 A;  4Y49 B;  3TCV A;  3EFA A;  1KZF A;  4U9Z A;  2ATR A;  3IWG A;  3P2H A;  4NCZ A;  4H6U A;  4XNH C;  1N71 A;  3VWE A;  5HMN A;  1S7L A;  2FS5 A;  2FIA A;  3FBU A;  2EVN A;  5G20 A;  5GCN A;  2ZW4 A;  1B87 A;  4F0Y A;  4KSF A;  3RYO A;  2DPS A;  5EC4 A;  2FT0 A;  3ZJ0 A;  4E0A A;  5F46 A;  4GS4 A;  3QB8 A;  3TTH A;  4JLY A;  3EY5 A;  4PK3 A;  5A28 A;  5IX3 A;  2JDC A;  5EBV A;  1YVO A;  3CXS A;  4NF1 A;  4NXY A;  3S6G A;  1MJB A;  2BSW A;  3FIX A;  4UFV A;  2Q44 A;  3SHP A;  4C7H A;  5H86 A;  4MHD A;  5AG6 A;  4B5P B;  2X7B A;  2YND A;  4X5K A;  1S7F A;  2JEV A;  4PK2 A;  2P6F A;  5HH1 A;  1ON0 A;  3T9Y A;  2FL4 A;  4PSW A;  4KLW A;  4KOW A;  2OH1 A;  4HNW B;  1L0C A;  4B10 A;  1UFH A;  3I9S A;  2GIV A;  2FIW A;  4MFQ A;  3TOA A;  1YR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...