4B13A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 25)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
b'MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
molecule tags Transferase
source organism Plasmodium vivax
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Antimalarial Drug Discovery.
pubmed doi rcsb
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b13A00
4C2ZA 5AGEA 5G1ZA 4A95A 2WUUA 4UFWA 4A33A 4B12A 5AG7A 4BBHA 4B10A 4CGOA 3H5ZA 5AG5A 2YNEA 4UCMA 4B11A 5A28A 4CYPA 4C2YA 4CAEA 4CGLA 4UCPA 5G20A 3IWEA 4CGNA 3IU2A 5AG4A 5AG6A 2YNCA 4UFVA 5G22A 3JTKA 4C7IA 4UCNA 4CAFA 4CYNA 4CGMA 4C2XA 4C7HA 2YNCC 4B14A 4A30A 4CGPA 5A27A 2WSAA 2YNDA 4A31A 4UFXA 4CYOA 3IU1A 4A2ZA 4C68A 5G21A 4B13A 4CYQA 4A32A
chains in the Genus database with same CATH superfamily
4MCSA 2P0WA 3IFEA 1IIDA 1R43A 1KUYA 2G3TA 1H8LA 4DYOA 2C6GA 5AG7A 4XNHB 4B10A 1DTDA 2O4HA 2NSMA 1M4DA 1TF8A 2G9DA 2XEJA 3L2NA 1UFHA 4UCPA 3EC4A 4A94A 4P4IA 1ZO0A 2PJ8A 4NXYA 4KOSA 3N5FA 2Z3KA 4MCQA 4NGPA 1Z8TA 1S7LA 4CYNA 2VZZA 1R3NA 4ZX8A 4TWEA 3PB8X 2CTCA 2H5MA 4PSXA 3D66A 3W91A 5K8NA 4MFPA 4ZY2A 2HQYA 2RFHA 4KLWA 4R6TA 1ZG9A 1X12A 4DUKA 3PRTA 3FRMA 5F49A 5LRKA 4YFJA 1MK4A 3RNZA 1ZG7A 1Q7LA 3SJEA 4BMHA 4KOYA 3FECA 1IYLA 3SI1A 1XF8A 2AFUA 3FX6A 1YGHA 2ZEHA 2R1IA 2PC1A 1M44A 4MI4A 5H84A 2FXFA 2DXQA 2G0BA 4C2YA 4M3SA 2RB7A 3RBUA 3GIUA 4CGLA 3S9MA 3DNSA 5AG6A 2YNCA 4F8ZA 2I00A 4ONUA 2HV2A 1YREA 1S7FA 4F9UA 1ELMP 1MJBA 4M6IA 3WC5A 3K2KA 4E2AA 3D67A 3TO9A 2B5GA 2CIJA 4CYOA 4MCPA 1XE4A 1Y9WA 5KTAA 4CYQA 4XPDB 3GKRA 2PIZA 2VZYA 2OU2A 4OIDA 3P2HA 4CPAA 4ZYQA 5KTDA 5HXDA 4UEZA 2AFZA 2OH1A 3FMCA 4YGOA 4QBJA 4JLYA 4LQGA 1QSRA 2PJ1A 2PSWA 2PIYA 3KR4A 4E8OA 1Z8WA 4PXBA 2FSRA 3SJFA 1M4IA 2I79A 3IO1A 4LX9A 4X2TA 1CM0A 1XMTA 4JXRA 1KWMA 5G22A 4H89A 1Q2YA 1JQGA 3V38A 4EWTA 2ZW5A 2CNMA 4KSFA 2ARHA 1VGYA 3W6SA 1V0CA 5HH1A 4X5KA 2JBKA 2CNTA 1HDQA 1PU9A 4IHMA 2JLMA 4A2ZA 3D8PA 2CNSA 3PP9A 2OZHA 1Q2DA 2QVPA 2EVNA 5CNPA 2AFMA 5LRJA 3PFEA 1CJWA 3PB6X 3TE4A 3MRUA 1I21A 4GXHA 4KSAA 3TO7A 2YNEA 3DSBA 2AE6A 3KKWA 4CRZB 5HMNA 2ATRA 3JUWA 4B11A 5LYLA 3BXMA 4NGRA 2GANA 3PEIA 4TNUA 5G20A 3KHZA 3R95A 1S7NA 1TXRA 1TKHA 1Z4RA 4K3NA 3VARA 1F2PA 2VXKA 3H8EA 3SJXA 4KVXA 4UWIA 2AFSA 5J8FA 4FWUA 4C2XA 2AJ6A 2CY2A 1VHEA 3W6XA 3D7HA 4JJXA 4WJBA 4JWPA 5C88A 4Y49B 3EXNA 2PVVA 2XEGA 2I3CA 2WPXA 2B3UA 4CAVA 1LAMA 4P4BA 5DWNA 1YX0A 1A2ZA 4MFKA 4PQAA 2WPWA 3TT2A 1Q2CA 5JH9A 2Q0YA 1QSOA 2EK9A 2FIAA 3CXQA 4L89A 3H5ZA 3P2FA 3DDDA 4EMEA 5K8PA 1SQHA 4QB9A 1YQEA 2PJ4A 3D2MA 5E96A 4KOXA 3EY5A 4ZGYB 3BHXA 4ZBGA 1MJAA 4UF4A 4H6UA 4CAWA 3D7DA 3FBUA 1OZPA 1PUAA 4B6ZA 4NGTA 3B35A 2Z11A 4KS9A 4OLLA 3DGVA 4MRIA 3CXSA 3IWGA 3LMSA 2FVGA 4G1PA 2ZEMA 3R1KA 4KORA 1YLOA 4LQ6A 1IB1E 4OC1A 4UEEA 1VIXA 2JBJA 1GYTA 3A9LA 3FF3A 3B3TA 4YRHA 5JPHA 4KOTA 5AGEA 2OZGA 3KQZA 1B6BA 2PRQA 2K5TA 3PGPA 3BLNA 4EVYA 2B4DB 5D29A 2Z3OA 3IC1A 3CPAA 4J3GA 3WR7A 3R9GA 4CS0B 3B7IA 1RTQA 2ZEPA 3QNVA 3G8WA 4KSIA 5EMIA 2Z3NA 4UEFA 4CYPA 5J1QA 1NSAA 1BPNA 5IX3A 4ONWA 3UY5A 1TKFA 1RO5A 2EWBA 4X8IA 2AFOA 4F0XA 1AYEA 3NA6A 4IUSA 4JXQA 4R87A 5J8CA 2B3VA 3R9FA 3CZXA 4NSQA 3WABA 1I1DA 2BCOA 3TCVA 1Z5RA 1YK3A 5ISVA 1XRYA 4MHYA 3RZAA 2V8VA 2Q4YA 1QMUA 4P10A 3K9TA 4PV6A 2Z3LA 2ZW6A 3GY9A 2Z3PA 4B13A 5BWAB 3FYNA 4KOVA 7CPAA 4FUUA 3TX8A 1EE3P 1TIQA 1XJOA 2NYQA 4U9ZA 2OR4A 4OIWA 3S6KA 5K8MA 3BJ7A 1PYTB 2BSWA 4NCZA 3CXPA 4JYWA 5THWA 2ZEDA 2FE7A 3SXOA 2PRBA 4ZY1A 1M4LA 1LANA 3FEDA 2VL1A 2B4DA 2POKA 4UIAA 4FD6A 3KASA 4IF5A 2OB0A 4BINA 2PJBA 2J8MA 2FL4A 4DNCA 1HEEA 2YNCC 4R3KA 1NSLA 4A30A 4QUSA 4PK3A 1LCPA 4W9YA 2EK8A 3KQXA 3N7ZA 5C82A 3RYOA 1ON0A 1U6MA 3B3VA 4RS2A 3BI1A 2D4PA 2PJ9A 4ORFA 4M6HA 4KZTA 4HNXB 4JZ0A 3NE8A 3PFOA 2G3AA 3S6HA 5F48A 4NF1A 4MHZA 1IGBA 2ZEFA 2ZEGA 2QECA 2EO8A 2IL4A 5IV0A 4MFZA 4CAXA 3DLJA 1RXTA 4NGSA 1S60A 2AFWA 4M85A 3VWEA 1CPSA 3GUXA 4UFXA 5DS0A 3S9LA 3D68A 3SJGA 4EFDA 2PJAA 2B58A 4RN7A 2V77A 1I12A 3D3SA 2JDCA 2C1CA 1CP7A 4YWYA 2PR8A 3TTHA 4A95A 3DR6A 1LOKA 4F9VA 4UFWA 1CG2A 3ZJ0A 1J4JA 3FXTA 3KL9A 1XMBA 1Z8XA 1NMTA 3NH5A 4HNYB 4MJ8A 4LUAA 4F0YA 2WZNA 4UCMA 3KZWA 2Q04A 5LYFA 3D2PA 3CDXA 2Q4ZA 1IYKA 3HUVA 5H86A 2PJ2A 3BJ8A 2CF4A 2BO9A 2J9AA 2PJ6A 1YW4A 4OP4A 3SI2A 3TOAA 4A38A 3B3SA 2VBQA 4MFJA 2FS5A 4OKOA 4OADA 1VHOA 4XNHC 4MFLA 1ARLA 4P45A 5CPAA 1AUGA 4C7HA 2Q43A 3FB3A 2C27A 2ODFA 1KZFA 5IB9A 3D4UA 1GHEA 2YNDA 3IGRA 4H6ZA 3IU1A 4AB7A 1Z4EA 1XFOA 2IMOA 1B87A 2ZELA 3PZJA 4RI1A 2GLFA 4PXEA 4HNWB 1Y7RA 3KHXA 4OC4A 4BD9A 2OZUA 3SHPA 4R9MA 1NE9A 3S6FA 4CGOA 4HPSA 4Q38A 1Y0YA 1YSJA 4OMEA 3RO0A 2BUEA 1Y9KA 3F0AA 4CAEA 2Z0ZA 3G3SA 1F57A 1VKCA 1WK4A 3T9YA 3LODA 4MY0A 4NJRA 3LD2A 4CAFA 2R7HA 1IOIA 2RC4A 4JD6A 3FH4A 4GM5A 4I49A 1S7KA 1Z2LA 1ZLIA 4R3LA 5LYIA 4CGPA 2D4OA 1P0HA 4MCRA 5A27A 2GU2A 1BAVA 3IEHA 4MHPA 2CTBA 4NFRA 3PB4X 4Q7AA 3TFYA 2PJ7A 1R57A 1FY7A 2Q44A 1CPXA 2X7BA 4ZX9A 3S6GA 4PK2A 4II9A 3WT4A 1BPMA 1YMEA 3NFZA 5EC4A 4PSWA 2V8HA 5DWMA 3R96A 3T8WA 2GREA 4A33A 2DPSA 2YGWA 5A28A 4P44A 5LYDA 2F5IA 1IOFA 1BO4A 4KUAA 3E0KA 2PDOA 2ZENA 4A39A 4P4JA 1Y0RA 1XOVA 1WWZA 2C6CA 1FNOA 4L8AA 2J8RA 3VH9A 3GB0A 2GIVA 2ZEOA 4XPLA 2FIWA 3JVNA 1ELLP 2WSAA 4CRYB 4YU9A 1BOBA 3I9SA 2O53A 4R7MA 5I4MA 1F2OA 2GE3A 4PXDA 2Q7BA 5CBMA 1K4JA 4QVTA 2CXAA 3B3CA 4MY3A 4A37A 2V8GA 2BL1A 2HC9A 3FVLA 3QAHA 1X10A 4NGNA 1S3ZA 1CP6A 4Z65A 4KVOE 1ZG8A 2P6FA 5AG5A 3MN8A 2GFQA 3KR5A 3ZZIA 2PQ8A 2XEIA 2ZW7A 4MXUA 4P6YA 2B4BA 2QIRA 3QAYA 2ZEEA 4UFVA 3B8GA 4IAVA 4MMOA 1VHSA 3ISXA 4P4DA 1BLLE 4KVME 4K30A 4R57A 2JDDA 4CGMA 1ZLHA 1KUVA 2ZPAA 5F46A 2ZOGA 4UA3A 2EUIA 3FEEA 4C68A 3JRUA 4UWJA 4ZI6A 2Q51A 1QSTA 1N71A 4AG7A 5K8OA 2VQYA 3I3GA 1XIXA 1OBRA 2PE3A 3PBBA 4AG9A 4B12A 2HUZA 4FBEA 4BBHA 1IU8A 4OC2A 2B5GB 3H4QA 4P4FA 4P4EA 2XEFA 2ABZA 2DEAA 2KCWA 1S5KA 3R9EA 1YLEA 3QB8A 4OC5A 2F7VA 3FJUA 4DJLA 3PBEA 2J8NA 3EFAA 4WWVA 5IB0A 4FD7A 3TO6A 2QMLA 5HVFA 3V7ZA 3TOBA 3RAMA 5HVHA 4QC6A 2Z10A 4OC3A 1QSMA 1Y7EA 3HLPA 4NEXA 5ELYA 5GCNA 2REEA 1L0CA 2V8DA 4M6GA 3F8KA 3IIBA 5G1ZA 4MHDA 3K9UA 3V8IA 1LRZA 2PJ3A 4IK2A 3KGQA 3FIXA 2REFA 3WC7A 4R76A 4FAIA 2PVWA 1M4GA 3IWWA 3B2YA 3FNCA 1Z8LA 2PJ0A 4UIBA 3S9NA 4KOWA 6CPAA 5F09A 4CGNA 3KI9A 3IU2A 2FCKA 3H8FA 4ZY0A 5D8NA 1P4NA 2QJ8A 4B5PB 5F47A 2Q7SA 2IJZA 4MHNA 4NGQA 1LAPA 4C7IA 1IY7A 5JQ4A 5HVGA 3GLJA 3T90A 4Y49C 2GLJA 4AVCA 2WYRA 1XEBA 1KUXA 1TF9A 3CPXA 3NE7A 4PPZA 4B5OA 1YVOA 1YVKA 3H8GA 4MBUA 5EBVA 3VATA 2AFXA 3BI0A 3NH4A 5G21A 3TC8A 2JEWA 4GS4A 4NJQA 3I1UA 4C2ZA 2PJ5A 4X3RA 4OC0A 2ZXVA 4UBRA 1XBUA 2WUUA 5FVJA 4HKFA 4AVAA 3D7FA 3F5BA 1AMPA 3NH8A 2QYVA 1ARMA 4Q36A 4PXCA 3B3WA 2R8VA 2A4NA 2VEZA 3GYAA 3C26A 4E0AA 2BEIA 3JTKA 2P6EA 3EO4A 1IICA 4MFQA 4UCNA 3SI0A 4AXVA 4O23A 4RUHA 1DE4C 4OAEA 2BOAA 4NGMA 3SXNA 2EBJA 3LACA 3PB9X 3VWDA 3DR8A 2R98A 1CBXA 2NMTA 2JEVA 1CX8A 1M1DA 2F8HA 4FD4A 4H2KA 1FT7A 1TKJA 4XPKA 5I0CA 2PCUA 4A32A 4U5YA 3WC6A 2Q4VA 1MJ9A 2VI7A 3ISZA 1QSNA 1LFWA 2OOTA 2Y0MA 1HDUA 4R8FA 3CT9A 2Z3MA 2C6PA 4B5PA 5JGFA 2O28A 1YR0A 3IWEA 4KLVA 1Z9UA 4F6AA 1JWQA 5AG4A 2HB6A 1PCAA 1UWYA 3IJ3A 3D7GA 2P6GA 3OWCA 4XPDC 2FT0A 4AVBA 4FD5A 4KUBA 4B14A 2PJCA 2DF5A 2IQ6A 3LWUA 3MGDA 4A31A 5JM6A 1YW6A 2ZW4A 1QQ9A 3PB7X 2PR1A 5KTCA 4KOUA 8CPAA 2ANPA 4U9YA 2DPTA 2ZOFA 5LRGA
chains in the Genus database with same CATH topology
2P0WA 1IIDA 1KUYA 2G3TA 5AG7A 4XNHB 4B10A 1M4DA 1UFHA 4UCPA 3EC4A 1ZO0A 4NXYA 4KOSA 2Z3KA 1S7LA 4CYNA 2VZZA 4PSXA 2H5MA 3W91A 4MFPA 2HQYA 4KLWA 3FRMA 5F49A 4YFJA 1MK4A 4BMHA 4KOYA 1IYLA 1XF8A 1YGHA 2R1IA 2PC1A 1M44A 4MI4A 5H84A 2FXFA 2DXQA 2G0BA 4C2YA 4M3SA 4CGLA 3DNSA 5AG6A 2YNCA 2I00A 4ONUA 2HV2A 1YREA 1S7FA 1MJBA 4E2AA 3TO9A 2B5GA 4CYOA 1XE4A 1Y9WA 5KTAA 4CYQA 4XPDB 3GKRA 2VZYA 2OU2A 3P2HA 5KTDA 2OH1A 4YGOA 4QBJA 4JLYA 1QSRA 2PSWA 4E8OA 2FSRA 1M4IA 2I79A 4LX9A 1CM0A 1XMTA 4JXRA 5G22A 4H89A 1Q2YA 2ZW5A 2CNMA 4KSFA 2ARHA 3W6SA 1V0CA 5HH1A 4X5KA 2CNTA 1PU9A 2JLMA 4A2ZA 3D8PA 2CNSA 3PP9A 2OZHA 1Q2DA 2EVNA 5CNPA 1CJWA 3TE4A 1I21A 4KSAA 3TO7A 2YNEA 3DSBA 2AE6A 3KKWA 4CRZB 5HMNA 2ATRA 3JUWA 4B11A 2GANA 5G20A 3R95A 1S7NA 1Z4RA 2VXKA 4KVXA 4UWIA 5J8FA 4C2XA 2AJ6A 2CY2A 3W6XA 5C88A 4JJXA 4JWPA 4Y49B 3EXNA 2WPXA 2B3UA 4CAVA 5DWNA 1YX0A 4MFKA 2WPWA 3TT2A 1Q2CA 2Q0YA 1QSOA 2FIAA 3CXQA 4L89A 3H5ZA 3P2FA 3DDDA 1SQHA 4QB9A 3D2MA 5E96A 4KOXA 3EY5A 4ZGYB 4ZBGA 1MJAA 4H6UA 4CAWA 3FBUA 1OZPA 1PUAA 2Z11A 4KS9A 4OLLA 3CXSA 3IWGA 4B5OA 4KORA 3R1KA 1IB1E 3A9LA 4YRHA 5JPHA 4KOTA 5AGEA 2OZGA 1B6BA 2K5TA 3PGPA 3BLNA 4EVYA 2B4DB 2Z3OA 4J3GA 3WR7A 3R9GA 4CS0B 3G8WA 2Z3NA 4CYPA 5IX3A 3UY5A 1RO5A 4F0XA 4IUSA 4JXQA 4R87A 5J8CA 2B3VA 3R9FA 4NSQA 5ISVA 1I1DA 3TCVA 1YK3A 2Q4YA 4PV6A 2Z3LA 2ZW6A 3GY9A 2Z3PA 4B13A 5BWAB 3FYNA 4KOVA 1TIQA 4U9ZA 3S6KA 3BJ7A 2BSWA 4NCZA 3CXPA 2FE7A 3SXOA 2PRBA 2B4DA 4FD6A 4IF5A 2OB0A 2J8MA 2FL4A 4DNCA 2YNCC 4R3KA 1NSLA 4A30A 4QUSA 4PK3A 3N7ZA 5C82A 3RYOA 1ON0A 1U6MA 4RS2A 2D4PA 4ORFA 4KZTA 4HNXB 2G3AA 3S6HA 5F48A 4NF1A 2QECA 2IL4A 5IV0A 4MFZA 4CAXA 1RXTA 1S60A 4M85A 3VWEA 4UFXA 2B58A 3D3SA 1I12A 2JDCA 3TTHA 2PR8A 4A95A 3DR6A 4UFWA 3ZJ0A 1J4JA 3FXTA 4MJ8A 1NMTA 4HNYB 4LUAA 4F0YA 4UCMA 2Q04A 3D2PA 1IYKA 5H86A 3BJ8A 3TOAA 2VBQA 4MFJA 2FS5A 4XNHC 4OADA 4MFLA 4C7HA 3FB3A 2C27A 1KZFA 1GHEA 2YNDA 3IGRA 4H6ZA 3IU1A 4AB7A 1Z4EA 1B87A 3PZJA 4RI1A 4HNWB 1Y7RA 2OZUA 3SHPA 4R9MA 1NE9A 3S6FA 4CGOA 4Q38A 2BUEA 1Y9KA 3F0AA 4CAEA 2Z0ZA 3G3SA 1VKCA 1WK4A 3T9YA 3LODA 4MY0A 3LD2A 4CAFA 2R7HA 2RC4A 4JD6A 4I49A 1S7KA 4R3LA 4CGPA 5A27A 2D4OA 1P0HA 3TFYA 1R57A 1FY7A 2Q44A 2X7BA 3S6GA 4PK2A 4II9A 5EC4A 4PSWA 5DWMA 3R96A 4A33A 2DPSA 2YGWA 5A28A 2F5IA 1BO4A 4KUAA 3E0KA 2PDOA 1WWZA 4L8AA 2J8RA 2GIVA 4XPLA 2FIWA 3JVNA 2WSAA 4CRYB 1BOBA 3I9SA 2GE3A 2Q7BA 1K4JA 4QVTA 2CXAA 4MY3A 2BL1A 3QAHA 1S3ZA 4KVOE 2P6FA 5AG5A 3ZZIA 2PQ8A 2ZW7A 2B4BA 2QIRA 4UFVA 3B8GA 1VHSA 4KVME 4K30A 4R57A 2JDDA 4CGMA 1KUVA 2ZPAA 5F46A 4UA3A 2EUIA 4C68A 4UWJA 1QSTA 1N71A 4AG7A 2VQYA 3I3GA 1XIXA 4AG9A 4B12A 2HUZA 4BBHA 2B5GB 3H4QA 2KCWA 3R9EA 1S5KA 1YLEA 3QB8A 2J8NA 3EFAA 5IB0A 4FD7A 3TO6A 2QMLA 3TOBA 4QC6A 2Z10A 1QSMA 4NEXA 5GCNA 2REEA 1L0CA 3F8KA 5G1ZA 4MHDA 3K9UA 3V8IA 1LRZA 3FIXA 2REFA 1M4GA 3FNCA 4KOWA 4CGNA 3IU2A 2FCKA 1P4NA 4B5PB 5F47A 4C7IA 5JQ4A 3T90A 4Y49C 4AVCA 1XEBA 1KUXA 3NE7A 1YVOA 1YVKA 4MBUA 5EBVA 5G21A 4GS4A 4C2ZA 4UBRA 2ZXVA 2WUUA 5FVJA 4HKFA 4AVAA 3F5BA 4Q36A 2R8VA 2A4NA 2VEZA 3GYAA 3C26A 4E0AA 2BEIA 3JTKA 2P6EA 3EO4A 1IICA 4MFQA 4UCNA 4OAEA 3SXNA 3VWDA 3DR8A 2R98A 2NMTA 2JEVA 1M1DA 4FD4A 4XPKA 5I0CA 4A32A 4U5YA 2Q4VA 1MJ9A 2VI7A 1QSNA 2Y0MA 2Z3MA 4B5PA 2O28A 1YR0A 3IWEA 4KLVA 1Z9UA 4F6AA 5AG4A 3OWCA 2P6GA 4XPDC 2FT0A 4AVBA 4FD5A 4KUBA 4B14A 3MGDA 4A31A 2ZW4A 2PR1A 5KTCA 4KOUA 4U9YA 2DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2Z A;  5AGE A;  5G1Z A;  4A95 A;  2WUU A;  4UFW A;  4A33 A;  4B12 A;  5AG7 A;  4BBH A;  4B10 A;  4CGO A;  3H5Z A;  5AG5 A;  2YNE A;  4UCM A;  4B11 A;  5A28 A;  4CYP A;  4C2Y A;  4CAE A;  4CGL A;  4UCP A;  5G20 A;  3IWE A;  4CGN A;  3IU2 A;  5AG4 A;  5AG6 A;  2YNC A;  4UFV A;  5G22 A;  3JTK A;  4C7I A;  4UCN A;  4CAF A;  4CYN A;  4CGM A;  4C2X A;  4C7H A;  2YNC C;  4B14 A;  4A30 A;  4CGP A;  5A27 A;  2WSA A;  2YND A;  4A31 A;  4UFX A;  4CYO A;  3IU1 A;  4A2Z A;  4C68 A;  5G21 A;  4B13 A;  4CYQ A;  4A32 A; 
#chains in the Genus database with same CATH topology
 4MCS A;  2P0W A;  3IFE A;  1IID A;  1R43 A;  1KUY A;  2G3T A;  1H8L A;  4DYO A;  2C6G A;  5AG7 A;  4XNH B;  4B10 A;  1DTD A;  2O4H A;  2NSM A;  1M4D A;  1TF8 A;  2G9D A;  2XEJ A;  3L2N A;  1UFH A;  4UCP A;  3EC4 A;  4A94 A;  4P4I A;  1ZO0 A;  2PJ8 A;  4NXY A;  4KOS A;  3N5F A;  2Z3K A;  4MCQ A;  4NGP A;  1Z8T A;  1S7L A;  4CYN A;  2VZZ A;  1R3N A;  4ZX8 A;  4TWE A;  3PB8 X;  2CTC A;  2H5M A;  4PSX A;  3D66 A;  3W91 A;  5K8N A;  4MFP A;  4ZY2 A;  2HQY A;  2RFH A;  4KLW A;  4R6T A;  1ZG9 A;  1X12 A;  4DUK A;  3PRT A;  3FRM A;  5F49 A;  5LRK A;  4YFJ A;  1MK4 A;  3RNZ A;  1ZG7 A;  1Q7L A;  3SJE A;  4BMH A;  4KOY A;  3FEC A;  1IYL A;  3SI1 A;  1XF8 A;  2AFU A;  3FX6 A;  1YGH A;  2ZEH A;  2R1I A;  2PC1 A;  1M44 A;  4MI4 A;  5H84 A;  2FXF A;  2DXQ A;  2G0B A;  4C2Y A;  4M3S A;  2RB7 A;  3RBU A;  3GIU A;  4CGL A;  3S9M A;  3DNS A;  5AG6 A;  2YNC A;  4F8Z A;  2I00 A;  4ONU A;  2HV2 A;  1YRE A;  1S7F A;  4F9U A;  1ELM P;  1MJB A;  4M6I A;  3WC5 A;  3K2K A;  4E2A A;  3D67 A;  3TO9 A;  2B5G A;  2CIJ A;  4CYO A;  4MCP A;  1XE4 A;  1Y9W A;  5KTA A;  4CYQ A;  4XPD B;  3GKR A;  2PIZ A;  2VZY A;  2OU2 A;  4OID A;  3P2H A;  4CPA A;  4ZYQ A;  5KTD A;  5HXD A;  4UEZ A;  2AFZ A;  2OH1 A;  3FMC A;  4YGO A;  4QBJ A;  4JLY A;  4LQG A;  1QSR A;  2PJ1 A;  2PSW A;  2PIY A;  3KR4 A;  4E8O A;  1Z8W A;  4PXB A;  2FSR A;  3SJF A;  1M4I A;  2I79 A;  3IO1 A;  4LX9 A;  4X2T A;  1CM0 A;  1XMT A;  4JXR A;  1KWM A;  5G22 A;  4H89 A;  1Q2Y A;  1JQG A;  3V38 A;  4EWT A;  2ZW5 A;  2CNM A;  4KSF A;  2ARH A;  1VGY A;  3W6S A;  1V0C A;  5HH1 A;  4X5K A;  2JBK A;  2CNT A;  1HDQ A;  1PU9 A;  4IHM A;  2JLM A;  4A2Z A;  3D8P A;  2CNS A;  3PP9 A;  2OZH A;  1Q2D A;  2QVP A;  2EVN A;  5CNP A;  2AFM A;  5LRJ A;  3PFE A;  1CJW A;  3PB6 X;  3TE4 A;  3MRU A;  1I21 A;  4GXH A;  4KSA A;  3TO7 A;  2YNE A;  3DSB A;  2AE6 A;  3KKW A;  4CRZ B;  5HMN A;  2ATR A;  3JUW A;  4B11 A;  5LYL A;  3BXM A;  4NGR A;  2GAN A;  3PEI A;  4TNU A;  5G20 A;  3KHZ A;  3R95 A;  1S7N A;  1TXR A;  1TKH A;  1Z4R A;  4K3N A;  3VAR A;  1F2P A;  2VXK A;  3H8E A;  3SJX A;  4KVX A;  4UWI A;  2AFS A;  5J8F A;  4FWU A;  4C2X A;  2AJ6 A;  2CY2 A;  1VHE A;  3W6X A;  3D7H A;  4JJX A;  4WJB A;  4JWP A;  5C88 A;  4Y49 B;  3EXN A;  2PVV A;  2XEG A;  2I3C A;  2WPX A;  2B3U A;  4CAV A;  1LAM A;  4P4B A;  5DWN A;  1YX0 A;  1A2Z A;  4MFK A;  4PQA A;  2WPW A;  3TT2 A;  1Q2C A;  5JH9 A;  2Q0Y A;  1QSO A;  2EK9 A;  2FIA A;  3CXQ A;  4L89 A;  3H5Z A;  3P2F A;  3DDD A;  4EME A;  5K8P A;  1SQH A;  4QB9 A;  1YQE A;  2PJ4 A;  3D2M A;  5E96 A;  4KOX A;  3EY5 A;  4ZGY B;  3BHX A;  4ZBG A;  1MJA A;  4UF4 A;  4H6U A;  4CAW A;  3D7D A;  3FBU A;  1OZP A;  1PUA A;  4B6Z A;  4NGT A;  3B35 A;  2Z11 A;  4KS9 A;  4OLL A;  3DGV A;  4MRI A;  3CXS A;  3IWG A;  3LMS A;  2FVG A;  4G1P A;  2ZEM A;  3R1K A;  4KOR A;  1YLO A;  4LQ6 A;  1IB1 E;  4OC1 A;  4UEE A;  1VIX A;  2JBJ A;  1GYT A;  3A9L A;  3FF3 A;  3B3T A;  4YRH A;  5JPH A;  4KOT A;  5AGE A;  2OZG A;  3KQZ A;  1B6B A;  2PRQ A;  2K5T A;  3PGP A;  3BLN A;  4EVY A;  2B4D B;  5D29 A;  2Z3O A;  3IC1 A;  3CPA A;  4J3G A;  3WR7 A;  3R9G A;  4CS0 B;  3B7I A;  1RTQ A;  2ZEP A;  3QNV A;  3G8W A;  4KSI A;  5EMI A;  2Z3N A;  4UEF A;  4CYP A;  5J1Q A;  1NSA A;  1BPN A;  5IX3 A;  4ONW A;  3UY5 A;  1TKF A;  1RO5 A;  2EWB A;  4X8I A;  2AFO A;  4F0X A;  1AYE A;  3NA6 A;  4IUS A;  4JXQ A;  4R87 A;  5J8C A;  2B3V A;  3R9F A;  3CZX A;  4NSQ A;  3WAB A;  1I1D A;  2BCO A;  3TCV A;  1Z5R A;  1YK3 A;  5ISV A;  1XRY A;  4MHY A;  3RZA A;  2V8V A;  2Q4Y A;  1QMU A;  4P10 A;  3K9T A;  4PV6 A;  2Z3L A;  2ZW6 A;  3GY9 A;  2Z3P A;  4B13 A;  5BWA B;  3FYN A;  4KOV A;  7CPA A;  4FUU A;  3TX8 A;  1EE3 P;  1TIQ A;  1XJO A;  2NYQ A;  4U9Z A;  2OR4 A;  4OIW A;  3S6K A;  5K8M A;  3BJ7 A;  1PYT B;  2BSW A;  4NCZ A;  3CXP A;  4JYW A;  5THW A;  2ZED A;  2FE7 A;  3SXO A;  2PRB A;  4ZY1 A;  1M4L A;  1LAN A;  3FED A;  2VL1 A;  2B4D A;  2POK A;  4UIA A;  4FD6 A;  3KAS A;  4IF5 A;  2OB0 A;  4BIN A;  2PJB A;  2J8M A;  2FL4 A;  4DNC A;  1HEE A;  2YNC C;  4R3K A;  1NSL A;  4A30 A;  4QUS A;  4PK3 A;  1LCP A;  4W9Y A;  2EK8 A;  3KQX A;  3N7Z A;  5C82 A;  3RYO A;  1ON0 A;  1U6M A;  3B3V A;  4RS2 A;  3BI1 A;  2D4P A;  2PJ9 A;  4ORF A;  4M6H A;  4KZT A;  4HNX B;  4JZ0 A;  3NE8 A;  3PFO A;  2G3A A;  3S6H A;  5F48 A;  4NF1 A;  4MHZ A;  1IGB A;  2ZEF A;  2ZEG A;  2QEC A;  2EO8 A;  2IL4 A;  5IV0 A;  4MFZ A;  4CAX A;  3DLJ A;  1RXT A;  4NGS A;  1S60 A;  2AFW A;  4M85 A;  3VWE A;  1CPS A;  3GUX A;  4UFX A;  5DS0 A;  3S9L A;  3D68 A;  3SJG A;  4EFD A;  2PJA A;  2B58 A;  4RN7 A;  2V77 A;  1I12 A;  3D3S A;  2JDC A;  2C1C A;  1CP7 A;  4YWY A;  2PR8 A;  3TTH A;  4A95 A;  3DR6 A;  1LOK A;  4F9V A;  4UFW A;  1CG2 A;  3ZJ0 A;  1J4J A;  3FXT A;  3KL9 A;  1XMB A;  1Z8X A;  1NMT A;  3NH5 A;  4HNY B;  4MJ8 A;  4LUA A;  4F0Y A;  2WZN A;  4UCM A;  3KZW A;  2Q04 A;  5LYF A;  3D2P A;  3CDX A;  2Q4Z A;  1IYK A;  3HUV A;  5H86 A;  2PJ2 A;  3BJ8 A;  2CF4 A;  2BO9 A;  2J9A A;  2PJ6 A;  1YW4 A;  4OP4 A;  3SI2 A;  3TOA A;  4A38 A;  3B3S A;  2VBQ A;  4MFJ A;  2FS5 A;  4OKO A;  4OAD A;  1VHO A;  4XNH C;  4MFL A;  1ARL A;  4P45 A;  5CPA A;  1AUG A;  4C7H A;  2Q43 A;  3FB3 A;  2C27 A;  2ODF A;  1KZF A;  5IB9 A;  3D4U A;  1GHE A;  2YND A;  3IGR A;  4H6Z A;  3IU1 A;  4AB7 A;  1Z4E A;  1XFO A;  2IMO A;  1B87 A;  2ZEL A;  3PZJ A;  4RI1 A;  2GLF A;  4PXE A;  4HNW B;  1Y7R A;  3KHX A;  4OC4 A;  4BD9 A;  2OZU A;  3SHP A;  4R9M A;  1NE9 A;  3S6F A;  4CGO A;  4HPS A;  4Q38 A;  1Y0Y A;  1YSJ A;  4OME A;  3RO0 A;  2BUE A;  1Y9K A;  3F0A A;  4CAE A;  2Z0Z A;  3G3S A;  1F57 A;  1VKC A;  1WK4 A;  3T9Y A;  3LOD A;  4MY0 A;  4NJR A;  3LD2 A;  4CAF A;  2R7H A;  1IOI A;  2RC4 A;  4JD6 A;  3FH4 A;  4GM5 A;  4I49 A;  1S7K A;  1Z2L A;  1ZLI A;  4R3L A;  5LYI A;  4CGP A;  2D4O A;  1P0H A;  4MCR A;  5A27 A;  2GU2 A;  1BAV A;  3IEH A;  4MHP A;  2CTB A;  4NFR A;  3PB4 X;  4Q7A A;  3TFY A;  2PJ7 A;  1R57 A;  1FY7 A;  2Q44 A;  1CPX A;  2X7B A;  4ZX9 A;  3S6G A;  4PK2 A;  4II9 A;  3WT4 A;  1BPM A;  1YME A;  3NFZ A;  5EC4 A;  4PSW A;  2V8H A;  5DWM A;  3R96 A;  3T8W A;  2GRE A;  4A33 A;  2DPS A;  2YGW A;  5A28 A;  4P44 A;  5LYD A;  2F5I A;  1IOF A;  1BO4 A;  4KUA A;  3E0K A;  2PDO A;  2ZEN A;  4A39 A;  4P4J A;  1Y0R A;  1XOV A;  1WWZ A;  2C6C A;  1FNO A;  4L8A A;  2J8R A;  3VH9 A;  3GB0 A;  2GIV A;  2ZEO A;  4XPL A;  2FIW A;  3JVN A;  1ELL P;  2WSA A;  4CRY B;  4YU9 A;  1BOB A;  3I9S A;  2O53 A;  4R7M A;  5I4M A;  1F2O A;  2GE3 A;  4PXD A;  2Q7B A;  5CBM A;  1K4J A;  4QVT A;  2CXA A;  3B3C A;  4MY3 A;  4A37 A;  2V8G A;  2BL1 A;  2HC9 A;  3FVL A;  3QAH A;  1X10 A;  4NGN A;  1S3Z A;  1CP6 A;  4Z65 A;  4KVO E;  1ZG8 A;  2P6F A;  5AG5 A;  3MN8 A;  2GFQ A;  3KR5 A;  3ZZI A;  2PQ8 A;  2XEI A;  2ZW7 A;  4MXU A;  4P6Y A;  2B4B A;  2QIR A;  3QAY A;  2ZEE A;  4UFV A;  3B8G A;  4IAV A;  4MMO A;  1VHS A;  3ISX A;  4P4D A;  1BLL E;  4KVM E;  4K30 A;  4R57 A;  2JDD A;  4CGM A;  1ZLH A;  1KUV A;  2ZPA A;  5F46 A;  2ZOG A;  4UA3 A;  2EUI A;  3FEE A;  4C68 A;  3JRU A;  4UWJ A;  4ZI6 A;  2Q51 A;  1QST A;  1N71 A;  4AG7 A;  5K8O A;  2VQY A;  3I3G A;  1XIX A;  1OBR A;  2PE3 A;  3PBB A;  4AG9 A;  4B12 A;  2HUZ A;  4FBE A;  4BBH A;  1IU8 A;  4OC2 A;  2B5G B;  3H4Q A;  4P4F A;  4P4E A;  2XEF A;  2ABZ A;  2DEA A;  2KCW A;  1S5K A;  3R9E A;  1YLE A;  3QB8 A;  4OC5 A;  2F7V A;  3FJU A;  4DJL A;  3PBE A;  2J8N A;  3EFA A;  4WWV A;  5IB0 A;  4FD7 A;  3TO6 A;  2QML A;  5HVF A;  3V7Z A;  3TOB A;  3RAM A;  5HVH A;  4QC6 A;  2Z10 A;  4OC3 A;  1QSM A;  1Y7E A;  3HLP A;  4NEX A;  5ELY A;  5GCN A;  2REE A;  1L0C A;  2V8D A;  4M6G A;  3F8K A;  3IIB A;  5G1Z A;  4MHD A;  3K9U A;  3V8I A;  1LRZ A;  2PJ3 A;  4IK2 A;  3KGQ A;  3FIX A;  2REF A;  3WC7 A;  4R76 A;  4FAI A;  2PVW A;  1M4G A;  3IWW A;  3B2Y A;  3FNC A;  1Z8L A;  2PJ0 A;  4UIB A;  3S9N A;  4KOW A;  6CPA A;  5F09 A;  4CGN A;  3KI9 A;  3IU2 A;  2FCK A;  3H8F A;  4ZY0 A;  5D8N A;  1P4N A;  2QJ8 A;  4B5P B;  5F47 A;  2Q7S A;  2IJZ A;  4MHN A;  4NGQ A;  1LAP A;  4C7I A;  1IY7 A;  5JQ4 A;  5HVG A;  3GLJ A;  3T90 A;  4Y49 C;  2GLJ A;  4AVC A;  2WYR A;  1XEB A;  1KUX A;  1TF9 A;  3CPX A;  3NE7 A;  4PPZ A;  4B5O A;  1YVO A;  1YVK A;  3H8G A;  4MBU A;  5EBV A;  3VAT A;  2AFX A;  3BI0 A;  3NH4 A;  5G21 A;  3TC8 A;  2JEW A;  4GS4 A;  4NJQ A;  3I1U A;  4C2Z A;  2PJ5 A;  4X3R A;  4OC0 A;  2ZXV A;  4UBR A;  1XBU A;  2WUU A;  5FVJ A;  4HKF A;  4AVA A;  3D7F A;  3F5B A;  1AMP A;  3NH8 A;  2QYV A;  1ARM A;  4Q36 A;  4PXC A;  3B3W A;  2R8V A;  2A4N A;  2VEZ A;  3GYA A;  3C26 A;  4E0A A;  2BEI A;  3JTK A;  2P6E A;  3EO4 A;  1IIC A;  4MFQ A;  4UCN A;  3SI0 A;  4AXV A;  4O23 A;  4RUH A;  1DE4 C;  4OAE A;  2BOA A;  4NGM A;  3SXN A;  2EBJ A;  3LAC A;  3PB9 X;  3VWD A;  3DR8 A;  2R98 A;  1CBX A;  2NMT A;  2JEV A;  1CX8 A;  1M1D A;  2F8H A;  4FD4 A;  4H2K A;  1FT7 A;  1TKJ A;  4XPK A;  5I0C A;  2PCU A;  4A32 A;  4U5Y A;  3WC6 A;  2Q4V A;  1MJ9 A;  2VI7 A;  3ISZ A;  1QSN A;  1LFW A;  2OOT A;  2Y0M A;  1HDU A;  4R8F A;  3CT9 A;  2Z3M A;  2C6P A;  4B5P A;  5JGF A;  2O28 A;  1YR0 A;  3IWE A;  4KLV A;  1Z9U A;  4F6A A;  1JWQ A;  5AG4 A;  2HB6 A;  1PCA A;  1UWY A;  3IJ3 A;  3D7G A;  2P6G A;  3OWC A;  4XPD C;  2FT0 A;  4AVB A;  4FD5 A;  4KUB A;  4B14 A;  2PJC A;  2DF5 A;  2IQ6 A;  3LWU A;  3MGD A;  4A31 A;  5JM6 A;  1YW6 A;  2ZW4 A;  1QQ9 A;  3PB7 X;  2PR1 A;  5KTC A;  4KOU A;  8CPA A;  2ANP A;  4U9Y A;  2DPT A;  2ZOF A;  5LRG A; 
#chains in the Genus database with same CATH homology
 2P0W A;  1IID A;  1KUY A;  2G3T A;  5AG7 A;  4XNH B;  4B10 A;  1M4D A;  1UFH A;  4UCP A;  3EC4 A;  1ZO0 A;  4NXY A;  4KOS A;  2Z3K A;  1S7L A;  4CYN A;  2VZZ A;  4PSX A;  2H5M A;  3W91 A;  4MFP A;  2HQY A;  4KLW A;  3FRM A;  5F49 A;  4YFJ A;  1MK4 A;  4BMH A;  4KOY A;  1IYL A;  1XF8 A;  1YGH A;  2R1I A;  2PC1 A;  1M44 A;  4MI4 A;  5H84 A;  2FXF A;  2DXQ A;  2G0B A;  4C2Y A;  4M3S A;  4CGL A;  3DNS A;  5AG6 A;  2YNC A;  2I00 A;  4ONU A;  2HV2 A;  1YRE A;  1S7F A;  1MJB A;  4E2A A;  3TO9 A;  2B5G A;  4CYO A;  1XE4 A;  1Y9W A;  5KTA A;  4CYQ A;  4XPD B;  3GKR A;  2VZY A;  2OU2 A;  3P2H A;  5KTD A;  2OH1 A;  4YGO A;  4QBJ A;  4JLY A;  1QSR A;  2PSW A;  4E8O A;  2FSR A;  1M4I A;  2I79 A;  4LX9 A;  1CM0 A;  1XMT A;  4JXR A;  5G22 A;  4H89 A;  1Q2Y A;  2ZW5 A;  2CNM A;  4KSF A;  2ARH A;  3W6S A;  1V0C A;  5HH1 A;  4X5K A;  2CNT A;  1PU9 A;  2JLM A;  4A2Z A;  3D8P A;  2CNS A;  3PP9 A;  2OZH A;  1Q2D A;  2EVN A;  5CNP A;  1CJW A;  3TE4 A;  1I21 A;  4KSA A;  3TO7 A;  2YNE A;  3DSB A;  2AE6 A;  3KKW A;  4CRZ B;  5HMN A;  2ATR A;  3JUW A;  4B11 A;  2GAN A;  5G20 A;  3R95 A;  1S7N A;  1Z4R A;  2VXK A;  4KVX A;  4UWI A;  5J8F A;  4C2X A;  2AJ6 A;  2CY2 A;  3W6X A;  5C88 A;  4JJX A;  4JWP A;  4Y49 B;  3EXN A;  2WPX A;  2B3U A;  4CAV A;  5DWN A;  1YX0 A;  4MFK A;  2WPW A;  3TT2 A;  1Q2C A;  2Q0Y A;  1QSO A;  2FIA A;  3CXQ A;  4L89 A;  3H5Z A;  3P2F A;  3DDD A;  1SQH A;  4QB9 A;  3D2M A;  5E96 A;  4KOX A;  3EY5 A;  4ZGY B;  4ZBG A;  1MJA A;  4H6U A;  4CAW A;  3FBU A;  1OZP A;  1PUA A;  2Z11 A;  4KS9 A;  4OLL A;  3CXS A;  3IWG A;  4B5O A;  4KOR A;  3R1K A;  1IB1 E;  3A9L A;  4YRH A;  5JPH A;  4KOT A;  5AGE A;  2OZG A;  1B6B A;  2K5T A;  3PGP A;  3BLN A;  4EVY A;  2B4D B;  2Z3O A;  4J3G A;  3WR7 A;  3R9G A;  4CS0 B;  3G8W A;  2Z3N A;  4CYP A;  5IX3 A;  3UY5 A;  1RO5 A;  4F0X A;  4IUS A;  4JXQ A;  4R87 A;  5J8C A;  2B3V A;  3R9F A;  4NSQ A;  5ISV A;  1I1D A;  3TCV A;  1YK3 A;  2Q4Y A;  4PV6 A;  2Z3L A;  2ZW6 A;  3GY9 A;  2Z3P A;  4B13 A;  5BWA B;  3FYN A;  4KOV A;  1TIQ A;  4U9Z A;  3S6K A;  3BJ7 A;  2BSW A;  4NCZ A;  3CXP A;  2FE7 A;  3SXO A;  2PRB A;  2B4D A;  4FD6 A;  4IF5 A;  2OB0 A;  2J8M A;  2FL4 A;  4DNC A;  2YNC C;  4R3K A;  1NSL A;  4A30 A;  4QUS A;  4PK3 A;  3N7Z A;  5C82 A;  3RYO A;  1ON0 A;  1U6M A;  4RS2 A;  2D4P A;  4ORF A;  4KZT A;  4HNX B;  2G3A A;  3S6H A;  5F48 A;  4NF1 A;  2QEC A;  2IL4 A;  5IV0 A;  4MFZ A;  4CAX A;  1RXT A;  1S60 A;  4M85 A;  3VWE A;  4UFX A;  2B58 A;  3D3S A;  1I12 A;  2JDC A;  3TTH A;  2PR8 A;  4A95 A;  3DR6 A;  4UFW A;  3ZJ0 A;  1J4J A;  3FXT A;  4MJ8 A;  1NMT A;  4HNY B;  4LUA A;  4F0Y A;  4UCM A;  2Q04 A;  3D2P A;  1IYK A;  5H86 A;  3BJ8 A;  3TOA A;  2VBQ A;  4MFJ A;  2FS5 A;  4XNH C;  4OAD A;  4MFL A;  4C7H A;  3FB3 A;  2C27 A;  1KZF A;  1GHE A;  2YND A;  3IGR A;  4H6Z A;  3IU1 A;  4AB7 A;  1Z4E A;  1B87 A;  3PZJ A;  4RI1 A;  4HNW B;  1Y7R A;  2OZU A;  3SHP A;  4R9M A;  1NE9 A;  3S6F A;  4CGO A;  4Q38 A;  2BUE A;  1Y9K A;  3F0A A;  4CAE A;  2Z0Z A;  3G3S A;  1VKC A;  1WK4 A;  3T9Y A;  3LOD A;  4MY0 A;  3LD2 A;  4CAF A;  2R7H A;  2RC4 A;  4JD6 A;  4I49 A;  1S7K A;  4R3L A;  4CGP A;  5A27 A;  2D4O A;  1P0H A;  3TFY A;  1R57 A;  1FY7 A;  2Q44 A;  2X7B A;  3S6G A;  4PK2 A;  4II9 A;  5EC4 A;  4PSW A;  5DWM A;  3R96 A;  4A33 A;  2DPS A;  2YGW A;  5A28 A;  2F5I A;  1BO4 A;  4KUA A;  3E0K A;  2PDO A;  1WWZ A;  4L8A A;  2J8R A;  2GIV A;  4XPL A;  2FIW A;  3JVN A;  2WSA A;  4CRY B;  1BOB A;  3I9S A;  2GE3 A;  2Q7B A;  1K4J A;  4QVT A;  2CXA A;  4MY3 A;  2BL1 A;  3QAH A;  1S3Z A;  4KVO E;  2P6F A;  5AG5 A;  3ZZI A;  2PQ8 A;  2ZW7 A;  2B4B A;  2QIR A;  4UFV A;  3B8G A;  1VHS A;  4KVM E;  4K30 A;  4R57 A;  2JDD A;  4CGM A;  1KUV A;  2ZPA A;  5F46 A;  4UA3 A;  2EUI A;  4C68 A;  4UWJ A;  1QST A;  1N71 A;  4AG7 A;  2VQY A;  3I3G A;  1XIX A;  4AG9 A;  4B12 A;  2HUZ A;  4BBH A;  2B5G B;  3H4Q A;  2KCW A;  3R9E A;  1S5K A;  1YLE A;  3QB8 A;  2J8N A;  3EFA A;  5IB0 A;  4FD7 A;  3TO6 A;  2QML A;  3TOB A;  4QC6 A;  2Z10 A;  1QSM A;  4NEX A;  5GCN A;  2REE A;  1L0C A;  3F8K A;  5G1Z A;  4MHD A;  3K9U A;  3V8I A;  1LRZ A;  3FIX A;  2REF A;  1M4G A;  3FNC A;  4KOW A;  4CGN A;  3IU2 A;  2FCK A;  1P4N A;  4B5P B;  5F47 A;  4C7I A;  5JQ4 A;  3T90 A;  4Y49 C;  4AVC A;  1XEB A;  1KUX A;  3NE7 A;  1YVO A;  1YVK A;  4MBU A;  5EBV A;  5G21 A;  4GS4 A;  4C2Z A;  4UBR A;  2ZXV A;  2WUU A;  5FVJ A;  4HKF A;  4AVA A;  3F5B A;  4Q36 A;  2R8V A;  2A4N A;  2VEZ A;  3GYA A;  3C26 A;  4E0A A;  2BEI A;  3JTK A;  2P6E A;  3EO4 A;  1IIC A;  4MFQ A;  4UCN A;  4OAE A;  3SXN A;  3VWD A;  3DR8 A;  2R98 A;  2NMT A;  2JEV A;  1M1D A;  4FD4 A;  4XPK A;  5I0C A;  4A32 A;  4U5Y A;  2Q4V A;  1MJ9 A;  2VI7 A;  1QSN A;  2Y0M A;  2Z3M A;  4B5P A;  2O28 A;  1YR0 A;  3IWE A;  4KLV A;  1Z9U A;  4F6A A;  5AG4 A;  3OWC A;  2P6G A;  4XPD C;  2FT0 A;  4AVB A;  4FD5 A;  4KUB A;  4B14 A;  3MGD A;  4A31 A;  2ZW4 A;  2PR1 A;  5KTC A;  4KOU A;  4U9Y A;  2DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...