4B13A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 25)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Antimalarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b13A00
4A2ZA 4CYOA 4CGOA 4B12A 4B14A 5AG4A 4C2XA 4CAFA 2WSAA 5G21A 4C68A 4A32A 4A95A 3IU1A 4C7IA 4CYNA 4A31A 4B11A 4BBHA 4UFXA 5G20A 4UFVA 5AG6A 2YNEA 4UCPA 2WUUA 4B10A 4B13A 4CGPA 4CGLA 4CAEA 2YNCA 4A30A 3JTKA 5G1ZA 3H5ZA 3IWEA 5A27A 5AGEA 4UCNA 4CYPA 3IU2A 4UFWA 4C2YA 4CYQA 5AG7A 4CGNA 4A33A 5AG5A 5G22A 5A28A 4CGMA 4C2ZA 4UCMA 2YNCC 4C7HA 2YNDA
chains in the Genus database with same CATH superfamily
3IGRA 2J9AA 4IHMA 4B12A 2AFUA 4PSWA 2EK8A 3VH9A 3B35A 1WK4A 2ZW7A 3VWEA 2C1CA 1R3NA 3TO7A 4JJXA 2I3CA 1NSAA 2AE6A 4KOSA 1SQHA 2OZGA 2Q51A 4HNYB 4OIDA 4PSXA 3KKWA 2BL1A 1LFWA 1S60A 2D4OA 4EWTA 4R76A 3D7FA 2Z3NA 5G1ZA 1CG2A 3VATA 2B3UA 4NSQA 3GYAA 1X12A 2Z3MA 4EFDA 3GIUA 4CYPA 2REFA 1UFHA 3GLJA 2POKA 2PJAA 3HUVA 3TTHA 1Y9WA 3W91A 1PYTB 4NCZA 3T90A 3MRUA 3FF3A 4X5KA 1IGBA 3T9YA 4A2ZA 2CNMA 2XEGA 1YMEA 2EO8A 3RAMA 4BMHA 4K3NA 1S7LA 3V7ZA 1YSJA 3D7GA 4W9YA 4NF1A 3FIXA 5IX3A 4AVCA 1QSOA 2JEVA 4KOUA 4XPLA 1S7FA 2RC4A 4A31A 2BSWA 2PJ5A 5IB0A 1QQ9A 2XEIA 1AUGA 2HC9A 2QYVA 4ZX9A 1AYEA 2PJBA 3W6SA 4JXQA 2AFWA 3TE4A 3JTKA 1CPXA 2FXFA 4XPDB 3IWEA 1ZG9A 3WC6A 3N7ZA 3WABA 2PR1A 2Z0ZA 4A37A 4B5OA 2Z3LA 2EK9A 4XPDC 3ISZA 2OZHA 1Z8XA 4F9VA 1CJWA 1CX8A 3SI0A 1ZG8A 3NA6A 4CAEA 4QB9A 2AFXA 2BOAA 2B4DB 4EMEA 2AFMA 1N71A 2IMOA 2G0BA 2OH1A 2IJZA 1M4IA 2PIZA 4ZY0A 1CM0A 4JD6A 4Q38A 4FBEA 4II9A 2GLFA 2PDOA 3NE8A 4OP4A 3GB0A 2Z3KA 4TNUA 5J8CA 2V8VA 4AG9A 2DPSA 3G8WA 3NH4A 2AFZA 4MMOA 5I0CA 4KVXA 2YNEA 3FECA 1M44A 2CNTA 2CTBA 3D7DA 1Q2CA 4MJ8A 3KR5A 1QSTA 4B6ZA 4L89A 3I3GA 4MCSA 2PIYA 1Y7RA 4KORA 4KSIA 2PJ0A 4KLVA 4MFLA 1YREA 4MFKA 1BO4A 4MBUA 2VZYA 2FIAA 2V8GA 4PV6A 3DR8A 2ZOGA 1GHEA 1YK3A 2YNCC 4KOTA 4KUAA 3F0AA 4XNHC 1V0CA 4CAWA 4MCPA 3KL9A 5AG4A 4IK2A 2ZXVA 4OIWA 2Q44A 1J4JA 4MHPA 4A94A 4C68A 3D2MA 4Q36A 4FAIA 2Y0MA 2CY2A 4NJQA 2Z11A 5DWNA 2QMLA 3BI0A 5THWA 3FBUA 1B6BA 3IJ3A 1F2PA 1XF8A 4JLYA 2R8VA 3B2YA 4OKOA 4CGLA 3TFYA 2FT0A 1YW4A 5J1QA 2G3AA 3CZXA 4U5YA 4OADA 4R9MA 2EVNA 3BJ8A 2XEJA 4MXUA 3EXNA 1TKHA 4NGNA 4PQAA 2PE3A 3DDDA 4ZYQA 2GANA 3CDXA 3R9EA 5K8NA 3NE7A 2PVWA 4MFQA 4ZY1A 4XPKA 4U9YA 4CYOA 1M4DA 4F8ZA 1VGYA 2GLJA 5JGFA 3FYNA 3PP9A 2O4HA 2O28A 2VQYA 3TCVA 2QECA 2WSAA 4KLWA 3HLPA 2VL1A 2RFHA 2B5GA 1PU9A 4ORFA 1YX0A 3D66A 2FSRA 2PVVA 2C6CA 4FD7A 4HKFA 2A4NA 1XRYA 2VXKA 4ZBGA 1I21A 2C27A 1ELLP 1S3ZA 2ANPA 3R9FA 2CTCA 1LCPA 2CF4A 3GKRA 3KGQA 4MFJA 2P6EA 3LACA 3KZWA 4NEXA 2AJ6A 3FH4A 4PXEA 1Z2LA 2VEZA 3JUWA 2JBJA 4K30A 4PXDA 4F9UA 2QVPA 4CPAA 2HV2A 1ON0A 5LYIA 4F0YA 2IL4A 4AVAA 4YGOA 4KVOE 1ZLIA 8CPAA 5H84A 3R1KA 5HMNA 3I1UA 3BLNA 3V38A 3PFEA 4HNWB 3WT4A 4CS0B 2ZEHA 2PJ2A 2DXQA 2PRQA 1HDQA 3IWWA 3K9TA 2C6GA 2FE7A 2HUZA 2PQ8A 1ZO0A 3E0KA 4IF5A 4GXHA 4RS2A 3UY5A 4ZX8A 3PZJA 1F2OA 4RN7A 1M1DA 3KQZA 4M85A 3CPXA 1YLEA 3D3SA 2ZEGA 2QIRA 1MJAA 2AFOA 2BCOA 1HDUA 2ARHA 4OC2A 2Q7SA 2REEA 4MHZA 4UFWA 1KUVA 4CYQA 1XMBA 2GREA 3QNVA 5HH1A 2NMTA 3S6HA 3I9SA 5LRKA 2PJ4A 2RB7A 4C2XA 3DGVA 5G21A 3D67A 4A32A 2ZEFA 4NGRA 2CNSA 5LRJA 2HB6A 2PJ8A 3K9UA 3DR6A 4X8IA 4C7IA 3MN8A 4FUUA 3PB4X 5C88A 2Q4VA 4UFXA 3G3SA 3H4QA 1YGHA 4LQ6A 1NMTA 4CGPA 1UWYA 5F49A 4KZTA 1FNOA 2YNCA 3CT9A 4MI4A 4P4FA 4U9ZA 4A30A 2ZW5A 4NGSA 3L2NA 4E0AA 5A27A 1BAVA 1M4GA 4AXVA 1XE4A 1MJ9A 4YRHA 2V8HA 4MRIA 1VKCA 4HPSA 3B3TA 3F5BA 4IAVA 5HXDA 5AG7A 1CBXA 2ZEPA 1YR0A 4R3KA 2ZOFA 1QSMA 3IFEA 1XEBA 2YNDA 4JXRA 4OAEA 1NE9A 2JEWA 2ZPAA 4UCMA 4C7HA 3SXNA 2B58A 2VI7A 4MCRA 1L0CA 7CPAA 1R57A 3FX6A 3FNCA 3B8GA 2KCWA 3B3SA 4CYNA 3CXPA 3EY5A 4P4EA 2PJ9A 5E96A 3H8EA 3TO6A 4DUKA 4ONUA 1BLLE 2V8DA 3B3VA 3H5ZA 3TO9A 3C26A 4YFJA 1DTDA 3FVLA 3D8PA 3EO4A 5BWAB 1IYLA 2BEIA 4KSFA 1VHSA 2ZEDA 3D7HA 3KR4A 5K8OA 4UEFA 4A33A 1ZG7A 3P2FA 2R7HA 1Y0YA 4M6IA 5GCNA 4UWJA 3PB6X 4UWIA 2PJCA 1I12A 4KOWA 3WC5A 5KTCA 5LRGA 5ELYA 1H8LA 2GIVA 4KOYA 1IB1E 1CP6A 2K5TA 2ZEOA 2Q04A 4P10A 2V77A 4BBHA 5LYFA 3MGDA 4CRZB 4FD4A 4DNCA 1CPSA 4LX9A 4A38A 4UCPA 1OZPA 4R3LA 2ZW4A 2J8MA 3P2HA 1Z9UA 3BHXA 4P45A 1M4LA 3CXSA 3RZAA 4B5PA 3IIBA 3NFZA 1YLOA 5C82A 3EFAA 1BPNA 1X10A 4H89A 4KVME 5D29A 4MFZA 1FY7A 2ABZA 4L8AA 3SJFA 1P4NA 5J8FA 4Y49B 2EBJA 1CP7A 4J3GA 3ZZIA 2WPWA 3FRMA 4KOVA 4AVBA 1IICA 5F47A 2Z3PA 4LQGA 4BINA 3N5FA 4Y49C 3QB8A 3R9GA 3EC4A 3H8GA 3GY9A 4H2KA 4P4BA 3PFOA 4KUBA 1ARMA 3WR7A 4CAFA 4A95A 5JQ4A 4GS4A 2R98A 4B11A 5JH9A 3SI2A 5JM6A 5HVFA 2PR8A 4PK2A 3S9LA 1Z8TA 5AG6A 4Z65A 1QMUA 4WJBA 1XMTA 5HVHA 3FXTA 1Y9KA 2H5MA 3T8WA 3TC8A 3S6KA 5DS0A 3TX8A 5AGEA 2D4PA 1Z4EA 3DLJA 2OZUA 4KOXA 4NFRA 2F8HA 4M6HA 3IEHA 4NJRA 4OC5A 1LRZA 5K8MA 5A28A 2Q4YA 1GYTA 1P0HA 2PSWA 4MHNA 5H86A 4CGOA 2C6PA 4HNXB 4G1PA 5CNPA 3DNSA 5KTAA 4OC4A 4P4JA 3RBUA 2PRBA 2Q4ZA 3DSBA 2WYRA 3FMCA 3TOAA 4A39A 5DWMA 2R1IA 2BO9A 1KWMA 3LWUA 2Z10A 2WPXA 1XJOA 4E8OA 2NYQA 4PPZA 3LMSA 5LYLA 3PBEA 2AFSA 3D68A 5K8PA 5EBVA 1IOFA 2ZW6A 2GU2A 2B4DA 4F0XA 2ATRA 2Q7BA 5I4MA 4JWPA 5AG5A 3ZJ0A 4DYOA 4NGQA 1IY7A 2BUEA 3SJXA 4ZGYB 3RO0A 1TXRA 1MK4A 4M6GA 5CPAA 4OC1A 4PXCA 4MHDA 4FD6A 4R8FA 3KASA 1Y0RA 3BJ7A 4UF4A 3RYOA 4JYWA 1TIQA 1WWZA 5G20A 4B10A 2WUUA 5D8NA 4MHYA 4QVTA 2B5GB 5JPHA 1KUXA 2I79A 3PBBA 1TKFA 2PJ1A 4UEEA 2JLMA 3D2PA 3D4UA 3PB8X 4OC0A 3R95A 5CBMA 4GM5A 4R7MA 4CAXA 2OU2A 2Z3OA 3FEDA 4P44A 1QSRA 1IYKA 1BOBA 2J8RA 2ZELA 2PJ3A 2NSMA 2ZENA 4OLLA 3VWDA 1PUAA 4MFPA 5F46A 1QSNA 2QJ8A 4ONWA 2ODFA 3F8KA 1S7NA 4QUSA 2FIWA 2P0WA 4OMEA 1Q2DA 4CAVA 5F09A 2B4BA 2VZZA 3FEEA 3IU1A 1VHEA 4FWUA 4H6UA 4AB7A 1I1DA 1VIXA 4NXYA 2FVGA 2F5IA 5EC4A 1BPMA 2YGWA 2OB0A 3B3WA 3R96A 3SI1A 2FS5A 1A2ZA 4Q7AA 3JRUA 3BI1A 3LODA 4RUHA 3A9LA 2F7VA 2J8NA 2PJ7A 2X7BA 4UCNA 4KS9A 1YW6A 1Z8LA 3PB7X 4UIBA 4C2YA 3NH8A 1LAMA 5FVJA 1EE3P 2O53A 4CGMA 4P4IA 3IC1A 5EMIA 4UA3A 2ZEMA 4C2ZA 3NH5A 3V8IA 1K4JA 5IV0A 2EUIA 1XBUA 5F48A 4QC6A 1Z4RA 4MCQA 3BXMA 4R57A 1KUYA 3K2KA 3PRTA 3RNZA 3SJEA 3CXQA 1Z8WA 4YWYA 3GUXA 2I00A 1DE4C 4ZI6A 3KQXA 4EVYA 2PC1A 4PK3A 3S9NA 3QAYA 4UFVA 2DEAA 4B13A 1IIDA 5HVGA 4AG7A 3OWCA 1Q7LA 1PCAA 1Y7EA 2DPTA 1B87A 4M3SA 4O23A 3KI9A 1IOIA 2ZEEA 2GFQA 3IO1A 3IU2A 4JZ0A 4KSAA 4XNHB 2EWBA 2Q0YA 2DF5A 1LAPA 4F6AA 2OR4A 1XIXA 1YVOA 1U6MA 2Q43A 4OC3A 1RO5A 1Q2YA 4LUAA 4NGTA 2JDDA 2P6GA 4NGPA 1RTQA 1Z5RA 3SXOA 1XFOA 4X2TA 2FCKA 1ELMP 4WWVA 2PJ6A 2P6FA 3ISXA 4NGMA 4R6TA 3S9MA 4E2AA 1YQEA 2IQ6A 3TT2A 3KHXA 3WC7A 4MY0A 4YU9A 5IB9A 3S6GA 1RXTA 1KZFA 4UEZA 3SJGA 3VARA 2PCUA 2G9DA 4IUSA 1HEEA 1LOKA 4FD5A 4BD9A 1AMPA 6CPAA 2VBQA 4UBRA 3S6FA 5LYDA 2HQYA 3JVNA 4R87A 1IU8A 1LANA 2FL4A 5G22A 3TOBA 3IWGA 3LD2A 4PXBA 4P4DA 1ARLA 4I49A 3SHPA 2G3TA 4ZY2A 1JQGA 2WZNA 2CXAA 4B14A 4DJLA 3FJUA 1TF9A 1F57A 1TKJA 2JBKA 4X3RA 5KTDA 3PB9X 5ISVA 3B7IA 2GE3A 3W6XA 3H8FA 1MJBA 1S5KA 2CIJA 2XEFA 1TF8A 4TWEA 1XOVA 1FT7A 1YVKA 1NSLA 3FB3A 4MY3A 1R43A 1JWQA 3KHZA 4RI1A 1VHOA 4UIAA 2OOTA 1ZLHA 1OBRA 3QAHA 4H6ZA 1S7KA 3B3CA 3PGPA 2JDCA 4CGNA 4B5PB 4CRYB 4QBJA 2B3VA 3PEIA 3CPAA 4P6YA
chains in the Genus database with same CATH topology
3IGRA 4B12A 4PSWA 1WK4A 2ZW7A 3VWEA 3TO7A 4JJXA 2AE6A 4KOSA 1SQHA 2OZGA 4HNYB 4PSXA 3KKWA 2BL1A 2D4OA 1S60A 5G1ZA 2Z3NA 2B3UA 4NSQA 3GYAA 2Z3MA 4CYPA 2REFA 1UFHA 3TTHA 1Y9WA 3W91A 4NCZA 3T90A 4X5KA 3T9YA 4A2ZA 2CNMA 4BMHA 1S7LA 4NF1A 3FIXA 5IX3A 4AVCA 1QSOA 2JEVA 4KOUA 4XPLA 1S7FA 2RC4A 4A31A 2BSWA 5IB0A 3W6SA 4JXQA 3TE4A 3JTKA 2FXFA 4XPDB 3IWEA 3N7ZA 2PR1A 2Z0ZA 4B5OA 2Z3LA 4XPDC 2OZHA 1CJWA 4CAEA 4QB9A 2B4DB 1N71A 2G0BA 2OH1A 4II9A 1M4IA 1CM0A 4JD6A 4Q38A 2PDOA 2Z3KA 5J8CA 4AG9A 2DPSA 3G8WA 5I0CA 4KVXA 2YNEA 1M44A 2CNTA 4MJ8A 1Q2CA 1QSTA 4L89A 3I3GA 1Y7RA 4KORA 4MFLA 4KLVA 1YREA 4MFKA 1BO4A 4MBUA 2VZYA 2FIAA 4PV6A 3DR8A 1GHEA 1YK3A 2YNCC 4KOTA 4KUAA 3F0AA 4XNHC 1V0CA 4CAWA 5AG4A 2ZXVA 2Q44A 1J4JA 4C68A 3D2MA 4Q36A 2Y0MA 2CY2A 5DWNA 2Z11A 2QMLA 3FBUA 1B6BA 4JLYA 1XF8A 3TFYA 4CGLA 2R8VA 2FT0A 2G3AA 4U5YA 4OADA 4R9MA 2EVNA 3BJ8A 3EXNA 3DDDA 2GANA 3R9EA 3NE7A 4MFQA 4XPKA 4U9YA 4CYOA 1M4DA 3FYNA 3PP9A 2O28A 2VQYA 3TCVA 2QECA 2WSAA 4KLWA 2B5GA 1PU9A 4ORFA 1YX0A 2FSRA 4FD7A 4HKFA 2A4NA 2VXKA 4ZBGA 1I21A 2C27A 1S3ZA 3R9FA 3GKRA 4MFJA 2P6EA 4NEXA 2AJ6A 2VEZA 3JUWA 4K30A 4F0YA 2HV2A 1ON0A 2IL4A 4AVAA 4YGOA 4KVOE 5HMNA 5H84A 3R1KA 3BLNA 4HNWB 4CS0B 2DXQA 2FE7A 2PQ8A 2HUZA 3E0KA 1ZO0A 4RS2A 4IF5A 3UY5A 3PZJA 1M1DA 4M85A 1YLEA 3D3SA 2QIRA 1MJAA 2ARHA 2REEA 4UFWA 1KUVA 4CYQA 5HH1A 2NMTA 3S6HA 3I9SA 4C2XA 5G21A 4A32A 2CNSA 3K9UA 3DR6A 4C7IA 5C88A 2Q4VA 4UFXA 3G3SA 3H4QA 1YGHA 1NMTA 4CGPA 5F49A 4KZTA 2YNCA 4MI4A 4A30A 4U9ZA 2ZW5A 4E0AA 5A27A 1M4GA 1XE4A 1MJ9A 4YRHA 1VKCA 3F5BA 5AG7A 1YR0A 4R3KA 5GCNA 1QSMA 4JXRA 1XEBA 2YNDA 4OAEA 4UCMA 1NE9A 4C7HA 2ZPAA 3SXNA 2B58A 2VI7A 1L0CA 1R57A 3FNCA 3B8GA 2KCWA 4CYNA 3CXPA 3EY5A 5E96A 3TO6A 4ONUA 3H5ZA 3TO9A 3C26A 4YFJA 3D8PA 3EO4A 5BWAB 1IYLA 2BEIA 4KSFA 1VHSA 4A33A 3P2FA 2R7HA 4UWJA 5KTCA 4UWIA 4KOWA 1I12A 2GIVA 4KOYA 1IB1E 2K5TA 2Q04A 4BBHA 3MGDA 4CRZB 4FD4A 4DNCA 4LX9A 4UCPA 1OZPA 4R3LA 2ZW4A 2J8MA 3P2HA 1Z9UA 3CXSA 4B5PA 5C82A 3EFAA 4H89A 4KVME 4MFZA 1FY7A 4L8AA 1P4NA 5J8FA 4Y49B 3ZZIA 4J3GA 2WPWA 3FRMA 4KOVA 4AVBA 1IICA 5F47A 2Z3PA 4Y49C 3QB8A 3R9GA 3EC4A 3GY9A 4KUBA 4CAFA 3WR7A 4A95A 5JQ4A 4GS4A 2R98A 4B11A 2PR8A 4PK2A 5AG6A 1XMTA 3FXTA 1Y9KA 2H5MA 3S6KA 5AGEA 2D4PA 1Z4EA 4KOXA 2OZUA 1LRZA 5A28A 2Q4YA 1P0HA 2PSWA 5H86A 4CGOA 4HNXB 5CNPA 3DNSA 5KTAA 2PRBA 3DSBA 3TOAA 5DWMA 2R1IA 2Z10A 2WPXA 4E8OA 5EBVA 2ZW6A 2B4DA 4F0XA 2ATRA 2Q7BA 4JWPA 5AG5A 3ZJ0A 4ZGYB 2BUEA 1MK4A 4MHDA 4FD6A 3BJ7A 3RYOA 1TIQA 1WWZA 5G20A 4B10A 2WUUA 4QVTA 2B5GB 5JPHA 1KUXA 2I79A 2JLMA 3D2PA 3R95A 4CAXA 2OU2A 2Z3OA 1QSRA 1IYKA 1BOBA 2J8RA 4OLLA 3VWDA 1PUAA 4MFPA 5F46A 1QSNA 3F8KA 1S7NA 4QUSA 2FIWA 2P0WA 4CAVA 1Q2DA 2B4BA 2VZZA 3IU1A 4H6UA 4AB7A 1I1DA 4NXYA 2F5IA 5EC4A 2YGWA 3R96A 2OB0A 2FS5A 3LODA 3A9LA 2J8NA 2X7BA 4UCNA 4KS9A 4C2YA 5FVJA 4CGMA 4UA3A 4C2ZA 3V8IA 1K4JA 5IV0A 2EUIA 5F48A 4QC6A 1Z4RA 4R57A 1KUYA 3CXQA 2I00A 4EVYA 2PC1A 4PK3A 4UFVA 4B13A 1IIDA 4AG7A 3OWCA 2DPTA 1B87A 4M3SA 4XNHB 3IU2A 4KSAA 2Q0YA 4F6AA 1XIXA 1YVOA 1U6MA 1RO5A 1Q2YA 4LUAA 3SXOA 2JDDA 2P6GA 2FCKA 2P6FA 4E2AA 3TT2A 4MY0A 3S6GA 1RXTA 1KZFA 4IUSA 4FD5A 2VBQA 4UBRA 3S6FA 2HQYA 3JVNA 4R87A 2FL4A 5G22A 3TOBA 3IWGA 3LD2A 4I49A 3SHPA 2G3TA 2CXAA 4B14A 5KTDA 5ISVA 2GE3A 3W6XA 1MJBA 1S5KA 1YVKA 1NSLA 3FB3A 4MY3A 4RI1A 4H6ZA 3QAHA 1S7KA 3PGPA 2JDCA 4CGNA 4B5PB 4CRYB 4QBJA 2B3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2Z A;  4CYO A;  4CGO A;  4B12 A;  4B14 A;  5AG4 A;  4C2X A;  4CAF A;  2WSA A;  5G21 A;  4C68 A;  4A32 A;  4A95 A;  3IU1 A;  4C7I A;  4CYN A;  4A31 A;  4B11 A;  4BBH A;  4UFX A;  5G20 A;  4UFV A;  5AG6 A;  2YNE A;  4UCP A;  2WUU A;  4B10 A;  4B13 A;  4CGP A;  4CGL A;  4CAE A;  2YNC A;  4A30 A;  3JTK A;  5G1Z A;  3H5Z A;  3IWE A;  5A27 A;  5AGE A;  4UCN A;  4CYP A;  3IU2 A;  4UFW A;  4C2Y A;  4CYQ A;  5AG7 A;  4CGN A;  4A33 A;  5AG5 A;  5G22 A;  5A28 A;  4CGM A;  4C2Z A;  4UCM A;  2YNC C;  4C7H A;  2YND A; 
#chains in the Genus database with same CATH topology
 3IGR A;  2J9A A;  4IHM A;  4B12 A;  2AFU A;  4PSW A;  2EK8 A;  3VH9 A;  3B35 A;  1WK4 A;  2ZW7 A;  3VWE A;  2C1C A;  1R3N A;  3TO7 A;  4JJX A;  2I3C A;  1NSA A;  2AE6 A;  4KOS A;  1SQH A;  2OZG A;  2Q51 A;  4HNY B;  4OID A;  4PSX A;  3KKW A;  2BL1 A;  1LFW A;  1S60 A;  2D4O A;  4EWT A;  4R76 A;  3D7F A;  2Z3N A;  5G1Z A;  1CG2 A;  3VAT A;  2B3U A;  4NSQ A;  3GYA A;  1X12 A;  2Z3M A;  4EFD A;  3GIU A;  4CYP A;  2REF A;  1UFH A;  3GLJ A;  2POK A;  2PJA A;  3HUV A;  3TTH A;  1Y9W A;  3W91 A;  1PYT B;  4NCZ A;  3T90 A;  3MRU A;  3FF3 A;  4X5K A;  1IGB A;  3T9Y A;  4A2Z A;  2CNM A;  2XEG A;  1YME A;  2EO8 A;  3RAM A;  4BMH A;  4K3N A;  1S7L A;  3V7Z A;  1YSJ A;  3D7G A;  4W9Y A;  4NF1 A;  3FIX A;  5IX3 A;  4AVC A;  1QSO A;  2JEV A;  4KOU A;  4XPL A;  1S7F A;  2RC4 A;  4A31 A;  2BSW A;  2PJ5 A;  5IB0 A;  1QQ9 A;  2XEI A;  1AUG A;  2HC9 A;  2QYV A;  4ZX9 A;  1AYE A;  2PJB A;  3W6S A;  4JXQ A;  2AFW A;  3TE4 A;  3JTK A;  1CPX A;  2FXF A;  4XPD B;  3IWE A;  1ZG9 A;  3WC6 A;  3N7Z A;  3WAB A;  2PR1 A;  2Z0Z A;  4A37 A;  4B5O A;  2Z3L A;  2EK9 A;  4XPD C;  3ISZ A;  2OZH A;  1Z8X A;  4F9V A;  1CJW A;  1CX8 A;  3SI0 A;  1ZG8 A;  3NA6 A;  4CAE A;  4QB9 A;  2AFX A;  2BOA A;  2B4D B;  4EME A;  2AFM A;  1N71 A;  2IMO A;  2G0B A;  2OH1 A;  2IJZ A;  1M4I A;  2PIZ A;  4ZY0 A;  1CM0 A;  4JD6 A;  4Q38 A;  4FBE A;  4II9 A;  2GLF A;  2PDO A;  3NE8 A;  4OP4 A;  3GB0 A;  2Z3K A;  4TNU A;  5J8C A;  2V8V A;  4AG9 A;  2DPS A;  3G8W A;  3NH4 A;  2AFZ A;  4MMO A;  5I0C A;  4KVX A;  2YNE A;  3FEC A;  1M44 A;  2CNT A;  2CTB A;  3D7D A;  1Q2C A;  4MJ8 A;  3KR5 A;  1QST A;  4B6Z A;  4L89 A;  3I3G A;  4MCS A;  2PIY A;  1Y7R A;  4KOR A;  4KSI A;  2PJ0 A;  4KLV A;  4MFL A;  1YRE A;  4MFK A;  1BO4 A;  4MBU A;  2VZY A;  2FIA A;  2V8G A;  4PV6 A;  3DR8 A;  2ZOG A;  1GHE A;  1YK3 A;  2YNC C;  4KOT A;  4KUA A;  3F0A A;  4XNH C;  1V0C A;  4CAW A;  4MCP A;  3KL9 A;  5AG4 A;  4IK2 A;  2ZXV A;  4OIW A;  2Q44 A;  1J4J A;  4MHP A;  4A94 A;  4C68 A;  3D2M A;  4Q36 A;  4FAI A;  2Y0M A;  2CY2 A;  4NJQ A;  2Z11 A;  5DWN A;  2QML A;  3BI0 A;  5THW A;  3FBU A;  1B6B A;  3IJ3 A;  1F2P A;  1XF8 A;  4JLY A;  2R8V A;  3B2Y A;  4OKO A;  4CGL A;  3TFY A;  2FT0 A;  1YW4 A;  5J1Q A;  2G3A A;  3CZX A;  4U5Y A;  4OAD A;  4R9M A;  2EVN A;  3BJ8 A;  2XEJ A;  4MXU A;  3EXN A;  1TKH A;  4NGN A;  4PQA A;  2PE3 A;  3DDD A;  4ZYQ A;  2GAN A;  3CDX A;  3R9E A;  5K8N A;  3NE7 A;  2PVW A;  4MFQ A;  4ZY1 A;  4XPK A;  4U9Y A;  4CYO A;  1M4D A;  4F8Z A;  1VGY A;  2GLJ A;  5JGF A;  3FYN A;  3PP9 A;  2O4H A;  2O28 A;  2VQY A;  3TCV A;  2QEC A;  2WSA A;  4KLW A;  3HLP A;  2VL1 A;  2RFH A;  2B5G A;  1PU9 A;  4ORF A;  1YX0 A;  3D66 A;  2FSR A;  2PVV A;  2C6C A;  4FD7 A;  4HKF A;  2A4N A;  1XRY A;  2VXK A;  4ZBG A;  1I21 A;  2C27 A;  1ELL P;  1S3Z A;  2ANP A;  3R9F A;  2CTC A;  1LCP A;  2CF4 A;  3GKR A;  3KGQ A;  4MFJ A;  2P6E A;  3LAC A;  3KZW A;  4NEX A;  2AJ6 A;  3FH4 A;  4PXE A;  1Z2L A;  2VEZ A;  3JUW A;  2JBJ A;  4K30 A;  4PXD A;  4F9U A;  2QVP A;  4CPA A;  2HV2 A;  1ON0 A;  5LYI A;  4F0Y A;  2IL4 A;  4AVA A;  4YGO A;  4KVO E;  1ZLI A;  8CPA A;  5H84 A;  3R1K A;  5HMN A;  3I1U A;  3BLN A;  3V38 A;  3PFE A;  4HNW B;  3WT4 A;  4CS0 B;  2ZEH A;  2PJ2 A;  2DXQ A;  2PRQ A;  1HDQ A;  3IWW A;  3K9T A;  2C6G A;  2FE7 A;  2HUZ A;  2PQ8 A;  1ZO0 A;  3E0K A;  4IF5 A;  4GXH A;  4RS2 A;  3UY5 A;  4ZX8 A;  3PZJ A;  1F2O A;  4RN7 A;  1M1D A;  3KQZ A;  4M85 A;  3CPX A;  1YLE A;  3D3S A;  2ZEG A;  2QIR A;  1MJA A;  2AFO A;  2BCO A;  1HDU A;  2ARH A;  4OC2 A;  2Q7S A;  2REE A;  4MHZ A;  4UFW A;  1KUV A;  4CYQ A;  1XMB A;  2GRE A;  3QNV A;  5HH1 A;  2NMT A;  3S6H A;  3I9S A;  5LRK A;  2PJ4 A;  2RB7 A;  4C2X A;  3DGV A;  5G21 A;  3D67 A;  4A32 A;  2ZEF A;  4NGR A;  2CNS A;  5LRJ A;  2HB6 A;  2PJ8 A;  3K9U A;  3DR6 A;  4X8I A;  4C7I A;  3MN8 A;  4FUU A;  3PB4 X;  5C88 A;  2Q4V A;  4UFX A;  3G3S A;  3H4Q A;  1YGH A;  4LQ6 A;  1NMT A;  4CGP A;  1UWY A;  5F49 A;  4KZT A;  1FNO A;  2YNC A;  3CT9 A;  4MI4 A;  4P4F A;  4U9Z A;  4A30 A;  2ZW5 A;  4NGS A;  3L2N A;  4E0A A;  5A27 A;  1BAV A;  1M4G A;  4AXV A;  1XE4 A;  1MJ9 A;  4YRH A;  2V8H A;  4MRI A;  1VKC A;  4HPS A;  3B3T A;  3F5B A;  4IAV A;  5HXD A;  5AG7 A;  1CBX A;  2ZEP A;  1YR0 A;  4R3K A;  2ZOF A;  1QSM A;  3IFE A;  1XEB A;  2YND A;  4JXR A;  4OAE A;  1NE9 A;  2JEW A;  2ZPA A;  4UCM A;  4C7H A;  3SXN A;  2B58 A;  2VI7 A;  4MCR A;  1L0C A;  7CPA A;  1R57 A;  3FX6 A;  3FNC A;  3B8G A;  2KCW A;  3B3S A;  4CYN A;  3CXP A;  3EY5 A;  4P4E A;  2PJ9 A;  5E96 A;  3H8E A;  3TO6 A;  4DUK A;  4ONU A;  1BLL E;  2V8D A;  3B3V A;  3H5Z A;  3TO9 A;  3C26 A;  4YFJ A;  1DTD A;  3FVL A;  3D8P A;  3EO4 A;  5BWA B;  1IYL A;  2BEI A;  4KSF A;  1VHS A;  2ZED A;  3D7H A;  3KR4 A;  5K8O A;  4UEF A;  4A33 A;  1ZG7 A;  3P2F A;  2R7H A;  1Y0Y A;  4M6I A;  5GCN A;  4UWJ A;  3PB6 X;  4UWI A;  2PJC A;  1I12 A;  4KOW A;  3WC5 A;  5KTC A;  5LRG A;  5ELY A;  1H8L A;  2GIV A;  4KOY A;  1IB1 E;  1CP6 A;  2K5T A;  2ZEO A;  2Q04 A;  4P10 A;  2V77 A;  4BBH A;  5LYF A;  3MGD A;  4CRZ B;  4FD4 A;  4DNC A;  1CPS A;  4LX9 A;  4A38 A;  4UCP A;  1OZP A;  4R3L A;  2ZW4 A;  2J8M A;  3P2H A;  1Z9U A;  3BHX A;  4P45 A;  1M4L A;  3CXS A;  3RZA A;  4B5P A;  3IIB A;  3NFZ A;  1YLO A;  5C82 A;  3EFA A;  1BPN A;  1X10 A;  4H89 A;  4KVM E;  5D29 A;  4MFZ A;  1FY7 A;  2ABZ A;  4L8A A;  3SJF A;  1P4N A;  5J8F A;  4Y49 B;  2EBJ A;  1CP7 A;  4J3G A;  3ZZI A;  2WPW A;  3FRM A;  4KOV A;  4AVB A;  1IIC A;  5F47 A;  2Z3P A;  4LQG A;  4BIN A;  3N5F A;  4Y49 C;  3QB8 A;  3R9G A;  3EC4 A;  3H8G A;  3GY9 A;  4H2K A;  4P4B A;  3PFO A;  4KUB A;  1ARM A;  3WR7 A;  4CAF A;  4A95 A;  5JQ4 A;  4GS4 A;  2R98 A;  4B11 A;  5JH9 A;  3SI2 A;  5JM6 A;  5HVF A;  2PR8 A;  4PK2 A;  3S9L A;  1Z8T A;  5AG6 A;  4Z65 A;  1QMU A;  4WJB A;  1XMT A;  5HVH A;  3FXT A;  1Y9K A;  2H5M A;  3T8W A;  3TC8 A;  3S6K A;  5DS0 A;  3TX8 A;  5AGE A;  2D4P A;  1Z4E A;  3DLJ A;  2OZU A;  4KOX A;  4NFR A;  2F8H A;  4M6H A;  3IEH A;  4NJR A;  4OC5 A;  1LRZ A;  5K8M A;  5A28 A;  2Q4Y A;  1GYT A;  1P0H A;  2PSW A;  4MHN A;  5H86 A;  4CGO A;  2C6P A;  4HNX B;  4G1P A;  5CNP A;  3DNS A;  5KTA A;  4OC4 A;  4P4J A;  3RBU A;  2PRB A;  2Q4Z A;  3DSB A;  2WYR A;  3FMC A;  3TOA A;  4A39 A;  5DWM A;  2R1I A;  2BO9 A;  1KWM A;  3LWU A;  2Z10 A;  2WPX A;  1XJO A;  4E8O A;  2NYQ A;  4PPZ A;  3LMS A;  5LYL A;  3PBE A;  2AFS A;  3D68 A;  5K8P A;  5EBV A;  1IOF A;  2ZW6 A;  2GU2 A;  2B4D A;  4F0X A;  2ATR A;  2Q7B A;  5I4M A;  4JWP A;  5AG5 A;  3ZJ0 A;  4DYO A;  4NGQ A;  1IY7 A;  2BUE A;  3SJX A;  4ZGY B;  3RO0 A;  1TXR A;  1MK4 A;  4M6G A;  5CPA A;  4OC1 A;  4PXC A;  4MHD A;  4FD6 A;  4R8F A;  3KAS A;  1Y0R A;  3BJ7 A;  4UF4 A;  3RYO A;  4JYW A;  1TIQ A;  1WWZ A;  5G20 A;  4B10 A;  2WUU A;  5D8N A;  4MHY A;  4QVT A;  2B5G B;  5JPH A;  1KUX A;  2I79 A;  3PBB A;  1TKF A;  2PJ1 A;  4UEE A;  2JLM A;  3D2P A;  3D4U A;  3PB8 X;  4OC0 A;  3R95 A;  5CBM A;  4GM5 A;  4R7M A;  4CAX A;  2OU2 A;  2Z3O A;  3FED A;  4P44 A;  1QSR A;  1IYK A;  1BOB A;  2J8R A;  2ZEL A;  2PJ3 A;  2NSM A;  2ZEN A;  4OLL A;  3VWD A;  1PUA A;  4MFP A;  5F46 A;  1QSN A;  2QJ8 A;  4ONW A;  2ODF A;  3F8K A;  1S7N A;  4QUS A;  2FIW A;  2P0W A;  4OME A;  1Q2D A;  4CAV A;  5F09 A;  2B4B A;  2VZZ A;  3FEE A;  3IU1 A;  1VHE A;  4FWU A;  4H6U A;  4AB7 A;  1I1D A;  1VIX A;  4NXY A;  2FVG A;  2F5I A;  5EC4 A;  1BPM A;  2YGW A;  2OB0 A;  3B3W A;  3R96 A;  3SI1 A;  2FS5 A;  1A2Z A;  4Q7A A;  3JRU A;  3BI1 A;  3LOD A;  4RUH A;  3A9L A;  2F7V A;  2J8N A;  2PJ7 A;  2X7B A;  4UCN A;  4KS9 A;  1YW6 A;  1Z8L A;  3PB7 X;  4UIB A;  4C2Y A;  3NH8 A;  1LAM A;  5FVJ A;  1EE3 P;  2O53 A;  4CGM A;  4P4I A;  3IC1 A;  5EMI A;  4UA3 A;  2ZEM A;  4C2Z A;  3NH5 A;  3V8I A;  1K4J A;  5IV0 A;  2EUI A;  1XBU A;  5F48 A;  4QC6 A;  1Z4R A;  4MCQ A;  3BXM A;  4R57 A;  1KUY A;  3K2K A;  3PRT A;  3RNZ A;  3SJE A;  3CXQ A;  1Z8W A;  4YWY A;  3GUX A;  2I00 A;  1DE4 C;  4ZI6 A;  3KQX A;  4EVY A;  2PC1 A;  4PK3 A;  3S9N A;  3QAY A;  4UFV A;  2DEA A;  4B13 A;  1IID A;  5HVG A;  4AG7 A;  3OWC A;  1Q7L A;  1PCA A;  1Y7E A;  2DPT A;  1B87 A;  4M3S A;  4O23 A;  3KI9 A;  1IOI A;  2ZEE A;  2GFQ A;  3IO1 A;  3IU2 A;  4JZ0 A;  4KSA A;  4XNH B;  2EWB A;  2Q0Y A;  2DF5 A;  1LAP A;  4F6A A;  2OR4 A;  1XIX A;  1YVO A;  1U6M A;  2Q43 A;  4OC3 A;  1RO5 A;  1Q2Y A;  4LUA A;  4NGT A;  2JDD A;  2P6G A;  4NGP A;  1RTQ A;  1Z5R A;  3SXO A;  1XFO A;  4X2T A;  2FCK A;  1ELM P;  4WWV A;  2PJ6 A;  2P6F A;  3ISX A;  4NGM A;  4R6T A;  3S9M A;  4E2A A;  1YQE A;  2IQ6 A;  3TT2 A;  3KHX A;  3WC7 A;  4MY0 A;  4YU9 A;  5IB9 A;  3S6G A;  1RXT A;  1KZF A;  4UEZ A;  3SJG A;  3VAR A;  2PCU A;  2G9D A;  4IUS A;  1HEE A;  1LOK A;  4FD5 A;  4BD9 A;  1AMP A;  6CPA A;  2VBQ A;  4UBR A;  3S6F A;  5LYD A;  2HQY A;  3JVN A;  4R87 A;  1IU8 A;  1LAN A;  2FL4 A;  5G22 A;  3TOB A;  3IWG A;  3LD2 A;  4PXB A;  4P4D A;  1ARL A;  4I49 A;  3SHP A;  2G3T A;  4ZY2 A;  1JQG A;  2WZN A;  2CXA A;  4B14 A;  4DJL A;  3FJU A;  1TF9 A;  1F57 A;  1TKJ A;  2JBK A;  4X3R A;  5KTD A;  3PB9 X;  5ISV A;  3B7I A;  2GE3 A;  3W6X A;  3H8F A;  1MJB A;  1S5K A;  2CIJ A;  2XEF A;  1TF8 A;  4TWE A;  1XOV A;  1FT7 A;  1YVK A;  1NSL A;  3FB3 A;  4MY3 A;  1R43 A;  1JWQ A;  3KHZ A;  4RI1 A;  1VHO A;  4UIA A;  2OOT A;  1ZLH A;  1OBR A;  3QAH A;  4H6Z A;  1S7K A;  3B3C A;  3PGP A;  2JDC A;  4CGN A;  4B5P B;  4CRY B;  4QBJ A;  2B3V A;  3PEI A;  3CPA A;  4P6Y A; 
#chains in the Genus database with same CATH homology
 3IGR A;  4B12 A;  4PSW A;  1WK4 A;  2ZW7 A;  3VWE A;  3TO7 A;  4JJX A;  2AE6 A;  4KOS A;  1SQH A;  2OZG A;  4HNY B;  4PSX A;  3KKW A;  2BL1 A;  2D4O A;  1S60 A;  5G1Z A;  2Z3N A;  2B3U A;  4NSQ A;  3GYA A;  2Z3M A;  4CYP A;  2REF A;  1UFH A;  3TTH A;  1Y9W A;  3W91 A;  4NCZ A;  3T90 A;  4X5K A;  3T9Y A;  4A2Z A;  2CNM A;  4BMH A;  1S7L A;  4NF1 A;  3FIX A;  5IX3 A;  4AVC A;  1QSO A;  2JEV A;  4KOU A;  4XPL A;  1S7F A;  2RC4 A;  4A31 A;  2BSW A;  5IB0 A;  3W6S A;  4JXQ A;  3TE4 A;  3JTK A;  2FXF A;  4XPD B;  3IWE A;  3N7Z A;  2PR1 A;  2Z0Z A;  4B5O A;  2Z3L A;  4XPD C;  2OZH A;  1CJW A;  4CAE A;  4QB9 A;  2B4D B;  1N71 A;  2G0B A;  2OH1 A;  4II9 A;  1M4I A;  1CM0 A;  4JD6 A;  4Q38 A;  2PDO A;  2Z3K A;  5J8C A;  4AG9 A;  2DPS A;  3G8W A;  5I0C A;  4KVX A;  2YNE A;  1M44 A;  2CNT A;  4MJ8 A;  1Q2C A;  1QST A;  4L89 A;  3I3G A;  1Y7R A;  4KOR A;  4MFL A;  4KLV A;  1YRE A;  4MFK A;  1BO4 A;  4MBU A;  2VZY A;  2FIA A;  4PV6 A;  3DR8 A;  1GHE A;  1YK3 A;  2YNC C;  4KOT A;  4KUA A;  3F0A A;  4XNH C;  1V0C A;  4CAW A;  5AG4 A;  2ZXV A;  2Q44 A;  1J4J A;  4C68 A;  3D2M A;  4Q36 A;  2Y0M A;  2CY2 A;  5DWN A;  2Z11 A;  2QML A;  3FBU A;  1B6B A;  4JLY A;  1XF8 A;  3TFY A;  4CGL A;  2R8V A;  2FT0 A;  2G3A A;  4U5Y A;  4OAD A;  4R9M A;  2EVN A;  3BJ8 A;  3EXN A;  3DDD A;  2GAN A;  3R9E A;  3NE7 A;  4MFQ A;  4XPK A;  4U9Y A;  4CYO A;  1M4D A;  3FYN A;  3PP9 A;  2O28 A;  2VQY A;  3TCV A;  2QEC A;  2WSA A;  4KLW A;  2B5G A;  1PU9 A;  4ORF A;  1YX0 A;  2FSR A;  4FD7 A;  4HKF A;  2A4N A;  2VXK A;  4ZBG A;  1I21 A;  2C27 A;  1S3Z A;  3R9F A;  3GKR A;  4MFJ A;  2P6E A;  4NEX A;  2AJ6 A;  2VEZ A;  3JUW A;  4K30 A;  4F0Y A;  2HV2 A;  1ON0 A;  2IL4 A;  4AVA A;  4YGO A;  4KVO E;  5HMN A;  5H84 A;  3R1K A;  3BLN A;  4HNW B;  4CS0 B;  2DXQ A;  2FE7 A;  2PQ8 A;  2HUZ A;  3E0K A;  1ZO0 A;  4RS2 A;  4IF5 A;  3UY5 A;  3PZJ A;  1M1D A;  4M85 A;  1YLE A;  3D3S A;  2QIR A;  1MJA A;  2ARH A;  2REE A;  4UFW A;  1KUV A;  4CYQ A;  5HH1 A;  2NMT A;  3S6H A;  3I9S A;  4C2X A;  5G21 A;  4A32 A;  2CNS A;  3K9U A;  3DR6 A;  4C7I A;  5C88 A;  2Q4V A;  4UFX A;  3G3S A;  3H4Q A;  1YGH A;  1NMT A;  4CGP A;  5F49 A;  4KZT A;  2YNC A;  4MI4 A;  4A30 A;  4U9Z A;  2ZW5 A;  4E0A A;  5A27 A;  1M4G A;  1XE4 A;  1MJ9 A;  4YRH A;  1VKC A;  3F5B A;  5AG7 A;  1YR0 A;  4R3K A;  5GCN A;  1QSM A;  4JXR A;  1XEB A;  2YND A;  4OAE A;  4UCM A;  1NE9 A;  4C7H A;  2ZPA A;  3SXN A;  2B58 A;  2VI7 A;  1L0C A;  1R57 A;  3FNC A;  3B8G A;  2KCW A;  4CYN A;  3CXP A;  3EY5 A;  5E96 A;  3TO6 A;  4ONU A;  3H5Z A;  3TO9 A;  3C26 A;  4YFJ A;  3D8P A;  3EO4 A;  5BWA B;  1IYL A;  2BEI A;  4KSF A;  1VHS A;  4A33 A;  3P2F A;  2R7H A;  4UWJ A;  5KTC A;  4UWI A;  4KOW A;  1I12 A;  2GIV A;  4KOY A;  1IB1 E;  2K5T A;  2Q04 A;  4BBH A;  3MGD A;  4CRZ B;  4FD4 A;  4DNC A;  4LX9 A;  4UCP A;  1OZP A;  4R3L A;  2ZW4 A;  2J8M A;  3P2H A;  1Z9U A;  3CXS A;  4B5P A;  5C82 A;  3EFA A;  4H89 A;  4KVM E;  4MFZ A;  1FY7 A;  4L8A A;  1P4N A;  5J8F A;  4Y49 B;  3ZZI A;  4J3G A;  2WPW A;  3FRM A;  4KOV A;  4AVB A;  1IIC A;  5F47 A;  2Z3P A;  4Y49 C;  3QB8 A;  3R9G A;  3EC4 A;  3GY9 A;  4KUB A;  4CAF A;  3WR7 A;  4A95 A;  5JQ4 A;  4GS4 A;  2R98 A;  4B11 A;  2PR8 A;  4PK2 A;  5AG6 A;  1XMT A;  3FXT A;  1Y9K A;  2H5M A;  3S6K A;  5AGE A;  2D4P A;  1Z4E A;  4KOX A;  2OZU A;  1LRZ A;  5A28 A;  2Q4Y A;  1P0H A;  2PSW A;  5H86 A;  4CGO A;  4HNX B;  5CNP A;  3DNS A;  5KTA A;  2PRB A;  3DSB A;  3TOA A;  5DWM A;  2R1I A;  2Z10 A;  2WPX A;  4E8O A;  5EBV A;  2ZW6 A;  2B4D A;  4F0X A;  2ATR A;  2Q7B A;  4JWP A;  5AG5 A;  3ZJ0 A;  4ZGY B;  2BUE A;  1MK4 A;  4MHD A;  4FD6 A;  3BJ7 A;  3RYO A;  1TIQ A;  1WWZ A;  5G20 A;  4B10 A;  2WUU A;  4QVT A;  2B5G B;  5JPH A;  1KUX A;  2I79 A;  2JLM A;  3D2P A;  3R95 A;  4CAX A;  2OU2 A;  2Z3O A;  1QSR A;  1IYK A;  1BOB A;  2J8R A;  4OLL A;  3VWD A;  1PUA A;  4MFP A;  5F46 A;  1QSN A;  3F8K A;  1S7N A;  4QUS A;  2FIW A;  2P0W A;  4CAV A;  1Q2D A;  2B4B A;  2VZZ A;  3IU1 A;  4H6U A;  4AB7 A;  1I1D A;  4NXY A;  2F5I A;  5EC4 A;  2YGW A;  3R96 A;  2OB0 A;  2FS5 A;  3LOD A;  3A9L A;  2J8N A;  2X7B A;  4UCN A;  4KS9 A;  4C2Y A;  5FVJ A;  4CGM A;  4UA3 A;  4C2Z A;  3V8I A;  1K4J A;  5IV0 A;  2EUI A;  5F48 A;  4QC6 A;  1Z4R A;  4R57 A;  1KUY A;  3CXQ A;  2I00 A;  4EVY A;  2PC1 A;  4PK3 A;  4UFV A;  4B13 A;  1IID A;  4AG7 A;  3OWC A;  2DPT A;  1B87 A;  4M3S A;  4XNH B;  3IU2 A;  4KSA A;  2Q0Y A;  4F6A A;  1XIX A;  1YVO A;  1U6M A;  1RO5 A;  1Q2Y A;  4LUA A;  3SXO A;  2JDD A;  2P6G A;  2FCK A;  2P6F A;  4E2A A;  3TT2 A;  4MY0 A;  3S6G A;  1RXT A;  1KZF A;  4IUS A;  4FD5 A;  2VBQ A;  4UBR A;  3S6F A;  2HQY A;  3JVN A;  4R87 A;  2FL4 A;  5G22 A;  3TOB A;  3IWG A;  3LD2 A;  4I49 A;  3SHP A;  2G3T A;  2CXA A;  4B14 A;  5KTD A;  5ISV A;  2GE3 A;  3W6X A;  1MJB A;  1S5K A;  1YVK A;  1NSL A;  3FB3 A;  4MY3 A;  4RI1 A;  4H6Z A;  3QAH A;  1S7K A;  3PGP A;  2JDC A;  4CGN A;  4B5P B;  4CRY B;  4QBJ A;  2B3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...