4B13A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 25)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Antimalarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b13A00
4B13A 2WSAA 2YNCC 4UFVA 3H5ZA 3IU2A 5AG7A 5AG6A 5AGEA 3IU1A 4A32A 4UFWA 4A31A 4B10A 4BBHA 3JTKA 2WUUA 4CGOA 5A27A 4B14A 4C7HA 5G21A 2YNEA 4B12A 4CYQA 4CYPA 4C2XA 5AG4A 4UCNA 4A95A 4C7IA 5G22A 4UCPA 4C2YA 4A33A 4CAFA 5G1ZA 4CAEA 4CYOA 4UFXA 4C68A 4CGLA 4CYNA 4A2ZA 4B11A 4CGMA 4CGNA 4CGPA 2YNCA 5G20A 5AG5A 5A28A 2YNDA 4C2ZA 3IWEA 4UCMA 4A30A
chains in the Genus database with same CATH superfamily
4AVBA 3QB8A 2Q44A 1HDQA 2ANPA 2PJAA 3BJ8A 3RBUA 3I1UA 1XJOA 2V8VA 1JWQA 2JDDA 2GANA 2Q43A 3N7ZA 3PFOA 1ELMP 4NSQA 3ISZA 2RB7A 4MXUA 5E96A 4ZI6A 3PP9A 4KUAA 3PZJA 4ZY1A 2J8RA 2JBJA 2P0WA 4PK2A 4QB9A 1CM0A 4RI1A 1Q2YA 2Q7SA 4K3NA 4YRHA 3LODA 1YREA 2K5TA 4C2ZA 2I79A 2WZNA 1TKJA 3FF3A 4KSIA 4R76A 3SXOA 1DTDA 3B3WA 4I49A 5F46A 2V77A 4F0YA 4B6ZA 3WC7A 4B10A 2CTCA 4AVAA 1Y7EA 1XEBA 1Y9WA 3KZWA 3H8GA 2FXFA 1S5KA 3TO9A 2EO8A 4B14A 3PB4X 2VL1A 1Z4RA 2B3VA 2OZGA 3V8IA 3WC6A 5K8MA 1TIQA 2ZEOA 4C7IA 1XIXA 4GS4A 2EVNA 4U9YA 3SJFA 4NXYA 1NMTA 3W6XA 2BSWA 4JLYA 3D66A 5I0CA 4CGMA 4PXBA 4KOYA 2OH1A 2FVGA 2PJ6A 3PB8X 1I21A 2YNDA 3GIUA 1KUYA 1YQEA 2REFA 3OWCA 1YMEA 4MFJA 4MI4A 4MHYA 4MY3A 4JJXA 4UCMA 2FIWA 5HVGA 4NFRA 1Q2CA 2WSAA 5FVJA 5ISVA 4PXDA 2AJ6A 3TOAA 2B4BA 3TO7A 2PIZA 2ZEDA 3FVLA 2P6EA 3JTKA 3FX6A 3QAYA 1VKCA 3NE7A 4QUSA 1S7FA 4FWUA 2O4HA 2VBQA 2R98A 4HNXB 1LFWA 1YGHA 2VZYA 3RAMA 4A39A 3B8GA 4OIDA 1KZFA 1L0CA 3DGVA 4JXQA 5CNPA 4MFZA 1CPSA 4TWEA 5BWAB 4KZTA 2GE3A 1PCAA 1YSJA 3R9FA 1XBUA 4FD5A 3D8PA 4F9UA 4KOVA 2RC4A 2ZEFA 3PEIA 1F2PA 4MMOA 4R7MA 4R3KA 3D67A 3NH5A 4XPKA 1MJAA 5K8OA 5C82A 4MY0A 4CAWA 3PBEA 3IWWA 3SJXA 1Z2LA 3VH9A 4MFPA 4UWIA 2AFMA 3KL9A 1BPMA 2PQ8A 2ZPAA 5IV0A 2KCWA 1YW4A 2EBJA 2GU2A 2R8VA 2DPSA 4C7HA 3FH4A 2HUZA 3T90A 1XRYA 4P4JA 2PJ4A 2ZOGA 3FB3A 1VHOA 4IUSA 4BMHA 2IQ6A 4FAIA 1XMBA 4KVXA 2PJ1A 4W9YA 2NYQA 1DE4C 4X3RA 1Y0RA 4GXHA 4MHPA 2ZW7A 1MK4A 1AYEA 2WPXA 3IFEA 4HNYB 2ZEEA 1KUVA 2Q4VA 3FIXA 5HH1A 1GHEA 3NFZA 3S9NA 2CNSA 2GFQA 4CGNA 4NGMA 3IC1A 3DDDA 2OOTA 3JRUA 4A30A 4O23A 1V0CA 1VHSA 2B3UA 2F7VA 1RO5A 5J1QA 2PJCA 3K2KA 4BBHA 4UFWA 4AXVA 1UWYA 2BOAA 1F57A 2BCOA 5D8NA 3GKRA 2PRQA 1VIXA 2FCKA 4H89A 3D68A 3V7ZA 1VGYA 4KOSA 5LRJA 2ZW6A 1IGBA 3NH4A 2PJ8A 3B3SA 4HNWB 3S6GA 4PV6A 1CX8A 1CP7A 2R1IA 4Z65A 4ONWA 6CPAA 3WR7A 4MHNA 5HVFA 5F09A 4B11A 3I3GA 1BLLE 5LYDA 4A37A 3H4QA 1LAPA 5AG5A 3H8FA 2AFUA 1XMTA 2ZEHA 4R6TA 2PIYA 1WWZA 4A38A 4EVYA 1Y7RA 3KR4A 4BINA 5K8PA 2ZW4A 3D7GA 5CPAA 4A32A 1ZLHA 2A4NA 2VXKA 5LRKA 5KTAA 4MCPA 1N71A 5F47A 3S6FA 4NGQA 3K9TA 3KHZA 3IO1A 4J3GA 1WK4A 3C26A 4OKOA 2PRBA 4JXRA 2DPTA 4R8FA 4X8IA 5G22A 1NSAA 4B5OA 2CTBA 4KSAA 3RO0A 4RUHA 5IX3A 4JD6A 3VATA 4P4FA 1ZG9A 2C27A 1IICA 1IY7A 1QSTA 2PJ0A 3GY9A 3PBBA 4MCRA 1CPXA 1YR0A 4PSXA 4A94A 3GYAA 2C6CA 4KOTA 1M44A 4RN7A 2AFZA 2CF4A 3DSBA 4P4BA 1Z8XA 4UEEA 4F0XA 2AFSA 2VEZA 1YLEA 3FJUA 4RS2A 4CRZB 5AGEA 1IB1E 3IU2A 4GM5A 3MN8A 3DR8A 1QMUA 4UEZA 2WUUA 2EK9A 1I1DA 1R57A 1XE4A 2AFXA 4Y49C 3SI1A 1HDUA 4NGSA 4UA3A 1M1DA 4M6IA 2G3TA 1OBRA 4B5PA 4IK2A 1S60A 1IOFA 3R9EA 3R95A 4UWJA 2WYRA 3EC4A 1M4IA 1TF9A 3LACA 2DXQA 4K30A 4R9MA 1XF8A 1X10A 2VI7A 3B3CA 1BO4A 5J8FA 3NH8A 2PJ2A 3VWEA 2CNTA 5A28A 2J8MA 3G3SA 3MGDA 1ZG7A 4KVME 4LQ6A 3VARA 1NE9A 4EMEA 5D29A 1R43A 2CNMA 2ZEPA 1EE3P 4WJBA 2PC1A 2ZEMA 2IJZA 4B5PB 1QSMA 1AMPA 2PR8A 2WPWA 2ZEGA 4Q38A 3FEEA 4Q36A 2OZHA 2JEWA 4OC2A 1LANA 2QJ8A 4AB7A 2Z3MA 4OP4A 3D7HA 4PQAA 2X7BA 5THWA 4FD7A 4R87A 3PFEA 3T8WA 3RYOA 2ARHA 2HQYA 3KGQA 3KASA 4EWTA 5JM6A 3F5BA 4NGPA 2GLFA 3B3TA 4KLWA 5KTDA 1YK3A 2Z11A 3PB6X 4OC5A 5EC4A 1H8LA 4OC1A 2B58A 1VHEA 2YNCC 4AG7A 4UFVA 2ZELA 3TO6A 3F0AA 4MCSA 4R57A 2Q51A 3TTHA 4CS0B 1HEEA 2G3AA 2AFWA 2FS5A 2CY2A 4MHZA 2FSRA 4ZX8A 1PUAA 2PVWA 2FE7A 2J9AA 3S6KA 5AG4A 4OLLA 1IYLA 2J8NA 3W91A 3T9YA 4KLVA 4A33A 5JQ4A 3IEHA 3RZAA 3WC5A 1Z9UA 2Z3KA 4CYOA 2Y0MA 3GB0A 4KOXA 3IWGA 4LQGA 3TX8A 4NGTA 1YVOA 2PJ5A 3CT9A 5G20A 1CBXA 2QVPA 2Z3OA 4JWPA 1M4LA 2JBKA 1Z8WA 4H6UA 1RXTA 1I12A 4ORFA 4PPZA 2HB6A 2Z3LA 3PGPA 1KUXA 4E0AA 5HMNA 3SJGA 1YW6A 3N5FA 3BJ7A 3E0KA 3QAHA 1YLOA 1M4DA 2BL1A 4TNUA 2FL4A 3CPAA 3KQZA 4NF1A 4KUBA 2PR1A 1KWMA 2XEGA 3CXQA 4U9ZA 4UF4A 4LX9A 2GLJA 2Q0YA 4CGOA 4CPAA 4MBUA 1J4JA 2D4PA 2I3CA 4CYPA 4E2AA 2Z3NA 4DJLA 4UCNA 5J8CA 1Q2DA 4UBRA 2NSMA 2Q04A 2ATRA 2C1CA 1S7LA 3BLNA 3H8EA 4L89A 4CGLA 3I9SA 3DNSA 1FNOA 2G0BA 1PYTB 4MHDA 4PK3A 4R3LA 2EWBA 4BD9A 4PXCA 1U6MA 4Y49B 4AVCA 3A9LA 3CZXA 3IWEA 3S9MA 3JUWA 4MFKA 1IU8A 3NE8A 1P0HA 3H5ZA 4IF5A 1YX0A 3KI9A 4KORA 2FIAA 2HV2A 5DWNA 3KKWA 5H86A 3S6HA 2NMTA 4P4EA 1BAVA 4LUAA 5EBVA 4PXEA 2HC9A 2ZW5A 5KTCA 1S3ZA 3LWUA 4KOUA 2G9DA 3WABA 4B12A 2PSWA 4YU9A 3FNCA 5JGFA 4CAXA 5CBMA 4JYWA 1A2ZA 2P6FA 1IIDA 1MJBA 3QNVA 3D4UA 1Y0YA 2JLMA 3BHXA 5JH9A 4CGPA 5LYLA 2Q4ZA 4NJQA 4F9VA 2YNCA 3FYNA 3LD2A 1BPNA 4P44A 3WT4A 3CXSA 3EO4A 3HUVA 4Q7AA 4PSWA 2CXAA 2EK8A 3SJEA 4OADA 4FBEA 4OIWA 4WWVA 3L2NA 2V8DA 4NJRA 3D7FA 2OZUA 3R1KA 4ZYQA 3TC8A 1X12A 1BOBA 5HVHA 2F8HA 3RNZA 2D4OA 1XOVA 1R3NA 3F8KA 4HPSA 5F48A 2VQYA 3SHPA 2YNEA 3FEDA 8CPAA 1ELLP 1Z8TA 2PJBA 2F5IA 3CXPA 3D2PA 4ZX9A 4CRYB 4L8AA 2CIJA 5IB0A 2O28A 1TF8A 2REEA 2PVVA 3TE4A 1ARLA 1TKFA 1Z8LA 2DEAA 2BUEA 2Z10A 2V8HA 5K8NA 1CP6A 3FBUA 5F49A 3D2MA 4M3SA 1UFHA 3K9UA 1NSLA 3LMSA 4XNHC 1OZPA 4ZBGA 3EXNA 2R7HA 3TFYA 3B7IA 1ZG8A 2XEIA 1IOIA 2BO9A 2VZZA 3HLPA 4KS9A 4YGOA 4YFJA 3IU1A 4UEFA 4E8OA 2V8GA 4U5YA 2PJ7A 4XPDC 5H84A 3V38A 3UY5A 5IB9A 4P45A 3ZJ0A 4MCQA 3S9LA 3P2FA 4NGRA 2ABZA 4A95A 3ISXA 1QSNA 4QBJA 4MRIA 7CPAA 3PRTA 1FY7A 1CJWA 4ZGYB 4UFXA 4C68A 2C6PA 1B6BA 1Q7LA 5DWMA 2FT0A 2YGWA 1JQGA 3GLJA 3EFAA 4FD4A 3IGRA 1TXRA 4II9A 2PCUA 4OC3A 4ZY0A 4EFDA 1MJ9A 2PDOA 2Z0ZA 4KSFA 3TT2A 3VWDA 3DLJA 4MFLA 1IYKA 4OMEA 3TOBA 3DR6A 2ZENA 3EY5A 5AG7A 4M6GA 5GCNA 5LYIA 4A31A 4QC6A 4H6ZA 3GUXA 2BEIA 5DS0A 3PB9X 3KHXA 4X5KA 3R96A 1FT7A 1QSOA 2H5MA 5G21A 2ZXVA 1F2OA 2B4DA 1RTQA 2Q4YA 2DF5A 3CPXA 3PB7X 4P4IA 3NA6A 5HXDA 4KOWA 1GYTA 4NEXA 3SI2A 1S7KA 4G1PA 3SXNA 1Z5RA 4ONUA 3SI0A 3P2HA 4A2ZA 4CAVA 4CYNA 4AG9A 4M6HA 2GREA 4HKFA 2AFOA 2OU2A 3BI1A 5LYFA 3IJ3A 2OR4A 4XPLA 4OC4A 2Q7BA 2C6GA 3BI0A 3FXTA 3JVNA 4B13A 1LOKA 2JEVA 2RFHA 4P4DA 3B35A 2PE3A 4QVTA 5AG6A 4UIBA 5C88A 2B4DB 1LAMA 2PJ3A 3B2YA 3R9GA 4FUUA 4M85A 4FD6A 4MJ8A 5I4MA 3ZZIA 2IMOA 4IHMA 4C2XA 2O53A 3FMCA 2IL4A 5JPHA 1P4NA 4CAFA 4C2YA 4X2TA 1Z4EA 3MRUA 1QQ9A 1SQHA 2POKA 4P6YA 2QYVA 1XFOA 4UIAA 4NGNA 1LCPA 2OB0A 3TCVA 2P6GA 1S7NA 1PU9A 3KQXA 1ARMA 2I00A 2XEJA 2Z3PA 3G8WA 1K4JA 2JDCA 1QSRA 2ODFA 3D7DA 4NCZA 3BXMA 3W6SA 4DYOA 1TKHA 1ON0A 2QECA 4DNCA 2B5GA 1YVKA 2AE6A 2PJ9A 3D3SA 4F8ZA 2QIRA 3FRMA 4DUKA 5A27A 4H2KA 4ZY2A 4CYQA 4JZ0A 4YWYA 1LRZA 3FECA 4XNHB 1ZO0A 3CDXA 4OC0A 2XEFA 4UCPA 4MFQA 1M4GA 5G1ZA 4KVOE 4F6AA 4CAEA 1CG2A 4OAEA 3IIBA 3KR5A 2GIVA 5EMIA 2EUIA 5ELYA 3B3VA 4XPDB 1ZLIA 4IAVA 4P10A 1AUGA 2B5GB 1B87A 2QMLA 5LRGA 2ZOFA 1Y9KA
chains in the Genus database with same CATH topology
4AVBA 3QB8A 2Q44A 3BJ8A 2JDDA 2GANA 3N7ZA 4NSQA 5E96A 3PP9A 4KUAA 3PZJA 2J8RA 2P0WA 4PK2A 4QB9A 1CM0A 4RI1A 1Q2YA 4YRHA 3LODA 1YREA 2K5TA 4C2ZA 2I79A 3SXOA 4I49A 5F46A 4F0YA 4B10A 4AVAA 1XEBA 1Y9WA 2FXFA 1S5KA 3TO9A 4B14A 1Z4RA 2B3VA 2OZGA 3V8IA 1TIQA 4C7IA 1XIXA 4GS4A 2EVNA 4U9YA 4NXYA 1NMTA 3W6XA 2BSWA 4JLYA 5I0CA 4CGMA 4KOYA 2OH1A 1I21A 2YNDA 4MFJA 1KUYA 2REFA 3OWCA 4MI4A 4MY3A 3W6SA 4JJXA 4UCMA 2FIWA 5ISVA 1Q2CA 2WSAA 5FVJA 3TOAA 2AJ6A 3TO7A 2B4BA 2P6EA 3JTKA 4QUSA 1VKCA 3NE7A 1S7FA 2VBQA 2R98A 4HNXB 1YGHA 2VZYA 3B8GA 1KZFA 1L0CA 4JXQA 5CNPA 4MFZA 5BWAB 4KZTA 2GE3A 3R9FA 4FD5A 3D8PA 4KOVA 2RC4A 4R3KA 4XPKA 1MJAA 5C82A 4MY0A 4CAWA 4MFPA 4UWIA 2PQ8A 2ZPAA 5IV0A 2KCWA 2R8VA 2DPSA 4C7HA 2HUZA 3T90A 4BMHA 3FB3A 4IUSA 4KVXA 2ZW7A 1MK4A 4HNYB 2WPXA 1KUVA 2Q4VA 3FIXA 5HH1A 1GHEA 2CNSA 4CGNA 3DDDA 4A30A 1V0CA 1VHSA 2B3UA 1RO5A 4BBHA 4UFWA 3GKRA 4H89A 2FCKA 4KOSA 2ZW6A 4HNWB 3S6GA 4PV6A 2R1IA 3WR7A 4B11A 3I3GA 3H4QA 5AG5A 1XMTA 1WWZA 4EVYA 1Y7RA 2ZW4A 4A32A 2A4NA 2VXKA 5KTAA 5F47A 1N71A 3S6FA 4J3GA 1WK4A 3C26A 2PRBA 4JXRA 2DPTA 5G22A 4B5OA 4KSAA 5IX3A 4JD6A 2C27A 1IICA 1QSTA 3GY9A 4PSXA 1YR0A 3GYAA 4KOTA 1M44A 3DSBA 4F0XA 2VEZA 1YLEA 4RS2A 4CRZB 5AGEA 1IB1E 3IU2A 3DR8A 2WUUA 1I1DA 1R57A 1XE4A 4Y49C 4UA3A 1M1DA 2G3TA 4B5PA 1S60A 3R9EA 3R95A 4UWJA 3EC4A 1M4IA 4K30A 2DXQA 4R9MA 1XF8A 2VI7A 1BO4A 5J8FA 5A28A 3VWEA 2CNTA 2J8MA 3G3SA 3MGDA 4KVME 1NE9A 2CNMA 2PC1A 4B5PB 1QSMA 2PR8A 2WPWA 4Q38A 4Q36A 2OZHA 4AB7A 2Z3MA 2X7BA 4FD7A 4R87A 3RYOA 2ARHA 2HQYA 3F5BA 4KLWA 5KTDA 1YK3A 2Z11A 5EC4A 2B58A 2YNCC 4AG7A 4UFVA 3TO6A 3F0AA 4R57A 3TTHA 4CS0B 2G3AA 2FS5A 2CY2A 2FSRA 1PUAA 2FE7A 3S6KA 5AG4A 4OLLA 1IYLA 2J8NA 3W91A 3T9YA 4KLVA 4A33A 5JQ4A 1Z9UA 2Z3KA 4CYOA 2Y0MA 4KOXA 3IWGA 1YVOA 5G20A 2Z3OA 4JWPA 4H6UA 1RXTA 1I12A 4ORFA 3PGPA 2Z3LA 1KUXA 4E0AA 5HMNA 3BJ7A 3E0KA 3QAHA 1M4DA 2BL1A 2FL4A 4NF1A 4KUBA 2PR1A 3CXQA 4U9ZA 4CGOA 4LX9A 2Q0YA 4MBUA 1J4JA 2D4PA 4CYPA 4E2AA 2Z3NA 4UCNA 5J8CA 1Q2DA 4UBRA 2Q04A 2ATRA 4L89A 1S7LA 3BLNA 4CGLA 3I9SA 3DNSA 2G0BA 4MHDA 4PK3A 4R3LA 1U6MA 4Y49B 4AVCA 3A9LA 3IWEA 3JUWA 4MFKA 1P0HA 3H5ZA 4IF5A 1YX0A 4KORA 5DWNA 2FIAA 2HV2A 5H86A 3KKWA 3S6HA 2NMTA 4LUAA 5EBVA 2ZW5A 5KTCA 1S3ZA 4KOUA 4B12A 2PSWA 3FNCA 4CAXA 2P6FA 1IIDA 1MJBA 2JLMA 4CGPA 2YNCA 3FYNA 3LD2A 3CXSA 3EO4A 4PSWA 2CXAA 4OADA 2OZUA 3R1KA 1BOBA 2D4OA 5F48A 3F8KA 3SHPA 2VQYA 2YNEA 3D2PA 2F5IA 3CXPA 4CRYB 4L8AA 5IB0A 2O28A 2REEA 3TE4A 2Z10A 2BUEA 3FBUA 5F49A 3D2MA 4M3SA 1UFHA 3K9UA 1NSLA 4XNHC 1OZPA 4ZBGA 3EXNA 2R7HA 3TFYA 2VZZA 4YFJA 4YGOA 4KS9A 3IU1A 4E8OA 4U5YA 4XPDC 5H84A 3UY5A 3ZJ0A 3P2FA 4A95A 1QSNA 4QBJA 1FY7A 1CJWA 4ZGYB 4UFXA 4C68A 1B6BA 5DWMA 2FT0A 2YGWA 3EFAA 4FD4A 3IGRA 4II9A 1MJ9A 2PDOA 2Z0ZA 4KSFA 3TT2A 3VWDA 4MFLA 1IYKA 3TOBA 3DR6A 3EY5A 5AG7A 5GCNA 4A31A 4QC6A 4H6ZA 2BEIA 3R96A 4X5KA 1QSOA 2H5MA 5G21A 2ZXVA 2B4DA 2Q4YA 4KOWA 3SXNA 4NEXA 1S7KA 4ONUA 4CAVA 3P2HA 4A2ZA 4CYNA 4AG9A 4HKFA 2OU2A 4XPLA 2Q7BA 3FXTA 3JVNA 4B13A 2JEVA 4QVTA 5AG6A 5C88A 2B4DB 3R9GA 4M85A 4FD6A 4MJ8A 3ZZIA 4C2XA 5JPHA 2IL4A 1P4NA 4CAFA 4C2YA 1Z4EA 1SQHA 2OB0A 3TCVA 2P6GA 1S7NA 1PU9A 2I00A 2Z3PA 3G8WA 1K4JA 2JDCA 1QSRA 4NCZA 2QECA 1ON0A 4DNCA 2B5GA 1YVKA 2AE6A 3D3SA 2QIRA 3FRMA 5A27A 4CYQA 1LRZA 4XNHB 1ZO0A 4UCPA 4MFQA 1M4GA 5G1ZA 4KVOE 4F6AA 4CAEA 4OAEA 2GIVA 2EUIA 4XPDB 2B5GB 2QMLA 1B87A 1Y9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B13 A;  2WSA A;  2YNC C;  4UFV A;  3H5Z A;  3IU2 A;  5AG7 A;  5AG6 A;  5AGE A;  3IU1 A;  4A32 A;  4UFW A;  4A31 A;  4B10 A;  4BBH A;  3JTK A;  2WUU A;  4CGO A;  5A27 A;  4B14 A;  4C7H A;  5G21 A;  2YNE A;  4B12 A;  4CYQ A;  4CYP A;  4C2X A;  5AG4 A;  4UCN A;  4A95 A;  4C7I A;  5G22 A;  4UCP A;  4C2Y A;  4A33 A;  4CAF A;  5G1Z A;  4CAE A;  4CYO A;  4UFX A;  4C68 A;  4CGL A;  4CYN A;  4A2Z A;  4B11 A;  4CGM A;  4CGN A;  4CGP A;  2YNC A;  5G20 A;  5AG5 A;  5A28 A;  2YND A;  4C2Z A;  3IWE A;  4UCM A;  4A30 A; 
#chains in the Genus database with same CATH topology
 4AVB A;  3QB8 A;  2Q44 A;  1HDQ A;  2ANP A;  2PJA A;  3BJ8 A;  3RBU A;  3I1U A;  1XJO A;  2V8V A;  1JWQ A;  2JDD A;  2GAN A;  2Q43 A;  3N7Z A;  3PFO A;  1ELM P;  4NSQ A;  3ISZ A;  2RB7 A;  4MXU A;  5E96 A;  4ZI6 A;  3PP9 A;  4KUA A;  3PZJ A;  4ZY1 A;  2J8R A;  2JBJ A;  2P0W A;  4PK2 A;  4QB9 A;  1CM0 A;  4RI1 A;  1Q2Y A;  2Q7S A;  4K3N A;  4YRH A;  3LOD A;  1YRE A;  2K5T A;  4C2Z A;  2I79 A;  2WZN A;  1TKJ A;  3FF3 A;  4KSI A;  4R76 A;  3SXO A;  1DTD A;  3B3W A;  4I49 A;  5F46 A;  2V77 A;  4F0Y A;  4B6Z A;  3WC7 A;  4B10 A;  2CTC A;  4AVA A;  1Y7E A;  1XEB A;  1Y9W A;  3KZW A;  3H8G A;  2FXF A;  1S5K A;  3TO9 A;  2EO8 A;  4B14 A;  3PB4 X;  2VL1 A;  1Z4R A;  2B3V A;  2OZG A;  3V8I A;  3WC6 A;  5K8M A;  1TIQ A;  2ZEO A;  4C7I A;  1XIX A;  4GS4 A;  2EVN A;  4U9Y A;  3SJF A;  4NXY A;  1NMT A;  3W6X A;  2BSW A;  4JLY A;  3D66 A;  5I0C A;  4CGM A;  4PXB A;  4KOY A;  2OH1 A;  2FVG A;  2PJ6 A;  3PB8 X;  1I21 A;  2YND A;  3GIU A;  1KUY A;  1YQE A;  2REF A;  3OWC A;  1YME A;  4MFJ A;  4MI4 A;  4MHY A;  4MY3 A;  4JJX A;  4UCM A;  2FIW A;  5HVG A;  4NFR A;  1Q2C A;  2WSA A;  5FVJ A;  5ISV A;  4PXD A;  2AJ6 A;  3TOA A;  2B4B A;  3TO7 A;  2PIZ A;  2ZED A;  3FVL A;  2P6E A;  3JTK A;  3FX6 A;  3QAY A;  1VKC A;  3NE7 A;  4QUS A;  1S7F A;  4FWU A;  2O4H A;  2VBQ A;  2R98 A;  4HNX B;  1LFW A;  1YGH A;  2VZY A;  3RAM A;  4A39 A;  3B8G A;  4OID A;  1KZF A;  1L0C A;  3DGV A;  4JXQ A;  5CNP A;  4MFZ A;  1CPS A;  4TWE A;  5BWA B;  4KZT A;  2GE3 A;  1PCA A;  1YSJ A;  3R9F A;  1XBU A;  4FD5 A;  3D8P A;  4F9U A;  4KOV A;  2RC4 A;  2ZEF A;  3PEI A;  1F2P A;  4MMO A;  4R7M A;  4R3K A;  3D67 A;  3NH5 A;  4XPK A;  1MJA A;  5K8O A;  5C82 A;  4MY0 A;  4CAW A;  3PBE A;  3IWW A;  3SJX A;  1Z2L A;  3VH9 A;  4MFP A;  4UWI A;  2AFM A;  3KL9 A;  1BPM A;  2PQ8 A;  2ZPA A;  5IV0 A;  2KCW A;  1YW4 A;  2EBJ A;  2GU2 A;  2R8V A;  2DPS A;  4C7H A;  3FH4 A;  2HUZ A;  3T90 A;  1XRY A;  4P4J A;  2PJ4 A;  2ZOG A;  3FB3 A;  1VHO A;  4IUS A;  4BMH A;  2IQ6 A;  4FAI A;  1XMB A;  4KVX A;  2PJ1 A;  4W9Y A;  2NYQ A;  1DE4 C;  4X3R A;  1Y0R A;  4GXH A;  4MHP A;  2ZW7 A;  1MK4 A;  1AYE A;  2WPX A;  3IFE A;  4HNY B;  2ZEE A;  1KUV A;  2Q4V A;  3FIX A;  5HH1 A;  1GHE A;  3NFZ A;  3S9N A;  2CNS A;  2GFQ A;  4CGN A;  4NGM A;  3IC1 A;  3DDD A;  2OOT A;  3JRU A;  4A30 A;  4O23 A;  1V0C A;  1VHS A;  2B3U A;  2F7V A;  1RO5 A;  5J1Q A;  2PJC A;  3K2K A;  4BBH A;  4UFW A;  4AXV A;  1UWY A;  2BOA A;  1F57 A;  2BCO A;  5D8N A;  3GKR A;  2PRQ A;  1VIX A;  2FCK A;  4H89 A;  3D68 A;  3V7Z A;  1VGY A;  4KOS A;  5LRJ A;  2ZW6 A;  1IGB A;  3NH4 A;  2PJ8 A;  3B3S A;  4HNW B;  3S6G A;  4PV6 A;  1CX8 A;  1CP7 A;  2R1I A;  4Z65 A;  4ONW A;  6CPA A;  3WR7 A;  4MHN A;  5HVF A;  5F09 A;  4B11 A;  3I3G A;  1BLL E;  5LYD A;  4A37 A;  3H4Q A;  1LAP A;  5AG5 A;  3H8F A;  2AFU A;  1XMT A;  2ZEH A;  4R6T A;  2PIY A;  1WWZ A;  4A38 A;  4EVY A;  1Y7R A;  3KR4 A;  4BIN A;  5K8P A;  2ZW4 A;  3D7G A;  5CPA A;  4A32 A;  1ZLH A;  2A4N A;  2VXK A;  5LRK A;  5KTA A;  4MCP A;  1N71 A;  5F47 A;  3S6F A;  4NGQ A;  3K9T A;  3KHZ A;  3IO1 A;  4J3G A;  1WK4 A;  3C26 A;  4OKO A;  2PRB A;  4JXR A;  2DPT A;  4R8F A;  4X8I A;  5G22 A;  1NSA A;  4B5O A;  2CTB A;  4KSA A;  3RO0 A;  4RUH A;  5IX3 A;  4JD6 A;  3VAT A;  4P4F A;  1ZG9 A;  2C27 A;  1IIC A;  1IY7 A;  1QST A;  2PJ0 A;  3GY9 A;  3PBB A;  4MCR A;  1CPX A;  1YR0 A;  4PSX A;  4A94 A;  3GYA A;  2C6C A;  4KOT A;  1M44 A;  4RN7 A;  2AFZ A;  2CF4 A;  3DSB A;  4P4B A;  1Z8X A;  4UEE A;  4F0X A;  2AFS A;  2VEZ A;  1YLE A;  3FJU A;  4RS2 A;  4CRZ B;  5AGE A;  1IB1 E;  3IU2 A;  4GM5 A;  3MN8 A;  3DR8 A;  1QMU A;  4UEZ A;  2WUU A;  2EK9 A;  1I1D A;  1R57 A;  1XE4 A;  2AFX A;  4Y49 C;  3SI1 A;  1HDU A;  4NGS A;  4UA3 A;  1M1D A;  4M6I A;  2G3T A;  1OBR A;  4B5P A;  4IK2 A;  1S60 A;  1IOF A;  3R9E A;  3R95 A;  4UWJ A;  2WYR A;  3EC4 A;  1M4I A;  1TF9 A;  3LAC A;  2DXQ A;  4K30 A;  4R9M A;  1XF8 A;  1X10 A;  2VI7 A;  3B3C A;  1BO4 A;  5J8F A;  3NH8 A;  2PJ2 A;  3VWE A;  2CNT A;  5A28 A;  2J8M A;  3G3S A;  3MGD A;  1ZG7 A;  4KVM E;  4LQ6 A;  3VAR A;  1NE9 A;  4EME A;  5D29 A;  1R43 A;  2CNM A;  2ZEP A;  1EE3 P;  4WJB A;  2PC1 A;  2ZEM A;  2IJZ A;  4B5P B;  1QSM A;  1AMP A;  2PR8 A;  2WPW A;  2ZEG A;  4Q38 A;  3FEE A;  4Q36 A;  2OZH A;  2JEW A;  4OC2 A;  1LAN A;  2QJ8 A;  4AB7 A;  2Z3M A;  4OP4 A;  3D7H A;  4PQA A;  2X7B A;  5THW A;  4FD7 A;  4R87 A;  3PFE A;  3T8W A;  3RYO A;  2ARH A;  2HQY A;  3KGQ A;  3KAS A;  4EWT A;  5JM6 A;  3F5B A;  4NGP A;  2GLF A;  3B3T A;  4KLW A;  5KTD A;  1YK3 A;  2Z11 A;  3PB6 X;  4OC5 A;  5EC4 A;  1H8L A;  4OC1 A;  2B58 A;  1VHE A;  2YNC C;  4AG7 A;  4UFV A;  2ZEL A;  3TO6 A;  3F0A A;  4MCS A;  4R57 A;  2Q51 A;  3TTH A;  4CS0 B;  1HEE A;  2G3A A;  2AFW A;  2FS5 A;  2CY2 A;  4MHZ A;  2FSR A;  4ZX8 A;  1PUA A;  2PVW A;  2FE7 A;  2J9A A;  3S6K A;  5AG4 A;  4OLL A;  1IYL A;  2J8N A;  3W91 A;  3T9Y A;  4KLV A;  4A33 A;  5JQ4 A;  3IEH A;  3RZA A;  3WC5 A;  1Z9U A;  2Z3K A;  4CYO A;  2Y0M A;  3GB0 A;  4KOX A;  3IWG A;  4LQG A;  3TX8 A;  4NGT A;  1YVO A;  2PJ5 A;  3CT9 A;  5G20 A;  1CBX A;  2QVP A;  2Z3O A;  4JWP A;  1M4L A;  2JBK A;  1Z8W A;  4H6U A;  1RXT A;  1I12 A;  4ORF A;  4PPZ A;  2HB6 A;  2Z3L A;  3PGP A;  1KUX A;  4E0A A;  5HMN A;  3SJG A;  1YW6 A;  3N5F A;  3BJ7 A;  3E0K A;  3QAH A;  1YLO A;  1M4D A;  2BL1 A;  4TNU A;  2FL4 A;  3CPA A;  3KQZ A;  4NF1 A;  4KUB A;  2PR1 A;  1KWM A;  2XEG A;  3CXQ A;  4U9Z A;  4UF4 A;  4LX9 A;  2GLJ A;  2Q0Y A;  4CGO A;  4CPA A;  4MBU A;  1J4J A;  2D4P A;  2I3C A;  4CYP A;  4E2A A;  2Z3N A;  4DJL A;  4UCN A;  5J8C A;  1Q2D A;  4UBR A;  2NSM A;  2Q04 A;  2ATR A;  2C1C A;  1S7L A;  3BLN A;  3H8E A;  4L89 A;  4CGL A;  3I9S A;  3DNS A;  1FNO A;  2G0B A;  1PYT B;  4MHD A;  4PK3 A;  4R3L A;  2EWB A;  4BD9 A;  4PXC A;  1U6M A;  4Y49 B;  4AVC A;  3A9L A;  3CZX A;  3IWE A;  3S9M A;  3JUW A;  4MFK A;  1IU8 A;  3NE8 A;  1P0H A;  3H5Z A;  4IF5 A;  1YX0 A;  3KI9 A;  4KOR A;  2FIA A;  2HV2 A;  5DWN A;  3KKW A;  5H86 A;  3S6H A;  2NMT A;  4P4E A;  1BAV A;  4LUA A;  5EBV A;  4PXE A;  2HC9 A;  2ZW5 A;  5KTC A;  1S3Z A;  3LWU A;  4KOU A;  2G9D A;  3WAB A;  4B12 A;  2PSW A;  4YU9 A;  3FNC A;  5JGF A;  4CAX A;  5CBM A;  4JYW A;  1A2Z A;  2P6F A;  1IID A;  1MJB A;  3QNV A;  3D4U A;  1Y0Y A;  2JLM A;  3BHX A;  5JH9 A;  4CGP A;  5LYL A;  2Q4Z A;  4NJQ A;  4F9V A;  2YNC A;  3FYN A;  3LD2 A;  1BPN A;  4P44 A;  3WT4 A;  3CXS A;  3EO4 A;  3HUV A;  4Q7A A;  4PSW A;  2CXA A;  2EK8 A;  3SJE A;  4OAD A;  4FBE A;  4OIW A;  4WWV A;  3L2N A;  2V8D A;  4NJR A;  3D7F A;  2OZU A;  3R1K A;  4ZYQ A;  3TC8 A;  1X12 A;  1BOB A;  5HVH A;  2F8H A;  3RNZ A;  2D4O A;  1XOV A;  1R3N A;  3F8K A;  4HPS A;  5F48 A;  2VQY A;  3SHP A;  2YNE A;  3FED A;  8CPA A;  1ELL P;  1Z8T A;  2PJB A;  2F5I A;  3CXP A;  3D2P A;  4ZX9 A;  4CRY B;  4L8A A;  2CIJ A;  5IB0 A;  2O28 A;  1TF8 A;  2REE A;  2PVV A;  3TE4 A;  1ARL A;  1TKF A;  1Z8L A;  2DEA A;  2BUE A;  2Z10 A;  2V8H A;  5K8N A;  1CP6 A;  3FBU A;  5F49 A;  3D2M A;  4M3S A;  1UFH A;  3K9U A;  1NSL A;  3LMS A;  4XNH C;  1OZP A;  4ZBG A;  3EXN A;  2R7H A;  3TFY A;  3B7I A;  1ZG8 A;  2XEI A;  1IOI A;  2BO9 A;  2VZZ A;  3HLP A;  4KS9 A;  4YGO A;  4YFJ A;  3IU1 A;  4UEF A;  4E8O A;  2V8G A;  4U5Y A;  2PJ7 A;  4XPD C;  5H84 A;  3V38 A;  3UY5 A;  5IB9 A;  4P45 A;  3ZJ0 A;  4MCQ A;  3S9L A;  3P2F A;  4NGR A;  2ABZ A;  4A95 A;  3ISX A;  1QSN A;  4QBJ A;  4MRI A;  7CPA A;  3PRT A;  1FY7 A;  1CJW A;  4ZGY B;  4UFX A;  4C68 A;  2C6P A;  1B6B A;  1Q7L A;  5DWM A;  2FT0 A;  2YGW A;  1JQG A;  3GLJ A;  3EFA A;  4FD4 A;  3IGR A;  1TXR A;  4II9 A;  2PCU A;  4OC3 A;  4ZY0 A;  4EFD A;  1MJ9 A;  2PDO A;  2Z0Z A;  4KSF A;  3TT2 A;  3VWD A;  3DLJ A;  4MFL A;  1IYK A;  4OME A;  3TOB A;  3DR6 A;  2ZEN A;  3EY5 A;  5AG7 A;  4M6G A;  5GCN A;  5LYI A;  4A31 A;  4QC6 A;  4H6Z A;  3GUX A;  2BEI A;  5DS0 A;  3PB9 X;  3KHX A;  4X5K A;  3R96 A;  1FT7 A;  1QSO A;  2H5M A;  5G21 A;  2ZXV A;  1F2O A;  2B4D A;  1RTQ A;  2Q4Y A;  2DF5 A;  3CPX A;  3PB7 X;  4P4I A;  3NA6 A;  5HXD A;  4KOW A;  1GYT A;  4NEX A;  3SI2 A;  1S7K A;  4G1P A;  3SXN A;  1Z5R A;  4ONU A;  3SI0 A;  3P2H A;  4A2Z A;  4CAV A;  4CYN A;  4AG9 A;  4M6H A;  2GRE A;  4HKF A;  2AFO A;  2OU2 A;  3BI1 A;  5LYF A;  3IJ3 A;  2OR4 A;  4XPL A;  4OC4 A;  2Q7B A;  2C6G A;  3BI0 A;  3FXT A;  3JVN A;  4B13 A;  1LOK A;  2JEV A;  2RFH A;  4P4D A;  3B35 A;  2PE3 A;  4QVT A;  5AG6 A;  4UIB A;  5C88 A;  2B4D B;  1LAM A;  2PJ3 A;  3B2Y A;  3R9G A;  4FUU A;  4M85 A;  4FD6 A;  4MJ8 A;  5I4M A;  3ZZI A;  2IMO A;  4IHM A;  4C2X A;  2O53 A;  3FMC A;  2IL4 A;  5JPH A;  1P4N A;  4CAF A;  4C2Y A;  4X2T A;  1Z4E A;  3MRU A;  1QQ9 A;  1SQH A;  2POK A;  4P6Y A;  2QYV A;  1XFO A;  4UIA A;  4NGN A;  1LCP A;  2OB0 A;  3TCV A;  2P6G A;  1S7N A;  1PU9 A;  3KQX A;  1ARM A;  2I00 A;  2XEJ A;  2Z3P A;  3G8W A;  1K4J A;  2JDC A;  1QSR A;  2ODF A;  3D7D A;  4NCZ A;  3BXM A;  3W6S A;  4DYO A;  1TKH A;  1ON0 A;  2QEC A;  4DNC A;  2B5G A;  1YVK A;  2AE6 A;  2PJ9 A;  3D3S A;  4F8Z A;  2QIR A;  3FRM A;  4DUK A;  5A27 A;  4H2K A;  4ZY2 A;  4CYQ A;  4JZ0 A;  4YWY A;  1LRZ A;  3FEC A;  4XNH B;  1ZO0 A;  3CDX A;  4OC0 A;  2XEF A;  4UCP A;  4MFQ A;  1M4G A;  5G1Z A;  4KVO E;  4F6A A;  4CAE A;  1CG2 A;  4OAE A;  3IIB A;  3KR5 A;  2GIV A;  5EMI A;  2EUI A;  5ELY A;  3B3V A;  4XPD B;  1ZLI A;  4IAV A;  4P10 A;  1AUG A;  2B5G B;  1B87 A;  2QML A;  5LRG A;  2ZOF A;  1Y9K A; 
#chains in the Genus database with same CATH homology
 4AVB A;  3QB8 A;  2Q44 A;  3BJ8 A;  2JDD A;  2GAN A;  3N7Z A;  4NSQ A;  5E96 A;  3PP9 A;  4KUA A;  3PZJ A;  2J8R A;  2P0W A;  4PK2 A;  4QB9 A;  1CM0 A;  4RI1 A;  1Q2Y A;  4YRH A;  3LOD A;  1YRE A;  2K5T A;  4C2Z A;  2I79 A;  3SXO A;  4I49 A;  5F46 A;  4F0Y A;  4B10 A;  4AVA A;  1XEB A;  1Y9W A;  2FXF A;  1S5K A;  3TO9 A;  4B14 A;  1Z4R A;  2B3V A;  2OZG A;  3V8I A;  1TIQ A;  4C7I A;  1XIX A;  4GS4 A;  2EVN A;  4U9Y A;  4NXY A;  1NMT A;  3W6X A;  2BSW A;  4JLY A;  5I0C A;  4CGM A;  4KOY A;  2OH1 A;  1I21 A;  2YND A;  4MFJ A;  1KUY A;  2REF A;  3OWC A;  4MI4 A;  4MY3 A;  3W6S A;  4JJX A;  4UCM A;  2FIW A;  5ISV A;  1Q2C A;  2WSA A;  5FVJ A;  3TOA A;  2AJ6 A;  3TO7 A;  2B4B A;  2P6E A;  3JTK A;  4QUS A;  1VKC A;  3NE7 A;  1S7F A;  2VBQ A;  2R98 A;  4HNX B;  1YGH A;  2VZY A;  3B8G A;  1KZF A;  1L0C A;  4JXQ A;  5CNP A;  4MFZ A;  5BWA B;  4KZT A;  2GE3 A;  3R9F A;  4FD5 A;  3D8P A;  4KOV A;  2RC4 A;  4R3K A;  4XPK A;  1MJA A;  5C82 A;  4MY0 A;  4CAW A;  4MFP A;  4UWI A;  2PQ8 A;  2ZPA A;  5IV0 A;  2KCW A;  2R8V A;  2DPS A;  4C7H A;  2HUZ A;  3T90 A;  4BMH A;  3FB3 A;  4IUS A;  4KVX A;  2ZW7 A;  1MK4 A;  4HNY B;  2WPX A;  1KUV A;  2Q4V A;  3FIX A;  5HH1 A;  1GHE A;  2CNS A;  4CGN A;  3DDD A;  4A30 A;  1V0C A;  1VHS A;  2B3U A;  1RO5 A;  4BBH A;  4UFW A;  3GKR A;  4H89 A;  2FCK A;  4KOS A;  2ZW6 A;  4HNW B;  3S6G A;  4PV6 A;  2R1I A;  3WR7 A;  4B11 A;  3I3G A;  3H4Q A;  5AG5 A;  1XMT A;  1WWZ A;  4EVY A;  1Y7R A;  2ZW4 A;  4A32 A;  2A4N A;  2VXK A;  5KTA A;  5F47 A;  1N71 A;  3S6F A;  4J3G A;  1WK4 A;  3C26 A;  2PRB A;  4JXR A;  2DPT A;  5G22 A;  4B5O A;  4KSA A;  5IX3 A;  4JD6 A;  2C27 A;  1IIC A;  1QST A;  3GY9 A;  4PSX A;  1YR0 A;  3GYA A;  4KOT A;  1M44 A;  3DSB A;  4F0X A;  2VEZ A;  1YLE A;  4RS2 A;  4CRZ B;  5AGE A;  1IB1 E;  3IU2 A;  3DR8 A;  2WUU A;  1I1D A;  1R57 A;  1XE4 A;  4Y49 C;  4UA3 A;  1M1D A;  2G3T A;  4B5P A;  1S60 A;  3R9E A;  3R95 A;  4UWJ A;  3EC4 A;  1M4I A;  4K30 A;  2DXQ A;  4R9M A;  1XF8 A;  2VI7 A;  1BO4 A;  5J8F A;  5A28 A;  3VWE A;  2CNT A;  2J8M A;  3G3S A;  3MGD A;  4KVM E;  1NE9 A;  2CNM A;  2PC1 A;  4B5P B;  1QSM A;  2PR8 A;  2WPW A;  4Q38 A;  4Q36 A;  2OZH A;  4AB7 A;  2Z3M A;  2X7B A;  4FD7 A;  4R87 A;  3RYO A;  2ARH A;  2HQY A;  3F5B A;  4KLW A;  5KTD A;  1YK3 A;  2Z11 A;  5EC4 A;  2B58 A;  2YNC C;  4AG7 A;  4UFV A;  3TO6 A;  3F0A A;  4R57 A;  3TTH A;  4CS0 B;  2G3A A;  2FS5 A;  2CY2 A;  2FSR A;  1PUA A;  2FE7 A;  3S6K A;  5AG4 A;  4OLL A;  1IYL A;  2J8N A;  3W91 A;  3T9Y A;  4KLV A;  4A33 A;  5JQ4 A;  1Z9U A;  2Z3K A;  4CYO A;  2Y0M A;  4KOX A;  3IWG A;  1YVO A;  5G20 A;  2Z3O A;  4JWP A;  4H6U A;  1RXT A;  1I12 A;  4ORF A;  3PGP A;  2Z3L A;  1KUX A;  4E0A A;  5HMN A;  3BJ7 A;  3E0K A;  3QAH A;  1M4D A;  2BL1 A;  2FL4 A;  4NF1 A;  4KUB A;  2PR1 A;  3CXQ A;  4U9Z A;  4CGO A;  4LX9 A;  2Q0Y A;  4MBU A;  1J4J A;  2D4P A;  4CYP A;  4E2A A;  2Z3N A;  4UCN A;  5J8C A;  1Q2D A;  4UBR A;  2Q04 A;  2ATR A;  4L89 A;  1S7L A;  3BLN A;  4CGL A;  3I9S A;  3DNS A;  2G0B A;  4MHD A;  4PK3 A;  4R3L A;  1U6M A;  4Y49 B;  4AVC A;  3A9L A;  3IWE A;  3JUW A;  4MFK A;  1P0H A;  3H5Z A;  4IF5 A;  1YX0 A;  4KOR A;  5DWN A;  2FIA A;  2HV2 A;  5H86 A;  3KKW A;  3S6H A;  2NMT A;  4LUA A;  5EBV A;  2ZW5 A;  5KTC A;  1S3Z A;  4KOU A;  4B12 A;  2PSW A;  3FNC A;  4CAX A;  2P6F A;  1IID A;  1MJB A;  2JLM A;  4CGP A;  2YNC A;  3FYN A;  3LD2 A;  3CXS A;  3EO4 A;  4PSW A;  2CXA A;  4OAD A;  2OZU A;  3R1K A;  1BOB A;  2D4O A;  5F48 A;  3F8K A;  3SHP A;  2VQY A;  2YNE A;  3D2P A;  2F5I A;  3CXP A;  4CRY B;  4L8A A;  5IB0 A;  2O28 A;  2REE A;  3TE4 A;  2Z10 A;  2BUE A;  3FBU A;  5F49 A;  3D2M A;  4M3S A;  1UFH A;  3K9U A;  1NSL A;  4XNH C;  1OZP A;  4ZBG A;  3EXN A;  2R7H A;  3TFY A;  2VZZ A;  4YFJ A;  4YGO A;  4KS9 A;  3IU1 A;  4E8O A;  4U5Y A;  4XPD C;  5H84 A;  3UY5 A;  3ZJ0 A;  3P2F A;  4A95 A;  1QSN A;  4QBJ A;  1FY7 A;  1CJW A;  4ZGY B;  4UFX A;  4C68 A;  1B6B A;  5DWM A;  2FT0 A;  2YGW A;  3EFA A;  4FD4 A;  3IGR A;  4II9 A;  1MJ9 A;  2PDO A;  2Z0Z A;  4KSF A;  3TT2 A;  3VWD A;  4MFL A;  1IYK A;  3TOB A;  3DR6 A;  3EY5 A;  5AG7 A;  5GCN A;  4A31 A;  4QC6 A;  4H6Z A;  2BEI A;  3R96 A;  4X5K A;  1QSO A;  2H5M A;  5G21 A;  2ZXV A;  2B4D A;  2Q4Y A;  4KOW A;  3SXN A;  4NEX A;  1S7K A;  4ONU A;  4CAV A;  3P2H A;  4A2Z A;  4CYN A;  4AG9 A;  4HKF A;  2OU2 A;  4XPL A;  2Q7B A;  3FXT A;  3JVN A;  4B13 A;  2JEV A;  4QVT A;  5AG6 A;  5C88 A;  2B4D B;  3R9G A;  4M85 A;  4FD6 A;  4MJ8 A;  3ZZI A;  4C2X A;  5JPH A;  2IL4 A;  1P4N A;  4CAF A;  4C2Y A;  1Z4E A;  1SQH A;  2OB0 A;  3TCV A;  2P6G A;  1S7N A;  1PU9 A;  2I00 A;  2Z3P A;  3G8W A;  1K4J A;  2JDC A;  1QSR A;  4NCZ A;  2QEC A;  1ON0 A;  4DNC A;  2B5G A;  1YVK A;  2AE6 A;  3D3S A;  2QIR A;  3FRM A;  5A27 A;  4CYQ A;  1LRZ A;  4XNH B;  1ZO0 A;  4UCP A;  4MFQ A;  1M4G A;  5G1Z A;  4KVO E;  4F6A A;  4CAE A;  4OAE A;  2GIV A;  2EUI A;  4XPD B;  2B5G B;  2QML A;  1B87 A;  1Y9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...