4B13A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 25)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Antimalarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b13A00
5G20A 2YNCA 4C68A 4CGLA 4B13A 4UCMA 4B14A 4BBHA 5A28A 4A30A 4UFVA 4A2ZA 2YNDA 4C7HA 4UCNA 4CYOA 4CAEA 5AG5A 4C2ZA 4A33A 5AG7A 5G1ZA 4CGMA 3IU2A 4B12A 2YNEA 5AGEA 4A32A 5A27A 4CYQA 5AG4A 4CAFA 4UCPA 4A95A 4CGPA 4CGNA 4B10A 4C7IA 4C2YA 4CYNA 4UFXA 4CYPA 4CGOA 5G22A 3IU1A 4C2XA 3H5ZA 5G21A 2WUUA 4A31A 4UFWA 5AG6A 3IWEA 3JTKA 4B11A 2YNCC 2WSAA
chains in the Genus database with same CATH superfamily
1PYTB 4KOTA 4CGLA 1HDQA 2J9AA 1XJOA 2Q7SA 4R76A 3DDDA 3IFEA 3SXOA 3UY5A 3BI0A 2JLMA 4PV6A 4Q36A 3RZAA 4CYOA 3FH4A 5AG5A 3KQZA 3SI1A 1BOBA 1Z8LA 4KOXA 3WC6A 2QMLA 3F8KA 2ZOGA 4C2ZA 2IJZA 2Q04A 3D68A 1IYLA 3LODA 5CBMA 4KOUA 2BSWA 4UIBA 3LD2A 4OIWA 4HNXB 5JH9A 3BLNA 3R1KA 3SJXA 4OIDA 4ZYQA 4MJ8A 2ATRA 5HVGA 1EE3P 3B7IA 1VGYA 1DE4C 1I21A 2IL4A 2I79A 3K9UA 4DYOA 1NSLA 4P6YA 2PIYA 4H6UA 4P45A 3ZZIA 2KCWA 4MRIA 1ON0A 2WYRA 4P10A 3OWCA 2FIAA 2DF5A 2OZHA 2Q0YA 3EC4A 2PJ7A 1Q2DA 2Q43A 2BEIA 2P6GA 3GY9A 4G1PA 1LFWA 5KTCA 1R57A 3H8GA 1Z8WA 2YNDA 4KUAA 3FBUA 3NH8A 2OR4A 4OP4A 5THWA 4BMHA 3TX8A 5DWNA 4GS4A 1DTDA 1XFOA 1NMTA 2C6GA 5F09A 1M1DA 2R7HA 2Z3PA 4X5KA 2AFWA 3B3VA 4MHDA 3S6KA 2DXQA 5KTDA 1CPXA 4CAFA 2ZPAA 1JQGA 4UCPA 1FNOA 3TFYA 1KUYA 1VIXA 3JRUA 4KOVA 1ZG9A 3EXNA 3BXMA 5LYFA 3ISXA 3R96A 5KTAA 1CP7A 3CXPA 3SJFA 4AB7A 4ORFA 5G21A 5LRGA 1XIXA 1YR0A 5LYLA 4R6TA 3TC8A 1MJBA 2JEWA 1ELLP 2XEFA 3IWWA 4LX9A 2PC1A 3LMSA 3T8WA 3FMCA 2PCUA 3D67A 2Z0ZA 4FD4A 4NCZA 2BL1A 4K3NA 4C7HA 2RFHA 5HH1A 1CBXA 3D2PA 3S9MA 1TXRA 2WZNA 4B12A 2CY2A 2VZYA 4MI4A 2ZXVA 3SJGA 1S7KA 5A27A 5LYDA 4OAEA 2Q51A 4AVCA 4A37A 3FXTA 2FXFA 2PJ8A 1GHEA 2VXKA 4FD5A 2JEVA 3F0AA 4PXBA 2AFOA 4Y49C 5I4MA 4IUSA 4U5YA 5G22A 4NGTA 1Z8XA 4NGRA 3VH9A 3GB0A 1U6MA 3A9LA 1QMUA 2EVNA 2PJ3A 2IQ6A 4KOWA 3MRUA 2ZW6A 3PB4X 4NGSA 4GM5A 3FF3A 4ONUA 4IK2A 3ISZA 4GXHA 1I1DA 2PR8A 5D8NA 5DWMA 1QSMA 4ZX9A 1IIDA 3GYAA 2PRQA 4XPLA 2YNEA 1YLEA 2CNMA 3RBUA 3RYOA 4CS0B 1S7NA 3CXQA 2Z3MA 2AFMA 4MFLA 4CYQA 5AG4A 4F8ZA 3NE7A 4MFJA 4ONWA 4NSQA 4PXDA 5F46A 1Y9KA 2X7BA 3CPAA 4H6ZA 4Z65A 2FE7A 1YVKA 3D7GA 1KWMA 1PU9A 2PJ9A 2BOAA 4X2TA 1IY7A 4IAVA 4A31A 2ZEMA 5AG6A 4UA3A 2JBJA 5AGEA 5G20A 1X10A 5ISVA 3EO4A 2RB7A 3T9YA 4OC0A 5A28A 3PBEA 4QVTA 4JXQA 4NGQA 1F57A 2ODFA 4ZBGA 1JWQA 3KASA 4UCNA 3PFOA 4KUBA 1YGHA 4UEEA 2REEA 4NF1A 2J8MA 5AG7A 4HPSA 2HUZA 1KZFA 2ZW7A 2Q7BA 4UEZA 2O28A 2OZGA 2ZENA 2PJAA 3FYNA 2GU2A 2Q44A 4HNWB 1ZLIA 2AFXA 4OMEA 2VZZA 1KUXA 3TO6A 1YREA 4KZTA 1MJ9A 2Q4ZA 3PRTA 2PJ6A 4QB9A 3VWDA 4MBUA 3PB8X 1YX0A 3FEEA 4P4EA 3PB9X 4KVOE 4LQGA 3ZJ0A 2ZEEA 4MY0A 4X8IA 3R9EA 2EUIA 2PJ1A 4C68A 3PGPA 1Y0YA 2AJ6A 1YSJA 3K2KA 1P0HA 1SQHA 4Q38A 2YGWA 2Z3LA 4UEFA 5CPAA 2ZELA 4OC2A 4ZY2A 4PQAA 4UIAA 1NE9A 3TT2A 4JXRA 5G1ZA 1QSRA 1XBUA 3VATA 4E0AA 3LWUA 2R1IA 4Q7AA 1YQEA 4EWTA 1M4IA 1XRYA 2ARHA 5F49A 4CAVA 4FAIA 2C27A 3EY5A 2VL1A 3E0KA 3MGDA 3BJ8A 1Y0RA 4OC5A 4RI1A 3IO1A 1J4JA 1LAPA 5IX3A 1IICA 4AG7A 4F6AA 3S6FA 4P44A 5EC4A 2PIZA 1P4NA 4RUHA 2P0WA 1BPMA 2OZUA 3CZXA 4II9A 2B3VA 2PQ8A 4OADA 4R87A 5JPHA 2B5GA 5GCNA 2HC9A 3VWEA 1KUVA 5K8OA 1NSAA 1FY7A 4NXYA 1Z4EA 3KHXA 4ZY0A 2BUEA 1Y9WA 2QYVA 2R8VA 3IU2A 4R3KA 1YW4A 1YVOA 3IEHA 2PJ2A 4AXVA 5HXDA 2Z3OA 5HMNA 1CG2A 1BAVA 3PZJA 4JWPA 2EO8A 3D7DA 2D4PA 4YGOA 4KS9A 4AVBA 4NEXA 4MFZA 3GUXA 4EMEA 3CT9A 1VKCA 3N5FA 1RO5A 4W9YA 4A2ZA 5K8MA 1QSTA 2V8HA 3KZWA 2GE3A 3FNCA 5HVHA 4FD7A 1RTQA 2CIJA 4R7MA 2C6CA 1QSNA 3G8WA 4DJLA 4M6IA 4QC6A 4MHPA 5ELYA 4R8FA 3S9NA 2EK8A 2F5IA 2I00A 4JD6A 4FBEA 1LCPA 2DPSA 2B3UA 1AYEA 2XEIA 2ZOFA 4M3SA 4TNUA 4C2YA 2QJ8A 2P6FA 4UFXA 4IHMA 4U9ZA 3IU1A 2VBQA 4EVYA 2EBJA 1A2ZA 3PEIA 3NE8A 2PE3A 3B35A 2PVVA 5K8PA 1Z2LA 4JLYA 3SI2A 5IB0A 1PCAA 2WPXA 1XMTA 1UFHA 4AG9A 3FEDA 4J3GA 3TCVA 5LRKA 4ZX8A 3IIBA 3FRMA 4IF5A 4OC4A 4UWIA 2AFSA 2Z3KA 2FL4A 1ZO0A 2VEZA 3PB6X 1BO4A 5C82A 1QQ9A 1OBRA 3DNSA 3V38A 2PJBA 3HLPA 3JUWA 4UWJA 4Y49B 3QNVA 3KQXA 2QVPA 3B3WA 4BD9A 5JQ4A 2PJ5A 5LRJA 4JZ0A 2V77A 4MY3A 4MHYA 4PXCA 2I3CA 1ZG7A 2P6EA 2ZEOA 3P2HA 4KVME 4NJRA 4H2KA 2ZW4A 2GLJA 2OOTA 4C2XA 2DPTA 4UFWA 4P4IA 5CNPA 3RNZA 3TOBA 2J8RA 2PSWA 2WSAA 3L2NA 4KSAA 1HDUA 2B5GB 4M85A 4O23A 4XPKA 2HV2A 5J8FA 4KORA 3D3SA 3KR4A 1YLOA 1B87A 1ZG8A 1LRZA 3D66A 4F9UA 2ANPA 2Z11A 2Q4VA 1IYKA 5I0CA 2G9DA 2ABZA 3KR5A 2FT0A 5J1QA 1RXTA 1M44A 2V8DA 2K5TA 2XEJA 2FIWA 2HB6A 3B8GA 2NYQA 1WK4A 5JGFA 1XOVA 2J8NA 4XNHC 4CGPA 1MK4A 2QIRA 1CPSA 2FSRA 3B3CA 3H5ZA 3I1UA 3QAYA 4UBRA 4A38A 1XEBA 1AUGA 1TF9A 2YNCC 3NH5A 2R98A 2PJ4A 3IWGA 1V0CA 2OU2A 4FWUA 4P4FA 2GREA 4CAWA 3IGRA 1F2PA 4R3LA 7CPAA 4F0XA 1VHEA 1S5KA 2IMOA 1GYTA 4R57A 3KL9A 4FUUA 1Y7RA 2VI7A 2CTCA 3NA6A 3DR6A 3S6HA 3TTHA 1Z8TA 2FVGA 4XNHB 4QUSA 4R9MA 4MFKA 1S7FA 4ZY1A 5C88A 1BLLE 3KI9A 3WR7A 2XEGA 1M4GA 4KVXA 2CF4A 2FS5A 1TKFA 4NFRA 4OC3A 3WC7A 4BINA 4DUKA 4XPDC 4NGPA 2AE6A 5IB9A 1IOFA 2PRBA 4KSIA 4B11A 2JBKA 4CRZB 2NSMA 4YRHA 1Q2YA 2FCKA 1UWYA 3PBBA 3SI0A 3RO0A 4WJBA 3C26A 5K8NA 3R95A 1FT7A 1BPNA 4P4JA 3FJUA 3K9TA 4NGNA 4OLLA 2Z10A 2H5MA 4KLVA 3LACA 4KSFA 3WT4A 4A33A 4K30A 2V8GA 2Z3NA 3QB8A 3TOAA 2GIVA 5J8CA 4PXEA 4UF4A 1S3ZA 3MN8A 1XMBA 2OB0A 4AVAA 3SJEA 5F47A 4XPDB 1YMEA 1XE4A 3FECA 5FVJA 4CGNA 3V8IA 2OH1A 1IOIA 3BI1A 3FB3A 3WABA 4X3RA 2AFUA 1L0CA 3HUVA 3IWEA 3JTKA 4OKOA 4A94A 2VQYA 2F8HA 4MCQA 4B5PA 1Z9UA 2BO9A 3H4QA 5E96A 3WC5A 4B14A 3PB7X 1ELMP 2G0BA 3R9FA 1S60A 2JDDA 4OC1A 1B6BA 1M4LA 2POKA 4H89A 2Q4YA 4P4BA 1VHOA 5H86A 1Q7LA 4JYWA 2B4DA 5H84A 1ARLA 2ZEPA 4MXUA 3QAHA 5HVFA 2C1CA 2NMTA 3D4UA 3CPXA 3TO9A 3N7ZA 5IV0A 4KOSA 1OZPA 3FVLA 4F9VA 3TE4A 3IJ3A 3I3GA 4PPZA 2ZEHA 3D7HA 4MFPA 2B4BA 4MHNA 2AFZA 4B10A 1N71A 4LQ6A 4CGOA 3S9LA 1Y7EA 4CAXA 2WUUA 1HEEA 4I49A 2YNCA 3PP9A 1Z5RA 1LOKA 4QBJA 4L89A 4B13A 2O53A 8CPAA 1CX8A 2PJCA 2EK9A 3KHZA 4RN7A 3GKRA 4CPAA 4DNCA 2B58A 4P4DA 4PK2A 4B6ZA 2G3TA 4YWYA 3G3SA 4MCPA 1PUAA 5F48A 4PSWA 1X12A 3JVNA 2WPWA 3CDXA 4L8AA 2CNSA 1I12A 4PK3A 2PDOA 1K4JA 1Z4RA 1CP6A 4WWVA 4EFDA 1QSOA 4RS2A 3FX6A 2CNTA 2G3AA 2ZEDA 4CYPA 1TF8A 3DR8A 3CXSA 1AMPA 4KOYA 1ARMA 1YW6A 4UCMA 3R9GA 1Q2CA 3F5BA 1IGBA 1LANA 3DGVA 4NJQA 4HNYB 1CM0A 4BBHA 2Y0MA 1TIQA 4MFQA 1F2OA 4FD6A 1XF8A 3P2FA 4UFVA 1IU8A 4MCSA 3RAMA 1TKHA 3I9SA 4JJXA 2DEAA 2PR1A 1WWZA 2GFQA 2HQYA 4YFJA 3T90A 4ZI6A 3GLJA 4KLWA 4A32A 3VARA 3D8PA 2RC4A 1R43A 2QECA 2F7VA 2ZEFA 4HKFA 4E2AA 4M6HA 5JM6A 1YK3A 2EWBA 3EFAA 4C7IA 4NGMA 4CYNA 5D29A 2CXAA 2A4NA 2C6PA 3BJ7A 3SHPA 4A39A 4MHZA 3V7ZA 1MJAA 1IB1E 1H8LA 2BCOA 3NH4A 3PFEA 3W91A 4B5PB 4LUAA 4MCRA 2V8VA 3B3TA 5EBVA 2GLFA 3FIXA 1S7LA 5DS0A 4F0YA 2JDCA 3B2YA 5EMIA 2GANA 3IC1A 3BHXA 4A30A 4ZGYB 3D7FA 3D2MA 2ZEGA 3DSBA 2CTBA 2PVWA 2ZW5A 3SXNA 3B3SA 4YU9A 3KGQA 3W6SA 4CAEA 2B4DB 2O4HA 3DLJA 1M4DA 3NFZA 4U9YA 4E8OA 4CGMA 1VHSA 1R3NA 3S6GA 4CRYB 5BWAB 3KKWA 4PSXA 4A95A 6CPAA 4MMOA 5LYIA 2D4OA 3GIUA 3H8FA 1LAMA 1ZLHA 1CJWA 2REFA 3H8EA 4M6GA 1TKJA 4TWEA 3W6XA 3TO7A 2PJ0A 4B5OA
chains in the Genus database with same CATH topology
4KOTA 4CGLA 3DDDA 3SXOA 3UY5A 2JLMA 4PV6A 4Q36A 4CYOA 5AG5A 1BOBA 4KOXA 4C2ZA 2QMLA 3F8KA 2Q04A 1IYLA 3LODA 4KOUA 2BSWA 3LD2A 4HNXB 3BLNA 3R1KA 4MJ8A 2ATRA 1I21A 2IL4A 2I79A 3K9UA 1NSLA 4H6UA 3ZZIA 2KCWA 1ON0A 3OWCA 2FIAA 2OZHA 2Q0YA 3EC4A 1Q2DA 2BEIA 2P6GA 3GY9A 5KTCA 1R57A 2YNDA 4KUAA 3FBUA 4BMHA 5DWNA 4GS4A 1NMTA 1M1DA 2R7HA 2Z3PA 4X5KA 4MHDA 3S6KA 2DXQA 5KTDA 4CAFA 2ZPAA 4UCPA 3TFYA 1KUYA 4KOVA 3EXNA 5KTAA 3R96A 3CXPA 4AB7A 4ORFA 5G21A 1XIXA 1YR0A 1MJBA 4LX9A 2PC1A 2Z0ZA 4FD4A 4NCZA 2BL1A 4C7HA 5HH1A 3D2PA 4B12A 2CY2A 2VZYA 4MI4A 2ZXVA 1S7KA 5A27A 4OAEA 4AVCA 3FXTA 2FXFA 1GHEA 2VXKA 4FD5A 2JEVA 3F0AA 4Y49C 4U5YA 5G22A 1U6MA 3A9LA 2EVNA 4KOWA 2ZW6A 4ONUA 1I1DA 2PR8A 5DWMA 1QSMA 1IIDA 3GYAA 4XPLA 2YNEA 1YLEA 2CNMA 3RYOA 4CS0B 4CYQA 1S7NA 3CXQA 2Z3MA 4MFLA 5AG4A 3NE7A 4MFJA 4NSQA 5F46A 1Y9KA 2X7BA 4H6ZA 2FE7A 1YVKA 1PU9A 4A31A 5AG6A 4UA3A 5AGEA 5G20A 5ISVA 3EO4A 3T9YA 5A28A 4QVTA 4JXQA 4ZBGA 4UCNA 4KUBA 1YGHA 2REEA 4NF1A 2J8MA 5AG7A 2HUZA 1KZFA 2ZW7A 2Q7BA 2O28A 2OZGA 3FYNA 2Q44A 4HNWB 2VZZA 1KUXA 3TO6A 1YREA 4KZTA 1MJ9A 4QB9A 3VWDA 4MBUA 3ZJ0A 1YX0A 4KVOE 4MY0A 3R9EA 2EUIA 4C68A 3PGPA 2AJ6A 1P0HA 1SQHA 4Q38A 2YGWA 2Z3LA 3TT2A 1NE9A 4JXRA 5G1ZA 1QSRA 4E0AA 2R1IA 1M4IA 2ARHA 5F49A 4CAVA 2C27A 3EY5A 3E0KA 3MGDA 3BJ8A 4RI1A 1J4JA 5IX3A 1IICA 4AG7A 4F6AA 3S6FA 5EC4A 1P4NA 2P0WA 2OZUA 4II9A 2B3VA 2PQ8A 4OADA 4R87A 5JPHA 2B5GA 5GCNA 3VWEA 1KUVA 1FY7A 4NXYA 1Z4EA 2BUEA 1Y9WA 3IU2A 2R8VA 4R3KA 1YVOA 2Z3OA 5HMNA 3PZJA 4JWPA 2D4PA 4YGOA 4KS9A 4AVBA 4NEXA 4MFZA 1VKCA 1RO5A 4A2ZA 1QSTA 2GE3A 3FNCA 4FD7A 3G8WA 1QSNA 4QC6A 2F5IA 2I00A 4JD6A 2DPSA 2B3UA 4M3SA 4C2YA 2P6FA 4UFXA 4U9ZA 3IU1A 2VBQA 4EVYA 4JLYA 5IB0A 2WPXA 1XMTA 1UFHA 4AG9A 4J3GA 3TCVA 3FRMA 4IF5A 4UWIA 2Z3KA 5C82A 2FL4A 1ZO0A 2VEZA 1BO4A 3DNSA 4UWJA 3JUWA 4Y49B 5JQ4A 4MY3A 4KVME 2P6EA 3P2HA 4C2XA 2ZW4A 2DPTA 4UFWA 5CNPA 3TOBA 2J8RA 2PSWA 2WSAA 4KSAA 2B5GB 4M85A 4XPKA 2HV2A 5J8FA 4KORA 3D3SA 1B87A 1LRZA 2Z11A 5I0CA 2Q4VA 1IYKA 2FT0A 1RXTA 1M44A 2K5TA 2FIWA 3B8GA 1WK4A 2J8NA 4XNHC 4CGPA 1MK4A 2QIRA 2FSRA 3H5ZA 4UBRA 1XEBA 2YNCC 2R98A 3IWGA 1V0CA 2OU2A 4CAWA 3IGRA 4R3LA 4F0XA 1S5KA 4R57A 1Y7RA 2VI7A 3DR6A 3S6HA 3TTHA 4XNHB 4QUSA 4R9MA 4MFKA 1S7FA 5C88A 3WR7A 1M4GA 4KVXA 2FS5A 4XPDC 2AE6A 2PRBA 4CRZB 4B11A 4YRHA 1Q2YA 2FCKA 3C26A 3R95A 4OLLA 2Z10A 2H5MA 4KLVA 4KSFA 4A33A 4K30A 2Z3NA 3QB8A 3TOAA 2GIVA 5J8CA 1S3ZA 2OB0A 4AVAA 5F47A 4XPDB 1XE4A 5FVJA 4CGNA 3V8IA 2OH1A 3FB3A 1L0CA 3IWEA 3JTKA 2VQYA 4B5PA 1Z9UA 3H4QA 5E96A 4B14A 2G0BA 3R9FA 1S60A 2JDDA 1B6BA 4H89A 2Q4YA 5H86A 2B4DA 5H84A 3QAHA 2NMTA 3TO9A 3N7ZA 5IV0A 4KOSA 1OZPA 3TE4A 3I3GA 4MFPA 2B4BA 4B10A 1N71A 4CGOA 4CAXA 2WUUA 4I49A 2YNCA 3PP9A 4QBJA 4L89A 4B13A 3GKRA 4DNCA 2B58A 4PK2A 2G3TA 3G3SA 1PUAA 5F48A 4PSWA 3JVNA 2WPWA 4L8AA 2CNSA 1I12A 4PK3A 2PDOA 1K4JA 1Z4RA 1QSOA 4RS2A 2CNTA 2G3AA 4CYPA 3DR8A 3CXSA 4KOYA 4UCMA 3R9GA 1Q2CA 3F5BA 4HNYB 1CM0A 4BBHA 2Y0MA 1TIQA 4MFQA 4FD6A 1XF8A 3P2FA 4UFVA 3I9SA 4JJXA 2PR1A 1WWZA 2HQYA 4YFJA 3T90A 4KLWA 4A32A 3D8PA 2RC4A 2QECA 4HKFA 4E2AA 1YK3A 3EFAA 4C7IA 4CYNA 2CXAA 2A4NA 3BJ7A 3SHPA 1MJAA 1IB1E 3W91A 4B5PB 4LUAA 5EBVA 3FIXA 1S7LA 4F0YA 2JDCA 2GANA 4A30A 4ZGYB 3D2MA 3DSBA 2ZW5A 3SXNA 3W6SA 4CAEA 2B4DB 4U9YA 4E8OA 1M4DA 4CGMA 1VHSA 3S6GA 4CRYB 5BWAB 3KKWA 4PSXA 4A95A 2D4OA 2REFA 1CJWA 3W6XA 3TO7A 4IUSA 4B5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G20 A;  2YNC A;  4C68 A;  4CGL A;  4B13 A;  4UCM A;  4B14 A;  4BBH A;  5A28 A;  4A30 A;  4UFV A;  4A2Z A;  2YND A;  4C7H A;  4UCN A;  4CYO A;  4CAE A;  5AG5 A;  4C2Z A;  4A33 A;  5AG7 A;  5G1Z A;  4CGM A;  3IU2 A;  4B12 A;  2YNE A;  5AGE A;  4A32 A;  5A27 A;  4CYQ A;  5AG4 A;  4CAF A;  4UCP A;  4A95 A;  4CGP A;  4CGN A;  4B10 A;  4C7I A;  4C2Y A;  4CYN A;  4UFX A;  4CYP A;  4CGO A;  5G22 A;  3IU1 A;  4C2X A;  3H5Z A;  5G21 A;  2WUU A;  4A31 A;  4UFW A;  5AG6 A;  3IWE A;  3JTK A;  4B11 A;  2YNC C;  2WSA A; 
#chains in the Genus database with same CATH topology
 1PYT B;  4KOT A;  4CGL A;  1HDQ A;  2J9A A;  1XJO A;  2Q7S A;  4R76 A;  3DDD A;  3IFE A;  3SXO A;  3UY5 A;  3BI0 A;  2JLM A;  4PV6 A;  4Q36 A;  3RZA A;  4CYO A;  3FH4 A;  5AG5 A;  3KQZ A;  3SI1 A;  1BOB A;  1Z8L A;  4KOX A;  3WC6 A;  2QML A;  3F8K A;  2ZOG A;  4C2Z A;  2IJZ A;  2Q04 A;  3D68 A;  1IYL A;  3LOD A;  5CBM A;  4KOU A;  2BSW A;  4UIB A;  3LD2 A;  4OIW A;  4HNX B;  5JH9 A;  3BLN A;  3R1K A;  3SJX A;  4OID A;  4ZYQ A;  4MJ8 A;  2ATR A;  5HVG A;  1EE3 P;  3B7I A;  1VGY A;  1DE4 C;  1I21 A;  2IL4 A;  2I79 A;  3K9U A;  4DYO A;  1NSL A;  4P6Y A;  2PIY A;  4H6U A;  4P45 A;  3ZZI A;  2KCW A;  4MRI A;  1ON0 A;  2WYR A;  4P10 A;  3OWC A;  2FIA A;  2DF5 A;  2OZH A;  2Q0Y A;  3EC4 A;  2PJ7 A;  1Q2D A;  2Q43 A;  2BEI A;  2P6G A;  3GY9 A;  4G1P A;  1LFW A;  5KTC A;  1R57 A;  3H8G A;  1Z8W A;  2YND A;  4KUA A;  3FBU A;  3NH8 A;  2OR4 A;  4OP4 A;  5THW A;  4BMH A;  3TX8 A;  5DWN A;  4GS4 A;  1DTD A;  1XFO A;  1NMT A;  2C6G A;  5F09 A;  1M1D A;  2R7H A;  2Z3P A;  4X5K A;  2AFW A;  3B3V A;  4MHD A;  3S6K A;  2DXQ A;  5KTD A;  1CPX A;  4CAF A;  2ZPA A;  1JQG A;  4UCP A;  1FNO A;  3TFY A;  1KUY A;  1VIX A;  3JRU A;  4KOV A;  1ZG9 A;  3EXN A;  3BXM A;  5LYF A;  3ISX A;  3R96 A;  5KTA A;  1CP7 A;  3CXP A;  3SJF A;  4AB7 A;  4ORF A;  5G21 A;  5LRG A;  1XIX A;  1YR0 A;  5LYL A;  4R6T A;  3TC8 A;  1MJB A;  2JEW A;  1ELL P;  2XEF A;  3IWW A;  4LX9 A;  2PC1 A;  3LMS A;  3T8W A;  3FMC A;  2PCU A;  3D67 A;  2Z0Z A;  4FD4 A;  4NCZ A;  2BL1 A;  4K3N A;  4C7H A;  2RFH A;  5HH1 A;  1CBX A;  3D2P A;  3S9M A;  1TXR A;  2WZN A;  4B12 A;  2CY2 A;  2VZY A;  4MI4 A;  2ZXV A;  3SJG A;  1S7K A;  5A27 A;  5LYD A;  4OAE A;  2Q51 A;  4AVC A;  4A37 A;  3FXT A;  2FXF A;  2PJ8 A;  1GHE A;  2VXK A;  4FD5 A;  2JEV A;  3F0A A;  4PXB A;  2AFO A;  4Y49 C;  5I4M A;  4IUS A;  4U5Y A;  5G22 A;  4NGT A;  1Z8X A;  4NGR A;  3VH9 A;  3GB0 A;  1U6M A;  3A9L A;  1QMU A;  2EVN A;  2PJ3 A;  2IQ6 A;  4KOW A;  3MRU A;  2ZW6 A;  3PB4 X;  4NGS A;  4GM5 A;  3FF3 A;  4ONU A;  4IK2 A;  3ISZ A;  4GXH A;  1I1D A;  2PR8 A;  5D8N A;  5DWM A;  1QSM A;  4ZX9 A;  1IID A;  3GYA A;  2PRQ A;  4XPL A;  2YNE A;  1YLE A;  2CNM A;  3RBU A;  3RYO A;  4CS0 B;  1S7N A;  3CXQ A;  2Z3M A;  2AFM A;  4MFL A;  4CYQ A;  5AG4 A;  4F8Z A;  3NE7 A;  4MFJ A;  4ONW A;  4NSQ A;  4PXD A;  5F46 A;  1Y9K A;  2X7B A;  3CPA A;  4H6Z A;  4Z65 A;  2FE7 A;  1YVK A;  3D7G A;  1KWM A;  1PU9 A;  2PJ9 A;  2BOA A;  4X2T A;  1IY7 A;  4IAV A;  4A31 A;  2ZEM A;  5AG6 A;  4UA3 A;  2JBJ A;  5AGE A;  5G20 A;  1X10 A;  5ISV A;  3EO4 A;  2RB7 A;  3T9Y A;  4OC0 A;  5A28 A;  3PBE A;  4QVT A;  4JXQ A;  4NGQ A;  1F57 A;  2ODF A;  4ZBG A;  1JWQ A;  3KAS A;  4UCN A;  3PFO A;  4KUB A;  1YGH A;  4UEE A;  2REE A;  4NF1 A;  2J8M A;  5AG7 A;  4HPS A;  2HUZ A;  1KZF A;  2ZW7 A;  2Q7B A;  4UEZ A;  2O28 A;  2OZG A;  2ZEN A;  2PJA A;  3FYN A;  2GU2 A;  2Q44 A;  4HNW B;  1ZLI A;  2AFX A;  4OME A;  2VZZ A;  1KUX A;  3TO6 A;  1YRE A;  4KZT A;  1MJ9 A;  2Q4Z A;  3PRT A;  2PJ6 A;  4QB9 A;  3VWD A;  4MBU A;  3PB8 X;  1YX0 A;  3FEE A;  4P4E A;  3PB9 X;  4KVO E;  4LQG A;  3ZJ0 A;  2ZEE A;  4MY0 A;  4X8I A;  3R9E A;  2EUI A;  2PJ1 A;  4C68 A;  3PGP A;  1Y0Y A;  2AJ6 A;  1YSJ A;  3K2K A;  1P0H A;  1SQH A;  4Q38 A;  2YGW A;  2Z3L A;  4UEF A;  5CPA A;  2ZEL A;  4OC2 A;  4ZY2 A;  4PQA A;  4UIA A;  1NE9 A;  3TT2 A;  4JXR A;  5G1Z A;  1QSR A;  1XBU A;  3VAT A;  4E0A A;  3LWU A;  2R1I A;  4Q7A A;  1YQE A;  4EWT A;  1M4I A;  1XRY A;  2ARH A;  5F49 A;  4CAV A;  4FAI A;  2C27 A;  3EY5 A;  2VL1 A;  3E0K A;  3MGD A;  3BJ8 A;  1Y0R A;  4OC5 A;  4RI1 A;  3IO1 A;  1J4J A;  1LAP A;  5IX3 A;  1IIC A;  4AG7 A;  4F6A A;  3S6F A;  4P44 A;  5EC4 A;  2PIZ A;  1P4N A;  4RUH A;  2P0W A;  1BPM A;  2OZU A;  3CZX A;  4II9 A;  2B3V A;  2PQ8 A;  4OAD A;  4R87 A;  5JPH A;  2B5G A;  5GCN A;  2HC9 A;  3VWE A;  1KUV A;  5K8O A;  1NSA A;  1FY7 A;  4NXY A;  1Z4E A;  3KHX A;  4ZY0 A;  2BUE A;  1Y9W A;  2QYV A;  2R8V A;  3IU2 A;  4R3K A;  1YW4 A;  1YVO A;  3IEH A;  2PJ2 A;  4AXV A;  5HXD A;  2Z3O A;  5HMN A;  1CG2 A;  1BAV A;  3PZJ A;  4JWP A;  2EO8 A;  3D7D A;  2D4P A;  4YGO A;  4KS9 A;  4AVB A;  4NEX A;  4MFZ A;  3GUX A;  4EME A;  3CT9 A;  1VKC A;  3N5F A;  1RO5 A;  4W9Y A;  4A2Z A;  5K8M A;  1QST A;  2V8H A;  3KZW A;  2GE3 A;  3FNC A;  5HVH A;  4FD7 A;  1RTQ A;  2CIJ A;  4R7M A;  2C6C A;  1QSN A;  3G8W A;  4DJL A;  4M6I A;  4QC6 A;  4MHP A;  5ELY A;  4R8F A;  3S9N A;  2EK8 A;  2F5I A;  2I00 A;  4JD6 A;  4FBE A;  1LCP A;  2DPS A;  2B3U A;  1AYE A;  2XEI A;  2ZOF A;  4M3S A;  4TNU A;  4C2Y A;  2QJ8 A;  2P6F A;  4UFX A;  4IHM A;  4U9Z A;  3IU1 A;  2VBQ A;  4EVY A;  2EBJ A;  1A2Z A;  3PEI A;  3NE8 A;  2PE3 A;  3B35 A;  2PVV A;  5K8P A;  1Z2L A;  4JLY A;  3SI2 A;  5IB0 A;  1PCA A;  2WPX A;  1XMT A;  1UFH A;  4AG9 A;  3FED A;  4J3G A;  3TCV A;  5LRK A;  4ZX8 A;  3IIB A;  3FRM A;  4IF5 A;  4OC4 A;  4UWI A;  2AFS A;  2Z3K A;  2FL4 A;  1ZO0 A;  2VEZ A;  3PB6 X;  1BO4 A;  5C82 A;  1QQ9 A;  1OBR A;  3DNS A;  3V38 A;  2PJB A;  3HLP A;  3JUW A;  4UWJ A;  4Y49 B;  3QNV A;  3KQX A;  2QVP A;  3B3W A;  4BD9 A;  5JQ4 A;  2PJ5 A;  5LRJ A;  4JZ0 A;  2V77 A;  4MY3 A;  4MHY A;  4PXC A;  2I3C A;  1ZG7 A;  2P6E A;  2ZEO A;  3P2H A;  4KVM E;  4NJR A;  4H2K A;  2ZW4 A;  2GLJ A;  2OOT A;  4C2X A;  2DPT A;  4UFW A;  4P4I A;  5CNP A;  3RNZ A;  3TOB A;  2J8R A;  2PSW A;  2WSA A;  3L2N A;  4KSA A;  1HDU A;  2B5G B;  4M85 A;  4O23 A;  4XPK A;  2HV2 A;  5J8F A;  4KOR A;  3D3S A;  3KR4 A;  1YLO A;  1B87 A;  1ZG8 A;  1LRZ A;  3D66 A;  4F9U A;  2ANP A;  2Z11 A;  2Q4V A;  1IYK A;  5I0C A;  2G9D A;  2ABZ A;  3KR5 A;  2FT0 A;  5J1Q A;  1RXT A;  1M44 A;  2V8D A;  2K5T A;  2XEJ A;  2FIW A;  2HB6 A;  3B8G A;  2NYQ A;  1WK4 A;  5JGF A;  1XOV A;  2J8N A;  4XNH C;  4CGP A;  1MK4 A;  2QIR A;  1CPS A;  2FSR A;  3B3C A;  3H5Z A;  3I1U A;  3QAY A;  4UBR A;  4A38 A;  1XEB A;  1AUG A;  1TF9 A;  2YNC C;  3NH5 A;  2R98 A;  2PJ4 A;  3IWG A;  1V0C A;  2OU2 A;  4FWU A;  4P4F A;  2GRE A;  4CAW A;  3IGR A;  1F2P A;  4R3L A;  7CPA A;  4F0X A;  1VHE A;  1S5K A;  2IMO A;  1GYT A;  4R57 A;  3KL9 A;  4FUU A;  1Y7R A;  2VI7 A;  2CTC A;  3NA6 A;  3DR6 A;  3S6H A;  3TTH A;  1Z8T A;  2FVG A;  4XNH B;  4QUS A;  4R9M A;  4MFK A;  1S7F A;  4ZY1 A;  5C88 A;  1BLL E;  3KI9 A;  3WR7 A;  2XEG A;  1M4G A;  4KVX A;  2CF4 A;  2FS5 A;  1TKF A;  4NFR A;  4OC3 A;  3WC7 A;  4BIN A;  4DUK A;  4XPD C;  4NGP A;  2AE6 A;  5IB9 A;  1IOF A;  2PRB A;  4KSI A;  4B11 A;  2JBK A;  4CRZ B;  2NSM A;  4YRH A;  1Q2Y A;  2FCK A;  1UWY A;  3PBB A;  3SI0 A;  3RO0 A;  4WJB A;  3C26 A;  5K8N A;  3R95 A;  1FT7 A;  1BPN A;  4P4J A;  3FJU A;  3K9T A;  4NGN A;  4OLL A;  2Z10 A;  2H5M A;  4KLV A;  3LAC A;  4KSF A;  3WT4 A;  4A33 A;  4K30 A;  2V8G A;  2Z3N A;  3QB8 A;  3TOA A;  2GIV A;  5J8C A;  4PXE A;  4UF4 A;  1S3Z A;  3MN8 A;  1XMB A;  2OB0 A;  4AVA A;  3SJE A;  5F47 A;  4XPD B;  1YME A;  1XE4 A;  3FEC A;  5FVJ A;  4CGN A;  3V8I A;  2OH1 A;  1IOI A;  3BI1 A;  3FB3 A;  3WAB A;  4X3R A;  2AFU A;  1L0C A;  3HUV A;  3IWE A;  3JTK A;  4OKO A;  4A94 A;  2VQY A;  2F8H A;  4MCQ A;  4B5P A;  1Z9U A;  2BO9 A;  3H4Q A;  5E96 A;  3WC5 A;  4B14 A;  3PB7 X;  1ELM P;  2G0B A;  3R9F A;  1S60 A;  2JDD A;  4OC1 A;  1B6B A;  1M4L A;  2POK A;  4H89 A;  2Q4Y A;  4P4B A;  1VHO A;  5H86 A;  1Q7L A;  4JYW A;  2B4D A;  5H84 A;  1ARL A;  2ZEP A;  4MXU A;  3QAH A;  5HVF A;  2C1C A;  2NMT A;  3D4U A;  3CPX A;  3TO9 A;  3N7Z A;  5IV0 A;  4KOS A;  1OZP A;  3FVL A;  4F9V A;  3TE4 A;  3IJ3 A;  3I3G A;  4PPZ A;  2ZEH A;  3D7H A;  4MFP A;  2B4B A;  4MHN A;  2AFZ A;  4B10 A;  1N71 A;  4LQ6 A;  4CGO A;  3S9L A;  1Y7E A;  4CAX A;  2WUU A;  1HEE A;  4I49 A;  2YNC A;  3PP9 A;  1Z5R A;  1LOK A;  4QBJ A;  4L89 A;  4B13 A;  2O53 A;  8CPA A;  1CX8 A;  2PJC A;  2EK9 A;  3KHZ A;  4RN7 A;  3GKR A;  4CPA A;  4DNC A;  2B58 A;  4P4D A;  4PK2 A;  4B6Z A;  2G3T A;  4YWY A;  3G3S A;  4MCP A;  1PUA A;  5F48 A;  4PSW A;  1X12 A;  3JVN A;  2WPW A;  3CDX A;  4L8A A;  2CNS A;  1I12 A;  4PK3 A;  2PDO A;  1K4J A;  1Z4R A;  1CP6 A;  4WWV A;  4EFD A;  1QSO A;  4RS2 A;  3FX6 A;  2CNT A;  2G3A A;  2ZED A;  4CYP A;  1TF8 A;  3DR8 A;  3CXS A;  1AMP A;  4KOY A;  1ARM A;  1YW6 A;  4UCM A;  3R9G A;  1Q2C A;  3F5B A;  1IGB A;  1LAN A;  3DGV A;  4NJQ A;  4HNY B;  1CM0 A;  4BBH A;  2Y0M A;  1TIQ A;  4MFQ A;  1F2O A;  4FD6 A;  1XF8 A;  3P2F A;  4UFV A;  1IU8 A;  4MCS A;  3RAM A;  1TKH A;  3I9S A;  4JJX A;  2DEA A;  2PR1 A;  1WWZ A;  2GFQ A;  2HQY A;  4YFJ A;  3T90 A;  4ZI6 A;  3GLJ A;  4KLW A;  4A32 A;  3VAR A;  3D8P A;  2RC4 A;  1R43 A;  2QEC A;  2F7V A;  2ZEF A;  4HKF A;  4E2A A;  4M6H A;  5JM6 A;  1YK3 A;  2EWB A;  3EFA A;  4C7I A;  4NGM A;  4CYN A;  5D29 A;  2CXA A;  2A4N A;  2C6P A;  3BJ7 A;  3SHP A;  4A39 A;  4MHZ A;  3V7Z A;  1MJA A;  1IB1 E;  1H8L A;  2BCO A;  3NH4 A;  3PFE A;  3W91 A;  4B5P B;  4LUA A;  4MCR A;  2V8V A;  3B3T A;  5EBV A;  2GLF A;  3FIX A;  1S7L A;  5DS0 A;  4F0Y A;  2JDC A;  3B2Y A;  5EMI A;  2GAN A;  3IC1 A;  3BHX A;  4A30 A;  4ZGY B;  3D7F A;  3D2M A;  2ZEG A;  3DSB A;  2CTB A;  2PVW A;  2ZW5 A;  3SXN A;  3B3S A;  4YU9 A;  3KGQ A;  3W6S A;  4CAE A;  2B4D B;  2O4H A;  3DLJ A;  1M4D A;  3NFZ A;  4U9Y A;  4E8O A;  4CGM A;  1VHS A;  1R3N A;  3S6G A;  4CRY B;  5BWA B;  3KKW A;  4PSX A;  4A95 A;  6CPA A;  4MMO A;  5LYI A;  2D4O A;  3GIU A;  3H8F A;  1LAM A;  1ZLH A;  1CJW A;  2REF A;  3H8E A;  4M6G A;  1TKJ A;  4TWE A;  3W6X A;  3TO7 A;  2PJ0 A;  4B5O A; 
#chains in the Genus database with same CATH homology
 4KOT A;  4CGL A;  3DDD A;  3SXO A;  3UY5 A;  2JLM A;  4PV6 A;  4Q36 A;  4CYO A;  5AG5 A;  1BOB A;  4KOX A;  4C2Z A;  2QML A;  3F8K A;  2Q04 A;  1IYL A;  3LOD A;  4KOU A;  2BSW A;  3LD2 A;  4HNX B;  3BLN A;  3R1K A;  4MJ8 A;  2ATR A;  1I21 A;  2IL4 A;  2I79 A;  3K9U A;  1NSL A;  4H6U A;  3ZZI A;  2KCW A;  1ON0 A;  3OWC A;  2FIA A;  2OZH A;  2Q0Y A;  3EC4 A;  1Q2D A;  2BEI A;  2P6G A;  3GY9 A;  5KTC A;  1R57 A;  2YND A;  4KUA A;  3FBU A;  4BMH A;  5DWN A;  4GS4 A;  1NMT A;  1M1D A;  2R7H A;  2Z3P A;  4X5K A;  4MHD A;  3S6K A;  2DXQ A;  5KTD A;  4CAF A;  2ZPA A;  4UCP A;  3TFY A;  1KUY A;  4KOV A;  3EXN A;  5KTA A;  3R96 A;  3CXP A;  4AB7 A;  4ORF A;  5G21 A;  1XIX A;  1YR0 A;  1MJB A;  4LX9 A;  2PC1 A;  2Z0Z A;  4FD4 A;  4NCZ A;  2BL1 A;  4C7H A;  5HH1 A;  3D2P A;  4B12 A;  2CY2 A;  2VZY A;  4MI4 A;  2ZXV A;  1S7K A;  5A27 A;  4OAE A;  4AVC A;  3FXT A;  2FXF A;  1GHE A;  2VXK A;  4FD5 A;  2JEV A;  3F0A A;  4Y49 C;  4U5Y A;  5G22 A;  1U6M A;  3A9L A;  2EVN A;  4KOW A;  2ZW6 A;  4ONU A;  1I1D A;  2PR8 A;  5DWM A;  1QSM A;  1IID A;  3GYA A;  4XPL A;  2YNE A;  1YLE A;  2CNM A;  3RYO A;  4CS0 B;  4CYQ A;  1S7N A;  3CXQ A;  2Z3M A;  4MFL A;  5AG4 A;  3NE7 A;  4MFJ A;  4NSQ A;  5F46 A;  1Y9K A;  2X7B A;  4H6Z A;  2FE7 A;  1YVK A;  1PU9 A;  4A31 A;  5AG6 A;  4UA3 A;  5AGE A;  5G20 A;  5ISV A;  3EO4 A;  3T9Y A;  5A28 A;  4QVT A;  4JXQ A;  4ZBG A;  4UCN A;  4KUB A;  1YGH A;  2REE A;  4NF1 A;  2J8M A;  5AG7 A;  2HUZ A;  1KZF A;  2ZW7 A;  2Q7B A;  2O28 A;  2OZG A;  3FYN A;  2Q44 A;  4HNW B;  2VZZ A;  1KUX A;  3TO6 A;  1YRE A;  4KZT A;  1MJ9 A;  4QB9 A;  3VWD A;  4MBU A;  3ZJ0 A;  1YX0 A;  4KVO E;  4MY0 A;  3R9E A;  2EUI A;  4C68 A;  3PGP A;  2AJ6 A;  1P0H A;  1SQH A;  4Q38 A;  2YGW A;  2Z3L A;  3TT2 A;  1NE9 A;  4JXR A;  5G1Z A;  1QSR A;  4E0A A;  2R1I A;  1M4I A;  2ARH A;  5F49 A;  4CAV A;  2C27 A;  3EY5 A;  3E0K A;  3MGD A;  3BJ8 A;  4RI1 A;  1J4J A;  5IX3 A;  1IIC A;  4AG7 A;  4F6A A;  3S6F A;  5EC4 A;  1P4N A;  2P0W A;  2OZU A;  4II9 A;  2B3V A;  2PQ8 A;  4OAD A;  4R87 A;  5JPH A;  2B5G A;  5GCN A;  3VWE A;  1KUV A;  1FY7 A;  4NXY A;  1Z4E A;  2BUE A;  1Y9W A;  3IU2 A;  2R8V A;  4R3K A;  1YVO A;  2Z3O A;  5HMN A;  3PZJ A;  4JWP A;  2D4P A;  4YGO A;  4KS9 A;  4AVB A;  4NEX A;  4MFZ A;  1VKC A;  1RO5 A;  4A2Z A;  1QST A;  2GE3 A;  3FNC A;  4FD7 A;  3G8W A;  1QSN A;  4QC6 A;  2F5I A;  2I00 A;  4JD6 A;  2DPS A;  2B3U A;  4M3S A;  4C2Y A;  2P6F A;  4UFX A;  4U9Z A;  3IU1 A;  2VBQ A;  4EVY A;  4JLY A;  5IB0 A;  2WPX A;  1XMT A;  1UFH A;  4AG9 A;  4J3G A;  3TCV A;  3FRM A;  4IF5 A;  4UWI A;  2Z3K A;  5C82 A;  2FL4 A;  1ZO0 A;  2VEZ A;  1BO4 A;  3DNS A;  4UWJ A;  3JUW A;  4Y49 B;  5JQ4 A;  4MY3 A;  4KVM E;  2P6E A;  3P2H A;  4C2X A;  2ZW4 A;  2DPT A;  4UFW A;  5CNP A;  3TOB A;  2J8R A;  2PSW A;  2WSA A;  4KSA A;  2B5G B;  4M85 A;  4XPK A;  2HV2 A;  5J8F A;  4KOR A;  3D3S A;  1B87 A;  1LRZ A;  2Z11 A;  5I0C A;  2Q4V A;  1IYK A;  2FT0 A;  1RXT A;  1M44 A;  2K5T A;  2FIW A;  3B8G A;  1WK4 A;  2J8N A;  4XNH C;  4CGP A;  1MK4 A;  2QIR A;  2FSR A;  3H5Z A;  4UBR A;  1XEB A;  2YNC C;  2R98 A;  3IWG A;  1V0C A;  2OU2 A;  4CAW A;  3IGR A;  4R3L A;  4F0X A;  1S5K A;  4R57 A;  1Y7R A;  2VI7 A;  3DR6 A;  3S6H A;  3TTH A;  4XNH B;  4QUS A;  4R9M A;  4MFK A;  1S7F A;  5C88 A;  3WR7 A;  1M4G A;  4KVX A;  2FS5 A;  4XPD C;  2AE6 A;  2PRB A;  4CRZ B;  4B11 A;  4YRH A;  1Q2Y A;  2FCK A;  3C26 A;  3R95 A;  4OLL A;  2Z10 A;  2H5M A;  4KLV A;  4KSF A;  4A33 A;  4K30 A;  2Z3N A;  3QB8 A;  3TOA A;  2GIV A;  5J8C A;  1S3Z A;  2OB0 A;  4AVA A;  5F47 A;  4XPD B;  1XE4 A;  5FVJ A;  4CGN A;  3V8I A;  2OH1 A;  3FB3 A;  1L0C A;  3IWE A;  3JTK A;  2VQY A;  4B5P A;  1Z9U A;  3H4Q A;  5E96 A;  4B14 A;  2G0B A;  3R9F A;  1S60 A;  2JDD A;  1B6B A;  4H89 A;  2Q4Y A;  5H86 A;  2B4D A;  5H84 A;  3QAH A;  2NMT A;  3TO9 A;  3N7Z A;  5IV0 A;  4KOS A;  1OZP A;  3TE4 A;  3I3G A;  4MFP A;  2B4B A;  4B10 A;  1N71 A;  4CGO A;  4CAX A;  2WUU A;  4I49 A;  2YNC A;  3PP9 A;  4QBJ A;  4L89 A;  4B13 A;  3GKR A;  4DNC A;  2B58 A;  4PK2 A;  2G3T A;  3G3S A;  1PUA A;  5F48 A;  4PSW A;  3JVN A;  2WPW A;  4L8A A;  2CNS A;  1I12 A;  4PK3 A;  2PDO A;  1K4J A;  1Z4R A;  1QSO A;  4RS2 A;  2CNT A;  2G3A A;  4CYP A;  3DR8 A;  3CXS A;  4KOY A;  4UCM A;  3R9G A;  1Q2C A;  3F5B A;  4HNY B;  1CM0 A;  4BBH A;  2Y0M A;  1TIQ A;  4MFQ A;  4FD6 A;  1XF8 A;  3P2F A;  4UFV A;  3I9S A;  4JJX A;  2PR1 A;  1WWZ A;  2HQY A;  4YFJ A;  3T90 A;  4KLW A;  4A32 A;  3D8P A;  2RC4 A;  2QEC A;  4HKF A;  4E2A A;  1YK3 A;  3EFA A;  4C7I A;  4CYN A;  2CXA A;  2A4N A;  3BJ7 A;  3SHP A;  1MJA A;  1IB1 E;  3W91 A;  4B5P B;  4LUA A;  5EBV A;  3FIX A;  1S7L A;  4F0Y A;  2JDC A;  2GAN A;  4A30 A;  4ZGY B;  3D2M A;  3DSB A;  2ZW5 A;  3SXN A;  3W6S A;  4CAE A;  2B4D B;  4U9Y A;  4E8O A;  1M4D A;  4CGM A;  1VHS A;  3S6G A;  4CRY B;  5BWA B;  3KKW A;  4PSX A;  4A95 A;  2D4O A;  2REF A;  1CJW A;  3W6X A;  3TO7 A;  4IUS A;  4B5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...