5AGEA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a benzomorpholinone ligand
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 119
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ageA00
4C2XA 4A33A 4B13A 4B12A 4C68A 2YNCC 4CYOA 4CGOA 4UFWA 4A95A 5G20A 4A31A 4CGNA 4CAFA 4CYQA 4CYPA 2WSAA 2YNCA 3JTKA 4CGPA 4B11A 5G1ZA 4B14A 4C7IA 4CGMA 3H5ZA 4CGLA 5A27A 5G21A 4UCNA 3IWEA 4C2ZA 5AG4A 5AG6A 2YNDA 4UCMA 4B10A 2WUUA 4UFVA 4CYNA 4UCPA 4UFXA 4C2YA 4CAEA 2YNEA 5G22A 4A30A 4C7HA 5A28A 3IU2A 3IU1A 5AG5A 4A32A 5AG7A 5AGEA 4A2ZA 4BBHA
chains in the Genus database with same CATH superfamily
2PE3A 2PJ9A 1B6BA 4UEFA 2CNSA 3S6KA 1GYTA 1S3ZA 3GKRA 2P6EA 1FY7A 1ZLIA 2VBQA 4W9YA 4ONWA 5LYDA 4F9VA 1XMBA 1S7LA 4CGNA 2IJZA 3IGRA 1YVKA 2WSAA 4MFZA 4B11A 5E96A 4R57A 2GIVA 1N71A 4LQGA 3D2MA 4M3SA 1TXRA 4UA3A 1ZG9A 3R9GA 4CAWA 2G0BA 2P6FA 2WYRA 1B87A 2PJCA 3IWEA 3RO0A 4QBJA 1ZG7A 3KL9A 1ARMA 1LFWA 4WJBA 3HUVA 3WT4A 3GLJA 2BO9A 3JVNA 5LRGA 5AG7A 4HNXB 3WC5A 2PIYA 3FX6A 4KZTA 1M4IA 4BBHA 4YU9A 3D7FA 4UWJA 1BAVA 3BI0A 1HDQA 3B7IA 4R3LA 3RBUA 2YNCC 4KSAA 1YGHA 1CM0A 4MJ8A 1TIQA 1Z2LA 1IYLA 2ANPA 3TOBA 2B5GB 1BPNA 4OIWA 2D4PA 2BOAA 3TC8A 2DPTA 3KR4A 2PJ4A 2VXKA 2Z0ZA 3D67A 2AE6A 2EBJA 1RTQA 2J8RA 4X2TA 2JDCA 1LRZA 4FAIA 6CPAA 4PV6A 2C6PA 1XEBA 4NFRA 4B5PA 5DWMA 4NJRA 4R7MA 4JYWA 4PQAA 2XEFA 3DLJA 2DXQA 2O4HA 4MBUA 1ON0A 3CZXA 3K9TA 3S9LA 1MJ9A 4J3GA 2POKA 4GM5A 5KTAA 1RXTA 2BUEA 2D4OA 4JXQA 4AG9A 2B4DB 4KS9A 4CYOA 3IO1A 3B3TA 4XNHB 2WPXA 3K2KA 4MCQA 4CGOA 3EFAA 2FIWA 2ZEPA 4RN7A 3CDXA 1R43A 4L8AA 3RNZA 4AG7A 3VATA 4YFJA 4KOUA 4F0XA 2FIAA 5DWNA 4EWTA 2AFWA 3D2PA 3PGPA 5LYLA 3S9NA 3B2YA 1PCAA 3FMCA 3KHZA 4ZYQA 4NGTA 2IQ6A 4OC5A 4UCPA 3PB4X 3PB8X 2YNEA 3FXTA 4JJXA 4RUHA 1NSLA 1CG2A 3H8EA 1BOBA 3B3CA 3IWWA 4KOSA 2CF4A 2AFMA 4E0AA 5K8NA 2GU2A 1XOVA 5IV0A 2FL4A 4B13A 1F57A 1I1DA 5CPAA 1NMTA 2IL4A 4O23A 2OB0A 3S6GA 4B5PB 2ZEMA 2PJAA 4HNYB 2JBJA 1Q2CA 5THWA 3GB0A 1V0CA 2PVVA 2EO8A 2DPSA 2REEA 5HVHA 1I21A 1S60A 2FVGA 2DF5A 2Q43A 3LODA 4MFPA 4KOTA 1MJBA 1CP7A 2ZW5A 3FH4A 2OOTA 4DYOA 4IF5A 4L89A 4CYNA 3B3SA 2FXFA 5IX3A 2ATRA 1PYTB 2F5IA 3OWCA 3R95A 4DUKA 2NSMA 3L2NA 2FCKA 5AGEA 4EFDA 4FUUA 1YQEA 2ARHA 5CNPA 3T8WA 4PSXA 3BJ7A 3KKWA 4UEEA 2GLFA 1Z8TA 2PVWA 3GY9A 3WC7A 4MHNA 4CAFA 4KOYA 4UEZA 4JWPA 4Z65A 3D68A 4MFLA 1YW4A 4EMEA 2YNCA 4GXHA 3FEEA 2I79A 3NH4A 4KOWA 4ZGYB 1S5KA 3VWEA 3NFZA 4PK2A 4ZI6A 5ISVA 3H8FA 2J9AA 2O53A 1ZG8A 2RB7A 3D7HA 3T90A 2ZEFA 4Q7AA 2PCUA 1HEEA 4RI1A 2AFXA 3DDDA 1Q2YA 4R3KA 3FRMA 1ZLHA 5IB9A 5LRKA 3N7ZA 4XPLA 1Z8XA 4MXUA 3ISXA 3ZZIA 5JM6A 2FS5A 2V8VA 2B4BA 4KUAA 1BLLE 4JXRA 1X12A 2C27A 2PJ5A 4NSQA 1ELLP 4P4JA 5GCNA 5HVGA 2IMOA 4R6TA 4MI4A 4ORFA 3CT9A 4XPKA 1M44A 1LAPA 3V7ZA 4U9ZA 1M1DA 1K4JA 2G3TA 1SQHA 2OZGA 1OBRA 2Q51A 3EY5A 3H5ZA 2P0WA 2FT0A 2R98A 4FD5A 2ZEHA 2PIZA 3IC1A 5BWAB 4YRHA 1IB1E 1R3NA 5EBVA 4FD4A 2RC4A 2Z3PA 1CJWA 1NE9A 2Q7SA 2ZW4A 4H6ZA 3PB6X 4M6GA 1FT7A 3B8GA 3I1UA 4P4FA 4MRIA 5EC4A 1MJAA 2ZOFA 3BJ8A 3GUXA 4IUSA 1TKJA 2ZEDA 4JD6A 3VARA 2B5GA 4DJLA 3DR6A 4A33A 2GE3A 2JBKA 3D7GA 5C82A 3FYNA 2QVPA 2J8NA 3NE8A 4P45A 2GLJA 4TWEA 4KSIA 2PJBA 2ZENA 1IICA 1P0HA 3GIUA 5KTCA 2ZXVA 3K9UA 2PR8A 4MHPA 1VHOA 4CGPA 4OC4A 4C7IA 2PJ3A 3CXSA 5F09A 1QSOA 2X7BA 4X8IA 4GS4A 4UBRA 4CGLA 1S7NA 3SXOA 2ZEOA 1F2OA 1YREA 2BSWA 2V8GA 4CAXA 5J1QA 4F6AA 1Z4EA 1KZFA 5K8PA 1J4JA 1GHEA 2XEJA 1KWMA 1EE3P 3WABA 2KCWA 1CP6A 1TKHA 4P4EA 3IFEA 3FB3A 1M4LA 5FVJA 3TTHA 3TCVA 3E0KA 1VHEA 4P10A 2Q44A 3WC6A 2WZNA 3QNVA 4A31A 4NCZA 3BXMA 2Q7BA 4OC1A 4FD6A 4AVCA 2EWBA 1FNOA 5F46A 3C26A 2V77A 5JGFA 4FWUA 2G9DA 2WPWA 2OZHA 3VWDA 1IY7A 2Z11A 3S6FA 3IWGA 1DE4C 2YNDA 5JQ4A 2BEIA 3BLNA 4XNHC 1X10A 1I12A 3SI2A 4LX9A 4MHYA 1S7FA 3PRTA 3IU2A 2C6CA 4B5OA 2Z10A 4NGPA 4OMEA 3TX8A 2ZPAA 4M85A 2XEGA 4FD7A 4HKFA 4BMHA 3I9SA 1IIDA 3TT2A 4X3RA 3KI9A 1XJOA 2ZEGA 3F8KA 2JDDA 1XBUA 4P44A 4H6UA 2PC1A 5DS0A 3DSBA 4AB7A 2R1IA 4I49A 4LUAA 2PQ8A 4R76A 4CYPA 3B35A 2Q4ZA 4PXEA 4ZY0A 3JTKA 4KVOE 2ODFA 2R8VA 3T9YA 1F2PA 2GFQA 4PXBA 3S6HA 2JEWA 2QMLA 1M4DA 3BHXA 2VL1A 2ZOGA 2QJ8A 3G8WA 4UCNA 4PPZA 4UCMA 1VKCA 7CPAA 4WWVA 4X5KA 4MHDA 5JH9A 2QIRA 5IB0A 2QECA 3R96A 4H89A 3SI1A 5HVFA 2GREA 3CXQA 2PJ2A 3KQZA 2ABZA 4E2AA 1S7KA 3B3WA 2EK8A 4KLVA 1ARLA 3SXNA 1CX8A 1VIXA 3MRUA 3SJEA 1Y0RA 4F8ZA 2C1CA 1AMPA 1A2ZA 4UIAA 3IJ3A 4ZX8A 3CPXA 5I4MA 1PUAA 3TO7A 4NGSA 5JPHA 1Z5RA 3FVLA 4A37A 4B6ZA 2PSWA 2CNMA 1UWYA 1Y7RA 3FEDA 3VH9A 3D3SA 4G1PA 4BINA 5AG6A 1ELMP 2HC9A 4MMOA 3TOAA 4HPSA 2VI7A 3R9EA 3S9MA 1Y0YA 2HB6A 3PFOA 4MHZA 2B3VA 4OP4A 4P6YA 5EMIA 3IU1A 4JZ0A 1Z8WA 5K8MA 3W6XA 1QMUA 2O28A 4II9A 2B3UA 2CTCA 3KR5A 4NXYA 1YW6A 3PBBA 1IU8A 2CXAA 3EC4A 3LACA 1XE4A 1KUYA 4KLWA 3PFEA 1KUVA 3IIBA 1Z9UA 5F49A 3BI1A 3LWUA 3EO4A 3R9FA 2PJ0A 2BL1A 4PK3A 4B14A 2JLMA 2Q4YA 4QB9A 1YLOA 2J8MA 4A39A 4U5YA 2CTBA 2A4NA 4CPAA 4CRZB 1IGBA 1QQ9A 2PJ1A 3CXPA 4P4DA 3IEHA 4OC0A 4UFVA 3SJXA 3PB7X 2G3AA 1YK3A 2OH1A 2EK9A 3NH5A 5HMNA 2FE7A 2REFA 4R87A 4A2ZA 4CS0B 3PZJA 1BPMA 1VHSA 3W6SA 4P4BA 1DTDA 3LMSA 2I00A 3KZWA 4C68A 2OZUA 2Y0MA 1YLEA 4UWIA 3FF3A 4NJQA 4ZY2A 2VEZA 1ZO0A 2K5TA 3H4QA 3PP9A 1QSNA 4NGRA 1MK4A 4EVYA 5J8FA 2B4DA 4KUBA 4AXVA 2HUZA 4DNCA 3KGQA 4NEXA 1CBXA 3FECA 4IK2A 4CGMA 3JRUA 1XMTA 3PBEA 1WK4A 5AG4A 1RO5A 4YWYA 1LOKA 3UY5A 3FBUA 1HDUA 2ZW7A 4R9MA 4ZX9A 1Z4RA 2XEIA 3GYAA 4A32A 2RFHA 4PXDA 2C6GA 2CY2A 3D7DA 4P4IA 2CIJA 3MGDA 4C2XA 8CPAA 4F9UA 2Z3MA 3DR8A 4CAVA 1Y7EA 2FSRA 4AVBA 5LRJA 3V8IA 3QAHA 3TO9A 1JWQA 2QYVA 2PJ7A 1AYEA 1Z8LA 4OC2A 4NGQA 5ELYA 3EXNA 1LANA 2NYQA 3DNSA 3NE7A 4UIBA 5J8CA 1CPXA 2P6GA 2Z3NA 3TO6A 4QVTA 3D66A 3N5FA 4NGMA 1XF8A 3NA6A 3KQXA 4ONUA 2ZW6A 1H8LA 2AJ6A 2B58A 3NH8A 1QSMA 2PJ8A 4KORA 4MCPA 4Y49C 4OKOA 2PDOA 3ZJ0A 4C2ZA 5CBMA 4A38A 1L0CA 3RAMA 4MY3A 3TFYA 5F48A 5G22A 5C88A 2AFSA 1TF8A 3SI0A 4LQ6A 2HQYA 4YGOA 1IOFA 2JEVA 3JUWA 4KOVA 5D8NA 3H8GA 4BD9A 2PR1A 4MFJA 2CNTA 4JLYA 2HV2A 3FJUA 5H86A 1YR0A 1JQGA 4B12A 4PSWA 3MN8A 4QUSA 5KTDA 4UFWA 1U6MA 2YGWA 4A95A 2AFZA 1Q2DA 2NMTA 3QAYA 4Y49B 3R1KA 2F7VA 3ISZA 1IOIA 4CYQA 2VQYA 4ZBGA 4NF1A 4KSFA 1BO4A 2Q0YA 4R8FA 2Z3KA 2R7HA 5G21A 4HNWB 1QSRA 2DEAA 1LAMA 4MCSA 4Q38A 4B10A 1XRYA 3KHXA 2AFUA 4OAEA 2GANA 4A30A 4F0YA 4C7HA 4PXCA 2PRQA 4OIDA 3SHPA 1TF9A 2V8HA 3I3GA 2ZELA 3B3VA 3V38A 1YSJA 3A9LA 3SJFA 3QB8A 3WR7A 1XFOA 3PB9X 5F47A 2EVNA 2VZYA 2H5MA 4KVXA 1XIXA 4TNUA 3D4UA 5G20A 1KUXA 4KVME 4MFKA 3FIXA 4KOXA 5HH1A 4RS2A 3P2HA 5H84A 2Q4VA 2I3CA 4U9YA 2OR4A 4IAVA 5K8OA 4QC6A 4AVAA 1UFHA 3F0AA 3W91A 2WUUA 3LD2A 4A94A 4XPDC 5D29A 4CAEA 3DGVA 4M6IA 4Q36A 3TE4A 3RZAA 1PU9A 1Q7LA 3SJGA 1R57A 3KASA 4UFXA 3RYOA 1Y9KA 1AUGA 2V8DA 4MFQA 4MCRA 1CPSA 1NSAA 3HLPA 4K30A 1IYKA 1LCPA 5HXDA 1P4NA 4M6HA 1YMEA 4MY0A 2Z3OA 3F5BA 4UF4A 2EUIA 4E8OA 1OZPA 1VGYA 2Q04A 3P2FA 4XPDB 5LYFA 2VZZA 2PJ6A 4ZY1A 1WWZA 5G1ZA 1Y9WA 2BCOA 1YX0A 4IHMA 4K3NA 5A27A 3G3SA 4H2KA 2F8HA 3CPAA 2PRBA 5LYIA 1M4GA 4FBEA 2AFOA 3D8PA 1QSTA 4C2YA 4OC3A 1TKFA 1YVOA 2Z3LA 3PEIA 5A28A 2OU2A 5AG5A 5I0CA 4CRYB 2ZEEA 3FNCA 4OADA 4OLLA 4NGNA
chains in the Genus database with same CATH topology
1B6BA 2CNSA 3S6KA 1S3ZA 3GKRA 2P6EA 1FY7A 2VBQA 1S7LA 4CGNA 3IGRA 1YVKA 2WSAA 4MFZA 4B11A 5E96A 4R57A 2GIVA 1N71A 3D2MA 4M3SA 4UA3A 3R9GA 4CAWA 2G0BA 2P6FA 3IWEA 1B87A 4QBJA 3JVNA 5AG7A 4HNXB 4KZTA 1M4IA 4BBHA 4UWJA 4R3LA 2YNCC 4KSAA 1YGHA 1CM0A 4MJ8A 1TIQA 1IYLA 3TOBA 2B5GB 2D4PA 2DPTA 2VXKA 2Z0ZA 2AE6A 2J8RA 2JDCA 1LRZA 4PV6A 1XEBA 4B5PA 5DWMA 2DXQA 4MBUA 1ON0A 1MJ9A 4J3GA 5KTAA 1RXTA 2BUEA 2D4OA 4JXQA 4AG9A 2B4DB 4KS9A 4CYOA 4XNHB 4CGOA 2WPXA 3EFAA 2FIWA 4L8AA 4AG7A 4YFJA 4KOUA 4F0XA 2FIAA 5DWNA 3D2PA 3PGPA 4UCPA 2YNEA 3FXTA 4JJXA 1NSLA 1BOBA 4KOSA 4E0AA 5IV0A 2FL4A 4B13A 1I1DA 1NMTA 2IL4A 2OB0A 3S6GA 4B5PB 4HNYB 1Q2CA 1V0CA 2DPSA 2REEA 1I21A 1S60A 4MFPA 3LODA 4KOTA 1MJBA 2ZW5A 4IF5A 4L89A 4CYNA 2FXFA 5IX3A 2ATRA 3OWCA 2F5IA 3R95A 2FCKA 5AGEA 2ARHA 5CNPA 4PSXA 3BJ7A 3KKWA 3GY9A 4CAFA 4KOYA 4JWPA 4MFLA 2YNCA 2I79A 4KOWA 1S5KA 3VWEA 4PK2A 5ISVA 3T90A 4RI1A 3DDDA 1Q2YA 4R3KA 3FRMA 3N7ZA 4XPLA 3ZZIA 2FS5A 2B4BA 4KUAA 4JXRA 2C27A 4NSQA 5GCNA 4MI4A 4ORFA 4XPKA 1M44A 4U9ZA 1M1DA 1K4JA 2G3TA 1SQHA 2OZGA 3H5ZA 3EY5A 4FD5A 2P0WA 2FT0A 2R98A 5BWAB 4YRHA 1IB1E 5EBVA 4FD4A 2RC4A 2Z3PA 1CJWA 1NE9A 2ZW4A 4H6ZA 3B8GA 5EC4A 1MJAA 3BJ8A 4IUSA 4JD6A 2B5GA 3DR6A 4A33A 2GE3A 5C82A 3FYNA 2J8NA 1IICA 1P0HA 5KTCA 2ZXVA 3K9UA 2PR8A 4CGPA 4C7IA 3CXSA 1QSOA 2X7BA 4CGLA 4GS4A 4UBRA 1S7NA 3SXOA 1YREA 2BSWA 4CAXA 4F6AA 1Z4EA 1KZFA 1J4JA 1GHEA 2KCWA 3FB3A 5FVJA 3TTHA 3TCVA 3E0KA 2Q44A 4A31A 4NCZA 2Q7BA 4FD6A 4AVCA 5F46A 3C26A 2WPWA 2OZHA 3VWDA 2Z11A 3S6FA 3IWGA 5JQ4A 2YNDA 2BEIA 3BLNA 4XNHC 1I12A 4LX9A 1S7FA 3IU2A 4B5OA 2Z10A 2ZPAA 4M85A 4FD7A 4HKFA 4BMHA 3I9SA 1IIDA 3TT2A 3F8KA 2JDDA 4H6UA 2PC1A 3DSBA 4AB7A 2R1IA 4I49A 4LUAA 2PQ8A 4CYPA 3JTKA 4KVOE 2R8VA 3T9YA 3S6HA 2QMLA 1M4DA 4UCNA 3G8WA 4UCMA 1VKCA 4X5KA 4MHDA 2QIRA 5IB0A 2QECA 3R96A 4H89A 3CXQA 4E2AA 1S7KA 4KLVA 3SXNA 1PUAA 3TO7A 5JPHA 2PSWA 2CNMA 1Y7RA 3D3SA 5AG6A 3TOAA 2VI7A 3R9EA 2B3VA 3IU1A 3W6XA 2O28A 4II9A 2B3UA 4NXYA 2CXAA 3EC4A 1XE4A 1KUYA 4KLWA 1KUVA 1Z9UA 5F49A 3EO4A 3R9FA 2BL1A 4PK3A 4B14A 2JLMA 2Q4YA 4QB9A 2J8MA 4U5YA 2A4NA 4CRZB 3CXPA 4UFVA 2G3AA 1YK3A 2OH1A 5HMNA 2FE7A 2REFA 4R87A 4A2ZA 4CS0B 3PZJA 1VHSA 3W6SA 2I00A 4C68A 2OZUA 2Y0MA 1YLEA 4UWIA 2VEZA 1ZO0A 2K5TA 3H4QA 3PP9A 1QSNA 4EVYA 1MK4A 5J8FA 2B4DA 4KUBA 2HUZA 4DNCA 4NEXA 4CGMA 1XMTA 1WK4A 5AG4A 1RO5A 3UY5A 3FBUA 2ZW7A 4R9MA 1Z4RA 3GYAA 4A32A 2CY2A 3MGDA 4C2XA 2Z3MA 3DR8A 4CAVA 2FSRA 4AVBA 3V8IA 3QAHA 3TO9A 3EXNA 3DNSA 3NE7A 5J8CA 2P6GA 2Z3NA 3TO6A 4QVTA 1XF8A 4ONUA 2ZW6A 2AJ6A 4ZGYB 2B58A 1QSMA 4KORA 4Y49C 4C2ZA 3ZJ0A 2PDOA 1L0CA 4MY3A 3TFYA 5F48A 5G22A 5C88A 2HQYA 4YGOA 2JEVA 3JUWA 4KOVA 2PR1A 4MFJA 2CNTA 4JLYA 2HV2A 5H86A 1YR0A 4B12A 4PSWA 4QUSA 5KTDA 4UFWA 1U6MA 2YGWA 4A95A 1Q2DA 2NMTA 4Y49B 3R1KA 4CYQA 2VQYA 4ZBGA 4NF1A 4KSFA 1BO4A 2Q0YA 2Z3KA 2R7HA 5G21A 4HNWB 1QSRA 4Q38A 4B10A 4OAEA 2GANA 4A30A 4F0YA 4C7HA 3SHPA 3I3GA 3A9LA 3QB8A 3WR7A 5F47A 2EVNA 2VZYA 2H5MA 4KVXA 1XIXA 5G20A 1KUXA 4KVME 4MFKA 3FIXA 4KOXA 5HH1A 4RS2A 3P2HA 5H84A 2Q4VA 4U9YA 4QC6A 4AVAA 1UFHA 3F0AA 3W91A 2WUUA 3LD2A 4XPDC 4CAEA 4Q36A 3TE4A 1PU9A 1R57A 4UFXA 3RYOA 1Y9KA 4MFQA 1IYKA 1P4NA 4E8OA 4MY0A 2Z3OA 3F5BA 2EUIA 1OZPA 2Q04A 3P2FA 4XPDB 2VZZA 1WWZA 5G1ZA 1Y9WA 1YX0A 5A27A 3G3SA 2PRBA 1M4GA 3D8PA 1QSTA 4C2YA 1YVOA 2Z3LA 5A28A 2OU2A 5AG5A 5I0CA 4CRYB 4K30A 3FNCA 4OADA 4OLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2X A;  4A33 A;  4B13 A;  4B12 A;  4C68 A;  2YNC C;  4CYO A;  4CGO A;  4UFW A;  4A95 A;  5G20 A;  4A31 A;  4CGN A;  4CAF A;  4CYQ A;  4CYP A;  2WSA A;  2YNC A;  3JTK A;  4CGP A;  4B11 A;  5G1Z A;  4B14 A;  4C7I A;  4CGM A;  3H5Z A;  4CGL A;  5A27 A;  5G21 A;  4UCN A;  3IWE A;  4C2Z A;  5AG4 A;  5AG6 A;  2YND A;  4UCM A;  4B10 A;  2WUU A;  4UFV A;  4CYN A;  4UCP A;  4UFX A;  4C2Y A;  4CAE A;  2YNE A;  5G22 A;  4A30 A;  4C7H A;  5A28 A;  3IU2 A;  3IU1 A;  5AG5 A;  4A32 A;  5AG7 A;  5AGE A;  4A2Z A;  4BBH A; 
#chains in the Genus database with same CATH topology
 2PE3 A;  2PJ9 A;  1B6B A;  4UEF A;  2CNS A;  3S6K A;  1GYT A;  1S3Z A;  3GKR A;  2P6E A;  1FY7 A;  1ZLI A;  2VBQ A;  4W9Y A;  4ONW A;  5LYD A;  4F9V A;  1XMB A;  1S7L A;  4CGN A;  2IJZ A;  3IGR A;  1YVK A;  2WSA A;  4MFZ A;  4B11 A;  5E96 A;  4R57 A;  2GIV A;  1N71 A;  4LQG A;  3D2M A;  4M3S A;  1TXR A;  4UA3 A;  1ZG9 A;  3R9G A;  4CAW A;  2G0B A;  2P6F A;  2WYR A;  1B87 A;  2PJC A;  3IWE A;  3RO0 A;  4QBJ A;  1ZG7 A;  3KL9 A;  1ARM A;  1LFW A;  4WJB A;  3HUV A;  3WT4 A;  3GLJ A;  2BO9 A;  3JVN A;  5LRG A;  5AG7 A;  4HNX B;  3WC5 A;  2PIY A;  3FX6 A;  4KZT A;  1M4I A;  4BBH A;  4YU9 A;  3D7F A;  4UWJ A;  1BAV A;  3BI0 A;  1HDQ A;  3B7I A;  4R3L A;  3RBU A;  2YNC C;  4KSA A;  1YGH A;  1CM0 A;  4MJ8 A;  1TIQ A;  1Z2L A;  1IYL A;  2ANP A;  3TOB A;  2B5G B;  1BPN A;  4OIW A;  2D4P A;  2BOA A;  3TC8 A;  2DPT A;  3KR4 A;  2PJ4 A;  2VXK A;  2Z0Z A;  3D67 A;  2AE6 A;  2EBJ A;  1RTQ A;  2J8R A;  4X2T A;  2JDC A;  1LRZ A;  4FAI A;  6CPA A;  4PV6 A;  2C6P A;  1XEB A;  4NFR A;  4B5P A;  5DWM A;  4NJR A;  4R7M A;  4JYW A;  4PQA A;  2XEF A;  3DLJ A;  2DXQ A;  2O4H A;  4MBU A;  1ON0 A;  3CZX A;  3K9T A;  3S9L A;  1MJ9 A;  4J3G A;  2POK A;  4GM5 A;  5KTA A;  1RXT A;  2BUE A;  2D4O A;  4JXQ A;  4AG9 A;  2B4D B;  4KS9 A;  4CYO A;  3IO1 A;  3B3T A;  4XNH B;  2WPX A;  3K2K A;  4MCQ A;  4CGO A;  3EFA A;  2FIW A;  2ZEP A;  4RN7 A;  3CDX A;  1R43 A;  4L8A A;  3RNZ A;  4AG7 A;  3VAT A;  4YFJ A;  4KOU A;  4F0X A;  2FIA A;  5DWN A;  4EWT A;  2AFW A;  3D2P A;  3PGP A;  5LYL A;  3S9N A;  3B2Y A;  1PCA A;  3FMC A;  3KHZ A;  4ZYQ A;  4NGT A;  2IQ6 A;  4OC5 A;  4UCP A;  3PB4 X;  3PB8 X;  2YNE A;  3FXT A;  4JJX A;  4RUH A;  1NSL A;  1CG2 A;  3H8E A;  1BOB A;  3B3C A;  3IWW A;  4KOS A;  2CF4 A;  2AFM A;  4E0A A;  5K8N A;  2GU2 A;  1XOV A;  5IV0 A;  2FL4 A;  4B13 A;  1F57 A;  1I1D A;  5CPA A;  1NMT A;  2IL4 A;  4O23 A;  2OB0 A;  3S6G A;  4B5P B;  2ZEM A;  2PJA A;  4HNY B;  2JBJ A;  1Q2C A;  5THW A;  3GB0 A;  1V0C A;  2PVV A;  2EO8 A;  2DPS A;  2REE A;  5HVH A;  1I21 A;  1S60 A;  2FVG A;  2DF5 A;  2Q43 A;  3LOD A;  4MFP A;  4KOT A;  1MJB A;  1CP7 A;  2ZW5 A;  3FH4 A;  2OOT A;  4DYO A;  4IF5 A;  4L89 A;  4CYN A;  3B3S A;  2FXF A;  5IX3 A;  2ATR A;  1PYT B;  2F5I A;  3OWC A;  3R95 A;  4DUK A;  2NSM A;  3L2N A;  2FCK A;  5AGE A;  4EFD A;  4FUU A;  1YQE A;  2ARH A;  5CNP A;  3T8W A;  4PSX A;  3BJ7 A;  3KKW A;  4UEE A;  2GLF A;  1Z8T A;  2PVW A;  3GY9 A;  3WC7 A;  4MHN A;  4CAF A;  4KOY A;  4UEZ A;  4JWP A;  4Z65 A;  3D68 A;  4MFL A;  1YW4 A;  4EME A;  2YNC A;  4GXH A;  3FEE A;  2I79 A;  3NH4 A;  4KOW A;  4ZGY B;  1S5K A;  3VWE A;  3NFZ A;  4PK2 A;  4ZI6 A;  5ISV A;  3H8F A;  2J9A A;  2O53 A;  1ZG8 A;  2RB7 A;  3D7H A;  3T90 A;  2ZEF A;  4Q7A A;  2PCU A;  1HEE A;  4RI1 A;  2AFX A;  3DDD A;  1Q2Y A;  4R3K A;  3FRM A;  1ZLH A;  5IB9 A;  5LRK A;  3N7Z A;  4XPL A;  1Z8X A;  4MXU A;  3ISX A;  3ZZI A;  5JM6 A;  2FS5 A;  2V8V A;  2B4B A;  4KUA A;  1BLL E;  4JXR A;  1X12 A;  2C27 A;  2PJ5 A;  4NSQ A;  1ELL P;  4P4J A;  5GCN A;  5HVG A;  2IMO A;  4R6T A;  4MI4 A;  4ORF A;  3CT9 A;  4XPK A;  1M44 A;  1LAP A;  3V7Z A;  4U9Z A;  1M1D A;  1K4J A;  2G3T A;  1SQH A;  2OZG A;  1OBR A;  2Q51 A;  3EY5 A;  3H5Z A;  2P0W A;  2FT0 A;  2R98 A;  4FD5 A;  2ZEH A;  2PIZ A;  3IC1 A;  5BWA B;  4YRH A;  1IB1 E;  1R3N A;  5EBV A;  4FD4 A;  2RC4 A;  2Z3P A;  1CJW A;  1NE9 A;  2Q7S A;  2ZW4 A;  4H6Z A;  3PB6 X;  4M6G A;  1FT7 A;  3B8G A;  3I1U A;  4P4F A;  4MRI A;  5EC4 A;  1MJA A;  2ZOF A;  3BJ8 A;  3GUX A;  4IUS A;  1TKJ A;  2ZED A;  4JD6 A;  3VAR A;  2B5G A;  4DJL A;  3DR6 A;  4A33 A;  2GE3 A;  2JBK A;  3D7G A;  5C82 A;  3FYN A;  2QVP A;  2J8N A;  3NE8 A;  4P45 A;  2GLJ A;  4TWE A;  4KSI A;  2PJB A;  2ZEN A;  1IIC A;  1P0H A;  3GIU A;  5KTC A;  2ZXV A;  3K9U A;  2PR8 A;  4MHP A;  1VHO A;  4CGP A;  4OC4 A;  4C7I A;  2PJ3 A;  3CXS A;  5F09 A;  1QSO A;  2X7B A;  4X8I A;  4GS4 A;  4UBR A;  4CGL A;  1S7N A;  3SXO A;  2ZEO A;  1F2O A;  1YRE A;  2BSW A;  2V8G A;  4CAX A;  5J1Q A;  4F6A A;  1Z4E A;  1KZF A;  5K8P A;  1J4J A;  1GHE A;  2XEJ A;  1KWM A;  1EE3 P;  3WAB A;  2KCW A;  1CP6 A;  1TKH A;  4P4E A;  3IFE A;  3FB3 A;  1M4L A;  5FVJ A;  3TTH A;  3TCV A;  3E0K A;  1VHE A;  4P10 A;  2Q44 A;  3WC6 A;  2WZN A;  3QNV A;  4A31 A;  4NCZ A;  3BXM A;  2Q7B A;  4OC1 A;  4FD6 A;  4AVC A;  2EWB A;  1FNO A;  5F46 A;  3C26 A;  2V77 A;  5JGF A;  4FWU A;  2G9D A;  2WPW A;  2OZH A;  3VWD A;  1IY7 A;  2Z11 A;  3S6F A;  3IWG A;  1DE4 C;  2YND A;  5JQ4 A;  2BEI A;  3BLN A;  4XNH C;  1X10 A;  1I12 A;  3SI2 A;  4LX9 A;  4MHY A;  1S7F A;  3PRT A;  3IU2 A;  2C6C A;  4B5O A;  2Z10 A;  4NGP A;  4OME A;  3TX8 A;  2ZPA A;  4M85 A;  2XEG A;  4FD7 A;  4HKF A;  4BMH A;  3I9S A;  1IID A;  3TT2 A;  4X3R A;  3KI9 A;  1XJO A;  2ZEG A;  3F8K A;  2JDD A;  1XBU A;  4P44 A;  4H6U A;  2PC1 A;  5DS0 A;  3DSB A;  4AB7 A;  2R1I A;  4I49 A;  4LUA A;  2PQ8 A;  4R76 A;  4CYP A;  3B35 A;  2Q4Z A;  4PXE A;  4ZY0 A;  3JTK A;  4KVO E;  2ODF A;  2R8V A;  3T9Y A;  1F2P A;  2GFQ A;  4PXB A;  3S6H A;  2JEW A;  2QML A;  1M4D A;  3BHX A;  2VL1 A;  2ZOG A;  2QJ8 A;  3G8W A;  4UCN A;  4PPZ A;  4UCM A;  1VKC A;  7CPA A;  4WWV A;  4X5K A;  4MHD A;  5JH9 A;  2QIR A;  5IB0 A;  2QEC A;  3R96 A;  4H89 A;  3SI1 A;  5HVF A;  2GRE A;  3CXQ A;  2PJ2 A;  3KQZ A;  2ABZ A;  4E2A A;  1S7K A;  3B3W A;  2EK8 A;  4KLV A;  1ARL A;  3SXN A;  1CX8 A;  1VIX A;  3MRU A;  3SJE A;  1Y0R A;  4F8Z A;  2C1C A;  1AMP A;  1A2Z A;  4UIA A;  3IJ3 A;  4ZX8 A;  3CPX A;  5I4M A;  1PUA A;  3TO7 A;  4NGS A;  5JPH A;  1Z5R A;  3FVL A;  4A37 A;  4B6Z A;  2PSW A;  2CNM A;  1UWY A;  1Y7R A;  3FED A;  3VH9 A;  3D3S A;  4G1P A;  4BIN A;  5AG6 A;  1ELM P;  2HC9 A;  4MMO A;  3TOA A;  4HPS A;  2VI7 A;  3R9E A;  3S9M A;  1Y0Y A;  2HB6 A;  3PFO A;  4MHZ A;  2B3V A;  4OP4 A;  4P6Y A;  5EMI A;  3IU1 A;  4JZ0 A;  1Z8W A;  5K8M A;  3W6X A;  1QMU A;  2O28 A;  4II9 A;  2B3U A;  2CTC A;  3KR5 A;  4NXY A;  1YW6 A;  3PBB A;  1IU8 A;  2CXA A;  3EC4 A;  3LAC A;  1XE4 A;  1KUY A;  4KLW A;  3PFE A;  1KUV A;  3IIB A;  1Z9U A;  5F49 A;  3BI1 A;  3LWU A;  3EO4 A;  3R9F A;  2PJ0 A;  2BL1 A;  4PK3 A;  4B14 A;  2JLM A;  2Q4Y A;  4QB9 A;  1YLO A;  2J8M A;  4A39 A;  4U5Y A;  2CTB A;  2A4N A;  4CPA A;  4CRZ B;  1IGB A;  1QQ9 A;  2PJ1 A;  3CXP A;  4P4D A;  3IEH A;  4OC0 A;  4UFV A;  3SJX A;  3PB7 X;  2G3A A;  1YK3 A;  2OH1 A;  2EK9 A;  3NH5 A;  5HMN A;  2FE7 A;  2REF A;  4R87 A;  4A2Z A;  4CS0 B;  3PZJ A;  1BPM A;  1VHS A;  3W6S A;  4P4B A;  1DTD A;  3LMS A;  2I00 A;  3KZW A;  4C68 A;  2OZU A;  2Y0M A;  1YLE A;  4UWI A;  3FF3 A;  4NJQ A;  4ZY2 A;  2VEZ A;  1ZO0 A;  2K5T A;  3H4Q A;  3PP9 A;  1QSN A;  4NGR A;  1MK4 A;  4EVY A;  5J8F A;  2B4D A;  4KUB A;  4AXV A;  2HUZ A;  4DNC A;  3KGQ A;  4NEX A;  1CBX A;  3FEC A;  4IK2 A;  4CGM A;  3JRU A;  1XMT A;  3PBE A;  1WK4 A;  5AG4 A;  1RO5 A;  4YWY A;  1LOK A;  3UY5 A;  3FBU A;  1HDU A;  2ZW7 A;  4R9M A;  4ZX9 A;  1Z4R A;  2XEI A;  3GYA A;  4A32 A;  2RFH A;  4PXD A;  2C6G A;  2CY2 A;  3D7D A;  4P4I A;  2CIJ A;  3MGD A;  4C2X A;  8CPA A;  4F9U A;  2Z3M A;  3DR8 A;  4CAV A;  1Y7E A;  2FSR A;  4AVB A;  5LRJ A;  3V8I A;  3QAH A;  3TO9 A;  1JWQ A;  2QYV A;  2PJ7 A;  1AYE A;  1Z8L A;  4OC2 A;  4NGQ A;  5ELY A;  3EXN A;  1LAN A;  2NYQ A;  3DNS A;  3NE7 A;  4UIB A;  5J8C A;  1CPX A;  2P6G A;  2Z3N A;  3TO6 A;  4QVT A;  3D66 A;  3N5F A;  4NGM A;  1XF8 A;  3NA6 A;  3KQX A;  4ONU A;  2ZW6 A;  1H8L A;  2AJ6 A;  2B58 A;  3NH8 A;  1QSM A;  2PJ8 A;  4KOR A;  4MCP A;  4Y49 C;  4OKO A;  2PDO A;  3ZJ0 A;  4C2Z A;  5CBM A;  4A38 A;  1L0C A;  3RAM A;  4MY3 A;  3TFY A;  5F48 A;  5G22 A;  5C88 A;  2AFS A;  1TF8 A;  3SI0 A;  4LQ6 A;  2HQY A;  4YGO A;  1IOF A;  2JEV A;  3JUW A;  4KOV A;  5D8N A;  3H8G A;  4BD9 A;  2PR1 A;  4MFJ A;  2CNT A;  4JLY A;  2HV2 A;  3FJU A;  5H86 A;  1YR0 A;  1JQG A;  4B12 A;  4PSW A;  3MN8 A;  4QUS A;  5KTD A;  4UFW A;  1U6M A;  2YGW A;  4A95 A;  2AFZ A;  1Q2D A;  2NMT A;  3QAY A;  4Y49 B;  3R1K A;  2F7V A;  3ISZ A;  1IOI A;  4CYQ A;  2VQY A;  4ZBG A;  4NF1 A;  4KSF A;  1BO4 A;  2Q0Y A;  4R8F A;  2Z3K A;  2R7H A;  5G21 A;  4HNW B;  1QSR A;  2DEA A;  1LAM A;  4MCS A;  4Q38 A;  4B10 A;  1XRY A;  3KHX A;  2AFU A;  4OAE A;  2GAN A;  4A30 A;  4F0Y A;  4C7H A;  4PXC A;  2PRQ A;  4OID A;  3SHP A;  1TF9 A;  2V8H A;  3I3G A;  2ZEL A;  3B3V A;  3V38 A;  1YSJ A;  3A9L A;  3SJF A;  3QB8 A;  3WR7 A;  1XFO A;  3PB9 X;  5F47 A;  2EVN A;  2VZY A;  2H5M A;  4KVX A;  1XIX A;  4TNU A;  3D4U A;  5G20 A;  1KUX A;  4KVM E;  4MFK A;  3FIX A;  4KOX A;  5HH1 A;  4RS2 A;  3P2H A;  5H84 A;  2Q4V A;  2I3C A;  4U9Y A;  2OR4 A;  4IAV A;  5K8O A;  4QC6 A;  4AVA A;  1UFH A;  3F0A A;  3W91 A;  2WUU A;  3LD2 A;  4A94 A;  4XPD C;  5D29 A;  4CAE A;  3DGV A;  4M6I A;  4Q36 A;  3TE4 A;  3RZA A;  1PU9 A;  1Q7L A;  3SJG A;  1R57 A;  3KAS A;  4UFX A;  3RYO A;  1Y9K A;  1AUG A;  2V8D A;  4MFQ A;  4MCR A;  1CPS A;  1NSA A;  3HLP A;  4K30 A;  1IYK A;  1LCP A;  5HXD A;  1P4N A;  4M6H A;  1YME A;  4MY0 A;  2Z3O A;  3F5B A;  4UF4 A;  2EUI A;  4E8O A;  1OZP A;  1VGY A;  2Q04 A;  3P2F A;  4XPD B;  5LYF A;  2VZZ A;  2PJ6 A;  4ZY1 A;  1WWZ A;  5G1Z A;  1Y9W A;  2BCO A;  1YX0 A;  4IHM A;  4K3N A;  5A27 A;  3G3S A;  4H2K A;  2F8H A;  3CPA A;  2PRB A;  5LYI A;  1M4G A;  4FBE A;  2AFO A;  3D8P A;  1QST A;  4C2Y A;  4OC3 A;  1TKF A;  1YVO A;  2Z3L A;  3PEI A;  5A28 A;  2OU2 A;  5AG5 A;  5I0C A;  4CRY B;  2ZEE A;  3FNC A;  4OAD A;  4OLL A;  4NGN A; 
#chains in the Genus database with same CATH homology
 1B6B A;  2CNS A;  3S6K A;  1S3Z A;  3GKR A;  2P6E A;  1FY7 A;  2VBQ A;  1S7L A;  4CGN A;  3IGR A;  1YVK A;  2WSA A;  4MFZ A;  4B11 A;  5E96 A;  4R57 A;  2GIV A;  1N71 A;  3D2M A;  4M3S A;  4UA3 A;  3R9G A;  4CAW A;  2G0B A;  2P6F A;  3IWE A;  1B87 A;  4QBJ A;  3JVN A;  5AG7 A;  4HNX B;  4KZT A;  1M4I A;  4BBH A;  4UWJ A;  4R3L A;  2YNC C;  4KSA A;  1YGH A;  1CM0 A;  4MJ8 A;  1TIQ A;  1IYL A;  3TOB A;  2B5G B;  2D4P A;  2DPT A;  2VXK A;  2Z0Z A;  2AE6 A;  2J8R A;  2JDC A;  1LRZ A;  4PV6 A;  1XEB A;  4B5P A;  5DWM A;  2DXQ A;  4MBU A;  1ON0 A;  1MJ9 A;  4J3G A;  5KTA A;  1RXT A;  2BUE A;  2D4O A;  4JXQ A;  4AG9 A;  2B4D B;  4KS9 A;  4CYO A;  4XNH B;  4CGO A;  2WPX A;  3EFA A;  2FIW A;  4L8A A;  4AG7 A;  4YFJ A;  4KOU A;  4F0X A;  2FIA A;  5DWN A;  3D2P A;  3PGP A;  4UCP A;  2YNE A;  3FXT A;  4JJX A;  1NSL A;  1BOB A;  4KOS A;  4E0A A;  5IV0 A;  2FL4 A;  4B13 A;  1I1D A;  1NMT A;  2IL4 A;  2OB0 A;  3S6G A;  4B5P B;  4HNY B;  1Q2C A;  1V0C A;  2DPS A;  2REE A;  1I21 A;  1S60 A;  4MFP A;  3LOD A;  4KOT A;  1MJB A;  2ZW5 A;  4IF5 A;  4L89 A;  4CYN A;  2FXF A;  5IX3 A;  2ATR A;  3OWC A;  2F5I A;  3R95 A;  2FCK A;  5AGE A;  2ARH A;  5CNP A;  4PSX A;  3BJ7 A;  3KKW A;  3GY9 A;  4CAF A;  4KOY A;  4JWP A;  4MFL A;  2YNC A;  2I79 A;  4KOW A;  1S5K A;  3VWE A;  4PK2 A;  5ISV A;  3T90 A;  4RI1 A;  3DDD A;  1Q2Y A;  4R3K A;  3FRM A;  3N7Z A;  4XPL A;  3ZZI A;  2FS5 A;  2B4B A;  4KUA A;  4JXR A;  2C27 A;  4NSQ A;  5GCN A;  4MI4 A;  4ORF A;  4XPK A;  1M44 A;  4U9Z A;  1M1D A;  1K4J A;  2G3T A;  1SQH A;  2OZG A;  3H5Z A;  3EY5 A;  4FD5 A;  2P0W A;  2FT0 A;  2R98 A;  5BWA B;  4YRH A;  1IB1 E;  5EBV A;  4FD4 A;  2RC4 A;  2Z3P A;  1CJW A;  1NE9 A;  2ZW4 A;  4H6Z A;  3B8G A;  5EC4 A;  1MJA A;  3BJ8 A;  4IUS A;  4JD6 A;  2B5G A;  3DR6 A;  4A33 A;  2GE3 A;  5C82 A;  3FYN A;  2J8N A;  1IIC A;  1P0H A;  5KTC A;  2ZXV A;  3K9U A;  2PR8 A;  4CGP A;  4C7I A;  3CXS A;  1QSO A;  2X7B A;  4CGL A;  4GS4 A;  4UBR A;  1S7N A;  3SXO A;  1YRE A;  2BSW A;  4CAX A;  4F6A A;  1Z4E A;  1KZF A;  1J4J A;  1GHE A;  2KCW A;  3FB3 A;  5FVJ A;  3TTH A;  3TCV A;  3E0K A;  2Q44 A;  4A31 A;  4NCZ A;  2Q7B A;  4FD6 A;  4AVC A;  5F46 A;  3C26 A;  2WPW A;  2OZH A;  3VWD A;  2Z11 A;  3S6F A;  3IWG A;  5JQ4 A;  2YND A;  2BEI A;  3BLN A;  4XNH C;  1I12 A;  4LX9 A;  1S7F A;  3IU2 A;  4B5O A;  2Z10 A;  2ZPA A;  4M85 A;  4FD7 A;  4HKF A;  4BMH A;  3I9S A;  1IID A;  3TT2 A;  3F8K A;  2JDD A;  4H6U A;  2PC1 A;  3DSB A;  4AB7 A;  2R1I A;  4I49 A;  4LUA A;  2PQ8 A;  4CYP A;  3JTK A;  4KVO E;  2R8V A;  3T9Y A;  3S6H A;  2QML A;  1M4D A;  4UCN A;  3G8W A;  4UCM A;  1VKC A;  4X5K A;  4MHD A;  2QIR A;  5IB0 A;  2QEC A;  3R96 A;  4H89 A;  3CXQ A;  4E2A A;  1S7K A;  4KLV A;  3SXN A;  1PUA A;  3TO7 A;  5JPH A;  2PSW A;  2CNM A;  1Y7R A;  3D3S A;  5AG6 A;  3TOA A;  2VI7 A;  3R9E A;  2B3V A;  3IU1 A;  3W6X A;  2O28 A;  4II9 A;  2B3U A;  4NXY A;  2CXA A;  3EC4 A;  1XE4 A;  1KUY A;  4KLW A;  1KUV A;  1Z9U A;  5F49 A;  3EO4 A;  3R9F A;  2BL1 A;  4PK3 A;  4B14 A;  2JLM A;  2Q4Y A;  4QB9 A;  2J8M A;  4U5Y A;  2A4N A;  4CRZ B;  3CXP A;  4UFV A;  2G3A A;  1YK3 A;  2OH1 A;  5HMN A;  2FE7 A;  2REF A;  4R87 A;  4A2Z A;  4CS0 B;  3PZJ A;  1VHS A;  3W6S A;  2I00 A;  4C68 A;  2OZU A;  2Y0M A;  1YLE A;  4UWI A;  2VEZ A;  1ZO0 A;  2K5T A;  3H4Q A;  3PP9 A;  1QSN A;  4EVY A;  1MK4 A;  5J8F A;  2B4D A;  4KUB A;  2HUZ A;  4DNC A;  4NEX A;  4CGM A;  1XMT A;  1WK4 A;  5AG4 A;  1RO5 A;  3UY5 A;  3FBU A;  2ZW7 A;  4R9M A;  1Z4R A;  3GYA A;  4A32 A;  2CY2 A;  3MGD A;  4C2X A;  2Z3M A;  3DR8 A;  4CAV A;  2FSR A;  4AVB A;  3V8I A;  3QAH A;  3TO9 A;  3EXN A;  3DNS A;  3NE7 A;  5J8C A;  2P6G A;  2Z3N A;  3TO6 A;  4QVT A;  1XF8 A;  4ONU A;  2ZW6 A;  2AJ6 A;  4ZGY B;  2B58 A;  1QSM A;  4KOR A;  4Y49 C;  4C2Z A;  3ZJ0 A;  2PDO A;  1L0C A;  4MY3 A;  3TFY A;  5F48 A;  5G22 A;  5C88 A;  2HQY A;  4YGO A;  2JEV A;  3JUW A;  4KOV A;  2PR1 A;  4MFJ A;  2CNT A;  4JLY A;  2HV2 A;  5H86 A;  1YR0 A;  4B12 A;  4PSW A;  4QUS A;  5KTD A;  4UFW A;  1U6M A;  2YGW A;  4A95 A;  1Q2D A;  2NMT A;  4Y49 B;  3R1K A;  4CYQ A;  2VQY A;  4ZBG A;  4NF1 A;  4KSF A;  1BO4 A;  2Q0Y A;  2Z3K A;  2R7H A;  5G21 A;  4HNW B;  1QSR A;  4Q38 A;  4B10 A;  4OAE A;  2GAN A;  4A30 A;  4F0Y A;  4C7H A;  3SHP A;  3I3G A;  3A9L A;  3QB8 A;  3WR7 A;  5F47 A;  2EVN A;  2VZY A;  2H5M A;  4KVX A;  1XIX A;  5G20 A;  1KUX A;  4KVM E;  4MFK A;  3FIX A;  4KOX A;  5HH1 A;  4RS2 A;  3P2H A;  5H84 A;  2Q4V A;  4U9Y A;  4QC6 A;  4AVA A;  1UFH A;  3F0A A;  3W91 A;  2WUU A;  3LD2 A;  4XPD C;  4CAE A;  4Q36 A;  3TE4 A;  1PU9 A;  1R57 A;  4UFX A;  3RYO A;  1Y9K A;  4MFQ A;  1IYK A;  1P4N A;  4E8O A;  4MY0 A;  2Z3O A;  3F5B A;  2EUI A;  1OZP A;  2Q04 A;  3P2F A;  4XPD B;  2VZZ A;  1WWZ A;  5G1Z A;  1Y9W A;  1YX0 A;  5A27 A;  3G3S A;  2PRB A;  1M4G A;  3D8P A;  1QST A;  4C2Y A;  1YVO A;  2Z3L A;  5A28 A;  2OU2 A;  5AG5 A;  5I0C A;  4CRY B;  4K30 A;  3FNC A;  4OAD A;  4OLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...