5AGEA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a benzomorpholinone ligand
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
total genus 119
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ageA00
4UFXA 4CYOA 3IU2A 4CYNA 4UCNA 3H5ZA 4A95A 4UFWA 3IWEA 5A27A 4C2ZA 4C2YA 4CGLA 4B10A 4A30A 5AG4A 2WUUA 4C7IA 4CAFA 5G1ZA 4CAEA 4A33A 4B12A 4BBHA 5G20A 5G22A 4C2XA 4CYQA 4A2ZA 4B13A 5AG7A 2YNCC 4UCPA 3JTKA 4CGNA 2YNEA 4UFVA 5A28A 5AG5A 4B14A 2WSAA 5G21A 3IU1A 4A31A 4CYPA 4C68A 4UCMA 4C7HA 4B11A 4CGPA 5AG6A 2YNDA 4CGMA 4CGOA 2YNCA 5AGEA 4A32A
chains in the Genus database with same CATH superfamily
4JXRA 3TOBA 3V38A 4IF5A 2PR1A 3SHPA 2FE7A 2GLJA 3ZZIA 2GLFA 2ZELA 3T9YA 3BI1A 4CGLA 4ZYQA 3PZJA 2CTCA 2D4PA 1JWQA 1Y0RA 4IAVA 4CAXA 4II9A 4KSAA 2CTBA 4P6YA 4JWPA 1K4JA 2EWBA 2ZOGA 3CPAA 2I79A 2ARHA 2CXAA 4OP4A 1X10A 2DXQA 4P44A 4C7IA 2Q0YA 3EXNA 4QVTA 5G20A 2PRBA 1PUAA 4PPZA 4NGSA 3K9UA 1AYEA 5LYFA 2OH1A 1LCPA 2WSAA 3SI2A 1XMBA 3FYNA 2ZEOA 2FL4A 4H6UA 2FCKA 3PB4X 4XPLA 1TKFA 4MCPA 2R8VA 4OC1A 3D67A 4WJBA 2QIRA 3FEDA 3TOAA 1XFOA 2B3UA 2B3VA 2Z3MA 2HUZA 3MN8A 1RTQA 3PB7X 4PXBA 3VWEA 2CY2A 2AFUA 1UWYA 2JDDA 4KVOE 2FIAA 2PJ7A 4X8IA 4R7MA 2BOAA 2J8NA 4MY0A 1ZLHA 4MFJA 1GYTA 1YW6A 1XRYA 4KS9A 2BL1A 2V8DA 4KOSA 4JJXA 1BOBA 2QECA 2B4BA 1UFHA 2RB7A 2NYQA 2ABZA 3IGRA 5I0CA 2WYRA 4KLVA 1ELLP 4O23A 3R96A 1Y9WA 2FVGA 1Y7EA 2AFWA 3P2FA 7CPAA 3PFEA 4NGRA 4UCMA 5K8OA 5ISVA 3PBBA 3IO1A 5BWAB 4UIBA 4MFPA 5F49A 4Q7AA 3ISZA 3KQZA 4MHNA 5LYDA 3CZXA 4L8AA 4L89A 1AUGA 2ZEDA 5EMIA 1Z8TA 5EC4A 2GFQA 4X2TA 1IOFA 1EE3P 3B2YA 2RC4A 1A2ZA 4KOTA 5JH9A 4B13A 3S6HA 4U9ZA 3GY9A 4OIWA 2JEWA 2CIJA 1CM0A 5IV0A 3GLJA 4P4FA 2JBKA 3K9TA 2PJBA 1TIQA 4YGOA 2IMOA 1IU8A 3RO0A 2P6FA 3IJ3A 4UF4A 2GIVA 2PE3A 3IWGA 2BO9A 4AVBA 2AE6A 1DTDA 2Z3LA 4KSIA 2ZW7A 3T8WA 1AMPA 1B87A 1M1DA 2ZEGA 2Q43A 4MHYA 5A27A 3B3SA 4ZX9A 1ARLA 3T90A 1FT7A 4FD6A 1U6MA 2POKA 4DUKA 2AFOA 2B4DB 1KUVA 3KL9A 4QC6A 2ANPA 2ZW6A 3LMSA 5CPAA 3CXSA 1CJWA 3NE8A 4A2ZA 1Q2YA 2PQ8A 5A28A 2VXKA 1RO5A 1YVKA 4BMHA 3S6GA 1YLOA 4KOYA 4J3GA 4RN7A 1QMUA 4CGOA 2EBJA 4KOWA 3S9NA 4NGNA 4M6IA 1CX8A 3IU2A 4NFRA 3V7ZA 4UCNA 2WPXA 1XF8A 1HDUA 1TF8A 4M85A 3S6KA 2Z3PA 3NH8A 3EFAA 2Y0MA 4BD9A 3S9LA 3D8PA 1TXRA 4H89A 1MJBA 3QAHA 3DLJA 2H5MA 4MFZA 5H84A 4MFKA 4A30A 2O28A 4Q36A 4B5PA 1KWMA 1Z8XA 1BO4A 2G0BA 4OC5A 4E2AA 4P4IA 3WT4A 5CNPA 4UA3A 2JDCA 4JYWA 1XJOA 3V8IA 2ZEEA 1QQ9A 1M4GA 4MY3A 3PB6X 5AG5A 1QSOA 1S7KA 5G21A 2Z10A 4WWVA 1R3NA 4F0XA 3IEHA 4OADA 1LAMA 3FH4A 3GKRA 4AB7A 2FXFA 2ZW5A 2C6CA 1OZPA 1YK3A 3RNZA 2O53A 1WK4A 4U5YA 2R7HA 2X7BA 4CYNA 4KSFA 4MI4A 3I3GA 2CNMA 1I12A 1VGYA 4BINA 3IWEA 3BJ7A 4EWTA 1ZLIA 2AJ6A 1M4IA 2DF5A 3D3SA 1P0HA 2EK8A 2DEAA 1HEEA 1YVOA 4PXDA 3JUWA 3N5FA 1ZG7A 6CPAA 1I21A 2PJ2A 2YGWA 4OLLA 2G3AA 3OWCA 1ZG8A 3SI1A 1YSJA 2DPTA 3E0KA 4YRHA 2R1IA 2YNEA 3W6SA 5HMNA 4ZX8A 5CBMA 1S3ZA 4Z65A 5LRKA 4A39A 3D4UA 2WPWA 1Q7LA 3FIXA 5F46A 4KZTA 3CDXA 1IY7A 4KUBA 4P4EA 4MCRA 4TWEA 4F8ZA 4Q38A 2VZYA 4CGMA 5LRGA 4DNCA 1BPNA 5IB0A 3GUXA 3JVNA 2ODFA 3FBUA 5DS0A 1Z8WA 5E96A 1IICA 2V8HA 1PU9A 2PDOA 1QSRA 2Q04A 3UY5A 4NSQA 3H8FA 2VL1A 3D2PA 5LRJA 5HVFA 1YR0A 4KUAA 2P6EA 2HV2A 4F6AA 4ZY1A 2ATRA 2GANA 1NSAA 1TKJA 1KUXA 1GHEA 4UBRA 3EC4A 4NEXA 1QSTA 1Z8LA 4R87A 5GCNA 3S6FA 4CYQA 4NGMA 4G1PA 1Z4RA 1BAVA 2I00A 3IC1A 4LUAA 4MFLA 4OC4A 4E8OA 3R9EA 3DNSA 3NH4A 2BUEA 4GS4A 3B8GA 1H8LA 4MCSA 4P45A 4ZBGA 4EVYA 4KOVA 2YNCA 1P4NA 3HUVA 3KI9A 3PB9X 1YX0A 4X5KA 4P10A 1TKHA 2XEGA 3I1UA 3WC7A 1ZO0A 5C88A 2JLMA 3IWWA 3VWDA 1S7LA 4PSXA 5KTCA 3L2NA 2V8VA 1HDQA 3DR8A 3R1KA 3TCVA 4CAFA 4B12A 4MHZA 2EK9A 3R95A 5JM6A 3SXOA 3LACA 4MJ8A 5DWNA 2JEVA 1Z5RA 2PJ4A 3B3WA 3SXNA 2P0WA 3EY5A 3DDDA 1M4DA 1NE9A 3MRUA 4P4JA 5FVJA 4JZ0A 1WWZA 3GYAA 1R57A 1FY7A 3D66A 4YWYA 4CYOA 3KASA 1ZG9A 4H2KA 3C26A 2Q4VA 2Z11A 3LD2A 2PRQA 2PJ6A 2C27A 1XMTA 2F7VA 4AG9A 3S9MA 2IL4A 2NSMA 4AXVA 4B5PB 4C2ZA 4OMEA 4LQ6A 3CPXA 4TNUA 5KTDA 3TFYA 4OIDA 2BSWA 2AFMA 1VKCA 1XE4A 4YU9A 1I1DA 2HB6A 3WABA 1CPSA 4AG7A 4PV6A 4JD6A 1NSLA 4KLWA 3B3CA 1J4JA 4UCPA 3D7FA 4A38A 4OKOA 2OB0A 3H4QA 2JBJA 4NF1A 2ZOFA 4CS0B 4DJLA 2PVVA 4R57A 1M4LA 1VHSA 2P6GA 4UEFA 1VHEA 5D8NA 5J1QA 2IJZA 5AG6A 1Z2LA 2YNDA 4A37A 1MK4A 4GXHA 4FBEA 1Y7RA 5DWMA 4FAIA 3NH5A 2GREA 3MGDA 3GB0A 1R43A 4X3RA 4XNHB 2REEA 4HNYB 2PJ0A 4QUSA 3WC6A 4ZY0A 1Z4EA 3PP9A 3QNVA 2XEFA 2IQ6A 4NJQA 3B3TA 3SJEA 2B58A 1L0CA 2FT0A 2R98A 4FD5A 2OOTA 2J8RA 3R9GA 2OR4A 3A9LA 4A33A 4CAEA 2PIZA 4Y49B 3N7ZA 2J9AA 3KHXA 1BLLE 4C2XA 3KQXA 2Q4ZA 5AG7A 4IK2A 3TO7A 3TO6A 3IFEA 3TT2A 1IIDA 3EO4A 2BEIA 1CBXA 2PR8A 2Z3OA 3PEIA 3PRTA 4MFQA 4NGPA 3IU1A 4F9UA 5HVGA 2Q4YA 3KGQA 2C6GA 3F0AA 4JLYA 2VI7A 4EFDA 5EBVA 4UFXA 1IOIA 2PJ1A 5H86A 1F2OA 4EMEA 4NJRA 3BJ8A 3KR5A 4NCZA 4NGTA 4R6TA 5LYIA 1QSMA 4KORA 5K8NA 3KHZA 2CF4A 3BI0A 1B6BA 3PBEA 4NXYA 3W91A 2Z3NA 2WZNA 1F57A 3WR7A 2EO8A 2ZEFA 5K8MA 1LAPA 2BCOA 4ZI6A 1FNOA 3D68A 4PK2A 3D7DA 3RYOA 3TX8A 4AVCA 2OZGA 3VATA 2RFHA 3HLPA 1RXTA 4NGQA 2VEZA 3TC8A 3PGPA 2O4HA 3FX6A 1XIXA 4CRYB 3P2HA 4E0AA 4C7HA 2VZZA 3BLNA 3BXMA 4B11A 2OU2A 4MCQA 2VQYA 3QAYA 5JQ4A 4UWIA 1KZFA 3R9FA 4A32A 5C82A 3TE4A 4B6ZA 4RI1A 1OBRA 2D4OA 3CT9A 8CPAA 1Q2DA 2ZEHA 5F09A 2Z0ZA 3CXQA 1S7FA 4MRIA 4F0YA 2V8GA 3K2KA 1PCAA 1XEBA 2OZUA 4C2YA 2REFA 4MBUA 3FF3A 4XPDB 4ZY2A 5J8CA 3ZJ0A 4KVXA 3DGVA 2G9DA 3FNCA 4MMOA 3B35A 3FECA 4M6GA 2EVNA 5HVHA 4HPSA 3W6XA 5K8PA 1KUYA 4CGNA 1IB1E 2I3CA 3SJFA 3I9SA 1LANA 5JGFA 4R76A 4UWJA 5HXDA 3TTHA 1LFWA 4C68A 1S7NA 3FB3A 3FMCA 3ISXA 5HH1A 5IX3A 5LYLA 1V0CA 1MJAA 4MHDA 4XNHC 4HNXB 3H8EA 1NMTA 1IYLA 1YGHA 2QMLA 3NFZA 2ZENA 1ARMA 4B10A 3DR6A 1LOKA 4KVME 4Y49C 2QJ8A 2HQYA 4I49A 1TF9A 1YREA 2PVWA 3FEEA 4PXCA 2PJCA 3KR4A 5G1ZA 4CAVA 2F8HA 5G22A 3PFOA 2Q7BA 5J8FA 1IYKA 4UEEA 1S5KA 4UFVA 2FS5A 2ZW4A 4M3SA 1QSNA 3H8GA 3LWUA 2QVPA 3NE7A 4KOXA 4H6ZA 4A31A 1MJ9A 2K5TA 1LRZA 3D2MA 2B5GB 2AFSA 2XEJA 3QB8A 4F9VA 4R3KA 3CXPA 5AGEA 4QBJA 2CNTA 3RZAA 2PJ3A 1PYTB 4FD7A 4UEZA 3GIUA 4UFWA 2ZEMA 4PSWA 3NA6A 4RS2A 4PK3A 2CNSA 2PJ5A 3DSBA 4DYOA 1XOVA 3SI0A 1ELMP 5D29A 1VHOA 1XBUA 3TO9A 5AG4A 1ON0A 3JRUA 2F5IA 4AVAA 1N71A 4ORFA 2NMTA 4FUUA 2AFZA 3D7GA 2VBQA 1JQGA 2Q44A 4JXQA 2C1CA 3FXTA 2YNCC 3KZWA 4K30A 1VIXA 3F8KA 4B14A 1Q2CA 4R8FA 2ZEPA 4QB9A 4B5OA 2AFXA 2G3TA 4IUSA 1Y0YA 5F47A 4ZGYB 2DPSA 3IIBA 1Z9UA 5JPHA 3B3VA 4K3NA 3B7IA 3H5ZA 4LQGA 2PJAA 3VH9A 2B5GA 4XPDC 4A95A 5KTAA 4ONWA 1CP7A 4OAEA 2ZXVA 1S60A 1CPXA 2J8MA 1Y9KA 2PSWA 3G8WA 4ONUA 4A94A 1YLEA 3KKWA 3FRMA 3LODA 4FD4A 1YW4A 2PIYA 4R3LA 3FJUA 4HKFA 2HC9A 4W9YA 1CP6A 4BBHA 4CAWA 3BHXA 1M44A 5THWA 4XPKA 3SJGA 2PCUA 5F48A 1IGBA 1YQEA 2GU2A 4CYPA 2XEIA 4MHPA 4YFJA 5ELYA 2V77A 4GM5A 1DE4C 4M6HA 5I4MA 4R9MA 4UIAA 2GE3A 1BPMA 4OC3A 5IB9A 3SJXA 4CRZB 2Q51A 2Q7SA 2PC1A 4CPAA 1F2PA 4PQAA 2KCWA 3F5BA 4U9YA 4RUHA 2WUUA 2EUIA 2PJ8A 3PB8X 3RBUA 3FVLA 3D7HA 4OC2A 4LX9A 4MXUA 4P4BA 2B4DA 1YMEA 2ZPAA 4KOUA 2FIWA 4HNWB 3JTKA 3VARA 4IHMA 2QYVA 2C6PA 4OC0A 4P4DA 4PXEA 1SQHA 4CGPA 2PJ9A 4FWUA 2A4NA 2FSRA 2Z3KA 1CG2A 3G3SA 2OZHA 3RAMA 3WC5A 1X12A
chains in the Genus database with same CATH topology
4JXRA 3TOBA 4IF5A 2PR1A 3SHPA 2FE7A 3ZZIA 3T9YA 4CGLA 3PZJA 2D4PA 4CAXA 4II9A 4KSAA 4JWPA 1K4JA 2I79A 2ARHA 2CXAA 4C7IA 2DXQA 2Q0YA 3EXNA 4QVTA 5G20A 2PRBA 1PUAA 3K9UA 2OH1A 2WSAA 3FYNA 2FL4A 4H6UA 2FCKA 4XPLA 2R8VA 2QIRA 3TOAA 2B3UA 2B3VA 2Z3MA 2HUZA 3VWEA 2CY2A 2JDDA 4KVOE 2FIAA 2J8NA 4MY0A 4MFJA 4KS9A 2BL1A 4KOSA 4JJXA 1BOBA 2QECA 2B4BA 1UFHA 3IGRA 5I0CA 4KLVA 3R96A 1Y9WA 3P2FA 4UCMA 5ISVA 5BWAB 4MFPA 5F49A 4L8AA 4L89A 5EC4A 2RC4A 4KOTA 4B13A 3S6HA 4U9ZA 3GY9A 1CM0A 5IV0A 5KTAA 4YGOA 1TIQA 2P6FA 2GIVA 3IWGA 4AVBA 2AE6A 2Z3LA 2ZW7A 1B87A 1M1DA 5A27A 3T90A 4FD6A 1U6MA 2B4DB 1KUVA 4QC6A 2ZW6A 3CXSA 1CJWA 4A2ZA 1Q2YA 2PQ8A 5A28A 2VXKA 1RO5A 1YVKA 4BMHA 3S6GA 4KOYA 4J3GA 4CGOA 4KOWA 3IU2A 4UCNA 2WPXA 1XF8A 4M85A 3S6KA 2Z3PA 3EFAA 2Y0MA 3D8PA 4H89A 1MJBA 3QAHA 5H84A 2H5MA 4MFZA 4A30A 4MFKA 2O28A 4Q36A 4B5PA 2G0BA 1BO4A 4E2AA 5CNPA 4UA3A 2JDCA 3V8IA 1M4GA 4MY3A 5AG5A 1QSOA 1S7KA 5G21A 2Z10A 4F0XA 4OADA 4AB7A 3GKRA 2FXFA 2ZW5A 1OZPA 1YK3A 1WK4A 4U5YA 2R7HA 2X7BA 4CYNA 4KSFA 4MI4A 3I3GA 2CNMA 1I12A 3IWEA 3BJ7A 2AJ6A 1M4IA 3D3SA 1P0HA 1YVOA 3JUWA 1I21A 2YGWA 4OLLA 2G3AA 3OWCA 2DPTA 3E0KA 4YRHA 2R1IA 2YNEA 3W6SA 5HMNA 1S3ZA 5F46A 2WPWA 3FIXA 4KZTA 4KUBA 4Q38A 2VZYA 4CGMA 4DNCA 5IB0A 3JVNA 3FBUA 5E96A 1IICA 1PU9A 2PDOA 1QSRA 2Q04A 3UY5A 4NSQA 3D2PA 1YR0A 4KUAA 2P6EA 2HV2A 4F6AA 2ATRA 2GANA 1KUXA 1GHEA 4UBRA 3EC4A 4NEXA 1QSTA 4R87A 5GCNA 3S6FA 4CYQA 1Z4RA 2I00A 4LUAA 4MFLA 4E8OA 3R9EA 3DNSA 2BUEA 4GS4A 3B8GA 4EVYA 4ZBGA 4KOVA 2YNCA 1P4NA 1YX0A 4X5KA 1ZO0A 5C88A 2JLMA 3VWDA 1S7LA 4PSXA 5KTCA 3DR8A 3R1KA 3TCVA 4CAFA 4B12A 3R95A 3SXOA 4MJ8A 5DWNA 2JEVA 3SXNA 2P0WA 3EY5A 3DDDA 1M4DA 1NE9A 5FVJA 1WWZA 3GYAA 1FY7A 1R57A 4CYOA 3C26A 2Q4VA 2Z11A 3LD2A 2C27A 1XMTA 4AG9A 2IL4A 4B5PB 4C2ZA 5KTDA 3TFYA 2BSWA 1VKCA 1XE4A 1I1DA 4AG7A 4PV6A 4JD6A 1NSLA 4KLWA 1J4JA 4UCPA 2OB0A 3H4QA 4NF1A 4CS0B 4R57A 1VHSA 2P6GA 5AG6A 2YNDA 1MK4A 1Y7RA 5DWMA 3MGDA 4XNHB 2REEA 4HNYB 4QUSA 1Z4EA 3PP9A 2B58A 1L0CA 2FT0A 2R98A 4FD5A 2J8RA 3R9GA 3A9LA 4A33A 4CAEA 4Y49B 3N7ZA 4C2XA 5AG7A 3TO7A 3TO6A 3TT2A 1IIDA 3EO4A 2BEIA 2PR8A 2Z3OA 4MFQA 3IU1A 2Q4YA 3F0AA 4JLYA 2VI7A 5EBVA 4UFXA 5H86A 3BJ8A 4NCZA 1QSMA 4KORA 4NXYA 1B6BA 3W91A 2Z3NA 3WR7A 4PK2A 3RYOA 4AVCA 2OZGA 1RXTA 2VEZA 3PGPA 1XIXA 4CRYB 3P2HA 4E0AA 4C7HA 2VZZA 3BLNA 4B11A 2OU2A 2VQYA 5JQ4A 4UWIA 1KZFA 3R9FA 5C82A 3TE4A 4RI1A 2D4OA 1Q2DA 2Z0ZA 3CXQA 1S7FA 4F0YA 1XEBA 2OZUA 4C2YA 2REFA 4MBUA 4XPDB 5J8CA 3ZJ0A 4KVXA 3FNCA 2EVNA 3W6XA 1KUYA 4CGNA 1IB1E 3I9SA 4UWJA 3TTHA 4C68A 1S7NA 3FB3A 5HH1A 5IX3A 1V0CA 1MJAA 4MHDA 4XNHC 4HNXB 1NMTA 1IYLA 1YGHA 2QMLA 4B10A 3DR6A 4KVME 4Y49C 2HQYA 4I49A 1YREA 4CAVA 5G1ZA 5G22A 2Q7BA 5J8FA 1IYKA 1S5KA 4UFVA 2FS5A 2ZW4A 4M3SA 1QSNA 4KOXA 4A31A 3NE7A 4H6ZA 1MJ9A 2K5TA 1LRZA 3D2MA 2B5GB 3QB8A 4R3KA 3CXPA 5AGEA 4QBJA 2CNTA 4FD7A 4UFWA 4PSWA 4RS2A 4PK3A 2CNSA 3DSBA 3TO9A 1ON0A 2F5IA 4AVAA 1N71A 4ORFA 2NMTA 2VBQA 4JXQA 2Q44A 3FXTA 4K30A 2YNCC 3F8KA 4B14A 1Q2CA 4QB9A 4B5OA 2G3TA 4IUSA 5F47A 4ZGYB 2DPSA 1Z9UA 5JPHA 3H5ZA 4A95A 2B5GA 4XPDC 4OAEA 2ZXVA 1S60A 2J8MA 1Y9KA 2PSWA 3G8WA 4ONUA 1YLEA 3KKWA 3FRMA 3LODA 4FD4A 4R3LA 5AG4A 4HKFA 4BBHA 4CAWA 1M44A 4XPKA 5F48A 4CYPA 4YFJA 4R9MA 2GE3A 4CRZB 2PC1A 2KCWA 3F5BA 4U9YA 2WUUA 2EUIA 4LX9A 2B4DA 2ZPAA 4KOUA 2FIWA 4HNWB 3JTKA 1SQHA 4CGPA 2A4NA 2FSRA 2Z3KA 3G3SA 2OZHA 4A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFX A;  4CYO A;  3IU2 A;  4CYN A;  4UCN A;  3H5Z A;  4A95 A;  4UFW A;  3IWE A;  5A27 A;  4C2Z A;  4C2Y A;  4CGL A;  4B10 A;  4A30 A;  5AG4 A;  2WUU A;  4C7I A;  4CAF A;  5G1Z A;  4CAE A;  4A33 A;  4B12 A;  4BBH A;  5G20 A;  5G22 A;  4C2X A;  4CYQ A;  4A2Z A;  4B13 A;  5AG7 A;  2YNC C;  4UCP A;  3JTK A;  4CGN A;  2YNE A;  4UFV A;  5A28 A;  5AG5 A;  4B14 A;  2WSA A;  5G21 A;  3IU1 A;  4A31 A;  4CYP A;  4C68 A;  4UCM A;  4C7H A;  4B11 A;  4CGP A;  5AG6 A;  2YND A;  4CGM A;  4CGO A;  2YNC A;  5AGE A;  4A32 A; 
#chains in the Genus database with same CATH topology
 4JXR A;  3TOB A;  3V38 A;  4IF5 A;  2PR1 A;  3SHP A;  2FE7 A;  2GLJ A;  3ZZI A;  2GLF A;  2ZEL A;  3T9Y A;  3BI1 A;  4CGL A;  4ZYQ A;  3PZJ A;  2CTC A;  2D4P A;  1JWQ A;  1Y0R A;  4IAV A;  4CAX A;  4II9 A;  4KSA A;  2CTB A;  4P6Y A;  4JWP A;  1K4J A;  2EWB A;  2ZOG A;  3CPA A;  2I79 A;  2ARH A;  2CXA A;  4OP4 A;  1X10 A;  2DXQ A;  4P44 A;  4C7I A;  2Q0Y A;  3EXN A;  4QVT A;  5G20 A;  2PRB A;  1PUA A;  4PPZ A;  4NGS A;  3K9U A;  1AYE A;  5LYF A;  2OH1 A;  1LCP A;  2WSA A;  3SI2 A;  1XMB A;  3FYN A;  2ZEO A;  2FL4 A;  4H6U A;  2FCK A;  3PB4 X;  4XPL A;  1TKF A;  4MCP A;  2R8V A;  4OC1 A;  3D67 A;  4WJB A;  2QIR A;  3FED A;  3TOA A;  1XFO A;  2B3U A;  2B3V A;  2Z3M A;  2HUZ A;  3MN8 A;  1RTQ A;  3PB7 X;  4PXB A;  3VWE A;  2CY2 A;  2AFU A;  1UWY A;  2JDD A;  4KVO E;  2FIA A;  2PJ7 A;  4X8I A;  4R7M A;  2BOA A;  2J8N A;  4MY0 A;  1ZLH A;  4MFJ A;  1GYT A;  1YW6 A;  1XRY A;  4KS9 A;  2BL1 A;  2V8D A;  4KOS A;  4JJX A;  1BOB A;  2QEC A;  2B4B A;  1UFH A;  2RB7 A;  2NYQ A;  2ABZ A;  3IGR A;  5I0C A;  2WYR A;  4KLV A;  1ELL P;  4O23 A;  3R96 A;  1Y9W A;  2FVG A;  1Y7E A;  2AFW A;  3P2F A;  7CPA A;  3PFE A;  4NGR A;  4UCM A;  5K8O A;  5ISV A;  3PBB A;  3IO1 A;  5BWA B;  4UIB A;  4MFP A;  5F49 A;  4Q7A A;  3ISZ A;  3KQZ A;  4MHN A;  5LYD A;  3CZX A;  4L8A A;  4L89 A;  1AUG A;  2ZED A;  5EMI A;  1Z8T A;  5EC4 A;  2GFQ A;  4X2T A;  1IOF A;  1EE3 P;  3B2Y A;  2RC4 A;  1A2Z A;  4KOT A;  5JH9 A;  4B13 A;  3S6H A;  4U9Z A;  3GY9 A;  4OIW A;  2JEW A;  2CIJ A;  1CM0 A;  5IV0 A;  3GLJ A;  4P4F A;  2JBK A;  3K9T A;  2PJB A;  1TIQ A;  4YGO A;  2IMO A;  1IU8 A;  3RO0 A;  2P6F A;  3IJ3 A;  4UF4 A;  2GIV A;  2PE3 A;  3IWG A;  2BO9 A;  4AVB A;  2AE6 A;  1DTD A;  2Z3L A;  4KSI A;  2ZW7 A;  3T8W A;  1AMP A;  1B87 A;  1M1D A;  2ZEG A;  2Q43 A;  4MHY A;  5A27 A;  3B3S A;  4ZX9 A;  1ARL A;  3T90 A;  1FT7 A;  4FD6 A;  1U6M A;  2POK A;  4DUK A;  2AFO A;  2B4D B;  1KUV A;  3KL9 A;  4QC6 A;  2ANP A;  2ZW6 A;  3LMS A;  5CPA A;  3CXS A;  1CJW A;  3NE8 A;  4A2Z A;  1Q2Y A;  2PQ8 A;  5A28 A;  2VXK A;  1RO5 A;  1YVK A;  4BMH A;  3S6G A;  1YLO A;  4KOY A;  4J3G A;  4RN7 A;  1QMU A;  4CGO A;  2EBJ A;  4KOW A;  3S9N A;  4NGN A;  4M6I A;  1CX8 A;  3IU2 A;  4NFR A;  3V7Z A;  4UCN A;  2WPX A;  1XF8 A;  1HDU A;  1TF8 A;  4M85 A;  3S6K A;  2Z3P A;  3NH8 A;  3EFA A;  2Y0M A;  4BD9 A;  3S9L A;  3D8P A;  1TXR A;  4H89 A;  1MJB A;  3QAH A;  3DLJ A;  2H5M A;  4MFZ A;  5H84 A;  4MFK A;  4A30 A;  2O28 A;  4Q36 A;  4B5P A;  1KWM A;  1Z8X A;  1BO4 A;  2G0B A;  4OC5 A;  4E2A A;  4P4I A;  3WT4 A;  5CNP A;  4UA3 A;  2JDC A;  4JYW A;  1XJO A;  3V8I A;  2ZEE A;  1QQ9 A;  1M4G A;  4MY3 A;  3PB6 X;  5AG5 A;  1QSO A;  1S7K A;  5G21 A;  2Z10 A;  4WWV A;  1R3N A;  4F0X A;  3IEH A;  4OAD A;  1LAM A;  3FH4 A;  3GKR A;  4AB7 A;  2FXF A;  2ZW5 A;  2C6C A;  1OZP A;  1YK3 A;  3RNZ A;  2O53 A;  1WK4 A;  4U5Y A;  2R7H A;  2X7B A;  4CYN A;  4KSF A;  4MI4 A;  3I3G A;  2CNM A;  1I12 A;  1VGY A;  4BIN A;  3IWE A;  3BJ7 A;  4EWT A;  1ZLI A;  2AJ6 A;  1M4I A;  2DF5 A;  3D3S A;  1P0H A;  2EK8 A;  2DEA A;  1HEE A;  1YVO A;  4PXD A;  3JUW A;  3N5F A;  1ZG7 A;  6CPA A;  1I21 A;  2PJ2 A;  2YGW A;  4OLL A;  2G3A A;  3OWC A;  1ZG8 A;  3SI1 A;  1YSJ A;  2DPT A;  3E0K A;  4YRH A;  2R1I A;  2YNE A;  3W6S A;  5HMN A;  4ZX8 A;  5CBM A;  1S3Z A;  4Z65 A;  5LRK A;  4A39 A;  3D4U A;  2WPW A;  1Q7L A;  3FIX A;  5F46 A;  4KZT A;  3CDX A;  1IY7 A;  4KUB A;  4P4E A;  4MCR A;  4TWE A;  4F8Z A;  4Q38 A;  2VZY A;  4CGM A;  5LRG A;  4DNC A;  1BPN A;  5IB0 A;  3GUX A;  3JVN A;  2ODF A;  3FBU A;  5DS0 A;  1Z8W A;  5E96 A;  1IIC A;  2V8H A;  1PU9 A;  2PDO A;  1QSR A;  2Q04 A;  3UY5 A;  4NSQ A;  3H8F A;  2VL1 A;  3D2P A;  5LRJ A;  5HVF A;  1YR0 A;  4KUA A;  2P6E A;  2HV2 A;  4F6A A;  4ZY1 A;  2ATR A;  2GAN A;  1NSA A;  1TKJ A;  1KUX A;  1GHE A;  4UBR A;  3EC4 A;  4NEX A;  1QST A;  1Z8L A;  4R87 A;  5GCN A;  3S6F A;  4CYQ A;  4NGM A;  4G1P A;  1Z4R A;  1BAV A;  2I00 A;  3IC1 A;  4LUA A;  4MFL A;  4OC4 A;  4E8O A;  3R9E A;  3DNS A;  3NH4 A;  2BUE A;  4GS4 A;  3B8G A;  1H8L A;  4MCS A;  4P45 A;  4ZBG A;  4EVY A;  4KOV A;  2YNC A;  1P4N A;  3HUV A;  3KI9 A;  3PB9 X;  1YX0 A;  4X5K A;  4P10 A;  1TKH A;  2XEG A;  3I1U A;  3WC7 A;  1ZO0 A;  5C88 A;  2JLM A;  3IWW A;  3VWD A;  1S7L A;  4PSX A;  5KTC A;  3L2N A;  2V8V A;  1HDQ A;  3DR8 A;  3R1K A;  3TCV A;  4CAF A;  4B12 A;  4MHZ A;  2EK9 A;  3R95 A;  5JM6 A;  3SXO A;  3LAC A;  4MJ8 A;  5DWN A;  2JEV A;  1Z5R A;  2PJ4 A;  3B3W A;  3SXN A;  2P0W A;  3EY5 A;  3DDD A;  1M4D A;  1NE9 A;  3MRU A;  4P4J A;  5FVJ A;  4JZ0 A;  1WWZ A;  3GYA A;  1R57 A;  1FY7 A;  3D66 A;  4YWY A;  4CYO A;  3KAS A;  1ZG9 A;  4H2K A;  3C26 A;  2Q4V A;  2Z11 A;  3LD2 A;  2PRQ A;  2PJ6 A;  2C27 A;  1XMT A;  2F7V A;  4AG9 A;  3S9M A;  2IL4 A;  2NSM A;  4AXV A;  4B5P B;  4C2Z A;  4OME A;  4LQ6 A;  3CPX A;  4TNU A;  5KTD A;  3TFY A;  4OID A;  2BSW A;  2AFM A;  1VKC A;  1XE4 A;  4YU9 A;  1I1D A;  2HB6 A;  3WAB A;  1CPS A;  4AG7 A;  4PV6 A;  4JD6 A;  1NSL A;  4KLW A;  3B3C A;  1J4J A;  4UCP A;  3D7F A;  4A38 A;  4OKO A;  2OB0 A;  3H4Q A;  2JBJ A;  4NF1 A;  2ZOF A;  4CS0 B;  4DJL A;  2PVV A;  4R57 A;  1M4L A;  1VHS A;  2P6G A;  4UEF A;  1VHE A;  5D8N A;  5J1Q A;  2IJZ A;  5AG6 A;  1Z2L A;  2YND A;  4A37 A;  1MK4 A;  4GXH A;  4FBE A;  1Y7R A;  5DWM A;  4FAI A;  3NH5 A;  2GRE A;  3MGD A;  3GB0 A;  1R43 A;  4X3R A;  4XNH B;  2REE A;  4HNY B;  2PJ0 A;  4QUS A;  3WC6 A;  4ZY0 A;  1Z4E A;  3PP9 A;  3QNV A;  2XEF A;  2IQ6 A;  4NJQ A;  3B3T A;  3SJE A;  2B58 A;  1L0C A;  2FT0 A;  2R98 A;  4FD5 A;  2OOT A;  2J8R A;  3R9G A;  2OR4 A;  3A9L A;  4A33 A;  4CAE A;  2PIZ A;  4Y49 B;  3N7Z A;  2J9A A;  3KHX A;  1BLL E;  4C2X A;  3KQX A;  2Q4Z A;  5AG7 A;  4IK2 A;  3TO7 A;  3TO6 A;  3IFE A;  3TT2 A;  1IID A;  3EO4 A;  2BEI A;  1CBX A;  2PR8 A;  2Z3O A;  3PEI A;  3PRT A;  4MFQ A;  4NGP A;  3IU1 A;  4F9U A;  5HVG A;  2Q4Y A;  3KGQ A;  2C6G A;  3F0A A;  4JLY A;  2VI7 A;  4EFD A;  5EBV A;  4UFX A;  1IOI A;  2PJ1 A;  5H86 A;  1F2O A;  4EME A;  4NJR A;  3BJ8 A;  3KR5 A;  4NCZ A;  4NGT A;  4R6T A;  5LYI A;  1QSM A;  4KOR A;  5K8N A;  3KHZ A;  2CF4 A;  3BI0 A;  1B6B A;  3PBE A;  4NXY A;  3W91 A;  2Z3N A;  2WZN A;  1F57 A;  3WR7 A;  2EO8 A;  2ZEF A;  5K8M A;  1LAP A;  2BCO A;  4ZI6 A;  1FNO A;  3D68 A;  4PK2 A;  3D7D A;  3RYO A;  3TX8 A;  4AVC A;  2OZG A;  3VAT A;  2RFH A;  3HLP A;  1RXT A;  4NGQ A;  2VEZ A;  3TC8 A;  3PGP A;  2O4H A;  3FX6 A;  1XIX A;  4CRY B;  3P2H A;  4E0A A;  4C7H A;  2VZZ A;  3BLN A;  3BXM A;  4B11 A;  2OU2 A;  4MCQ A;  2VQY A;  3QAY A;  5JQ4 A;  4UWI A;  1KZF A;  3R9F A;  4A32 A;  5C82 A;  3TE4 A;  4B6Z A;  4RI1 A;  1OBR A;  2D4O A;  3CT9 A;  8CPA A;  1Q2D A;  2ZEH A;  5F09 A;  2Z0Z A;  3CXQ A;  1S7F A;  4MRI A;  4F0Y A;  2V8G A;  3K2K A;  1PCA A;  1XEB A;  2OZU A;  4C2Y A;  2REF A;  4MBU A;  3FF3 A;  4XPD B;  4ZY2 A;  5J8C A;  3ZJ0 A;  4KVX A;  3DGV A;  2G9D A;  3FNC A;  4MMO A;  3B35 A;  3FEC A;  4M6G A;  2EVN A;  5HVH A;  4HPS A;  3W6X A;  5K8P A;  1KUY A;  4CGN A;  1IB1 E;  2I3C A;  3SJF A;  3I9S A;  1LAN A;  5JGF A;  4R76 A;  4UWJ A;  5HXD A;  3TTH A;  1LFW A;  4C68 A;  1S7N A;  3FB3 A;  3FMC A;  3ISX A;  5HH1 A;  5IX3 A;  5LYL A;  1V0C A;  1MJA A;  4MHD A;  4XNH C;  4HNX B;  3H8E A;  1NMT A;  1IYL A;  1YGH A;  2QML A;  3NFZ A;  2ZEN A;  1ARM A;  4B10 A;  3DR6 A;  1LOK A;  4KVM E;  4Y49 C;  2QJ8 A;  2HQY A;  4I49 A;  1TF9 A;  1YRE A;  2PVW A;  3FEE A;  4PXC A;  2PJC A;  3KR4 A;  5G1Z A;  4CAV A;  2F8H A;  5G22 A;  3PFO A;  2Q7B A;  5J8F A;  1IYK A;  4UEE A;  1S5K A;  4UFV A;  2FS5 A;  2ZW4 A;  4M3S A;  1QSN A;  3H8G A;  3LWU A;  2QVP A;  3NE7 A;  4KOX A;  4H6Z A;  4A31 A;  1MJ9 A;  2K5T A;  1LRZ A;  3D2M A;  2B5G B;  2AFS A;  2XEJ A;  3QB8 A;  4F9V A;  4R3K A;  3CXP A;  5AGE A;  4QBJ A;  2CNT A;  3RZA A;  2PJ3 A;  1PYT B;  4FD7 A;  4UEZ A;  3GIU A;  4UFW A;  2ZEM A;  4PSW A;  3NA6 A;  4RS2 A;  4PK3 A;  2CNS A;  2PJ5 A;  3DSB A;  4DYO A;  1XOV A;  3SI0 A;  1ELM P;  5D29 A;  1VHO A;  1XBU A;  3TO9 A;  5AG4 A;  1ON0 A;  3JRU A;  2F5I A;  4AVA A;  1N71 A;  4ORF A;  2NMT A;  4FUU A;  2AFZ A;  3D7G A;  2VBQ A;  1JQG A;  2Q44 A;  4JXQ A;  2C1C A;  3FXT A;  2YNC C;  3KZW A;  4K30 A;  1VIX A;  3F8K A;  4B14 A;  1Q2C A;  4R8F A;  2ZEP A;  4QB9 A;  4B5O A;  2AFX A;  2G3T A;  4IUS A;  1Y0Y A;  5F47 A;  4ZGY B;  2DPS A;  3IIB A;  1Z9U A;  5JPH A;  3B3V A;  4K3N A;  3B7I A;  3H5Z A;  4LQG A;  2PJA A;  3VH9 A;  2B5G A;  4XPD C;  4A95 A;  5KTA A;  4ONW A;  1CP7 A;  4OAE A;  2ZXV A;  1S60 A;  1CPX A;  2J8M A;  1Y9K A;  2PSW A;  3G8W A;  4ONU A;  4A94 A;  1YLE A;  3KKW A;  3FRM A;  3LOD A;  4FD4 A;  1YW4 A;  2PIY A;  4R3L A;  3FJU A;  4HKF A;  2HC9 A;  4W9Y A;  1CP6 A;  4BBH A;  4CAW A;  3BHX A;  1M44 A;  5THW A;  4XPK A;  3SJG A;  2PCU A;  5F48 A;  1IGB A;  1YQE A;  2GU2 A;  4CYP A;  2XEI A;  4MHP A;  4YFJ A;  5ELY A;  2V77 A;  4GM5 A;  1DE4 C;  4M6H A;  5I4M A;  4R9M A;  4UIA A;  2GE3 A;  1BPM A;  4OC3 A;  5IB9 A;  3SJX A;  4CRZ B;  2Q51 A;  2Q7S A;  2PC1 A;  4CPA A;  1F2P A;  4PQA A;  2KCW A;  3F5B A;  4U9Y A;  4RUH A;  2WUU A;  2EUI A;  2PJ8 A;  3PB8 X;  3RBU A;  3FVL A;  3D7H A;  4OC2 A;  4LX9 A;  4MXU A;  4P4B A;  2B4D A;  1YME A;  2ZPA A;  4KOU A;  2FIW A;  4HNW B;  3JTK A;  3VAR A;  4IHM A;  2QYV A;  2C6P A;  4OC0 A;  4P4D A;  4PXE A;  1SQH A;  4CGP A;  2PJ9 A;  4FWU A;  2A4N A;  2FSR A;  2Z3K A;  1CG2 A;  3G3S A;  2OZH A;  3RAM A;  3WC5 A;  1X12 A; 
#chains in the Genus database with same CATH homology
 4JXR A;  3TOB A;  4IF5 A;  2PR1 A;  3SHP A;  2FE7 A;  3ZZI A;  3T9Y A;  4CGL A;  3PZJ A;  2D4P A;  4CAX A;  4II9 A;  4KSA A;  4JWP A;  1K4J A;  2I79 A;  2ARH A;  2CXA A;  4C7I A;  2DXQ A;  2Q0Y A;  3EXN A;  4QVT A;  5G20 A;  2PRB A;  1PUA A;  3K9U A;  2OH1 A;  2WSA A;  3FYN A;  2FL4 A;  4H6U A;  2FCK A;  4XPL A;  2R8V A;  2QIR A;  3TOA A;  2B3U A;  2B3V A;  2Z3M A;  2HUZ A;  3VWE A;  2CY2 A;  2JDD A;  4KVO E;  2FIA A;  2J8N A;  4MY0 A;  4MFJ A;  4KS9 A;  2BL1 A;  4KOS A;  4JJX A;  1BOB A;  2QEC A;  2B4B A;  1UFH A;  3IGR A;  5I0C A;  4KLV A;  3R96 A;  1Y9W A;  3P2F A;  4UCM A;  5ISV A;  5BWA B;  4MFP A;  5F49 A;  4L8A A;  4L89 A;  5EC4 A;  2RC4 A;  4KOT A;  4B13 A;  3S6H A;  4U9Z A;  3GY9 A;  1CM0 A;  5IV0 A;  5KTA A;  4YGO A;  1TIQ A;  2P6F A;  2GIV A;  3IWG A;  4AVB A;  2AE6 A;  2Z3L A;  2ZW7 A;  1B87 A;  1M1D A;  5A27 A;  3T90 A;  4FD6 A;  1U6M A;  2B4D B;  1KUV A;  4QC6 A;  2ZW6 A;  3CXS A;  1CJW A;  4A2Z A;  1Q2Y A;  2PQ8 A;  5A28 A;  2VXK A;  1RO5 A;  1YVK A;  4BMH A;  3S6G A;  4KOY A;  4J3G A;  4CGO A;  4KOW A;  3IU2 A;  4UCN A;  2WPX A;  1XF8 A;  4M85 A;  3S6K A;  2Z3P A;  3EFA A;  2Y0M A;  3D8P A;  4H89 A;  1MJB A;  3QAH A;  5H84 A;  2H5M A;  4MFZ A;  4A30 A;  4MFK A;  2O28 A;  4Q36 A;  4B5P A;  2G0B A;  1BO4 A;  4E2A A;  5CNP A;  4UA3 A;  2JDC A;  3V8I A;  1M4G A;  4MY3 A;  5AG5 A;  1QSO A;  1S7K A;  5G21 A;  2Z10 A;  4F0X A;  4OAD A;  4AB7 A;  3GKR A;  2FXF A;  2ZW5 A;  1OZP A;  1YK3 A;  1WK4 A;  4U5Y A;  2R7H A;  2X7B A;  4CYN A;  4KSF A;  4MI4 A;  3I3G A;  2CNM A;  1I12 A;  3IWE A;  3BJ7 A;  2AJ6 A;  1M4I A;  3D3S A;  1P0H A;  1YVO A;  3JUW A;  1I21 A;  2YGW A;  4OLL A;  2G3A A;  3OWC A;  2DPT A;  3E0K A;  4YRH A;  2R1I A;  2YNE A;  3W6S A;  5HMN A;  1S3Z A;  5F46 A;  2WPW A;  3FIX A;  4KZT A;  4KUB A;  4Q38 A;  2VZY A;  4CGM A;  4DNC A;  5IB0 A;  3JVN A;  3FBU A;  5E96 A;  1IIC A;  1PU9 A;  2PDO A;  1QSR A;  2Q04 A;  3UY5 A;  4NSQ A;  3D2P A;  1YR0 A;  4KUA A;  2P6E A;  2HV2 A;  4F6A A;  2ATR A;  2GAN A;  1KUX A;  1GHE A;  4UBR A;  3EC4 A;  4NEX A;  1QST A;  4R87 A;  5GCN A;  3S6F A;  4CYQ A;  1Z4R A;  2I00 A;  4LUA A;  4MFL A;  4E8O A;  3R9E A;  3DNS A;  2BUE A;  4GS4 A;  3B8G A;  4EVY A;  4ZBG A;  4KOV A;  2YNC A;  1P4N A;  1YX0 A;  4X5K A;  1ZO0 A;  5C88 A;  2JLM A;  3VWD A;  1S7L A;  4PSX A;  5KTC A;  3DR8 A;  3R1K A;  3TCV A;  4CAF A;  4B12 A;  3R95 A;  3SXO A;  4MJ8 A;  5DWN A;  2JEV A;  3SXN A;  2P0W A;  3EY5 A;  3DDD A;  1M4D A;  1NE9 A;  5FVJ A;  1WWZ A;  3GYA A;  1FY7 A;  1R57 A;  4CYO A;  3C26 A;  2Q4V A;  2Z11 A;  3LD2 A;  2C27 A;  1XMT A;  4AG9 A;  2IL4 A;  4B5P B;  4C2Z A;  5KTD A;  3TFY A;  2BSW A;  1VKC A;  1XE4 A;  1I1D A;  4AG7 A;  4PV6 A;  4JD6 A;  1NSL A;  4KLW A;  1J4J A;  4UCP A;  2OB0 A;  3H4Q A;  4NF1 A;  4CS0 B;  4R57 A;  1VHS A;  2P6G A;  5AG6 A;  2YND A;  1MK4 A;  1Y7R A;  5DWM A;  3MGD A;  4XNH B;  2REE A;  4HNY B;  4QUS A;  1Z4E A;  3PP9 A;  2B58 A;  1L0C A;  2FT0 A;  2R98 A;  4FD5 A;  2J8R A;  3R9G A;  3A9L A;  4A33 A;  4CAE A;  4Y49 B;  3N7Z A;  4C2X A;  5AG7 A;  3TO7 A;  3TO6 A;  3TT2 A;  1IID A;  3EO4 A;  2BEI A;  2PR8 A;  2Z3O A;  4MFQ A;  3IU1 A;  2Q4Y A;  3F0A A;  4JLY A;  2VI7 A;  5EBV A;  4UFX A;  5H86 A;  3BJ8 A;  4NCZ A;  1QSM A;  4KOR A;  4NXY A;  1B6B A;  3W91 A;  2Z3N A;  3WR7 A;  4PK2 A;  3RYO A;  4AVC A;  2OZG A;  1RXT A;  2VEZ A;  3PGP A;  1XIX A;  4CRY B;  3P2H A;  4E0A A;  4C7H A;  2VZZ A;  3BLN A;  4B11 A;  2OU2 A;  2VQY A;  5JQ4 A;  4UWI A;  1KZF A;  3R9F A;  5C82 A;  3TE4 A;  4RI1 A;  2D4O A;  1Q2D A;  2Z0Z A;  3CXQ A;  1S7F A;  4F0Y A;  1XEB A;  2OZU A;  4C2Y A;  2REF A;  4MBU A;  4XPD B;  5J8C A;  3ZJ0 A;  4KVX A;  3FNC A;  2EVN A;  3W6X A;  1KUY A;  4CGN A;  1IB1 E;  3I9S A;  4UWJ A;  3TTH A;  4C68 A;  1S7N A;  3FB3 A;  5HH1 A;  5IX3 A;  1V0C A;  1MJA A;  4MHD A;  4XNH C;  4HNX B;  1NMT A;  1IYL A;  1YGH A;  2QML A;  4B10 A;  3DR6 A;  4KVM E;  4Y49 C;  2HQY A;  4I49 A;  1YRE A;  4CAV A;  5G1Z A;  5G22 A;  2Q7B A;  5J8F A;  1IYK A;  1S5K A;  4UFV A;  2FS5 A;  2ZW4 A;  4M3S A;  1QSN A;  4KOX A;  4A31 A;  3NE7 A;  4H6Z A;  1MJ9 A;  2K5T A;  1LRZ A;  3D2M A;  2B5G B;  3QB8 A;  4R3K A;  3CXP A;  5AGE A;  4QBJ A;  2CNT A;  4FD7 A;  4UFW A;  4PSW A;  4RS2 A;  4PK3 A;  2CNS A;  3DSB A;  3TO9 A;  1ON0 A;  2F5I A;  4AVA A;  1N71 A;  4ORF A;  2NMT A;  2VBQ A;  4JXQ A;  2Q44 A;  3FXT A;  4K30 A;  2YNC C;  3F8K A;  4B14 A;  1Q2C A;  4QB9 A;  4B5O A;  2G3T A;  4IUS A;  5F47 A;  4ZGY B;  2DPS A;  1Z9U A;  5JPH A;  3H5Z A;  4A95 A;  2B5G A;  4XPD C;  4OAE A;  2ZXV A;  1S60 A;  2J8M A;  1Y9K A;  2PSW A;  3G8W A;  4ONU A;  1YLE A;  3KKW A;  3FRM A;  3LOD A;  4FD4 A;  4R3L A;  5AG4 A;  4HKF A;  4BBH A;  4CAW A;  1M44 A;  4XPK A;  5F48 A;  4CYP A;  4YFJ A;  4R9M A;  2GE3 A;  4CRZ B;  2PC1 A;  2KCW A;  3F5B A;  4U9Y A;  2WUU A;  2EUI A;  4LX9 A;  2B4D A;  2ZPA A;  4KOU A;  2FIW A;  4HNW B;  3JTK A;  1SQH A;  4CGP A;  2A4N A;  2FSR A;  2Z3K A;  3G3S A;  2OZH A;  4A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...