5AGEA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a benzomorpholinone ligand
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 119
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ageA00
5AG7A 4CAEA 4C68A 5G20A 4C2YA 4B13A 2YNCC 2YNCA 3IU2A 4UFWA 4C7IA 2YNDA 4A32A 4A30A 4A2ZA 2WUUA 4B12A 4CGPA 4B14A 3IU1A 4B10A 4CYPA 5G21A 4UCMA 3IWEA 4CYQA 5AGEA 4A33A 4C2ZA 4UCPA 4B11A 4C7HA 2YNEA 4CGOA 4CYNA 5AG4A 4CGNA 4C2XA 5G1ZA 4UFXA 5AG5A 4BBHA 5A28A 5A27A 3H5ZA 4CAFA 5AG6A 4A31A 4CGLA 3JTKA 4UFVA 4CYOA 2WSAA 4UCNA 4CGMA 5G22A 4A95A
chains in the Genus database with same CATH superfamily
2ZEOA 4CAEA 2PVWA 4C68A 1QQ9A 1ARMA 3IIBA 1YLEA 2GU2A 4X3RA 4M3SA 3FEEA 3B3TA 1NSLA 2EK8A 1XIXA 4IK2A 2FS5A 2P6EA 1I12A 2OZUA 1B6BA 1OZPA 2EUIA 3H8GA 2NYQA 2V8DA 4C2ZA 1Z8WA 4OC0A 2Z3PA 1Z8LA 4ZBGA 1LAMA 5IB0A 5K8PA 3KL9A 2Z10A 2O28A 3DSBA 4MMOA 2B5GA 4NGSA 3D3SA 4EWTA 4FUUA 2QECA 3QNVA 1M4LA 2ANPA 1F2OA 3WR7A 3CXQA 4MHPA 5EC4A 3IC1A 2WPXA 4FD6A 5AG7A 2PRBA 4CAXA 3VARA 4M6HA 4MCQA 1KUVA 4FD4A 4M6IA 3RO0A 5F46A 2J8MA 5HVGA 1QSNA 2CF4A 4KOVA 1CP7A 4G1PA 4NGRA 4B14A 3G8WA 4MCRA 2Z3NA 2Z3MA 4UEEA 3KGQA 2HUZA 2HV2A 3VWDA 4MFLA 4B5PB 4YRHA 2R1IA 2ZEFA 4OC1A 2QVPA 2OR4A 4U9YA 2Q4YA 2V8VA 4KOWA 1YREA 2ATRA 5JM6A 2ZEEA 2KCWA 1AYEA 3B35A 4UFXA 4ORFA 3FBUA 3WT4A 2ZPAA 3D66A 4F0XA 2Q51A 5D8NA 4MFPA 5DWNA 2IQ6A 4NJQA 3TO7A 1IYKA 3D7GA 5ELYA 2JBJA 4KVME 1AUGA 4CAVA 1P4NA 1XMBA 3D2PA 1Y7EA 1VIXA 2B4DA 3IU2A 3NFZA 1LAPA 1EE3P 1M4GA 2V77A 2VBQA 3R95A 4DYOA 3R9FA 4ZI6A 3WC6A 4AVCA 4R57A 1TF8A 3SHPA 3KR4A 5KTDA 2D4PA 2REFA 2Y0MA 3ISZA 2FT0A 4ZX9A 2C6GA 2PR8A 3S9MA 1ELMP 4PK2A 5F09A 1U6MA 3E0KA 3NE8A 5A27A 4MFQA 4CPAA 2ZEDA 3V7ZA 4Q7AA 4RS2A 1QSTA 1GYTA 4L8AA 2VZYA 4OC5A 4QBJA 3ISXA 4M6GA 1M1DA 2NSMA 3DGVA 3G3SA 2CNSA 4PXBA 2OOTA 1MJ9A 3S6FA 4P6YA 4C2YA 4CRYB 4Z65A 4MI4A 3H8EA 3T90A 2BEIA 6CPAA 4KS9A 2ARHA 1XJOA 4HNYB 2ZW5A 2RB7A 5LRGA 5H86A 1LANA 2P0WA 4KSIA 4B12A 5I4MA 2D4OA 3CDXA 3H4QA 4MHDA 5D29A 1CM0A 3B2YA 5K8OA 5J8CA 3KHXA 3MN8A 4CGNA 4H6UA 2V8GA 3W91A 2AFUA 2ZW4A 3FVLA 1VHOA 4U5YA 5AG6A 3NH8A 1IYLA 4A31A 5K8NA 5IX3A 1VHSA 3SXOA 2PJ3A 5LYFA 2IL4A 3PB7X 4TWEA 3HUVA 1M4DA 4JJXA 4OIDA 5LYLA 3PB8X 1YW6A 4A39A 2B3VA 2FCKA 1K4JA 4XNHC 4R87A 2RFHA 1RXTA 3C26A 2YNCA 3KR5A 4KVXA 1WWZA 2RC4A 2WPWA 3JUWA 2HB6A 1QSOA 2HQYA 4X8IA 1IGBA 5G21A 1S7FA 1XEBA 3D7DA 3PFOA 2ZEMA 2DEAA 5EBVA 2JEVA 3QAHA 3I3GA 3N5FA 4CYNA 3D2MA 5HVHA 4XNHB 4MBUA 4H6ZA 1YLOA 2FVGA 1YR0A 4KZTA 4F6AA 3H5ZA 1I1DA 1Z2LA 4P4DA 2GFQA 4NGPA 2G3TA 3TTHA 1ZG9A 1P0HA 2F5IA 5H84A 2JBKA 3D68A 2FIWA 3PGPA 3KQZA 4EMEA 4AG7A 1IU8A 3CXSA 3GYAA 3JRUA 3DLJA 1TXRA 3S9NA 2IMOA 3WABA 3FNCA 4JLYA 3B8GA 2QJ8A 4FD5A 3FXTA 4A30A 4PXCA 4OAEA 3LWUA 4GM5A 4PXEA 4UA3A 3PEIA 3PBEA 1YW4A 4JXRA 1JWQA 1R43A 2J9AA 4GXHA 5BWAB 2J8NA 2PJ4A 3FB3A 1SQHA 3GLJA 1H8LA 3MRUA 4MHNA 4E8OA 2DF5A 3D67A 2P6FA 4P4BA 1ELLP 3RNZA 4P4EA 4NGNA 4BINA 2OZHA 3IWWA 1S7LA 3IEHA 3P2HA 4OMEA 4EFDA 2ZEPA 4GS4A 2Q04A 4PV6A 4EVYA 2Q43A 1JQGA 4X5KA 4CGMA 1F57A 2G9DA 2REEA 1Q2DA 4NGQA 1VGYA 2GLFA 4FWUA 4K30A 2AFSA 2QMLA 3DNSA 4CYPA 2PJ7A 4A37A 3DDDA 5GCNA 2ZELA 2Q7BA 3SI0A 3TT2A 4RUHA 4P4JA 1MK4A 4NGMA 5AGEA 4TNUA 2PJ2A 3R96A 3GIUA 2XEIA 1A2ZA 2AFMA 2EBJA 2FSRA 2PJCA 2VL1A 2GREA 3KI9A 3SJXA 4F0YA 4OP4A 4R3LA 3B3WA 1Z5RA 1HDUA 3SJGA 2EVNA 4UFVA 4MY0A 3IJ3A 2CIJA 2JLMA 3BI1A 1V0CA 4A95A 2OU2A 3R1KA 2CXAA 3BI0A 2PE3A 4MHZA 4UFWA 7CPAA 5EMIA 1I21A 4JZ0A 4AXVA 1YGHA 1LRZA 4LUAA 2JEWA 4B10A 2Z3OA 1Z8XA 2ZW7A 2CNMA 3FMCA 4NGTA 4YFJA 4B11A 1J4JA 1Y9WA 1MJAA 2EK9A 3H8FA 3PZJA 2PJ0A 3ZZIA 3W6XA 3F0AA 1ZG8A 5IV0A 1DE4C 2JDDA 3VH9A 1S5KA 4DJLA 1TIQA 3GKRA 3B7IA 3GUXA 1IB1E 1R57A 2IJZA 4Y49C 1Z4EA 1OBRA 4UIBA 4B5PA 1QMUA 2AFOA 3A9LA 4MJ8A 3VWEA 1CG2A 5J8FA 4MCPA 2ZOFA 4OADA 1X12A 4W9YA 4MFZA 1S60A 3NE7A 2AFZA 3WC7A 3I1UA 1XRYA 1CBXA 4DUKA 1IIDA 3UY5A 1KUXA 1KUYA 1YSJA 3BJ7A 5E96A 3R9EA 1BPNA 5JGFA 4Y49B 2XEFA 1N71A 3MGDA 2FE7A 4KOYA 4R76A 1PUAA 1QSRA 2AJ6A 2DPSA 2PC1A 2PIZA 4IHMA 4IUSA 4F9UA 2AFXA 3PFEA 3TFYA 1Y0YA 2B58A 4CAWA 3SXNA 1Q7LA 5HMNA 4E0AA 4IAVA 2O4HA 4KOTA 4P10A 3S9LA 4WWVA 1IY7A 4XPDC 2WSAA 4L89A 1PYTB 4UCNA 3SI2A 4AB7A 3PP9A 4P45A 4X2TA 4RN7A 4QB9A 2PRQA 2FL4A 2ZXVA 1Z4RA 4MCSA 4QUSA 4ZYQA 4ZY0A 3KKWA 1YX0A 3S6GA 2PQ8A 4M85A 3PB9X 1IOIA 3D7FA 1M4IA 4KORA 1HDQA 2Z3LA 3B3CA 1Y7RA 3CT9A 1WK4A 2PJ5A 4XPDB 4UF4A 1B87A 4NJRA 1S7KA 4FAIA 4R7MA 2C1CA 2Q4VA 3RYOA 1TKHA 2C6CA 2PJAA 2WYRA 1YQEA 3IWGA 5A28A 1YMEA 2B4BA 3CXPA 3CZXA 4LX9A 1AMPA 4CGLA 4HKFA 2O53A 4A94A 3TE4A 4R8FA 3W6SA 2K5TA 3PRTA 4UIAA 1M44A 4YWYA 2Z11A 1KWMA 1XBUA 1XMTA 2PCUA 3FIXA 4OKOA 1XOVA 2BSWA 4U9ZA 4ONUA 4BMHA 1PU9A 2B5GB 5F49A 4F9VA 3TOAA 1BLLE 2BUEA 3TO9A 2EWBA 1TF9A 3HLPA 2Q4ZA 3LODA 4MY3A 1BPMA 4ZY1A 1CX8A 4MFJA 4O23A 1R3NA 2VEZA 3EXNA 3IWEA 2VQYA 4P44A 5HVFA 2PR1A 3BJ8A 2PJ9A 1BAVA 4NFRA 4R3KA 3RBUA 4KUBA 4YU9A 4Q36A 4UEZA 2Z3KA 4HNWB 4BD9A 1XF8A 3JVNA 1Z9UA 1LCPA 2XEGA 3D4UA 5HH1A 3OWCA 2CY2A 2PIYA 2PSWA 4OC4A 1IOFA 3KHZA 2ZW6A 3FYNA 2CNTA 3JTKA 4R6TA 2EO8A 4ZGYB 4PXDA 4JXQA 3TC8A 2Z0ZA 4MRIA 3FX6A 3RZAA 3EC4A 5JQ4A 3FF3A 5CPAA 4B5OA 2H5MA 3ZJ0A 4KSFA 3FECA 4JWPA 4NXYA 4PSWA 4AG9A 2VI7A 4Q38A 4MFKA 3K9TA 4RI1A 5AG4A 1CP6A 5DWMA 2G0BA 2YNEA 4KSAA 5LRKA 1FY7A 2GANA 2PJ6A 4PQAA 5THWA 4C2XA 2B4DB 3D8PA 4QVTA 3K9UA 4ONWA 2ODFA 2V8HA 4QC6A 5LRJA 4KOXA 4ZY2A 2C6PA 1IICA 2PDOA 4WJBA 5LYIA 4XPLA 2OZGA 1LFWA 1YVOA 3NA6A 2FXFA 1UFHA 3IO1A 3F8KA 2OH1A 3TO6A 3GY9A 3L2NA 5CBMA 3SJEA 4CS0B 1BO4A 1ON0A 2QIRA 4R9MA 4C7IA 8CPAA 1GHEA 2PJ1A 4LQ6A 2BL1A 1RTQA 3P2FA 3NH4A 1UWYA 3IU1A 3V38A 1MJBA 4KLWA 3CPXA 1Y0RA 4JYWA 1TKJA 5J1QA 4NF1A 1XE4A 2GE3A 4CRZB 1S3ZA 4OC2A 5JH9A 2J8RA 5DS0A 2DXQA 1VKCA 2AE6A 2BO9A 2ZEGA 4H2KA 4LQGA 3PB4X 3GB0A 2AFWA 3EY5A 1NMTA 1HEEA 5KTAA 3EO4A 4OLLA 1NE9A 5JPHA 2BCOA 1Y9KA 3FEDA 4NEXA 4CYOA 3VATA 4NCZA 3BXMA 2A4NA 3BLNA 4UBRA 3R9GA 4B13A 1FT7A 2YNCC 2ZENA 3B3VA 2P6GA 3FRMA 3LMSA 1QSMA 2BOAA 2FIAA 2GLJA 1F2PA 1PCAA 2R8VA 5KTCA 3CPAA 5C82A 2DPTA 2I00A 3TOBA 3DR8A 4KLVA 2G3AA 2GIVA 2QYVA 4C7HA 4KOUA 4DNCA 5HXDA 4KUAA 3KQXA 1KZFA 1YK3A 2JDCA 3PBBA 4PK3A 2NMTA 3WC5A 1DTDA 1ZO0A 2CTBA 4B6ZA 3QB8A 5CNPA 1CJWA 2PJBA 1NSAA 3T9YA 4JD6A 4P4FA 3B3SA 2Q44A 3SJFA 3TCVA 3IGRA 4AVAA 2OB0A 3TX8A 5G20A 4OC3A 1VHEA 4F8ZA 5F47A 1ARLA 3LACA 4I49A 2YNDA 2XEJA 4A32A 2CTCA 4A2ZA 4E2AA 5C88A 3K2KA 3D7HA 4ZX8A 3F5BA 2Q0YA 1ZG7A 3T8WA 2WZNA 2B3UA 4MXUA 2YGWA 1ZLIA 4KVOE 4NSQA 1S7NA 1ZLHA 3N7ZA 1Z8TA 2X7BA 5G1ZA 3SI1A 2Q7SA 2VXKA 1CPXA 4K3NA 4PSXA 3RAMA 4XPKA 4PPZA 2PVVA 1Q2CA 5K8MA 4HPSA 2R98A 4FD7A 1RO5A 3QAYA 4HNXB 5LYDA 4AVBA 4BBHA 1Q2YA 4II9A 2I79A 1LOKA 2POKA 3NH5A 4KOSA 4UWIA 2F8HA 5FVJA 5G22A 1L0CA 3BHXA 4OIWA 1CPSA 3I9SA 2ABZA 2R7HA 1X10A 2WUUA 4YGOA 4CGPA 3V8IA 2ZEHA 1TKFA 3FH4A 4UEFA 4UCMA 2ZOGA 4CYQA 1YVKA 2VZZA 2I3CA 4A33A 4CGOA 4UCPA 3DR6A 4P4IA 5F48A 4IF5A 1BOBA 2HC9A 3LD2A 3S6KA 5AG5A 3S6HA 4UWJA 3FJUA 3KZWA 4CAFA 5ISVA 1FNOA 3PB6X 2C27A 3KASA 4A38A 4MHYA 5I0CA 2PJ8A 5IB9A 4J3GA 3IFEA 1XFOA 2F7VA 4FBEA 3EFAA 4H89A
chains in the Genus database with same CATH topology
4CAEA 4C68A 1YLEA 4M3SA 1NSLA 1XIXA 2FS5A 2P6EA 1I12A 2OZUA 1B6BA 1OZPA 2EUIA 4C2ZA 2Z3PA 4ZBGA 5IB0A 2Z10A 2O28A 3DSBA 2B5GA 3D3SA 2QECA 3WR7A 3CXQA 5EC4A 2WPXA 4FD6A 5AG7A 2PRBA 4CAXA 5F46A 1KUVA 4FD4A 2J8MA 1QSNA 4KOVA 4B14A 3G8WA 2Z3NA 2Z3MA 2HUZA 2HV2A 3VWDA 4MFLA 4B5PB 4YRHA 2R1IA 4U9YA 2Q4YA 4KOWA 1YREA 2ATRA 2KCWA 4UFXA 4ORFA 3FBUA 4F0XA 2ZPAA 4MFPA 5DWNA 3TO7A 1IYKA 4KVME 4CAVA 1P4NA 3D2PA 3IU2A 2B4DA 1M4GA 2VBQA 3R95A 3R9FA 4AVCA 4R57A 3SHPA 5KTDA 2D4PA 2REFA 2Y0MA 2FT0A 2PR8A 4PK2A 1U6MA 3E0KA 5A27A 4MFQA 4RS2A 1QSTA 4L8AA 2VZYA 4QBJA 3S6FA 1M1DA 3G3SA 2CNSA 1MJ9A 4C2YA 4CRYB 4MI4A 3T90A 2BEIA 4KS9A 2ARHA 4HNYB 2ZW5A 5H86A 2P0WA 4B12A 2D4OA 3H4QA 4MHDA 1CM0A 5J8CA 4CGNA 4H6UA 3W91A 2ZW4A 5AG6A 4U5YA 4A31A 1IYLA 5IX3A 1VHSA 3SXOA 2IL4A 1M4DA 2B3VA 2FCKA 1K4JA 4XNHC 4R87A 1RXTA 3C26A 2YNCA 4KVXA 1WWZA 2RC4A 2WPWA 3JUWA 1QSOA 2HQYA 5G21A 1S7FA 1XEBA 5EBVA 2JEVA 3QAHA 3I3GA 4CYNA 3D2MA 4XNHB 4MBUA 4H6ZA 4KZTA 1YR0A 4F6AA 3H5ZA 1I1DA 3TTHA 2G3TA 2F5IA 1P0HA 5H84A 3PGPA 2FIWA 4AG7A 3CXSA 3GYAA 3FNCA 4JLYA 3B8GA 4FD5A 3FXTA 4A30A 4OAEA 4UA3A 4JXRA 5BWAB 2J8NA 3FB3A 1SQHA 4E8OA 2P6FA 2OZHA 1S7LA 3P2HA 4GS4A 2Q04A 4PV6A 4EVYA 4X5KA 4CGMA 2REEA 1Q2DA 4K30A 2QMLA 3DNSA 4CYPA 3DDDA 5GCNA 2Q7BA 3TT2A 1MK4A 5AGEA 3R96A 2FSRA 4F0YA 4R3LA 2EVNA 4UFVA 4MY0A 2JLMA 1V0CA 4A95A 2OU2A 3R1KA 2CXAA 4UFWA 1I21A 1YGHA 1LRZA 4LUAA 4B10A 2Z3OA 2ZW7A 2CNMA 4YFJA 4B11A 1J4JA 1Y9WA 1MJAA 3PZJA 3ZZIA 3W6XA 3F0AA 5IV0A 2JDDA 1S5KA 1TIQA 3GKRA 1IB1E 1R57A 4Y49C 1Z4EA 4B5PA 3A9LA 4MJ8A 3VWEA 5J8FA 4OADA 4MFZA 1S60A 3NE7A 1IIDA 3UY5A 1KUXA 1KUYA 3BJ7A 5E96A 3R9EA 4Y49B 1N71A 3MGDA 2FE7A 4KOYA 1PUAA 1QSRA 2AJ6A 2DPSA 2PC1A 4IUSA 3TFYA 2B58A 4CAWA 3SXNA 5HMNA 4E0AA 4KOTA 4XPDC 2WSAA 4L89A 4UCNA 4AB7A 3PP9A 4QB9A 2FL4A 2ZXVA 1Z4RA 4QUSA 3KKWA 1YX0A 3S6GA 2PQ8A 4M85A 1M4IA 4KORA 2Z3LA 1Y7RA 1WK4A 4XPDB 1B87A 1S7KA 2Q4VA 3RYOA 3IWGA 5A28A 2B4BA 3CXPA 4LX9A 4CGLA 4HKFA 3TE4A 3W6SA 2K5TA 1M44A 2Z11A 1XMTA 3FIXA 2BSWA 4U9ZA 4ONUA 4BMHA 1PU9A 2B5GB 5F49A 3TOAA 2BUEA 3TO9A 3LODA 4MY3A 4MFJA 2VEZA 3EXNA 3IWEA 2VQYA 2PR1A 3BJ8A 4R3KA 4KUBA 4Q36A 2Z3KA 4HNWB 1XF8A 3JVNA 1Z9UA 5HH1A 3OWCA 2CY2A 2PSWA 2ZW6A 3FYNA 2CNTA 3JTKA 4ZGYB 4JXQA 2Z0ZA 3EC4A 5JQ4A 4B5OA 2H5MA 3ZJ0A 4KSFA 4NXYA 4JWPA 4PSWA 4AG9A 2VI7A 4Q38A 4MFKA 4RI1A 5AG4A 5DWMA 2G0BA 2YNEA 4KSAA 1FY7A 2GANA 4C2XA 2B4DB 3D8PA 4QVTA 3K9UA 4QC6A 4KOXA 1IICA 2PDOA 4XPLA 2OZGA 1YVOA 2FXFA 1UFHA 3F8KA 2OH1A 3TO6A 3GY9A 4CS0B 1BO4A 1ON0A 2QIRA 4R9MA 4C7IA 1GHEA 2BL1A 3P2FA 3IU1A 1MJBA 4KLWA 4NF1A 1XE4A 2GE3A 4CRZB 1S3ZA 2J8RA 2DXQA 1VKCA 2AE6A 3EY5A 1NMTA 5KTAA 3EO4A 4OLLA 1NE9A 5JPHA 1Y9KA 4NEXA 4CYOA 4NCZA 2A4NA 3BLNA 4UBRA 3R9GA 4B13A 2YNCC 4JJXA 2P6GA 3FRMA 1QSMA 2FIAA 2R8VA 5KTCA 5C82A 2DPTA 2I00A 3TOBA 3DR8A 4KLVA 2G3AA 2GIVA 4C7HA 4KOUA 4DNCA 4KUAA 1KZFA 1YK3A 2JDCA 4PK3A 2NMTA 1ZO0A 3QB8A 5CNPA 1CJWA 3T9YA 4JD6A 3TCVA 2Q44A 3IGRA 4AVAA 2OB0A 5G20A 5F47A 4I49A 2YNDA 4A32A 4A2ZA 4E2AA 5C88A 3F5BA 2Q0YA 2B3UA 2YGWA 4KVOE 4NSQA 1S7NA 3N7ZA 2X7BA 5G1ZA 2VXKA 4PSXA 4XPKA 1Q2CA 2R98A 4FD7A 1RO5A 4HNXB 4AVBA 4BBHA 1Q2YA 4II9A 2I79A 5G22A 4UWIA 4KOSA 5FVJA 1L0CA 3I9SA 2R7HA 2WUUA 4YGOA 4CGPA 3V8IA 4UCMA 4CYQA 1YVKA 2VZZA 4A33A 4CGOA 4UCPA 3DR6A 5F48A 4IF5A 1BOBA 3LD2A 3S6KA 5AG5A 3S6HA 4UWJA 4CAFA 5ISVA 2C27A 5I0CA 4J3GA 3EFAA 4H89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG7 A;  4CAE A;  4C68 A;  5G20 A;  4C2Y A;  4B13 A;  2YNC C;  2YNC A;  3IU2 A;  4UFW A;  4C7I A;  2YND A;  4A32 A;  4A30 A;  4A2Z A;  2WUU A;  4B12 A;  4CGP A;  4B14 A;  3IU1 A;  4B10 A;  4CYP A;  5G21 A;  4UCM A;  3IWE A;  4CYQ A;  5AGE A;  4A33 A;  4C2Z A;  4UCP A;  4B11 A;  4C7H A;  2YNE A;  4CGO A;  4CYN A;  5AG4 A;  4CGN A;  4C2X A;  5G1Z A;  4UFX A;  5AG5 A;  4BBH A;  5A28 A;  5A27 A;  3H5Z A;  4CAF A;  5AG6 A;  4A31 A;  4CGL A;  3JTK A;  4UFV A;  4CYO A;  2WSA A;  4UCN A;  4CGM A;  5G22 A;  4A95 A; 
#chains in the Genus database with same CATH topology
 2ZEO A;  4CAE A;  2PVW A;  4C68 A;  1QQ9 A;  1ARM A;  3IIB A;  1YLE A;  2GU2 A;  4X3R A;  4M3S A;  3FEE A;  3B3T A;  1NSL A;  2EK8 A;  1XIX A;  4IK2 A;  2FS5 A;  2P6E A;  1I12 A;  2OZU A;  1B6B A;  1OZP A;  2EUI A;  3H8G A;  2NYQ A;  2V8D A;  4C2Z A;  1Z8W A;  4OC0 A;  2Z3P A;  1Z8L A;  4ZBG A;  1LAM A;  5IB0 A;  5K8P A;  3KL9 A;  2Z10 A;  2O28 A;  3DSB A;  4MMO A;  2B5G A;  4NGS A;  3D3S A;  4EWT A;  4FUU A;  2QEC A;  3QNV A;  1M4L A;  2ANP A;  1F2O A;  3WR7 A;  3CXQ A;  4MHP A;  5EC4 A;  3IC1 A;  2WPX A;  4FD6 A;  5AG7 A;  2PRB A;  4CAX A;  3VAR A;  4M6H A;  4MCQ A;  1KUV A;  4FD4 A;  4M6I A;  3RO0 A;  5F46 A;  2J8M A;  5HVG A;  1QSN A;  2CF4 A;  4KOV A;  1CP7 A;  4G1P A;  4NGR A;  4B14 A;  3G8W A;  4MCR A;  2Z3N A;  2Z3M A;  4UEE A;  3KGQ A;  2HUZ A;  2HV2 A;  3VWD A;  4MFL A;  4B5P B;  4YRH A;  2R1I A;  2ZEF A;  4OC1 A;  2QVP A;  2OR4 A;  4U9Y A;  2Q4Y A;  2V8V A;  4KOW A;  1YRE A;  2ATR A;  5JM6 A;  2ZEE A;  2KCW A;  1AYE A;  3B35 A;  4UFX A;  4ORF A;  3FBU A;  3WT4 A;  2ZPA A;  3D66 A;  4F0X A;  2Q51 A;  5D8N A;  4MFP A;  5DWN A;  2IQ6 A;  4NJQ A;  3TO7 A;  1IYK A;  3D7G A;  5ELY A;  2JBJ A;  4KVM E;  1AUG A;  4CAV A;  1P4N A;  1XMB A;  3D2P A;  1Y7E A;  1VIX A;  2B4D A;  3IU2 A;  3NFZ A;  1LAP A;  1EE3 P;  1M4G A;  2V77 A;  2VBQ A;  3R95 A;  4DYO A;  3R9F A;  4ZI6 A;  3WC6 A;  4AVC A;  4R57 A;  1TF8 A;  3SHP A;  3KR4 A;  5KTD A;  2D4P A;  2REF A;  2Y0M A;  3ISZ A;  2FT0 A;  4ZX9 A;  2C6G A;  2PR8 A;  3S9M A;  1ELM P;  4PK2 A;  5F09 A;  1U6M A;  3E0K A;  3NE8 A;  5A27 A;  4MFQ A;  4CPA A;  2ZED A;  3V7Z A;  4Q7A A;  4RS2 A;  1QST A;  1GYT A;  4L8A A;  2VZY A;  4OC5 A;  4QBJ A;  3ISX A;  4M6G A;  1M1D A;  2NSM A;  3DGV A;  3G3S A;  2CNS A;  4PXB A;  2OOT A;  1MJ9 A;  3S6F A;  4P6Y A;  4C2Y A;  4CRY B;  4Z65 A;  4MI4 A;  3H8E A;  3T90 A;  2BEI A;  6CPA A;  4KS9 A;  2ARH A;  1XJO A;  4HNY B;  2ZW5 A;  2RB7 A;  5LRG A;  5H86 A;  1LAN A;  2P0W A;  4KSI A;  4B12 A;  5I4M A;  2D4O A;  3CDX A;  3H4Q A;  4MHD A;  5D29 A;  1CM0 A;  3B2Y A;  5K8O A;  5J8C A;  3KHX A;  3MN8 A;  4CGN A;  4H6U A;  2V8G A;  3W91 A;  2AFU A;  2ZW4 A;  3FVL A;  1VHO A;  4U5Y A;  5AG6 A;  3NH8 A;  1IYL A;  4A31 A;  5K8N A;  5IX3 A;  1VHS A;  3SXO A;  2PJ3 A;  5LYF A;  2IL4 A;  3PB7 X;  4TWE A;  3HUV A;  1M4D A;  4JJX A;  4OID A;  5LYL A;  3PB8 X;  1YW6 A;  4A39 A;  2B3V A;  2FCK A;  1K4J A;  4XNH C;  4R87 A;  2RFH A;  1RXT A;  3C26 A;  2YNC A;  3KR5 A;  4KVX A;  1WWZ A;  2RC4 A;  2WPW A;  3JUW A;  2HB6 A;  1QSO A;  2HQY A;  4X8I A;  1IGB A;  5G21 A;  1S7F A;  1XEB A;  3D7D A;  3PFO A;  2ZEM A;  2DEA A;  5EBV A;  2JEV A;  3QAH A;  3I3G A;  3N5F A;  4CYN A;  3D2M A;  5HVH A;  4XNH B;  4MBU A;  4H6Z A;  1YLO A;  2FVG A;  1YR0 A;  4KZT A;  4F6A A;  3H5Z A;  1I1D A;  1Z2L A;  4P4D A;  2GFQ A;  4NGP A;  2G3T A;  3TTH A;  1ZG9 A;  1P0H A;  2F5I A;  5H84 A;  2JBK A;  3D68 A;  2FIW A;  3PGP A;  3KQZ A;  4EME A;  4AG7 A;  1IU8 A;  3CXS A;  3GYA A;  3JRU A;  3DLJ A;  1TXR A;  3S9N A;  2IMO A;  3WAB A;  3FNC A;  4JLY A;  3B8G A;  2QJ8 A;  4FD5 A;  3FXT A;  4A30 A;  4PXC A;  4OAE A;  3LWU A;  4GM5 A;  4PXE A;  4UA3 A;  3PEI A;  3PBE A;  1YW4 A;  4JXR A;  1JWQ A;  1R43 A;  2J9A A;  4GXH A;  5BWA B;  2J8N A;  2PJ4 A;  3FB3 A;  1SQH A;  3GLJ A;  1H8L A;  3MRU A;  4MHN A;  4E8O A;  2DF5 A;  3D67 A;  2P6F A;  4P4B A;  1ELL P;  3RNZ A;  4P4E A;  4NGN A;  4BIN A;  2OZH A;  3IWW A;  1S7L A;  3IEH A;  3P2H A;  4OME A;  4EFD A;  2ZEP A;  4GS4 A;  2Q04 A;  4PV6 A;  4EVY A;  2Q43 A;  1JQG A;  4X5K A;  4CGM A;  1F57 A;  2G9D A;  2REE A;  1Q2D A;  4NGQ A;  1VGY A;  2GLF A;  4FWU A;  4K30 A;  2AFS A;  2QML A;  3DNS A;  4CYP A;  2PJ7 A;  4A37 A;  3DDD A;  5GCN A;  2ZEL A;  2Q7B A;  3SI0 A;  3TT2 A;  4RUH A;  4P4J A;  1MK4 A;  4NGM A;  5AGE A;  4TNU A;  2PJ2 A;  3R96 A;  3GIU A;  2XEI A;  1A2Z A;  2AFM A;  2EBJ A;  2FSR A;  2PJC A;  2VL1 A;  2GRE A;  3KI9 A;  3SJX A;  4F0Y A;  4OP4 A;  4R3L A;  3B3W A;  1Z5R A;  1HDU A;  3SJG A;  2EVN A;  4UFV A;  4MY0 A;  3IJ3 A;  2CIJ A;  2JLM A;  3BI1 A;  1V0C A;  4A95 A;  2OU2 A;  3R1K A;  2CXA A;  3BI0 A;  2PE3 A;  4MHZ A;  4UFW A;  7CPA A;  5EMI A;  1I21 A;  4JZ0 A;  4AXV A;  1YGH A;  1LRZ A;  4LUA A;  2JEW A;  4B10 A;  2Z3O A;  1Z8X A;  2ZW7 A;  2CNM A;  3FMC A;  4NGT A;  4YFJ A;  4B11 A;  1J4J A;  1Y9W A;  1MJA A;  2EK9 A;  3H8F A;  3PZJ A;  2PJ0 A;  3ZZI A;  3W6X A;  3F0A A;  1ZG8 A;  5IV0 A;  1DE4 C;  2JDD A;  3VH9 A;  1S5K A;  4DJL A;  1TIQ A;  3GKR A;  3B7I A;  3GUX A;  1IB1 E;  1R57 A;  2IJZ A;  4Y49 C;  1Z4E A;  1OBR A;  4UIB A;  4B5P A;  1QMU A;  2AFO A;  3A9L A;  4MJ8 A;  3VWE A;  1CG2 A;  5J8F A;  4MCP A;  2ZOF A;  4OAD A;  1X12 A;  4W9Y A;  4MFZ A;  1S60 A;  3NE7 A;  2AFZ A;  3WC7 A;  3I1U A;  1XRY A;  1CBX A;  4DUK A;  1IID A;  3UY5 A;  1KUX A;  1KUY A;  1YSJ A;  3BJ7 A;  5E96 A;  3R9E A;  1BPN A;  5JGF A;  4Y49 B;  2XEF A;  1N71 A;  3MGD A;  2FE7 A;  4KOY A;  4R76 A;  1PUA A;  1QSR A;  2AJ6 A;  2DPS A;  2PC1 A;  2PIZ A;  4IHM A;  4IUS A;  4F9U A;  2AFX A;  3PFE A;  3TFY A;  1Y0Y A;  2B58 A;  4CAW A;  3SXN A;  1Q7L A;  5HMN A;  4E0A A;  4IAV A;  2O4H A;  4KOT A;  4P10 A;  3S9L A;  4WWV A;  1IY7 A;  4XPD C;  2WSA A;  4L89 A;  1PYT B;  4UCN A;  3SI2 A;  4AB7 A;  3PP9 A;  4P45 A;  4X2T A;  4RN7 A;  4QB9 A;  2PRQ A;  2FL4 A;  2ZXV A;  1Z4R A;  4MCS A;  4QUS A;  4ZYQ A;  4ZY0 A;  3KKW A;  1YX0 A;  3S6G A;  2PQ8 A;  4M85 A;  3PB9 X;  1IOI A;  3D7F A;  1M4I A;  4KOR A;  1HDQ A;  2Z3L A;  3B3C A;  1Y7R A;  3CT9 A;  1WK4 A;  2PJ5 A;  4XPD B;  4UF4 A;  1B87 A;  4NJR A;  1S7K A;  4FAI A;  4R7M A;  2C1C A;  2Q4V A;  3RYO A;  1TKH A;  2C6C A;  2PJA A;  2WYR A;  1YQE A;  3IWG A;  5A28 A;  1YME A;  2B4B A;  3CXP A;  3CZX A;  4LX9 A;  1AMP A;  4CGL A;  4HKF A;  2O53 A;  4A94 A;  3TE4 A;  4R8F A;  3W6S A;  2K5T A;  3PRT A;  4UIA A;  1M44 A;  4YWY A;  2Z11 A;  1KWM A;  1XBU A;  1XMT A;  2PCU A;  3FIX A;  4OKO A;  1XOV A;  2BSW A;  4U9Z A;  4ONU A;  4BMH A;  1PU9 A;  2B5G B;  5F49 A;  4F9V A;  3TOA A;  1BLL E;  2BUE A;  3TO9 A;  2EWB A;  1TF9 A;  3HLP A;  2Q4Z A;  3LOD A;  4MY3 A;  1BPM A;  4ZY1 A;  1CX8 A;  4MFJ A;  4O23 A;  1R3N A;  2VEZ A;  3EXN A;  3IWE A;  2VQY A;  4P44 A;  5HVF A;  2PR1 A;  3BJ8 A;  2PJ9 A;  1BAV A;  4NFR A;  4R3K A;  3RBU A;  4KUB A;  4YU9 A;  4Q36 A;  4UEZ A;  2Z3K A;  4HNW B;  4BD9 A;  1XF8 A;  3JVN A;  1Z9U A;  1LCP A;  2XEG A;  3D4U A;  5HH1 A;  3OWC A;  2CY2 A;  2PIY A;  2PSW A;  4OC4 A;  1IOF A;  3KHZ A;  2ZW6 A;  3FYN A;  2CNT A;  3JTK A;  4R6T A;  2EO8 A;  4ZGY B;  4PXD A;  4JXQ A;  3TC8 A;  2Z0Z A;  4MRI A;  3FX6 A;  3RZA A;  3EC4 A;  5JQ4 A;  3FF3 A;  5CPA A;  4B5O A;  2H5M A;  3ZJ0 A;  4KSF A;  3FEC A;  4JWP A;  4NXY A;  4PSW A;  4AG9 A;  2VI7 A;  4Q38 A;  4MFK A;  3K9T A;  4RI1 A;  5AG4 A;  1CP6 A;  5DWM A;  2G0B A;  2YNE A;  4KSA A;  5LRK A;  1FY7 A;  2GAN A;  2PJ6 A;  4PQA A;  5THW A;  4C2X A;  2B4D B;  3D8P A;  4QVT A;  3K9U A;  4ONW A;  2ODF A;  2V8H A;  4QC6 A;  5LRJ A;  4KOX A;  4ZY2 A;  2C6P A;  1IIC A;  2PDO A;  4WJB A;  5LYI A;  4XPL A;  2OZG A;  1LFW A;  1YVO A;  3NA6 A;  2FXF A;  1UFH A;  3IO1 A;  3F8K A;  2OH1 A;  3TO6 A;  3GY9 A;  3L2N A;  5CBM A;  3SJE A;  4CS0 B;  1BO4 A;  1ON0 A;  2QIR A;  4R9M A;  4C7I A;  8CPA A;  1GHE A;  2PJ1 A;  4LQ6 A;  2BL1 A;  1RTQ A;  3P2F A;  3NH4 A;  1UWY A;  3IU1 A;  3V38 A;  1MJB A;  4KLW A;  3CPX A;  1Y0R A;  4JYW A;  1TKJ A;  5J1Q A;  4NF1 A;  1XE4 A;  2GE3 A;  4CRZ B;  1S3Z A;  4OC2 A;  5JH9 A;  2J8R A;  5DS0 A;  2DXQ A;  1VKC A;  2AE6 A;  2BO9 A;  2ZEG A;  4H2K A;  4LQG A;  3PB4 X;  3GB0 A;  2AFW A;  3EY5 A;  1NMT A;  1HEE A;  5KTA A;  3EO4 A;  4OLL A;  1NE9 A;  5JPH A;  2BCO A;  1Y9K A;  3FED A;  4NEX A;  4CYO A;  3VAT A;  4NCZ A;  3BXM A;  2A4N A;  3BLN A;  4UBR A;  3R9G A;  4B13 A;  1FT7 A;  2YNC C;  2ZEN A;  3B3V A;  2P6G A;  3FRM A;  3LMS A;  1QSM A;  2BOA A;  2FIA A;  2GLJ A;  1F2P A;  1PCA A;  2R8V A;  5KTC A;  3CPA A;  5C82 A;  2DPT A;  2I00 A;  3TOB A;  3DR8 A;  4KLV A;  2G3A A;  2GIV A;  2QYV A;  4C7H A;  4KOU A;  4DNC A;  5HXD A;  4KUA A;  3KQX A;  1KZF A;  1YK3 A;  2JDC A;  3PBB A;  4PK3 A;  2NMT A;  3WC5 A;  1DTD A;  1ZO0 A;  2CTB A;  4B6Z A;  3QB8 A;  5CNP A;  1CJW A;  2PJB A;  1NSA A;  3T9Y A;  4JD6 A;  4P4F A;  3B3S A;  2Q44 A;  3SJF A;  3TCV A;  3IGR A;  4AVA A;  2OB0 A;  3TX8 A;  5G20 A;  4OC3 A;  1VHE A;  4F8Z A;  5F47 A;  1ARL A;  3LAC A;  4I49 A;  2YND A;  2XEJ A;  4A32 A;  2CTC A;  4A2Z A;  4E2A A;  5C88 A;  3K2K A;  3D7H A;  4ZX8 A;  3F5B A;  2Q0Y A;  1ZG7 A;  3T8W A;  2WZN A;  2B3U A;  4MXU A;  2YGW A;  1ZLI A;  4KVO E;  4NSQ A;  1S7N A;  1ZLH A;  3N7Z A;  1Z8T A;  2X7B A;  5G1Z A;  3SI1 A;  2Q7S A;  2VXK A;  1CPX A;  4K3N A;  4PSX A;  3RAM A;  4XPK A;  4PPZ A;  2PVV A;  1Q2C A;  5K8M A;  4HPS A;  2R98 A;  4FD7 A;  1RO5 A;  3QAY A;  4HNX B;  5LYD A;  4AVB A;  4BBH A;  1Q2Y A;  4II9 A;  2I79 A;  1LOK A;  2POK A;  3NH5 A;  4KOS A;  4UWI A;  2F8H A;  5FVJ A;  5G22 A;  1L0C A;  3BHX A;  4OIW A;  1CPS A;  3I9S A;  2ABZ A;  2R7H A;  1X10 A;  2WUU A;  4YGO A;  4CGP A;  3V8I A;  2ZEH A;  1TKF A;  3FH4 A;  4UEF A;  4UCM A;  2ZOG A;  4CYQ A;  1YVK A;  2VZZ A;  2I3C A;  4A33 A;  4CGO A;  4UCP A;  3DR6 A;  4P4I A;  5F48 A;  4IF5 A;  1BOB A;  2HC9 A;  3LD2 A;  3S6K A;  5AG5 A;  3S6H A;  4UWJ A;  3FJU A;  3KZW A;  4CAF A;  5ISV A;  1FNO A;  3PB6 X;  2C27 A;  3KAS A;  4A38 A;  4MHY A;  5I0C A;  2PJ8 A;  5IB9 A;  4J3G A;  3IFE A;  1XFO A;  2F7V A;  4FBE A;  3EFA A;  4H89 A; 
#chains in the Genus database with same CATH homology
 4CAE A;  4C68 A;  1YLE A;  4M3S A;  1NSL A;  1XIX A;  2FS5 A;  2P6E A;  1I12 A;  2OZU A;  1B6B A;  1OZP A;  2EUI A;  4C2Z A;  2Z3P A;  4ZBG A;  5IB0 A;  2Z10 A;  2O28 A;  3DSB A;  2B5G A;  3D3S A;  2QEC A;  3WR7 A;  3CXQ A;  5EC4 A;  2WPX A;  4FD6 A;  5AG7 A;  2PRB A;  4CAX A;  5F46 A;  1KUV A;  4FD4 A;  2J8M A;  1QSN A;  4KOV A;  4B14 A;  3G8W A;  2Z3N A;  2Z3M A;  2HUZ A;  2HV2 A;  3VWD A;  4MFL A;  4B5P B;  4YRH A;  2R1I A;  4U9Y A;  2Q4Y A;  4KOW A;  1YRE A;  2ATR A;  2KCW A;  4UFX A;  4ORF A;  3FBU A;  4F0X A;  2ZPA A;  4MFP A;  5DWN A;  3TO7 A;  1IYK A;  4KVM E;  4CAV A;  1P4N A;  3D2P A;  3IU2 A;  2B4D A;  1M4G A;  2VBQ A;  3R95 A;  3R9F A;  4AVC A;  4R57 A;  3SHP A;  5KTD A;  2D4P A;  2REF A;  2Y0M A;  2FT0 A;  2PR8 A;  4PK2 A;  1U6M A;  3E0K A;  5A27 A;  4MFQ A;  4RS2 A;  1QST A;  4L8A A;  2VZY A;  4QBJ A;  3S6F A;  1M1D A;  3G3S A;  2CNS A;  1MJ9 A;  4C2Y A;  4CRY B;  4MI4 A;  3T90 A;  2BEI A;  4KS9 A;  2ARH A;  4HNY B;  2ZW5 A;  5H86 A;  2P0W A;  4B12 A;  2D4O A;  3H4Q A;  4MHD A;  1CM0 A;  5J8C A;  4CGN A;  4H6U A;  3W91 A;  2ZW4 A;  5AG6 A;  4U5Y A;  4A31 A;  1IYL A;  5IX3 A;  1VHS A;  3SXO A;  2IL4 A;  1M4D A;  2B3V A;  2FCK A;  1K4J A;  4XNH C;  4R87 A;  1RXT A;  3C26 A;  2YNC A;  4KVX A;  1WWZ A;  2RC4 A;  2WPW A;  3JUW A;  1QSO A;  2HQY A;  5G21 A;  1S7F A;  1XEB A;  5EBV A;  2JEV A;  3QAH A;  3I3G A;  4CYN A;  3D2M A;  4XNH B;  4MBU A;  4H6Z A;  4KZT A;  1YR0 A;  4F6A A;  3H5Z A;  1I1D A;  3TTH A;  2G3T A;  2F5I A;  1P0H A;  5H84 A;  3PGP A;  2FIW A;  4AG7 A;  3CXS A;  3GYA A;  3FNC A;  4JLY A;  3B8G A;  4FD5 A;  3FXT A;  4A30 A;  4OAE A;  4UA3 A;  4JXR A;  5BWA B;  2J8N A;  3FB3 A;  1SQH A;  4E8O A;  2P6F A;  2OZH A;  1S7L A;  3P2H A;  4GS4 A;  2Q04 A;  4PV6 A;  4EVY A;  4X5K A;  4CGM A;  2REE A;  1Q2D A;  4K30 A;  2QML A;  3DNS A;  4CYP A;  3DDD A;  5GCN A;  2Q7B A;  3TT2 A;  1MK4 A;  5AGE A;  3R96 A;  2FSR A;  4F0Y A;  4R3L A;  2EVN A;  4UFV A;  4MY0 A;  2JLM A;  1V0C A;  4A95 A;  2OU2 A;  3R1K A;  2CXA A;  4UFW A;  1I21 A;  1YGH A;  1LRZ A;  4LUA A;  4B10 A;  2Z3O A;  2ZW7 A;  2CNM A;  4YFJ A;  4B11 A;  1J4J A;  1Y9W A;  1MJA A;  3PZJ A;  3ZZI A;  3W6X A;  3F0A A;  5IV0 A;  2JDD A;  1S5K A;  1TIQ A;  3GKR A;  1IB1 E;  1R57 A;  4Y49 C;  1Z4E A;  4B5P A;  3A9L A;  4MJ8 A;  3VWE A;  5J8F A;  4OAD A;  4MFZ A;  1S60 A;  3NE7 A;  1IID A;  3UY5 A;  1KUX A;  1KUY A;  3BJ7 A;  5E96 A;  3R9E A;  4Y49 B;  1N71 A;  3MGD A;  2FE7 A;  4KOY A;  1PUA A;  1QSR A;  2AJ6 A;  2DPS A;  2PC1 A;  4IUS A;  3TFY A;  2B58 A;  4CAW A;  3SXN A;  5HMN A;  4E0A A;  4KOT A;  4XPD C;  2WSA A;  4L89 A;  4UCN A;  4AB7 A;  3PP9 A;  4QB9 A;  2FL4 A;  2ZXV A;  1Z4R A;  4QUS A;  3KKW A;  1YX0 A;  3S6G A;  2PQ8 A;  4M85 A;  1M4I A;  4KOR A;  2Z3L A;  1Y7R A;  1WK4 A;  4XPD B;  1B87 A;  1S7K A;  2Q4V A;  3RYO A;  3IWG A;  5A28 A;  2B4B A;  3CXP A;  4LX9 A;  4CGL A;  4HKF A;  3TE4 A;  3W6S A;  2K5T A;  1M44 A;  2Z11 A;  1XMT A;  3FIX A;  2BSW A;  4U9Z A;  4ONU A;  4BMH A;  1PU9 A;  2B5G B;  5F49 A;  3TOA A;  2BUE A;  3TO9 A;  3LOD A;  4MY3 A;  4MFJ A;  2VEZ A;  3EXN A;  3IWE A;  2VQY A;  2PR1 A;  3BJ8 A;  4R3K A;  4KUB A;  4Q36 A;  2Z3K A;  4HNW B;  1XF8 A;  3JVN A;  1Z9U A;  5HH1 A;  3OWC A;  2CY2 A;  2PSW A;  2ZW6 A;  3FYN A;  2CNT A;  3JTK A;  4ZGY B;  4JXQ A;  2Z0Z A;  3EC4 A;  5JQ4 A;  4B5O A;  2H5M A;  3ZJ0 A;  4KSF A;  4NXY A;  4JWP A;  4PSW A;  4AG9 A;  2VI7 A;  4Q38 A;  4MFK A;  4RI1 A;  5AG4 A;  5DWM A;  2G0B A;  2YNE A;  4KSA A;  1FY7 A;  2GAN A;  4C2X A;  2B4D B;  3D8P A;  4QVT A;  3K9U A;  4QC6 A;  4KOX A;  1IIC A;  2PDO A;  4XPL A;  2OZG A;  1YVO A;  2FXF A;  1UFH A;  3F8K A;  2OH1 A;  3TO6 A;  3GY9 A;  4CS0 B;  1BO4 A;  1ON0 A;  2QIR A;  4R9M A;  4C7I A;  1GHE A;  2BL1 A;  3P2F A;  3IU1 A;  1MJB A;  4KLW A;  4NF1 A;  1XE4 A;  2GE3 A;  4CRZ B;  1S3Z A;  2J8R A;  2DXQ A;  1VKC A;  2AE6 A;  3EY5 A;  1NMT A;  5KTA A;  3EO4 A;  4OLL A;  1NE9 A;  5JPH A;  1Y9K A;  4NEX A;  4CYO A;  4NCZ A;  2A4N A;  3BLN A;  4UBR A;  3R9G A;  4B13 A;  2YNC C;  4JJX A;  2P6G A;  3FRM A;  1QSM A;  2FIA A;  2R8V A;  5KTC A;  5C82 A;  2DPT A;  2I00 A;  3TOB A;  3DR8 A;  4KLV A;  2G3A A;  2GIV A;  4C7H A;  4KOU A;  4DNC A;  4KUA A;  1KZF A;  1YK3 A;  2JDC A;  4PK3 A;  2NMT A;  1ZO0 A;  3QB8 A;  5CNP A;  1CJW A;  3T9Y A;  4JD6 A;  3TCV A;  2Q44 A;  3IGR A;  4AVA A;  2OB0 A;  5G20 A;  5F47 A;  4I49 A;  2YND A;  4A32 A;  4A2Z A;  4E2A A;  5C88 A;  3F5B A;  2Q0Y A;  2B3U A;  2YGW A;  4KVO E;  4NSQ A;  1S7N A;  3N7Z A;  2X7B A;  5G1Z A;  2VXK A;  4PSX A;  4XPK A;  1Q2C A;  2R98 A;  4FD7 A;  1RO5 A;  4HNX B;  4AVB A;  4BBH A;  1Q2Y A;  4II9 A;  2I79 A;  5G22 A;  4UWI A;  4KOS A;  5FVJ A;  1L0C A;  3I9S A;  2R7H A;  2WUU A;  4YGO A;  4CGP A;  3V8I A;  4UCM A;  4CYQ A;  1YVK A;  2VZZ A;  4A33 A;  4CGO A;  4UCP A;  3DR6 A;  5F48 A;  4IF5 A;  1BOB A;  3LD2 A;  3S6K A;  5AG5 A;  3S6H A;  4UWJ A;  4CAF A;  5ISV A;  2C27 A;  5I0C A;  4J3G A;  3EFA A;  4H89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...