5AGEA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a benzomorpholinone ligand
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 119
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ageA00
2YNDA 4UFWA 4A32A 5AG6A 3IU1A 4C7HA 4A30A 5AG5A 4A2ZA 4B10A 4B13A 4CGNA 3H5ZA 4CGPA 4A95A 4B11A 4C2YA 4B14A 4C2XA 2YNCC 4UFVA 5G20A 5AG7A 4CYOA 4CYPA 4UCNA 4A31A 4CYQA 4C7IA 4C68A 3IWEA 2WSAA 5G1ZA 4A33A 5G21A 4CGLA 4CAEA 4UCMA 4CGMA 4UCPA 4BBHA 4CGOA 5G22A 4C2ZA 5AG4A 2WUUA 2YNCA 4UFXA 5A27A 5A28A 4CAFA 3IU2A 3JTKA 4CYNA 4B12A 2YNEA 5AGEA
chains in the Genus database with same CATH superfamily
3FXTA 2PR1A 1Y7RA 5IB9A 2OR4A 3IU1A 2REEA 3TX8A 5D29A 1CG2A 2RFHA 4P10A 2PR8A 5I4MA 2JBJA 3D8PA 3FYNA 2XEIA 5KTDA 4PQAA 2PCUA 3JRUA 2FIWA 3G3SA 3T8WA 5I0CA 4JD6A 1GHEA 2HB6A 3DSBA 4ZY1A 1A2ZA 2WZNA 1YW6A 2XEGA 3PB9X 4XNHC 4QB9A 3DGVA 2H5MA 1S7LA 4L89A 1YR0A 4E2AA 2PJ3A 1NSLA 4NFRA 4UEEA 2XEFA 4PXCA 2IL4A 1FY7A 1YW4A 2NYQA 4HKFA 3D7GA 4CGOA 1XEBA 4NSQA 2Q0YA 3VWDA 4NGPA 3VH9A 4MFQA 3FEEA 3IU2A 2FVGA 4R8FA 3V8IA 2R7HA 3RBUA 2C27A 3FBUA 4CYOA 4KUBA 1HEEA 2Q43A 2Z11A 1KZFA 2P6FA 2ATRA 4NEXA 5AG6A 1B6BA 2A4NA 2AFOA 2X7BA 2CNMA 1RTQA 2Q51A 1BPNA 5K8PA 3RZAA 2GIVA 4OIDA 4PK3A 3KKWA 2Q7BA 2VEZA 5F46A 1M4DA 2WYRA 4P4EA 4MMOA 4NJRA 4ZBGA 5G20A 5BWAB 1CP6A 4F9UA 4KZTA 4P6YA 2VXKA 2ZEPA 4F6AA 1CPXA 2RC4A 1LAPA 2AFWA 3WC7A 5K8MA 2PJAA 1Q2DA 3PFEA 5FVJA 4FD4A 3B3WA 2PQ8A 1RO5A 2ZXVA 2GLJA 1IYKA 1UFHA 3NA6A 4PXEA 3PFOA 3SJFA 4LUAA 4MCQA 2GFQA 3SJXA 3FB3A 3QNVA 1VGYA 3FF3A 2B58A 4OC0A 1RXTA 3FH4A 4R3LA 1IIDA 4A95A 3KR4A 5HMNA 3T90A 4KS9A 1M4GA 3SJGA 4A38A 4RS2A 4UEFA 2C6PA 4Y49C 3IWEA 2PJBA 5JPHA 3CDXA 4I49A 1YVKA 2V8GA 2FE7A 1V0CA 3NE8A 4MJ8A 2ZENA 4TNUA 3DR8A 1YREA 2ANPA 2Q44A 3MN8A 3D2PA 1CJWA 5A27A 4Q38A 5DWMA 2B4DA 4KLVA 3V7ZA 4K3NA 2EO8A 3HLPA 2CNTA 5LYFA 3KL9A 1SQHA 2ZOFA 2ZEMA 3N5FA 3PGPA 4KVOE 4MFJA 4ZX9A 2FL4A 4UFWA 4F0YA 2AJ6A 3R9EA 3BXMA 1Z9UA 1MJAA 3PB7X 1QSNA 1LANA 2J9AA 5LYLA 2KCWA 5J8FA 3GKRA 1JQGA 4C2YA 2AFUA 2P6GA 4C2XA 3B35A 1S7KA 4MI4A 3RO0A 1KUXA 3FMCA 1Q2CA 2O28A 3PRTA 4P45A 4CGLA 3B3TA 4KLWA 4EWTA 3DR6A 4UCPA 3S6FA 5HXDA 2PRBA 1TIQA 2G0BA 1XE4A 3TOBA 1LAMA 1Z5RA 3SI2A 1Z4RA 3SXOA 2BUEA 1YK3A 3EC4A 3TO7A 3TOAA 2XEJA 4U9YA 2B4DB 2ARHA 5KTAA 1LRZA 2PC1A 3B2YA 4B5PA 1Z8LA 4KVME 1TKJA 3F5BA 3A9LA 2JEVA 1I1DA 2VBQA 1S7FA 4CYPA 4E0AA 2Z10A 4QUSA 4R87A 4U5YA 2BCOA 2AE6A 1M4LA 4FWUA 1P0HA 1IOIA 3BI1A 4MCPA 2QIRA 3GY9A 4J3GA 3D4UA 4NJQA 1S5KA 4OAEA 1CPSA 1Z2LA 3IFEA 3H4QA 2QJ8A 5EC4A 1F2OA 3PP9A 3I3GA 4OMEA 1AUGA 1IB1E 2B3VA 2J8RA 2PVWA 3IC1A 4WJBA 5IX3A 2WPXA 4JYWA 2REFA 4YU9A 4MBUA 2EBJA 5ELYA 2ODFA 2Q7SA 2PRQA 4KOUA 4OC1A 1N71A 2BOAA 4R57A 5KTCA 2YNCC 3R95A 4H89A 3GIUA 4OC4A 3KR5A 5J8CA 1AYEA 4X3RA 4B5PB 3S9NA 5E96A 3ISZA 2JBKA 1IY7A 4E8OA 1PUAA 4JZ0A 1NE9A 4ONUA 3KGQA 5CNPA 3H8FA 1X12A 4W9YA 4MCRA 5JH9A 3R9FA 5G22A 3SHPA 4RI1A 2BSWA 2EVNA 4XPDB 3KI9A 2Z3LA 4MXUA 2IMOA 5GCNA 3JUWA 2CTBA 3PEIA 4LQGA 1BPMA 2AFZA 1DTDA 3IEHA 4R7MA 2DPTA 4CPAA 4Q7AA 4R76A 3BI0A 3F8KA 2HUZA 3SI0A 4B13A 4A2ZA 2BL1A 4QBJA 3H5ZA 2PJ2A 4M6HA 3NH4A 2JDDA 2C6GA 2DF5A 1ZG7A 2F5IA 1MJ9A 3LODA 4NCZA 1KWMA 1Y0YA 2B5GA 2CXAA 1BAVA 2V8DA 4FUUA 5G21A 3PBEA 1H8LA 3D7FA 2RB7A 4A94A 5H84A 2OZHA 4Q36A 1ZG9A 5HVHA 1XIXA 2I79A 3K9TA 4UWIA 1P4NA 3CPXA 1MK4A 4MHNA 1KUVA 2Q04A 2P0WA 2Q4VA 3WR7A 1WK4A 4IAVA 5K8OA 4YWYA 4B12A 2G3AA 2FIAA 2K5TA 3K2KA 4YGOA 2GANA 1ZLHA 4IK2A 4EFDA 1Z4EA 1OBRA 2ZW5A 3R9GA 4KOSA 4B10A 3W91A 4CGPA 2OZUA 4F9VA 4MHZA 1B87A 1WWZA 3C26A 3GLJA 4AVCA 3CZXA 4C7IA 4PXDA 2PSWA 1X10A 2QYVA 3IIBA 5DWNA 1PYTB 2FSRA 2Z3NA 3E0KA 4OP4A 1VHEA 3TFYA 4FBEA 2B5GB 1FNOA 4NF1A 2PIYA 4EMEA 1QSMA 1YLOA 4A37A 4PXBA 1LCPA 5HH1A 4MRIA 3H8GA 4MHPA 4A30A 2EUIA 3KQZA 4KSFA 3IJ3A 1Y7EA 4R9MA 4NGSA 4HPSA 4UIBA 5AGEA 1XRYA 2PJ8A 5C82A 2ZW4A 4EVYA 4II9A 2OZGA 1XMBA 1XBUA 2OU2A 4DYOA 4P4IA 4XNHB 3DLJA 1XMTA 4M6IA 2D4OA 4X8IA 2QVPA 1CP7A 2POKA 3KZWA 1NMTA 1LOKA 3DNSA 3KQXA 4BD9A 4BINA 4PK2A 2Y0MA 4MFZA 1L0CA 4ZX8A 3MGDA 4HNWB 3FNCA 4CGMA 3BJ7A 3QAHA 2ZEOA 2VZZA 1I21A 1F57A 2QMLA 3P2HA 1OZPA 2OH1A 2P6EA 2WUUA 3ISXA 4JJXA 4KOXA 3S9MA 1MJBA 3RAMA 4B5OA 4ZY0A 1CX8A 2I00A 3L2NA 3KHZA 1QQ9A 2GLFA 4WWVA 2PJ5A 1ELMP 3I1UA 2B3UA 2AFXA 1XFOA 4JWPA 4UWJA 4K30A 3I9SA 2YGWA 3EO4A 3JVNA 1YSJA 3PB8X 3PB6X 4JXQA 4NGRA 4P4JA 1S60A 2B4BA 1QMUA 3LD2A 3UY5A 3LMSA 4AG9A 4B14A 3NH5A 3GUXA 3MRUA 4GXHA 2AFSA 5AG7A 3NE7A 3S6GA 5ISVA 2R8VA 3GB0A 4HNXB 3D67A 1Z8XA 2O4HA 2WSAA 2V77A 3FEDA 2O53A 4PSWA 4ZYQA 1Y9KA 2FXFA 4OLLA 4YRHA 4KOVA 4NGQA 3TT2A 3CXSA 4IF5A 4YFJA 3EY5A 4P4BA 5LYIA 4C2ZA 1XJOA 3EXNA 3K9UA 4UFXA 5H86A 4OC5A 4A39A 1VHOA 4KOYA 3QB8A 4CAWA 1QSTA 3ZJ0A 4CRYB 3TC8A 4UIAA 1IICA 3T9YA 2ZEDA 3TO9A 2ZW7A 1HDUA 3VATA 1LFWA 2NSMA 4RUHA 5AG5A 1Q7LA 1EE3P 4Y49B 3WABA 3WT4A 4UEZA 1VIXA 3CPAA 1BOBA 3D7HA 2C1CA 4H6UA 5A28A 4UA3A 4TWEA 2G3TA 5EMIA 4ORFA 4ZI6A 2GU2A 1F2PA 3KASA 4PPZA 4UF4A 1Y9WA 4R3KA 7CPAA 4NGNA 1Y0RA 1U6MA 4CAVA 3OWCA 1ELLP 4DUKA 3RNZA 4O23A 2HQYA 1K4JA 3SJEA 3VARA 5AG4A 3FVLA 1TKFA 1DE4C 1Q2YA 2ZEEA 4CAFA 3PBBA 4LQ6A 4MHDA 3JTKA 4MCSA 2Z0ZA 4DJLA 8CPAA 4H2KA 1YQEA 2EK8A 2BEIA 3FJUA 5LRJA 4A32A 2ZEFA 2IQ6A 3W6SA 2Z3KA 4CGNA 5F49A 5HVFA 1IYLA 2Z3OA 1IOFA 4M3SA 5LYDA 1BLLE 2FCKA 3R1KA 2PVVA 2Q4ZA 2CIJA 5C88A 1R43A 4UCNA 1CBXA 2ZEHA 1S3ZA 3HUVA 3IO1A 4CRZB 3D68A 1PCAA 2JEWA 1NSAA 1VKCA 5IB0A 1M44A 1KUYA 2J8MA 1IGBA 1TXRA 2HV2A 4U9ZA 2ZW6A 1AMPA 2PJ7A 2DPSA 1XF8A 2PJ4A 2PJ0A 4GM5A 3BJ8A 4HNYB 2YNCA 3B3CA 1ZLIA 3BHXA 2PJ1A 4Z65A 1TF8A 2J8NA 4ZY2A 4MY3A 3W6XA 4FD5A 2DEAA 3D2MA 3H8EA 1HDQA 5JM6A 1Z8WA 3FX6A 1FT7A 2PE3A 4G1PA 3SXNA 1S7NA 4AVBA 4PSXA 4UFVA 2VQYA 4FAIA 1TF9A 4DNCA 4OC3A 4RN7A 2PJ6A 1R3NA 4IHMA 5F09A 1BO4A 2D4PA 2OB0A 4P4DA 4OC2A 2VL1A 2FS5A 4ONWA 4UCMA 1Z8TA 2WPWA 4MHYA 1TKHA 1QSOA 4P4FA 2Z3MA 4KUAA 4OIWA 3IGRA 5DS0A 4MFKA 3V38A 3LACA 3ZZIA 2G9DA 3D7DA 4MFLA 2ZEGA 2GE3A 3D66A 2V8HA 4CYNA 2R1IA 3BLNA 4AB7A 1GYTA 4NGMA 4F8ZA 2PIZA 5LRGA 4KOWA 4FD6A 4JXRA 2Q4YA 1ARMA 4KSIA 3TCVA 3B3VA 1YLEA 3VWEA 2PDOA 1ON0A 4MY0A 4A31A 2CNSA 4AVAA 3LWUA 3WC6A 5IV0A 1IU8A 5THWA 2HC9A 2FT0A 4A33A 3GYAA 2GREA 3CT9A 4NXYA 4R6TA 3S6KA 4AXVA 1QSRA 4M6GA 3S9LA 3CXQA 4B6ZA 3EFAA 2DXQA 3FECA 4ZGYB 4UBRA 1M1DA 2AFMA 2VZYA 1ZG8A 4MFPA 3CXPA 2CY2A 2V8VA 4OKOA 4AG7A 2EWBA 2R98A 2PJ9A 2ABZA 2ZOGA 3NFZA 5JQ4A 4X5KA 3KHXA 4L8AA 2I3CA 2F8HA 4CAXA 4XPDC 3B7IA 5F47A 2EK9A 4F0XA 5K8NA 2BO9A 4KSAA 3D3SA 3RYOA 3IWGA 2VI7A 1I12A 3FIXA 4KORA 3IWWA 4IUSA 1CM0A 3TO6A 1ZO0A 3QAYA 2C6CA 5G1ZA 1JWQA 4LX9A 1YGHA 3P2FA 4CAEA 3R96A 4JLYA 4BBHA 3PB4X 4KVXA 4FD7A 3TE4A 3F0AA 3FRMA 2OOTA 2IJZA 2YNEA 4B11A 2QECA 4QVTA 2Z3PA 5JGFA 2YNDA 4OADA 3WC5A 3B3SA 2CTCA 4M85A 4C7HA 3NH8A 2ZELA 4PV6A 1VHSA 1M4IA 1R57A 1YVOA 1ARLA 4XPKA 3PZJA 1PU9A 5EBVA 1YMEA 2CF4A 5F48A 5HVGA 1YX0A 3G8WA 2JDCA 5LRKA 4GS4A 5CPAA 4CYQA 3N7ZA 4C68A 1XOVA 4NGTA 3B8GA 3DDDA 5J1QA 4H6ZA 2ZPAA 4QC6A 4P44A 5CBMA 1J4JA 4KOTA 4BMHA 3TTHA 2JLMA 2F7VA 2NMTA 5D8NA 2PJCA 4CS0B 3SI1A 3S6HA 4XPLA 4X2TA 6CPAA 1UWYA
chains in the Genus database with same CATH topology
3FXTA 2PR1A 1Y7RA 3IU1A 2REEA 2PR8A 3D8PA 3FYNA 5KTDA 2FIWA 3G3SA 5I0CA 4JD6A 1GHEA 3DSBA 4XNHC 4QB9A 2H5MA 1S7LA 4L89A 1YR0A 4E2AA 1NSLA 4CGOA 2IL4A 1FY7A 4HKFA 1XEBA 4NSQA 2Q0YA 3VWDA 4MFQA 3IU2A 3V8IA 2R7HA 2C27A 3FBUA 4CYOA 4KUBA 2Z11A 1KZFA 2P6FA 2ATRA 4NEXA 5AG6A 1B6BA 2A4NA 2X7BA 2CNMA 2GIVA 4PK3A 3KKWA 2Q7BA 2VEZA 5F46A 1M4DA 4ZBGA 5G20A 5BWAB 4KZTA 2VXKA 4F6AA 2RC4A 1Q2DA 5FVJA 4FD4A 2PQ8A 1RO5A 2ZXVA 1IYKA 1UFHA 4LUAA 3FB3A 2B58A 1RXTA 4R3LA 1IIDA 4A95A 5HMNA 3T90A 4KS9A 1M4GA 4RS2A 4Y49C 3IWEA 5JPHA 4I49A 1YVKA 2FE7A 1V0CA 4MJ8A 3DR8A 1YREA 2Q44A 3D2PA 1CJWA 5A27A 4Q38A 5DWMA 2B4DA 4KLVA 2CNTA 4MFJA 1SQHA 3PGPA 4KVOE 4F0XA 4F0YA 2FL4A 4UFWA 2AJ6A 3R9EA 1Z9UA 1MJAA 1QSNA 2KCWA 5J8FA 3GKRA 4C2YA 2P6GA 4C2XA 1S7KA 4MI4A 1KUXA 1Q2CA 2O28A 4CGLA 4KLWA 3DR6A 4UCPA 3S6FA 2PRBA 1TIQA 2G0BA 1XE4A 1Z4RA 3SXOA 3EC4A 2BUEA 1YK3A 3TO7A 3TOAA 4U9YA 2B4DB 2ARHA 5KTAA 1LRZA 2PC1A 4B5PA 4KVME 3F5BA 3A9LA 2JEVA 1I1DA 2VBQA 1S7FA 4CYPA 4E0AA 2Z10A 4QUSA 4R87A 4U5YA 2AE6A 1P0HA 2QIRA 3GY9A 4J3GA 1S5KA 4OAEA 3H4QA 5EC4A 3PP9A 3I3GA 2B3VA 1IB1E 2J8RA 5IX3A 2WPXA 2REFA 4MBUA 4KOUA 1N71A 4R57A 5KTCA 2YNCC 3R95A 4H89A 5J8CA 4B5PB 5E96A 4E8OA 1PUAA 4ONUA 1NE9A 5CNPA 3R9FA 5G22A 3SHPA 4RI1A 2BSWA 2EVNA 4XPDB 2Z3LA 5GCNA 3JUWA 2DPTA 3F8KA 2HUZA 4B13A 4A2ZA 2BL1A 4QBJA 3H5ZA 2JDDA 3LODA 2F5IA 1MJ9A 4NCZA 2B5GA 2CXAA 5G21A 5H84A 2OZHA 4Q36A 1XIXA 2I79A 4UWIA 1P4NA 1MK4A 1KUVA 2Q04A 2P0WA 2Q4VA 3WR7A 1WK4A 4B12A 2G3AA 2FIAA 2K5TA 4YGOA 2GANA 1Z4EA 3R9GA 2ZW5A 4B10A 4KOSA 4CGPA 3W91A 2OZUA 1B87A 1WWZA 3C26A 4AVCA 4C7IA 2PSWA 5DWNA 2FSRA 2Z3NA 3E0KA 3TFYA 2B5GB 4NF1A 1QSMA 5HH1A 2EUIA 4KSFA 4R9MA 5AGEA 5C82A 2ZW4A 4EVYA 4II9A 2OZGA 2OU2A 4XNHB 1XMTA 2D4OA 1NMTA 3DNSA 4PK2A 2Y0MA 4MFZA 1L0CA 3MGDA 4HNWB 3FNCA 4CGMA 3BJ7A 3QAHA 2VZZA 1I21A 2QMLA 3P2HA 1OZPA 2OH1A 2P6EA 2WUUA 4JJXA 4KOXA 4B5OA 1MJBA 2I00A 2B3UA 4JWPA 4UWJA 4K30A 3I9SA 2YGWA 3EO4A 3JVNA 4JXQA 3S6HA 4A30A 5JQ4A 1S60A 2B4BA 3LD2A 3UY5A 4AG9A 4B14A 5AG7A 3NE7A 3S6GA 5ISVA 2R8VA 4HNXB 2WSAA 4PSWA 1Y9KA 2FXFA 4OLLA 4YRHA 4KOVA 3TT2A 3CXSA 4IF5A 4YFJA 3EY5A 4C2ZA 4UFXA 3EXNA 3K9UA 5H86A 4KOYA 3QB8A 4CAWA 1QSTA 3ZJ0A 4CRYB 1IICA 3T9YA 3TO9A 2ZW7A 5AG5A 4Y49B 1BOBA 4H6UA 5A28A 4UA3A 2G3TA 4ORFA 1Y9WA 4R3KA 1U6MA 4CAVA 3OWCA 2HQYA 1K4JA 5AG4A 1Q2YA 4CAFA 4MHDA 3JTKA 2Z0ZA 2BEIA 4A32A 3W6SA 2Z3KA 4CGNA 5F49A 1IYLA 2Z3OA 4M3SA 2FCKA 3R1KA 5C88A 4UCNA 1S3ZA 4CRZB 1VKCA 1M44A 1KUYA 2J8MA 2HV2A 4U9ZA 2ZW6A 2DPSA 1XF8A 3BJ8A 4HNYB 2YNCA 2J8NA 4MY3A 3W6XA 4FD5A 3D2MA 3SXNA 1S7NA 4AVBA 4PSXA 4UFVA 2VQYA 4DNCA 1BO4A 2D4PA 2OB0A 2FS5A 4UCMA 2WPWA 1QSOA 2Z3MA 4KUAA 3IGRA 4MFKA 3ZZIA 4MFLA 2GE3A 4CYNA 2R1IA 3BLNA 4AB7A 4KOWA 4FD6A 4JXRA 2Q4YA 3TCVA 1YLEA 3VWEA 2PDOA 1ON0A 4MY0A 4A31A 2CNSA 4AVAA 5IV0A 2FT0A 4A33A 3GYAA 4NXYA 3S6KA 1QSRA 3CXQA 3EFAA 2DXQA 4ZGYB 4UBRA 1M1DA 2VZYA 4MFPA 3CXPA 2CY2A 4AG7A 2R98A 4X5KA 4L8AA 4CAXA 4XPDC 5F47A 4KSAA 3D3SA 3RYOA 3IWGA 2VI7A 1I12A 3FIXA 4KORA 3TO6A 4IUSA 1CM0A 1ZO0A 5G1ZA 4LX9A 1YGHA 3P2FA 4CAEA 3R96A 4JLYA 4BBHA 4KVXA 4FD7A 3TE4A 3F0AA 3FRMA 2YNEA 4B11A 2QECA 4QVTA 2Z3PA 2YNDA 4OADA 4M85A 4C7HA 4PV6A 1VHSA 1M4IA 1R57A 1YVOA 4XPKA 5EBVA 3PZJA 1PU9A 5F48A 3TOBA 5IB0A 1YX0A 3G8WA 2JDCA 4GS4A 4CYQA 3N7ZA 4C68A 3B8GA 3DDDA 4H6ZA 2ZPAA 4QC6A 1J4JA 4KOTA 4BMHA 3TTHA 2JLMA 2NMTA 4CS0B 4XPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YND A;  4UFW A;  4A32 A;  5AG6 A;  3IU1 A;  4C7H A;  4A30 A;  5AG5 A;  4A2Z A;  4B10 A;  4B13 A;  4CGN A;  3H5Z A;  4CGP A;  4A95 A;  4B11 A;  4C2Y A;  4B14 A;  4C2X A;  2YNC C;  4UFV A;  5G20 A;  5AG7 A;  4CYO A;  4CYP A;  4UCN A;  4A31 A;  4CYQ A;  4C7I A;  4C68 A;  3IWE A;  2WSA A;  5G1Z A;  4A33 A;  5G21 A;  4CGL A;  4CAE A;  4UCM A;  4CGM A;  4UCP A;  4BBH A;  4CGO A;  5G22 A;  4C2Z A;  5AG4 A;  2WUU A;  2YNC A;  4UFX A;  5A27 A;  5A28 A;  4CAF A;  3IU2 A;  3JTK A;  4CYN A;  4B12 A;  2YNE A;  5AGE A; 
#chains in the Genus database with same CATH topology
 3FXT A;  2PR1 A;  1Y7R A;  5IB9 A;  2OR4 A;  3IU1 A;  2REE A;  3TX8 A;  5D29 A;  1CG2 A;  2RFH A;  4P10 A;  2PR8 A;  5I4M A;  2JBJ A;  3D8P A;  3FYN A;  2XEI A;  5KTD A;  4PQA A;  2PCU A;  3JRU A;  2FIW A;  3G3S A;  3T8W A;  5I0C A;  4JD6 A;  1GHE A;  2HB6 A;  3DSB A;  4ZY1 A;  1A2Z A;  2WZN A;  1YW6 A;  2XEG A;  3PB9 X;  4XNH C;  4QB9 A;  3DGV A;  2H5M A;  1S7L A;  4L89 A;  1YR0 A;  4E2A A;  2PJ3 A;  1NSL A;  4NFR A;  4UEE A;  2XEF A;  4PXC A;  2IL4 A;  1FY7 A;  1YW4 A;  2NYQ A;  4HKF A;  3D7G A;  4CGO A;  1XEB A;  4NSQ A;  2Q0Y A;  3VWD A;  4NGP A;  3VH9 A;  4MFQ A;  3FEE A;  3IU2 A;  2FVG A;  4R8F A;  3V8I A;  2R7H A;  3RBU A;  2C27 A;  3FBU A;  4CYO A;  4KUB A;  1HEE A;  2Q43 A;  2Z11 A;  1KZF A;  2P6F A;  2ATR A;  4NEX A;  5AG6 A;  1B6B A;  2A4N A;  2AFO A;  2X7B A;  2CNM A;  1RTQ A;  2Q51 A;  1BPN A;  5K8P A;  3RZA A;  2GIV A;  4OID A;  4PK3 A;  3KKW A;  2Q7B A;  2VEZ A;  5F46 A;  1M4D A;  2WYR A;  4P4E A;  4MMO A;  4NJR A;  4ZBG A;  5G20 A;  5BWA B;  1CP6 A;  4F9U A;  4KZT A;  4P6Y A;  2VXK A;  2ZEP A;  4F6A A;  1CPX A;  2RC4 A;  1LAP A;  2AFW A;  3WC7 A;  5K8M A;  2PJA A;  1Q2D A;  3PFE A;  5FVJ A;  4FD4 A;  3B3W A;  2PQ8 A;  1RO5 A;  2ZXV A;  2GLJ A;  1IYK A;  1UFH A;  3NA6 A;  4PXE A;  3PFO A;  3SJF A;  4LUA A;  4MCQ A;  2GFQ A;  3SJX A;  3FB3 A;  3QNV A;  1VGY A;  3FF3 A;  2B58 A;  4OC0 A;  1RXT A;  3FH4 A;  4R3L A;  1IID A;  4A95 A;  3KR4 A;  5HMN A;  3T90 A;  4KS9 A;  1M4G A;  3SJG A;  4A38 A;  4RS2 A;  4UEF A;  2C6P A;  4Y49 C;  3IWE A;  2PJB A;  5JPH A;  3CDX A;  4I49 A;  1YVK A;  2V8G A;  2FE7 A;  1V0C A;  3NE8 A;  4MJ8 A;  2ZEN A;  4TNU A;  3DR8 A;  1YRE A;  2ANP A;  2Q44 A;  3MN8 A;  3D2P A;  1CJW A;  5A27 A;  4Q38 A;  5DWM A;  2B4D A;  4KLV A;  3V7Z A;  4K3N A;  2EO8 A;  3HLP A;  2CNT A;  5LYF A;  3KL9 A;  1SQH A;  2ZOF A;  2ZEM A;  3N5F A;  3PGP A;  4KVO E;  4MFJ A;  4ZX9 A;  2FL4 A;  4UFW A;  4F0Y A;  2AJ6 A;  3R9E A;  3BXM A;  1Z9U A;  1MJA A;  3PB7 X;  1QSN A;  1LAN A;  2J9A A;  5LYL A;  2KCW A;  5J8F A;  3GKR A;  1JQG A;  4C2Y A;  2AFU A;  2P6G A;  4C2X A;  3B35 A;  1S7K A;  4MI4 A;  3RO0 A;  1KUX A;  3FMC A;  1Q2C A;  2O28 A;  3PRT A;  4P45 A;  4CGL A;  3B3T A;  4KLW A;  4EWT A;  3DR6 A;  4UCP A;  3S6F A;  5HXD A;  2PRB A;  1TIQ A;  2G0B A;  1XE4 A;  3TOB A;  1LAM A;  1Z5R A;  3SI2 A;  1Z4R A;  3SXO A;  2BUE A;  1YK3 A;  3EC4 A;  3TO7 A;  3TOA A;  2XEJ A;  4U9Y A;  2B4D B;  2ARH A;  5KTA A;  1LRZ A;  2PC1 A;  3B2Y A;  4B5P A;  1Z8L A;  4KVM E;  1TKJ A;  3F5B A;  3A9L A;  2JEV A;  1I1D A;  2VBQ A;  1S7F A;  4CYP A;  4E0A A;  2Z10 A;  4QUS A;  4R87 A;  4U5Y A;  2BCO A;  2AE6 A;  1M4L A;  4FWU A;  1P0H A;  1IOI A;  3BI1 A;  4MCP A;  2QIR A;  3GY9 A;  4J3G A;  3D4U A;  4NJQ A;  1S5K A;  4OAE A;  1CPS A;  1Z2L A;  3IFE A;  3H4Q A;  2QJ8 A;  5EC4 A;  1F2O A;  3PP9 A;  3I3G A;  4OME A;  1AUG A;  1IB1 E;  2B3V A;  2J8R A;  2PVW A;  3IC1 A;  4WJB A;  5IX3 A;  2WPX A;  4JYW A;  2REF A;  4YU9 A;  4MBU A;  2EBJ A;  5ELY A;  2ODF A;  2Q7S A;  2PRQ A;  4KOU A;  4OC1 A;  1N71 A;  2BOA A;  4R57 A;  5KTC A;  2YNC C;  3R95 A;  4H89 A;  3GIU A;  4OC4 A;  3KR5 A;  5J8C A;  1AYE A;  4X3R A;  4B5P B;  3S9N A;  5E96 A;  3ISZ A;  2JBK A;  1IY7 A;  4E8O A;  1PUA A;  4JZ0 A;  1NE9 A;  4ONU A;  3KGQ A;  5CNP A;  3H8F A;  1X12 A;  4W9Y A;  4MCR A;  5JH9 A;  3R9F A;  5G22 A;  3SHP A;  4RI1 A;  2BSW A;  2EVN A;  4XPD B;  3KI9 A;  2Z3L A;  4MXU A;  2IMO A;  5GCN A;  3JUW A;  2CTB A;  3PEI A;  4LQG A;  1BPM A;  2AFZ A;  1DTD A;  3IEH A;  4R7M A;  2DPT A;  4CPA A;  4Q7A A;  4R76 A;  3BI0 A;  3F8K A;  2HUZ A;  3SI0 A;  4B13 A;  4A2Z A;  2BL1 A;  4QBJ A;  3H5Z A;  2PJ2 A;  4M6H A;  3NH4 A;  2JDD A;  2C6G A;  2DF5 A;  1ZG7 A;  2F5I A;  1MJ9 A;  3LOD A;  4NCZ A;  1KWM A;  1Y0Y A;  2B5G A;  2CXA A;  1BAV A;  2V8D A;  4FUU A;  5G21 A;  3PBE A;  1H8L A;  3D7F A;  2RB7 A;  4A94 A;  5H84 A;  2OZH A;  4Q36 A;  1ZG9 A;  5HVH A;  1XIX A;  2I79 A;  3K9T A;  4UWI A;  1P4N A;  3CPX A;  1MK4 A;  4MHN A;  1KUV A;  2Q04 A;  2P0W A;  2Q4V A;  3WR7 A;  1WK4 A;  4IAV A;  5K8O A;  4YWY A;  4B12 A;  2G3A A;  2FIA A;  2K5T A;  3K2K A;  4YGO A;  2GAN A;  1ZLH A;  4IK2 A;  4EFD A;  1Z4E A;  1OBR A;  2ZW5 A;  3R9G A;  4KOS A;  4B10 A;  3W91 A;  4CGP A;  2OZU A;  4F9V A;  4MHZ A;  1B87 A;  1WWZ A;  3C26 A;  3GLJ A;  4AVC A;  3CZX A;  4C7I A;  4PXD A;  2PSW A;  1X10 A;  2QYV A;  3IIB A;  5DWN A;  1PYT B;  2FSR A;  2Z3N A;  3E0K A;  4OP4 A;  1VHE A;  3TFY A;  4FBE A;  2B5G B;  1FNO A;  4NF1 A;  2PIY A;  4EME A;  1QSM A;  1YLO A;  4A37 A;  4PXB A;  1LCP A;  5HH1 A;  4MRI A;  3H8G A;  4MHP A;  4A30 A;  2EUI A;  3KQZ A;  4KSF A;  3IJ3 A;  1Y7E A;  4R9M A;  4NGS A;  4HPS A;  4UIB A;  5AGE A;  1XRY A;  2PJ8 A;  5C82 A;  2ZW4 A;  4EVY A;  4II9 A;  2OZG A;  1XMB A;  1XBU A;  2OU2 A;  4DYO A;  4P4I A;  4XNH B;  3DLJ A;  1XMT A;  4M6I A;  2D4O A;  4X8I A;  2QVP A;  1CP7 A;  2POK A;  3KZW A;  1NMT A;  1LOK A;  3DNS A;  3KQX A;  4BD9 A;  4BIN A;  4PK2 A;  2Y0M A;  4MFZ A;  1L0C A;  4ZX8 A;  3MGD A;  4HNW B;  3FNC A;  4CGM A;  3BJ7 A;  3QAH A;  2ZEO A;  2VZZ A;  1I21 A;  1F57 A;  2QML A;  3P2H A;  1OZP A;  2OH1 A;  2P6E A;  2WUU A;  3ISX A;  4JJX A;  4KOX A;  3S9M A;  1MJB A;  3RAM A;  4B5O A;  4ZY0 A;  1CX8 A;  2I00 A;  3L2N A;  3KHZ A;  1QQ9 A;  2GLF A;  4WWV A;  2PJ5 A;  1ELM P;  3I1U A;  2B3U A;  2AFX A;  1XFO A;  4JWP A;  4UWJ A;  4K30 A;  3I9S A;  2YGW A;  3EO4 A;  3JVN A;  1YSJ A;  3PB8 X;  3PB6 X;  4JXQ A;  4NGR A;  4P4J A;  1S60 A;  2B4B A;  1QMU A;  3LD2 A;  3UY5 A;  3LMS A;  4AG9 A;  4B14 A;  3NH5 A;  3GUX A;  3MRU A;  4GXH A;  2AFS A;  5AG7 A;  3NE7 A;  3S6G A;  5ISV A;  2R8V A;  3GB0 A;  4HNX B;  3D67 A;  1Z8X A;  2O4H A;  2WSA A;  2V77 A;  3FED A;  2O53 A;  4PSW A;  4ZYQ A;  1Y9K A;  2FXF A;  4OLL A;  4YRH A;  4KOV A;  4NGQ A;  3TT2 A;  3CXS A;  4IF5 A;  4YFJ A;  3EY5 A;  4P4B A;  5LYI A;  4C2Z A;  1XJO A;  3EXN A;  3K9U A;  4UFX A;  5H86 A;  4OC5 A;  4A39 A;  1VHO A;  4KOY A;  3QB8 A;  4CAW A;  1QST A;  3ZJ0 A;  4CRY B;  3TC8 A;  4UIA A;  1IIC A;  3T9Y A;  2ZED A;  3TO9 A;  2ZW7 A;  1HDU A;  3VAT A;  1LFW A;  2NSM A;  4RUH A;  5AG5 A;  1Q7L A;  1EE3 P;  4Y49 B;  3WAB A;  3WT4 A;  4UEZ A;  1VIX A;  3CPA A;  1BOB A;  3D7H A;  2C1C A;  4H6U A;  5A28 A;  4UA3 A;  4TWE A;  2G3T A;  5EMI A;  4ORF A;  4ZI6 A;  2GU2 A;  1F2P A;  3KAS A;  4PPZ A;  4UF4 A;  1Y9W A;  4R3K A;  7CPA A;  4NGN A;  1Y0R A;  1U6M A;  4CAV A;  3OWC A;  1ELL P;  4DUK A;  3RNZ A;  4O23 A;  2HQY A;  1K4J A;  3SJE A;  3VAR A;  5AG4 A;  3FVL A;  1TKF A;  1DE4 C;  1Q2Y A;  2ZEE A;  4CAF A;  3PBB A;  4LQ6 A;  4MHD A;  3JTK A;  4MCS A;  2Z0Z A;  4DJL A;  8CPA A;  4H2K A;  1YQE A;  2EK8 A;  2BEI A;  3FJU A;  5LRJ A;  4A32 A;  2ZEF A;  2IQ6 A;  3W6S A;  2Z3K A;  4CGN A;  5F49 A;  5HVF A;  1IYL A;  2Z3O A;  1IOF A;  4M3S A;  5LYD A;  1BLL E;  2FCK A;  3R1K A;  2PVV A;  2Q4Z A;  2CIJ A;  5C88 A;  1R43 A;  4UCN A;  1CBX A;  2ZEH A;  1S3Z A;  3HUV A;  3IO1 A;  4CRZ B;  3D68 A;  1PCA A;  2JEW A;  1NSA A;  1VKC A;  5IB0 A;  1M44 A;  1KUY A;  2J8M A;  1IGB A;  1TXR A;  2HV2 A;  4U9Z A;  2ZW6 A;  1AMP A;  2PJ7 A;  2DPS A;  1XF8 A;  2PJ4 A;  2PJ0 A;  4GM5 A;  3BJ8 A;  4HNY B;  2YNC A;  3B3C A;  1ZLI A;  3BHX A;  2PJ1 A;  4Z65 A;  1TF8 A;  2J8N A;  4ZY2 A;  4MY3 A;  3W6X A;  4FD5 A;  2DEA A;  3D2M A;  3H8E A;  1HDQ A;  5JM6 A;  1Z8W A;  3FX6 A;  1FT7 A;  2PE3 A;  4G1P A;  3SXN A;  1S7N A;  4AVB A;  4PSX A;  4UFV A;  2VQY A;  4FAI A;  1TF9 A;  4DNC A;  4OC3 A;  4RN7 A;  2PJ6 A;  1R3N A;  4IHM A;  5F09 A;  1BO4 A;  2D4P A;  2OB0 A;  4P4D A;  4OC2 A;  2VL1 A;  2FS5 A;  4ONW A;  4UCM A;  1Z8T A;  2WPW A;  4MHY A;  1TKH A;  1QSO A;  4P4F A;  2Z3M A;  4KUA A;  4OIW A;  3IGR A;  5DS0 A;  4MFK A;  3V38 A;  3LAC A;  3ZZI A;  2G9D A;  3D7D A;  4MFL A;  2ZEG A;  2GE3 A;  3D66 A;  2V8H A;  4CYN A;  2R1I A;  3BLN A;  4AB7 A;  1GYT A;  4NGM A;  4F8Z A;  2PIZ A;  5LRG A;  4KOW A;  4FD6 A;  4JXR A;  2Q4Y A;  1ARM A;  4KSI A;  3TCV A;  3B3V A;  1YLE A;  3VWE A;  2PDO A;  1ON0 A;  4MY0 A;  4A31 A;  2CNS A;  4AVA A;  3LWU A;  3WC6 A;  5IV0 A;  1IU8 A;  5THW A;  2HC9 A;  2FT0 A;  4A33 A;  3GYA A;  2GRE A;  3CT9 A;  4NXY A;  4R6T A;  3S6K A;  4AXV A;  1QSR A;  4M6G A;  3S9L A;  3CXQ A;  4B6Z A;  3EFA A;  2DXQ A;  3FEC A;  4ZGY B;  4UBR A;  1M1D A;  2AFM A;  2VZY A;  1ZG8 A;  4MFP A;  3CXP A;  2CY2 A;  2V8V A;  4OKO A;  4AG7 A;  2EWB A;  2R98 A;  2PJ9 A;  2ABZ A;  2ZOG A;  3NFZ A;  5JQ4 A;  4X5K A;  3KHX A;  4L8A A;  2I3C A;  2F8H A;  4CAX A;  4XPD C;  3B7I A;  5F47 A;  2EK9 A;  4F0X A;  5K8N A;  2BO9 A;  4KSA A;  3D3S A;  3RYO A;  3IWG A;  2VI7 A;  1I12 A;  3FIX A;  4KOR A;  3IWW A;  4IUS A;  1CM0 A;  3TO6 A;  1ZO0 A;  3QAY A;  2C6C A;  5G1Z A;  1JWQ A;  4LX9 A;  1YGH A;  3P2F A;  4CAE A;  3R96 A;  4JLY A;  4BBH A;  3PB4 X;  4KVX A;  4FD7 A;  3TE4 A;  3F0A A;  3FRM A;  2OOT A;  2IJZ A;  2YNE A;  4B11 A;  2QEC A;  4QVT A;  2Z3P A;  5JGF A;  2YND A;  4OAD A;  3WC5 A;  3B3S A;  2CTC A;  4M85 A;  4C7H A;  3NH8 A;  2ZEL A;  4PV6 A;  1VHS A;  1M4I A;  1R57 A;  1YVO A;  1ARL A;  4XPK A;  3PZJ A;  1PU9 A;  5EBV A;  1YME A;  2CF4 A;  5F48 A;  5HVG A;  1YX0 A;  3G8W A;  2JDC A;  5LRK A;  4GS4 A;  5CPA A;  4CYQ A;  3N7Z A;  4C68 A;  1XOV A;  4NGT A;  3B8G A;  3DDD A;  5J1Q A;  4H6Z A;  2ZPA A;  4QC6 A;  4P44 A;  5CBM A;  1J4J A;  4KOT A;  4BMH A;  3TTH A;  2JLM A;  2F7V A;  2NMT A;  5D8N A;  2PJC A;  4CS0 B;  3SI1 A;  3S6H A;  4XPL A;  4X2T A;  6CPA A;  1UWY A; 
#chains in the Genus database with same CATH homology
 3FXT A;  2PR1 A;  1Y7R A;  3IU1 A;  2REE A;  2PR8 A;  3D8P A;  3FYN A;  5KTD A;  2FIW A;  3G3S A;  5I0C A;  4JD6 A;  1GHE A;  3DSB A;  4XNH C;  4QB9 A;  2H5M A;  1S7L A;  4L89 A;  1YR0 A;  4E2A A;  1NSL A;  4CGO A;  2IL4 A;  1FY7 A;  4HKF A;  1XEB A;  4NSQ A;  2Q0Y A;  3VWD A;  4MFQ A;  3IU2 A;  3V8I A;  2R7H A;  2C27 A;  3FBU A;  4CYO A;  4KUB A;  2Z11 A;  1KZF A;  2P6F A;  2ATR A;  4NEX A;  5AG6 A;  1B6B A;  2A4N A;  2X7B A;  2CNM A;  2GIV A;  4PK3 A;  3KKW A;  2Q7B A;  2VEZ A;  5F46 A;  1M4D A;  4ZBG A;  5G20 A;  5BWA B;  4KZT A;  2VXK A;  4F6A A;  2RC4 A;  1Q2D A;  5FVJ A;  4FD4 A;  2PQ8 A;  1RO5 A;  2ZXV A;  1IYK A;  1UFH A;  4LUA A;  3FB3 A;  2B58 A;  1RXT A;  4R3L A;  1IID A;  4A95 A;  5HMN A;  3T90 A;  4KS9 A;  1M4G A;  4RS2 A;  4Y49 C;  3IWE A;  5JPH A;  4I49 A;  1YVK A;  2FE7 A;  1V0C A;  4MJ8 A;  3DR8 A;  1YRE A;  2Q44 A;  3D2P A;  1CJW A;  5A27 A;  4Q38 A;  5DWM A;  2B4D A;  4KLV A;  2CNT A;  4MFJ A;  1SQH A;  3PGP A;  4KVO E;  4F0X A;  4F0Y A;  2FL4 A;  4UFW A;  2AJ6 A;  3R9E A;  1Z9U A;  1MJA A;  1QSN A;  2KCW A;  5J8F A;  3GKR A;  4C2Y A;  2P6G A;  4C2X A;  1S7K A;  4MI4 A;  1KUX A;  1Q2C A;  2O28 A;  4CGL A;  4KLW A;  3DR6 A;  4UCP A;  3S6F A;  2PRB A;  1TIQ A;  2G0B A;  1XE4 A;  1Z4R A;  3SXO A;  3EC4 A;  2BUE A;  1YK3 A;  3TO7 A;  3TOA A;  4U9Y A;  2B4D B;  2ARH A;  5KTA A;  1LRZ A;  2PC1 A;  4B5P A;  4KVM E;  3F5B A;  3A9L A;  2JEV A;  1I1D A;  2VBQ A;  1S7F A;  4CYP A;  4E0A A;  2Z10 A;  4QUS A;  4R87 A;  4U5Y A;  2AE6 A;  1P0H A;  2QIR A;  3GY9 A;  4J3G A;  1S5K A;  4OAE A;  3H4Q A;  5EC4 A;  3PP9 A;  3I3G A;  2B3V A;  1IB1 E;  2J8R A;  5IX3 A;  2WPX A;  2REF A;  4MBU A;  4KOU A;  1N71 A;  4R57 A;  5KTC A;  2YNC C;  3R95 A;  4H89 A;  5J8C A;  4B5P B;  5E96 A;  4E8O A;  1PUA A;  4ONU A;  1NE9 A;  5CNP A;  3R9F A;  5G22 A;  3SHP A;  4RI1 A;  2BSW A;  2EVN A;  4XPD B;  2Z3L A;  5GCN A;  3JUW A;  2DPT A;  3F8K A;  2HUZ A;  4B13 A;  4A2Z A;  2BL1 A;  4QBJ A;  3H5Z A;  2JDD A;  3LOD A;  2F5I A;  1MJ9 A;  4NCZ A;  2B5G A;  2CXA A;  5G21 A;  5H84 A;  2OZH A;  4Q36 A;  1XIX A;  2I79 A;  4UWI A;  1P4N A;  1MK4 A;  1KUV A;  2Q04 A;  2P0W A;  2Q4V A;  3WR7 A;  1WK4 A;  4B12 A;  2G3A A;  2FIA A;  2K5T A;  4YGO A;  2GAN A;  1Z4E A;  3R9G A;  2ZW5 A;  4B10 A;  4KOS A;  4CGP A;  3W91 A;  2OZU A;  1B87 A;  1WWZ A;  3C26 A;  4AVC A;  4C7I A;  2PSW A;  5DWN A;  2FSR A;  2Z3N A;  3E0K A;  3TFY A;  2B5G B;  4NF1 A;  1QSM A;  5HH1 A;  2EUI A;  4KSF A;  4R9M A;  5AGE A;  5C82 A;  2ZW4 A;  4EVY A;  4II9 A;  2OZG A;  2OU2 A;  4XNH B;  1XMT A;  2D4O A;  1NMT A;  3DNS A;  4PK2 A;  2Y0M A;  4MFZ A;  1L0C A;  3MGD A;  4HNW B;  3FNC A;  4CGM A;  3BJ7 A;  3QAH A;  2VZZ A;  1I21 A;  2QML A;  3P2H A;  1OZP A;  2OH1 A;  2P6E A;  2WUU A;  4JJX A;  4KOX A;  4B5O A;  1MJB A;  2I00 A;  2B3U A;  4JWP A;  4UWJ A;  4K30 A;  3I9S A;  2YGW A;  3EO4 A;  3JVN A;  4JXQ A;  3S6H A;  4A30 A;  5JQ4 A;  1S60 A;  2B4B A;  3LD2 A;  3UY5 A;  4AG9 A;  4B14 A;  5AG7 A;  3NE7 A;  3S6G A;  5ISV A;  2R8V A;  4HNX B;  2WSA A;  4PSW A;  1Y9K A;  2FXF A;  4OLL A;  4YRH A;  4KOV A;  3TT2 A;  3CXS A;  4IF5 A;  4YFJ A;  3EY5 A;  4C2Z A;  4UFX A;  3EXN A;  3K9U A;  5H86 A;  4KOY A;  3QB8 A;  4CAW A;  1QST A;  3ZJ0 A;  4CRY B;  1IIC A;  3T9Y A;  3TO9 A;  2ZW7 A;  5AG5 A;  4Y49 B;  1BOB A;  4H6U A;  5A28 A;  4UA3 A;  2G3T A;  4ORF A;  1Y9W A;  4R3K A;  1U6M A;  4CAV A;  3OWC A;  2HQY A;  1K4J A;  5AG4 A;  1Q2Y A;  4CAF A;  4MHD A;  3JTK A;  2Z0Z A;  2BEI A;  4A32 A;  3W6S A;  2Z3K A;  4CGN A;  5F49 A;  1IYL A;  2Z3O A;  4M3S A;  2FCK A;  3R1K A;  5C88 A;  4UCN A;  1S3Z A;  4CRZ B;  1VKC A;  1M44 A;  1KUY A;  2J8M A;  2HV2 A;  4U9Z A;  2ZW6 A;  2DPS A;  1XF8 A;  3BJ8 A;  4HNY B;  2YNC A;  2J8N A;  4MY3 A;  3W6X A;  4FD5 A;  3D2M A;  3SXN A;  1S7N A;  4AVB A;  4PSX A;  4UFV A;  2VQY A;  4DNC A;  1BO4 A;  2D4P A;  2OB0 A;  2FS5 A;  4UCM A;  2WPW A;  1QSO A;  2Z3M A;  4KUA A;  3IGR A;  4MFK A;  3ZZI A;  4MFL A;  2GE3 A;  4CYN A;  2R1I A;  3BLN A;  4AB7 A;  4KOW A;  4FD6 A;  4JXR A;  2Q4Y A;  3TCV A;  1YLE A;  3VWE A;  2PDO A;  1ON0 A;  4MY0 A;  4A31 A;  2CNS A;  4AVA A;  5IV0 A;  2FT0 A;  4A33 A;  3GYA A;  4NXY A;  3S6K A;  1QSR A;  3CXQ A;  3EFA A;  2DXQ A;  4ZGY B;  4UBR A;  1M1D A;  2VZY A;  4MFP A;  3CXP A;  2CY2 A;  4AG7 A;  2R98 A;  4X5K A;  4L8A A;  4CAX A;  4XPD C;  5F47 A;  4KSA A;  3D3S A;  3RYO A;  3IWG A;  2VI7 A;  1I12 A;  3FIX A;  4KOR A;  3TO6 A;  4IUS A;  1CM0 A;  1ZO0 A;  5G1Z A;  4LX9 A;  1YGH A;  3P2F A;  4CAE A;  3R96 A;  4JLY A;  4BBH A;  4KVX A;  4FD7 A;  3TE4 A;  3F0A A;  3FRM A;  2YNE A;  4B11 A;  2QEC A;  4QVT A;  2Z3P A;  2YND A;  4OAD A;  4M85 A;  4C7H A;  4PV6 A;  1VHS A;  1M4I A;  1R57 A;  1YVO A;  4XPK A;  5EBV A;  3PZJ A;  1PU9 A;  5F48 A;  3TOB A;  5IB0 A;  1YX0 A;  3G8W A;  2JDC A;  4GS4 A;  4CYQ A;  3N7Z A;  4C68 A;  3B8G A;  3DDD A;  4H6Z A;  2ZPA A;  4QC6 A;  1J4J A;  4KOT A;  4BMH A;  3TTH A;  2JLM A;  2NMT A;  4CS0 B;  4XPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...