4YGOA

Dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae in intermediate state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (atcc 39315 / el tor inaba n16961)
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ygoA00
4KOXA 3EY5A 3TTHA 2P6GA 3JVNA 3NE7A 1M4DA 3D2PA 4MY0A 3TO9A 3V8IA 1OZPA 2OU2A 1P0HA 4NSQA 2PDOA 3SXNA 3N7ZA 1M4IA 1Q2YA 2B3UA 4CAVA 4KVOE 5CNPA 2BSWA 1XF8A 2ZW6A 1IB1E 1Z4RA 3GY9A 1QSRA 3E0KA 1IIDA 3ZJ0A 4XPDB 5F46A 4M85A 2CNMA 3W6SA 3PGPA 4JJXA 2ZW4A 1S7LA 5F49A 4K30A 1YLEA 4I49A 4E0AA 3PP9A 4KVME 3D3SA 2A4NA 2Q4VA 4KOTA 4MI4A 3GYAA 1L0CA 4KZTA 4EVYA 2J8RA 1QSTA 3BJ7A 2P0WA 2FIWA 1MJAA 2B4DA 3FB3A 2OZUA 2WPWA 4QUSA 1QSNA 2HQYA 1Z9UA 5J8CA 4KLWA 1WWZA 1KUXA 4QBJA 2PR1A 2R98A 2NMTA 2D4OA 2ATRA 4NCZA 3P2HA 3EO4A 3T90A 3TE4A 2HUZA 4NEXA 4FD6A 2ZXVA 1YGHA 4HKFA 2QMLA 4M3SA 1Z4EA 2R8VA 3TFYA 4JLYA 3D8PA 2CNSA 1Q2CA 2JDDA 4H89A 1I12A 4PSXA 4KOWA 2H5MA 1PUAA 4PSWA 1NMTA 1K4JA 2FXFA 3FRMA 5DWMA 3TT2A 4R87A 2GANA 3LD2A 5IV0A 1IYKA 3DR8A 4ORFA 1ON0A 4YGOA 1U6MA 4JXRA 1QSMA 2J8MA 1P4NA 3DDDA 2VBQA 4UBRA 4R3KA 3JUWA 3ZZIA 3FXTA 4AVAA 4BMHA 4B5PA 3QAHA 4QVTA 3RYOA 4AVCA 3VWDA 1XIXA 2G3AA 4OAEA 2BEIA 2VXKA 4U9YA 4UWIA 2QIRA 1WK4A 3GKRA 4KVXA 1Q2DA 3CXSA 5JQ4A 1VKCA 1CJWA 1R57A 4LX9A 4PK3A 3DSBA 4FD5A 4J3GA 4H6UA 3CXQA 2F5IA 2B5GA 1S7FA 4UA3A 2PR8A 1S3ZA 5DWNA 2CY2A 4CS0B 3SXOA 2AJ6A 4XPDC 3F0AA 2FL4A 5I0CA 4XPKA 3R9GA 3BJ8A 4Y49C 5KTAA 3P2FA 1S5KA 2BL1A 1VHSA 4ZBGA 2VEZA 3R1KA 5F48A 2CNTA 5KTCA 1B87A 4OLLA 4HNWB 4XNHC 2Q44A 3I9SA 4L89A 2FSRA 3R9EA 2ZPAA 2ARHA 2I00A 5KTDA 1BOBA 1KZFA 1UFHA 4FD7A 3F5BA 1CM0A 2D4PA 3VWEA 4IUSA 5HMNA 1Y9WA 5GCNA 4MY3A 4F6AA 5C82A 3EXNA 4H6ZA 3TOBA 5ISVA 3W91A 2J8NA 1YK3A 1IICA 2KCWA 4JXQA 1PU9A 2PQ8A 3B8GA 1BO4A 3TO6A 4HNXB 2Y0MA 5H84A 2WPXA 1YX0A 3PZJA 3EC4A 4CRYB 2OZGA 1S7KA 1Y9KA 3BLNA 4MBUA 3T9YA 2FCKA 1YVKA 3UY5A 5J8FA 1YVOA 4E8OA 4CAWA 2C27A 3DR6A 4OADA 4GS4A 1N71A 2Z11A 1YREA 4MJ8A 1S7NA 4QB9A 1NE9A 3CXPA 2AE6A 3FYNA 3S6KA 2B3VA 2G3TA 3S6FA 2O28A 3LODA 1MJ9A 4U5YA 2B4BA 1RXTA 2K5TA 2B4DB 2G0BA 4X5KA 5E96A 1LRZA 2VQYA 4R9MA 3S6HA 2OH1A 1I21A 1QSOA 2BUEA 2FIAA 3D2MA 2VZZA 4LUAA 3G8WA 2FE7A 2JEVA 4E2AA 4NXYA 1SQHA 4KUAA 1J4JA 4CAXA 1KUYA 4KOSA 2Z10A 3W6XA 1TIQA 3C26A 3DNSA 1XEBA 3WR7A 3FBUA 4FD4A 4XNHB 2FT0A 4R3LA 2Q0YA 2B5GB 3S6GA 1YR0A 4JD6A 2EVNA 4KOUA 3TO7A 2REFA 3MGDA 2GIVA 2Q4YA 1GHEA 3K9UA 4F0YA 4RI1A 1FY7A 3R9FA 4II9A 4AG7A 4B5OA 1XE4A 2Q7BA 1I1DA 2JLMA 2REEA 2VZYA 4IF5A 1V0CA 4KOVA 2ZW5A 4AB7A 5HH1A 1Y7RA 3I3GA 4XPLA 1MJBA 3EFAA 3IGRA 5C88A 3KKWA 4RS2A 1B6BA 4QC6A 4HNYB 2GE3A 4ONUA 2OZHA 1XMTA 2JDCA 3TOAA 2PRBA 2R7HA 1IYLA 5IB0A 3QB8A 4KOYA 1M1DA 2P6FA 4KLVA 5EC4A 2EUIA 1RO5A 3OWCA 5H86A 1MK4A 5EBVA 2VI7A 3TCVA 2PC1A 1KUVA 3G3SA 4PK2A 4U9ZA 2DXQA 4L8AA 4PV6A 2PSWA 2Z0ZA 2RC4A 4DNCA 4YRHA 4KORA 4UWJA 4NF1A 4Y49B 4YFJA 3R95A 1M4GA 5JPHA 2P6EA 5IX3A 4MHDA 3SHPA 4KUBA 5F47A 4JWPA 2I79A 2Q04A 2IL4A 4R57A 2OB0A 2ZW7A 1NSLA 2QECA 3FIXA 1M44A 3IWGA 3FNCA 2HV2A 2R1IA 2X7BA 5FVJA 4CRZB 4AG9A 3F8KA 1S60A 2FS5A 4B5PB 3R96A 4AVBA 2B58A 3H4QA
chains in the Genus database with same CATH superfamily
2HC9A 4KOXA 2IMOA 2PJBA 3EY5A 3TTHA 4MHPA 2P6GA 5D29A 5K8PA 2AFUA 4MFLA 3JVNA 4UEZA 2AFWA 2AFMA 3NE7A 1ELLP 1M4DA 3D68A 3S9MA 1AMPA 4C2ZA 3D2PA 3FEDA 4MY0A 3D7FA 3TO9A 3V8IA 3WABA 1OZPA 2PJ9A 2OU2A 4TNUA 4X3RA 1P0HA 3FF3A 4NSQA 3V7ZA 1PYTB 2PDOA 3RAMA 3SXNA 1R3NA 3N7ZA 4P45A 1YLOA 4Q7AA 1M4IA 3BI1A 1Q2YA 2B3UA 4B12A 2Q4ZA 4CAVA 1Z8LA 1NSAA 3QAYA 4KVOE 2XEFA 4NJRA 5CNPA 2BSWA 2WUUA 1XF8A 2ZW6A 1IB1E 1Z4RA 2Z3OA 1TKFA 3GY9A 1QSRA 1HDQA 5AG4A 3E0KA 4CAFA 3TX8A 1IIDA 3PB6X 2WSAA 4KSAA 3ZJ0A 4XPDB 2XEGA 2IJZA 5F46A 4M85A 1CG2A 2YNDA 3T8WA 4DUKA 2CNMA 3W6SA 3PGPA 4JJXA 3VATA 2ZW4A 4OC2A 4AXVA 1S7LA 2Z3LA 1VGYA 4MFZA 4B13A 1Z2LA 4ZX8A 2YNEA 4ZY1A 5F49A 4K30A 1YLEA 3GIUA 4I49A 5AG5A 3PP9A 4E0AA 4KVME 2EBJA 3D3SA 3PB4X 4PXCA 4P4FA 3GUXA 2A4NA 2Q4VA 3D7HA 3KZWA 4ZYQA 4KOTA 4MI4A 3GYAA 1L0CA 4KZTA 4EVYA 2J8RA 2I3CA 2EK8A 1QSTA 3BJ7A 2P0WA 2FIWA 1MJAA 1ELMP 2C1CA 2B4DA 3FB3A 3MRUA 1CP7A 2OZUA 2AFXA 2WPWA 3H8FA 1IGBA 4QUSA 2PJ6A 3VH9A 2YGWA 4MCPA 1QSNA 2HQYA 4MFPA 4UF4A 3KHZA 4DYOA 3WC7A 1Z9UA 4MFKA 2BOAA 5J8CA 4NGSA 3NH8A 4KLWA 4OC3A 1WWZA 3KR5A 1KUXA 4QBJA 2GLJA 4A94A 5A28A 4R7MA 4MHZA 2PR1A 1QMUA 2R98A 2NMTA 1LAPA 3KGQA 2V77A 4WWVA 4C7IA 2D4OA 4UEEA 2Q43A 3SJXA 5J1QA 2XEJA 2ATRA 2PJ0A 4NCZA 3P2HA 4P4DA 3EO4A 1H8LA 3T90A 3TE4A 2HUZA 3B3VA 2XEIA 4NEXA 2PVWA 4UCMA 5IB9A 4FD6A 2ZXVA 3GB0A 2IQ6A 1CPXA 1YGHA 2CIJA 4DJLA 4HKFA 2QMLA 4PPZA 4NGRA 1XMBA 2ZELA 5K8MA 4M3SA 2BCOA 4R8FA 4C68A 1Z4EA 2R8VA 2PIZA 4G1PA 3IC1A 4JLYA 3TFYA 3D8PA 2CNSA 4Q36A 3KQXA 2GLFA 1Q2CA 4NGTA 2JDDA 3KI9A 4H89A 1I12A 4PSXA 4KOWA 4P4IA 2H5MA 1PUAA 2BO9A 2ZEGA 3CZXA 4MCRA 2CF4A 2ODFA 2G9DA 3HUVA 4TWEA 4PSWA 1NMTA 5BWAB 3CPAA 3H8EA 2Q51A 1K4JA 2FXFA 3LMSA 4MHYA 3FRMA 4Q38A 3KL9A 5DWMA 4OKOA 4R87A 3L2NA 3TT2A 2GANA 3LD2A 1BPMA 5IV0A 1IYKA 2O53A 2QVPA 3DR8A 1ON0A 2GFQA 4ORFA 1CX8A 1Z8WA 1U6MA 4JXRA 4P44A 4PXBA 4YGOA 1QSMA 2J8MA 4LQGA 4OC5A 3RNZA 1P4NA 3DDDA 5HVFA 3B3WA 2VBQA 4CYOA 4F9UA 4UBRA 3IFEA 2ZEEA 4R3KA 3JUWA 3ZZIA 4CYNA 3FXTA 4AVAA 4BMHA 4P4BA 2PJ5A 3D66A 1ZO0A 4B5PA 2PJ2A 3D7DA 5LYDA 3QAHA 4QVTA 3WC5A 4H2KA 1Y0YA 3RYOA 2V8GA 4AVCA 4F0XA 3B3CA 4OIWA 4C7HA 2ZEDA 5JM6A 3VWDA 1LCPA 3FEEA 1XIXA 2G3AA 4F8ZA 4YWYA 4OAEA 2NYQA 4A38A 5AG7A 2BEIA 1VHEA 2VXKA 4U9YA 4UWIA 4PQAA 2QIRA 2V8VA 3FMCA 2PJ8A 1WK4A 1YW4A 3GKRA 4KVXA 1Q2DA 3RBUA 1LOKA 2JBKA 3CXSA 5JQ4A 4OC1A 1VKCA 1CJWA 3IWEA 3CPXA 1R57A 4LX9A 4PK3A 3DSBA 4FD5A 4J3GA 1AYEA 4H6UA 3CXQA 2F5IA 4A30A 2B5GA 3BHXA 1S7FA 4UA3A 2PR8A 1S3ZA 4YU9A 3LWUA 2F8HA 3PFEA 4MHNA 4ONWA 5DWNA 2CY2A 5AG6A 4P10A 4CS0B 4UFXA 5DS0A 1YMEA 3SXOA 2OR4A 2AJ6A 3SJFA 4GM5A 3WC6A 4CAEA 4XPDC 3F0AA 2FL4A 5I0CA 5LRGA 4O23A 8CPAA 4XPKA 2CTBA 3R9GA 3BJ8A 4Y49C 3K9TA 5KTAA 4CGPA 3P2FA 1S5KA 3IIBA 2BL1A 2C6GA 1VHSA 4ZBGA 5F09A 2VEZA 3R1KA 5F48A 2CNTA 3HLPA 5LYIA 3B2YA 2YNCA 1PCAA 4ZGYB 2PJ1A 5KTCA 1B87A 5G1ZA 1IOIA 4OLLA 4HNWB 4XNHC 1YSJA 1XFOA 2Q44A 5A27A 1ARMA 4PXDA 3I9SA 4L89A 1ZLIA 3DLJA 2FSRA 3R9EA 3B3TA 2ZPAA 2ARHA 2I00A 1UWYA 2V8HA 5KTDA 4MRIA 3NFZA 2WZNA 1BOBA 1CP6A 3H5ZA 1KZFA 4B11A 1UFHA 4FD7A 3N5FA 3F5BA 3JTKA 1Y0RA 3SI1A 1CM0A 4MMOA 3WT4A 2D4PA 3CT9A 3VWEA 4IUSA 5HMNA 1Y9WA 2QJ8A 5GCNA 1BPNA 1VIXA 4M6IA 4MY3A 4A95A 3IWWA 4F6AA 4ZI6A 2GU2A 4R6TA 5C82A 1HEEA 3EXNA 4H6ZA 3RO0A 3TOBA 3W91A 5ISVA 2J8NA 2NSMA 1XOVA 3FX6A 3KHXA 1YK3A 3IU1A 1OBRA 4WJBA 2OOTA 2ZEPA 2HB6A 4A31A 4ZY2A 3NH5A 2DPSA 1IICA 2KCWA 4JXQA 4P4EA 1PU9A 4C2XA 2J9AA 2PQ8A 5EMIA 2WYRA 1F2PA 3B8GA 1BO4A 3TO6A 1ZG9A 4FUUA 2FVGA 2POKA 1TF8A 4HNXB 2Y0MA 4PXEA 3PB8X 1IOFA 4IHMA 2PVVA 5H84A 3SJGA 3TC8A 2WPXA 1YX0A 4K3NA 4X8IA 4UEFA 2PJ3A 3PZJA 3EC4A 3S6HA 3IEHA 4CRYB 2Q7SA 3LACA 2OZGA 1S7KA 1Y9KA 2O4HA 4NGNA 1X10A 2CXAA 3BLNA 1Z5RA 4FWUA 4MBUA 3T9YA 3NA6A 1VHOA 2FCKA 3S9LA 1YVKA 3UY5A 4A39A 5J8FA 1YVOA 1TXRA 2JBJA 1GYTA 3PBEA 4E8OA 4CAWA 2C27A 3DR6A 4X2TA 3PBBA 2QYVA 4GS4A 1N71A 4OADA 2Z11A 2PIYA 1YREA 1ZG8A 2PJ4A 3B3SA 4HPSA 4MJ8A 1S7NA 4QB9A 1NE9A 1YW6A 3CXPA 3IU2A 4MCSA 2AE6A 3PEIA 3FYNA 4UFVA 4A33A 2PJ7A 3B7IA 1A2ZA 3S6KA 2B3VA 2G3TA 3S6FA 2O28A 4FBEA 3LODA 4R76A 1MJ9A 4U5YA 2B4BA 4W9YA 1RXTA 4NGMA 2K5TA 2B4DB 3BI0A 3QNVA 4Z65A 2G0BA 4KSFA 2Z3MA 4X5KA 4OP4A 5THWA 3NE8A 1QQ9A 1LRZA 4NJQA 4P4JA 5E96A 3S9NA 2VQYA 3KQZA 1KWMA 1LANA 3DGVA 4P6YA 2OH1A 1I21A 1ZLHA 1QSOA 2BUEA 2FIAA 3SJEA 3D2MA 3GLJA 2VZZA 1IU8A 1CBXA 4LUAA 3BXMA 4M6HA 3G8WA 2FE7A 3FH4A 5D8NA 2JEVA 1M4LA 4E2AA 5CBMA 4NXYA 4B6ZA 5JH9A 1SQHA 4KUAA 4UFWA 4UCNA 1J4JA 5G21A 1R43A 4CAXA 4EMEA 5LRKA 2C6PA 5HXDA 5I4MA 3H8GA 1HDUA 4OMEA 1KUYA 4KOSA 2Z10A 3ISXA 3W6XA 1F57A 1TIQA 3C26A 2V8DA 3DNSA 5LYFA 1XEBA 3I1UA 3WR7A 3FBUA 4FD4A 4XNHB 1XRYA 2FT0A 2YNCC 4R3LA 2PE3A 2Q0YA 3A9LA 4OC0A 4MFJA 1ARLA 2B5GB 1XJOA 2ZOGA 2PJAA 2EK9A 1YR0A 2EVNA 1FNOA 2Z3PA 4JD6A 4KOUA 3S6GA 4CYPA 4EFDA 4RUHA 1TF9A 2Z3NA 4KSIA 3TO7A 1JQGA 2REFA 3B35A 3MGDA 2DEAA 2GIVA 2AFZA 4UCPA 3PB7X 2DF5A 4CPAA 2Q4YA 1TKHA 1GHEA 4A32A 1ZG7A 3K9UA 4F0YA 4RI1A 1FY7A 3R9FA 3ISZA 4CYQA 4II9A 1LAMA 3PRTA 4AG7A 4IK2A 4LQ6A 5AGEA 4B5OA 1XE4A 2PJCA 2Q7BA 1I1DA 2JLMA 2REEA 3FVLA 4KS9A 1X12A 2ZOFA 4IAVA 5HVGA 1F2OA 2VZYA 2JEWA 4IF5A 4ZY0A 1V0CA 4KOVA 5G22A 2RB7A 4FAIA 5K8OA 2ZW5A 4AB7A 5HH1A 1FT7A 2VL1A 2F7VA 4RN7A 2GREA 1Y7RA 3I3GA 4XPLA 4EWTA 4CGOA 4CGNA 4JYWA 1MJBA 3EFAA 3IGRA 2AFOA 4C2YA 3KKWA 5C88A 4RS2A 3NH4A 1XBUA 1B6BA 1LFWA 4HNYB 4QC6A 5LYLA 2GE3A 2ZEOA 4ONUA 4B14A 3D67A 2OZHA 1XMTA 5JGFA 2JDCA 5HVHA 3TOAA 4OC4A 2PRBA 7CPAA 2R7HA 1IYLA 3IO1A 5IB0A 4NFRA 3QB8A 4F9VA 4BINA 3V38A 4KOYA 1M1DA 2RFHA 4GXHA 1IY7A 1DTDA 2P6FA 2ZENA 4KLVA 5EC4A 2EUIA 4NGPA 2C6CA 2CTCA 1RO5A 3OWCA 5H86A 3MN8A 1MK4A 5CPAA 2VI7A 5EBVA 3PB9X 4BD9A 4R9MA 3TCVA 2ANPA 4M6GA 4MFQA 2EO8A 2PC1A 1KUVA 3G3SA 1BLLE 2EWBA 2PRQA 4PK2A 4U9ZA 2DXQA 4UIBA 4BBHA 4L8AA 4NGQA 1JWQA 2PSWA 2Z0ZA 4PV6A 6CPAA 3IJ3A 1TKJA 4A2ZA 2RC4A 3D4UA 4DNCA 4YRHA 5ELYA 1RTQA 4KORA 4OIDA 1CPSA 1EE3P 1BAVA 4UWJA 5LRJA 4NF1A 3CDXA 1AUGA 1YQEA 1Z8TA 2PCUA 4Y49B 5K8NA 4YFJA 3K2KA 5G20A 1DE4C 3R95A 1M4GA 2AFSA 5JPHA 2P6EA 5IX3A 4MXUA 4MHDA 3RZAA 4KUBA 4MCQA 5F47A 4JWPA 3SHPA 2I79A 2Q04A 2IL4A 3D7GA 4R57A 2ZEFA 4B10A 2OB0A 2ABZA 2ZEMA 2ZW7A 1Z8XA 3KR4A 4UIAA 1NSLA 2QECA 3FIXA 3VARA 1M44A 3IWGA 4A37A 3KASA 3FNCA 2HV2A 2R1IA 2X7BA 3PFOA 4JZ0A 5FVJA 4CRZB 4AG9A 3FJUA 1Y7EA 3F8KA 4CGMA 2Z3KA 4CGLA 1S60A 2ZEHA 2FS5A 3SI0A 2DPTA 4B5PB 3SI2A 3R96A 3JRUA 4AVBA 2B58A 4ZX9A 3FECA 3H4QA 1Q7LA
chains in the Genus database with same CATH topology
4KOXA 3EY5A 3TTHA 2P6GA 4MFLA 3JVNA 3NE7A 1M4DA 4C2ZA 3D2PA 4MY0A 3TO9A 3V8IA 1OZPA 2OU2A 1P0HA 4NSQA 2PDOA 3SXNA 3N7ZA 1M4IA 1Q2YA 2B3UA 4B12A 4CAVA 4KVOE 5CNPA 2BSWA 2WUUA 1XF8A 2ZW6A 1IB1E 1Z4RA 2Z3OA 3GY9A 1QSRA 5AG4A 3E0KA 4CAFA 1IIDA 2WSAA 4KSAA 3ZJ0A 4XPDB 5F46A 4M85A 2YNDA 2CNMA 3W6SA 3PGPA 4JJXA 2ZW4A 1S7LA 2Z3LA 4MFZA 4B13A 2YNEA 5F49A 4K30A 1YLEA 4I49A 5AG5A 4E0AA 3PP9A 4KVME 3D3SA 2A4NA 2Q4VA 4KOTA 4MI4A 3GYAA 1L0CA 4KZTA 4EVYA 2J8RA 1QSTA 3BJ7A 2P0WA 2FIWA 1MJAA 2B4DA 3FB3A 2OZUA 2WPWA 4QUSA 2YGWA 1QSNA 2HQYA 4MFPA 1Z9UA 4MFKA 5J8CA 4KLWA 1WWZA 1KUXA 4QBJA 5A28A 2PR1A 2R98A 2NMTA 4C7IA 2D4OA 2ATRA 4NCZA 3P2HA 3EO4A 3T90A 3TE4A 2HUZA 4NEXA 4UCMA 4FD6A 2ZXVA 1YGHA 4HKFA 2QMLA 4M3SA 4C68A 1Z4EA 2R8VA 3TFYA 4JLYA 3D8PA 2CNSA 4Q36A 1Q2CA 2JDDA 4H89A 1I12A 4PSXA 4KOWA 2H5MA 1PUAA 4PSWA 1NMTA 5BWAB 1K4JA 2FXFA 3FRMA 4Q38A 5DWMA 3TT2A 4R87A 2GANA 3LD2A 5IV0A 1IYKA 3DR8A 4ORFA 1ON0A 4YGOA 1U6MA 4JXRA 1QSMA 2J8MA 1P4NA 3DDDA 2VBQA 4CYOA 4UBRA 4R3KA 3JUWA 3ZZIA 4CYNA 3FXTA 4AVAA 4BMHA 1ZO0A 4B5PA 3QAHA 4QVTA 3RYOA 4AVCA 4F0XA 4C7HA 3VWDA 1XIXA 2G3AA 4OAEA 5AG7A 2BEIA 2VXKA 4U9YA 4UWIA 2QIRA 1WK4A 3GKRA 4KVXA 1Q2DA 3CXSA 5JQ4A 1VKCA 1CJWA 3IWEA 1R57A 4LX9A 4PK3A 3DSBA 4FD5A 4J3GA 4H6UA 3CXQA 2F5IA 4A30A 2B5GA 1S7FA 4UA3A 2PR8A 1S3ZA 5DWNA 2CY2A 5AG6A 4CS0B 4UFXA 3SXOA 2AJ6A 4CAEA 4XPDC 3F0AA 2FL4A 5I0CA 4XPKA 3R9GA 3BJ8A 4Y49C 5KTAA 4CGPA 3P2FA 1S5KA 2BL1A 1VHSA 4ZBGA 2VEZA 3R1KA 5F48A 2CNTA 2YNCA 4ZGYB 5KTCA 1B87A 5G1ZA 4OLLA 4HNWB 4XNHC 2Q44A 5A27A 3I9SA 4L89A 2FSRA 3R9EA 2ZPAA 2ARHA 2I00A 5KTDA 1BOBA 3H5ZA 4B11A 1KZFA 1UFHA 4FD7A 3F5BA 3JTKA 1CM0A 2D4PA 3VWEA 4IUSA 5HMNA 1Y9WA 5GCNA 4MY3A 4A95A 4F6AA 5C82A 3EXNA 4H6ZA 3TOBA 5ISVA 3W91A 2J8NA 1YK3A 3IU1A 4A31A 2DPSA 1IICA 2KCWA 4JXQA 4C2XA 1PU9A 2PQ8A 3B8GA 1BO4A 3TO6A 4HNXB 2Y0MA 5H84A 2WPXA 1YX0A 3PZJA 3EC4A 4CRYB 2OZGA 1S7KA 1Y9KA 2CXAA 3BLNA 4MBUA 3T9YA 2FCKA 1YVKA 3UY5A 5J8FA 1YVOA 4E8OA 4CAWA 2C27A 3DR6A 4OADA 4GS4A 1N71A 2Z11A 1YREA 4MJ8A 1S7NA 4QB9A 1NE9A 3CXPA 3IU2A 4UFVA 2AE6A 4A33A 3FYNA 3S6KA 2B3VA 2G3TA 3S6FA 2O28A 3LODA 1MJ9A 4U5YA 2B4BA 1RXTA 2K5TA 2B4DB 2G0BA 4KSFA 2Z3MA 4X5KA 5E96A 1LRZA 2VQYA 4R9MA 3S6HA 2OH1A 1I21A 1QSOA 2BUEA 2FIAA 3D2MA 2VZZA 4LUAA 3G8WA 2FE7A 2JEVA 4E2AA 4NXYA 1SQHA 4KUAA 4UFWA 4UCNA 1J4JA 5G21A 4CAXA 1KUYA 4KOSA 2Z10A 3W6XA 1TIQA 3C26A 3DNSA 1XEBA 3WR7A 3FBUA 4FD4A 4XNHB 2FT0A 2YNCC 4R3LA 2Q0YA 3A9LA 4MFJA 2B5GB 3S6GA 1YR0A 4JD6A 2Z3PA 4KOUA 2EVNA 4CYPA 2Z3NA 3TO7A 2REFA 3MGDA 2GIVA 4UCPA 2Q4YA 1GHEA 4A32A 3K9UA 4F0YA 4RI1A 1FY7A 3R9FA 4CYQA 4II9A 4AG7A 5AGEA 4B5OA 1XE4A 2Q7BA 1I1DA 2JLMA 2REEA 4KS9A 2VZYA 4IF5A 1V0CA 4KOVA 5G22A 2ZW5A 4AB7A 5HH1A 1Y7RA 3I3GA 4XPLA 4CGOA 4CGNA 1MJBA 3EFAA 3IGRA 4C2YA 5C88A 3KKWA 4RS2A 1B6BA 4QC6A 4HNYB 2GE3A 4ONUA 4B14A 2OZHA 1XMTA 2JDCA 3TOAA 2PRBA 2R7HA 1IYLA 5IB0A 3QB8A 4KOYA 1M1DA 2P6FA 4KLVA 5EC4A 2EUIA 1RO5A 3OWCA 5H86A 1MK4A 5EBVA 2VI7A 3TCVA 4MFQA 2PC1A 1KUVA 3G3SA 4PK2A 4U9ZA 2DXQA 4BBHA 4L8AA 4PV6A 2PSWA 2Z0ZA 4A2ZA 2RC4A 4DNCA 4YRHA 4KORA 4UWJA 4NF1A 4Y49B 4YFJA 5G20A 3R95A 1M4GA 5JPHA 2P6EA 5IX3A 4MHDA 3SHPA 4KUBA 5F47A 4JWPA 2I79A 2Q04A 2IL4A 4R57A 4B10A 2OB0A 2ZW7A 1NSLA 2QECA 3FIXA 1M44A 3IWGA 3FNCA 2HV2A 2R1IA 2X7BA 5FVJA 4CRZB 4AG9A 3F8KA 4CGMA 2Z3KA 4CGLA 1S60A 2FS5A 2DPTA 4B5PB 3R96A 4AVBA 2B58A 3H4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOX A;  3EY5 A;  3TTH A;  2P6G A;  3JVN A;  3NE7 A;  1M4D A;  3D2P A;  4MY0 A;  3TO9 A;  3V8I A;  1OZP A;  2OU2 A;  1P0H A;  4NSQ A;  2PDO A;  3SXN A;  3N7Z A;  1M4I A;  1Q2Y A;  2B3U A;  4CAV A;  4KVO E;  5CNP A;  2BSW A;  1XF8 A;  2ZW6 A;  1IB1 E;  1Z4R A;  3GY9 A;  1QSR A;  3E0K A;  1IID A;  3ZJ0 A;  4XPD B;  5F46 A;  4M85 A;  2CNM A;  3W6S A;  3PGP A;  4JJX A;  2ZW4 A;  1S7L A;  5F49 A;  4K30 A;  1YLE A;  4I49 A;  4E0A A;  3PP9 A;  4KVM E;  3D3S A;  2A4N A;  2Q4V A;  4KOT A;  4MI4 A;  3GYA A;  1L0C A;  4KZT A;  4EVY A;  2J8R A;  1QST A;  3BJ7 A;  2P0W A;  2FIW A;  1MJA A;  2B4D A;  3FB3 A;  2OZU A;  2WPW A;  4QUS A;  1QSN A;  2HQY A;  1Z9U A;  5J8C A;  4KLW A;  1WWZ A;  1KUX A;  4QBJ A;  2PR1 A;  2R98 A;  2NMT A;  2D4O A;  2ATR A;  4NCZ A;  3P2H A;  3EO4 A;  3T90 A;  3TE4 A;  2HUZ A;  4NEX A;  4FD6 A;  2ZXV A;  1YGH A;  4HKF A;  2QML A;  4M3S A;  1Z4E A;  2R8V A;  3TFY A;  4JLY A;  3D8P A;  2CNS A;  1Q2C A;  2JDD A;  4H89 A;  1I12 A;  4PSX A;  4KOW A;  2H5M A;  1PUA A;  4PSW A;  1NMT A;  1K4J A;  2FXF A;  3FRM A;  5DWM A;  3TT2 A;  4R87 A;  2GAN A;  3LD2 A;  5IV0 A;  1IYK A;  3DR8 A;  4ORF A;  1ON0 A;  4YGO A;  1U6M A;  4JXR A;  1QSM A;  2J8M A;  1P4N A;  3DDD A;  2VBQ A;  4UBR A;  4R3K A;  3JUW A;  3ZZI A;  3FXT A;  4AVA A;  4BMH A;  4B5P A;  3QAH A;  4QVT A;  3RYO A;  4AVC A;  3VWD A;  1XIX A;  2G3A A;  4OAE A;  2BEI A;  2VXK A;  4U9Y A;  4UWI A;  2QIR A;  1WK4 A;  3GKR A;  4KVX A;  1Q2D A;  3CXS A;  5JQ4 A;  1VKC A;  1CJW A;  1R57 A;  4LX9 A;  4PK3 A;  3DSB A;  4FD5 A;  4J3G A;  4H6U A;  3CXQ A;  2F5I A;  2B5G A;  1S7F A;  4UA3 A;  2PR8 A;  1S3Z A;  5DWN A;  2CY2 A;  4CS0 B;  3SXO A;  2AJ6 A;  4XPD C;  3F0A A;  2FL4 A;  5I0C A;  4XPK A;  3R9G A;  3BJ8 A;  4Y49 C;  5KTA A;  3P2F A;  1S5K A;  2BL1 A;  1VHS A;  4ZBG A;  2VEZ A;  3R1K A;  5F48 A;  2CNT A;  5KTC A;  1B87 A;  4OLL A;  4HNW B;  4XNH C;  2Q44 A;  3I9S A;  4L89 A;  2FSR A;  3R9E A;  2ZPA A;  2ARH A;  2I00 A;  5KTD A;  1BOB A;  1KZF A;  1UFH A;  4FD7 A;  3F5B A;  1CM0 A;  2D4P A;  3VWE A;  4IUS A;  5HMN A;  1Y9W A;  5GCN A;  4MY3 A;  4F6A A;  5C82 A;  3EXN A;  4H6Z A;  3TOB A;  5ISV A;  3W91 A;  2J8N A;  1YK3 A;  1IIC A;  2KCW A;  4JXQ A;  1PU9 A;  2PQ8 A;  3B8G A;  1BO4 A;  3TO6 A;  4HNX B;  2Y0M A;  5H84 A;  2WPX A;  1YX0 A;  3PZJ A;  3EC4 A;  4CRY B;  2OZG A;  1S7K A;  1Y9K A;  3BLN A;  4MBU A;  3T9Y A;  2FCK A;  1YVK A;  3UY5 A;  5J8F A;  1YVO A;  4E8O A;  4CAW A;  2C27 A;  3DR6 A;  4OAD A;  4GS4 A;  1N71 A;  2Z11 A;  1YRE A;  4MJ8 A;  1S7N A;  4QB9 A;  1NE9 A;  3CXP A;  2AE6 A;  3FYN A;  3S6K A;  2B3V A;  2G3T A;  3S6F A;  2O28 A;  3LOD A;  1MJ9 A;  4U5Y A;  2B4B A;  1RXT A;  2K5T A;  2B4D B;  2G0B A;  4X5K A;  5E96 A;  1LRZ A;  2VQY A;  4R9M A;  3S6H A;  2OH1 A;  1I21 A;  1QSO A;  2BUE A;  2FIA A;  3D2M A;  2VZZ A;  4LUA A;  3G8W A;  2FE7 A;  2JEV A;  4E2A A;  4NXY A;  1SQH A;  4KUA A;  1J4J A;  4CAX A;  1KUY A;  4KOS A;  2Z10 A;  3W6X A;  1TIQ A;  3C26 A;  3DNS A;  1XEB A;  3WR7 A;  3FBU A;  4FD4 A;  4XNH B;  2FT0 A;  4R3L A;  2Q0Y A;  2B5G B;  3S6G A;  1YR0 A;  4JD6 A;  2EVN A;  4KOU A;  3TO7 A;  2REF A;  3MGD A;  2GIV A;  2Q4Y A;  1GHE A;  3K9U A;  4F0Y A;  4RI1 A;  1FY7 A;  3R9F A;  4II9 A;  4AG7 A;  4B5O A;  1XE4 A;  2Q7B A;  1I1D A;  2JLM A;  2REE A;  2VZY A;  4IF5 A;  1V0C A;  4KOV A;  2ZW5 A;  4AB7 A;  5HH1 A;  1Y7R A;  3I3G A;  4XPL A;  1MJB A;  3EFA A;  3IGR A;  5C88 A;  3KKW A;  4RS2 A;  1B6B A;  4QC6 A;  4HNY B;  2GE3 A;  4ONU A;  2OZH A;  1XMT A;  2JDC A;  3TOA A;  2PRB A;  2R7H A;  1IYL A;  5IB0 A;  3QB8 A;  4KOY A;  1M1D A;  2P6F A;  4KLV A;  5EC4 A;  2EUI A;  1RO5 A;  3OWC A;  5H86 A;  1MK4 A;  5EBV A;  2VI7 A;  3TCV A;  2PC1 A;  1KUV A;  3G3S A;  4PK2 A;  4U9Z A;  2DXQ A;  4L8A A;  4PV6 A;  2PSW A;  2Z0Z A;  2RC4 A;  4DNC A;  4YRH A;  4KOR A;  4UWJ A;  4NF1 A;  4Y49 B;  4YFJ A;  3R95 A;  1M4G A;  5JPH A;  2P6E A;  5IX3 A;  4MHD A;  3SHP A;  4KUB A;  5F47 A;  4JWP A;  2I79 A;  2Q04 A;  2IL4 A;  4R57 A;  2OB0 A;  2ZW7 A;  1NSL A;  2QEC A;  3FIX A;  1M44 A;  3IWG A;  3FNC A;  2HV2 A;  2R1I A;  2X7B A;  5FVJ A;  4CRZ B;  4AG9 A;  3F8K A;  1S60 A;  2FS5 A;  4B5P B;  3R96 A;  4AVB A;  2B58 A;  3H4Q A; 
#chains in the Genus database with same CATH topology
 2HC9 A;  4KOX A;  2IMO A;  2PJB A;  3EY5 A;  3TTH A;  4MHP A;  2P6G A;  5D29 A;  5K8P A;  2AFU A;  4MFL A;  3JVN A;  4UEZ A;  2AFW A;  2AFM A;  3NE7 A;  1ELL P;  1M4D A;  3D68 A;  3S9M A;  1AMP A;  4C2Z A;  3D2P A;  3FED A;  4MY0 A;  3D7F A;  3TO9 A;  3V8I A;  3WAB A;  1OZP A;  2PJ9 A;  2OU2 A;  4TNU A;  4X3R A;  1P0H A;  3FF3 A;  4NSQ A;  3V7Z A;  1PYT B;  2PDO A;  3RAM A;  3SXN A;  1R3N A;  3N7Z A;  4P45 A;  1YLO A;  4Q7A A;  1M4I A;  3BI1 A;  1Q2Y A;  2B3U A;  4B12 A;  2Q4Z A;  4CAV A;  1Z8L A;  1NSA A;  3QAY A;  4KVO E;  2XEF A;  4NJR A;  5CNP A;  2BSW A;  2WUU A;  1XF8 A;  2ZW6 A;  1IB1 E;  1Z4R A;  2Z3O A;  1TKF A;  3GY9 A;  1QSR A;  1HDQ A;  5AG4 A;  3E0K A;  4CAF A;  3TX8 A;  1IID A;  3PB6 X;  2WSA A;  4KSA A;  3ZJ0 A;  4XPD B;  2XEG A;  2IJZ A;  5F46 A;  4M85 A;  1CG2 A;  2YND A;  3T8W A;  4DUK A;  2CNM A;  3W6S A;  3PGP A;  4JJX A;  3VAT A;  2ZW4 A;  4OC2 A;  4AXV A;  1S7L A;  2Z3L A;  1VGY A;  4MFZ A;  4B13 A;  1Z2L A;  4ZX8 A;  2YNE A;  4ZY1 A;  5F49 A;  4K30 A;  1YLE A;  3GIU A;  4I49 A;  5AG5 A;  3PP9 A;  4E0A A;  4KVM E;  2EBJ A;  3D3S A;  3PB4 X;  4PXC A;  4P4F A;  3GUX A;  2A4N A;  2Q4V A;  3D7H A;  3KZW A;  4ZYQ A;  4KOT A;  4MI4 A;  3GYA A;  1L0C A;  4KZT A;  4EVY A;  2J8R A;  2I3C A;  2EK8 A;  1QST A;  3BJ7 A;  2P0W A;  2FIW A;  1MJA A;  1ELM P;  2C1C A;  2B4D A;  3FB3 A;  3MRU A;  1CP7 A;  2OZU A;  2AFX A;  2WPW A;  3H8F A;  1IGB A;  4QUS A;  2PJ6 A;  3VH9 A;  2YGW A;  4MCP A;  1QSN A;  2HQY A;  4MFP A;  4UF4 A;  3KHZ A;  4DYO A;  3WC7 A;  1Z9U A;  4MFK A;  2BOA A;  5J8C A;  4NGS A;  3NH8 A;  4KLW A;  4OC3 A;  1WWZ A;  3KR5 A;  1KUX A;  4QBJ A;  2GLJ A;  4A94 A;  5A28 A;  4R7M A;  4MHZ A;  2PR1 A;  1QMU A;  2R98 A;  2NMT A;  1LAP A;  3KGQ A;  2V77 A;  4WWV A;  4C7I A;  2D4O A;  4UEE A;  2Q43 A;  3SJX A;  5J1Q A;  2XEJ A;  2ATR A;  2PJ0 A;  4NCZ A;  3P2H A;  4P4D A;  3EO4 A;  1H8L A;  3T90 A;  3TE4 A;  2HUZ A;  3B3V A;  2XEI A;  4NEX A;  2PVW A;  4UCM A;  5IB9 A;  4FD6 A;  2ZXV A;  3GB0 A;  2IQ6 A;  1CPX A;  1YGH A;  2CIJ A;  4DJL A;  4HKF A;  2QML A;  4PPZ A;  4NGR A;  1XMB A;  2ZEL A;  5K8M A;  4M3S A;  2BCO A;  4R8F A;  4C68 A;  1Z4E A;  2R8V A;  2PIZ A;  4G1P A;  3IC1 A;  4JLY A;  3TFY A;  3D8P A;  2CNS A;  4Q36 A;  3KQX A;  2GLF A;  1Q2C A;  4NGT A;  2JDD A;  3KI9 A;  4H89 A;  1I12 A;  4PSX A;  4KOW A;  4P4I A;  2H5M A;  1PUA A;  2BO9 A;  2ZEG A;  3CZX A;  4MCR A;  2CF4 A;  2ODF A;  2G9D A;  3HUV A;  4TWE A;  4PSW A;  1NMT A;  5BWA B;  3CPA A;  3H8E A;  2Q51 A;  1K4J A;  2FXF A;  3LMS A;  4MHY A;  3FRM A;  4Q38 A;  3KL9 A;  5DWM A;  4OKO A;  4R87 A;  3L2N A;  3TT2 A;  2GAN A;  3LD2 A;  1BPM A;  5IV0 A;  1IYK A;  2O53 A;  2QVP A;  3DR8 A;  1ON0 A;  2GFQ A;  4ORF A;  1CX8 A;  1Z8W A;  1U6M A;  4JXR A;  4P44 A;  4PXB A;  4YGO A;  1QSM A;  2J8M A;  4LQG A;  4OC5 A;  3RNZ A;  1P4N A;  3DDD A;  5HVF A;  3B3W A;  2VBQ A;  4CYO A;  4F9U A;  4UBR A;  3IFE A;  2ZEE A;  4R3K A;  3JUW A;  3ZZI A;  4CYN A;  3FXT A;  4AVA A;  4BMH A;  4P4B A;  2PJ5 A;  3D66 A;  1ZO0 A;  4B5P A;  2PJ2 A;  3D7D A;  5LYD A;  3QAH A;  4QVT A;  3WC5 A;  4H2K A;  1Y0Y A;  3RYO A;  2V8G A;  4AVC A;  4F0X A;  3B3C A;  4OIW A;  4C7H A;  2ZED A;  5JM6 A;  3VWD A;  1LCP A;  3FEE A;  1XIX A;  2G3A A;  4F8Z A;  4YWY A;  4OAE A;  2NYQ A;  4A38 A;  5AG7 A;  2BEI A;  1VHE A;  2VXK A;  4U9Y A;  4UWI A;  4PQA A;  2QIR A;  2V8V A;  3FMC A;  2PJ8 A;  1WK4 A;  1YW4 A;  3GKR A;  4KVX A;  1Q2D A;  3RBU A;  1LOK A;  2JBK A;  3CXS A;  5JQ4 A;  4OC1 A;  1VKC A;  1CJW A;  3IWE A;  3CPX A;  1R57 A;  4LX9 A;  4PK3 A;  3DSB A;  4FD5 A;  4J3G A;  1AYE A;  4H6U A;  3CXQ A;  2F5I A;  4A30 A;  2B5G A;  3BHX A;  1S7F A;  4UA3 A;  2PR8 A;  1S3Z A;  4YU9 A;  3LWU A;  2F8H A;  3PFE A;  4MHN A;  4ONW A;  5DWN A;  2CY2 A;  5AG6 A;  4P10 A;  4CS0 B;  4UFX A;  5DS0 A;  1YME A;  3SXO A;  2OR4 A;  2AJ6 A;  3SJF A;  4GM5 A;  3WC6 A;  4CAE A;  4XPD C;  3F0A A;  2FL4 A;  5I0C A;  5LRG A;  4O23 A;  8CPA A;  4XPK A;  2CTB A;  3R9G A;  3BJ8 A;  4Y49 C;  3K9T A;  5KTA A;  4CGP A;  3P2F A;  1S5K A;  3IIB A;  2BL1 A;  2C6G A;  1VHS A;  4ZBG A;  5F09 A;  2VEZ A;  3R1K A;  5F48 A;  2CNT A;  3HLP A;  5LYI A;  3B2Y A;  2YNC A;  1PCA A;  4ZGY B;  2PJ1 A;  5KTC A;  1B87 A;  5G1Z A;  1IOI A;  4OLL A;  4HNW B;  4XNH C;  1YSJ A;  1XFO A;  2Q44 A;  5A27 A;  1ARM A;  4PXD A;  3I9S A;  4L89 A;  1ZLI A;  3DLJ A;  2FSR A;  3R9E A;  3B3T A;  2ZPA A;  2ARH A;  2I00 A;  1UWY A;  2V8H A;  5KTD A;  4MRI A;  3NFZ A;  2WZN A;  1BOB A;  1CP6 A;  3H5Z A;  1KZF A;  4B11 A;  1UFH A;  4FD7 A;  3N5F A;  3F5B A;  3JTK A;  1Y0R A;  3SI1 A;  1CM0 A;  4MMO A;  3WT4 A;  2D4P A;  3CT9 A;  3VWE A;  4IUS A;  5HMN A;  1Y9W A;  2QJ8 A;  5GCN A;  1BPN A;  1VIX A;  4M6I A;  4MY3 A;  4A95 A;  3IWW A;  4F6A A;  4ZI6 A;  2GU2 A;  4R6T A;  5C82 A;  1HEE A;  3EXN A;  4H6Z A;  3RO0 A;  3TOB A;  3W91 A;  5ISV A;  2J8N A;  2NSM A;  1XOV A;  3FX6 A;  3KHX A;  1YK3 A;  3IU1 A;  1OBR A;  4WJB A;  2OOT A;  2ZEP A;  2HB6 A;  4A31 A;  4ZY2 A;  3NH5 A;  2DPS A;  1IIC A;  2KCW A;  4JXQ A;  4P4E A;  1PU9 A;  4C2X A;  2J9A A;  2PQ8 A;  5EMI A;  2WYR A;  1F2P A;  3B8G A;  1BO4 A;  3TO6 A;  1ZG9 A;  4FUU A;  2FVG A;  2POK A;  1TF8 A;  4HNX B;  2Y0M A;  4PXE A;  3PB8 X;  1IOF A;  4IHM A;  2PVV A;  5H84 A;  3SJG A;  3TC8 A;  2WPX A;  1YX0 A;  4K3N A;  4X8I A;  4UEF A;  2PJ3 A;  3PZJ A;  3EC4 A;  3S6H A;  3IEH A;  4CRY B;  2Q7S A;  3LAC A;  2OZG A;  1S7K A;  1Y9K A;  2O4H A;  4NGN A;  1X10 A;  2CXA A;  3BLN A;  1Z5R A;  4FWU A;  4MBU A;  3T9Y A;  3NA6 A;  1VHO A;  2FCK A;  3S9L A;  1YVK A;  3UY5 A;  4A39 A;  5J8F A;  1YVO A;  1TXR A;  2JBJ A;  1GYT A;  3PBE A;  4E8O A;  4CAW A;  2C27 A;  3DR6 A;  4X2T A;  3PBB A;  2QYV A;  4GS4 A;  1N71 A;  4OAD A;  2Z11 A;  2PIY A;  1YRE A;  1ZG8 A;  2PJ4 A;  3B3S A;  4HPS A;  4MJ8 A;  1S7N A;  4QB9 A;  1NE9 A;  1YW6 A;  3CXP A;  3IU2 A;  4MCS A;  2AE6 A;  3PEI A;  3FYN A;  4UFV A;  4A33 A;  2PJ7 A;  3B7I A;  1A2Z A;  3S6K A;  2B3V A;  2G3T A;  3S6F A;  2O28 A;  4FBE A;  3LOD A;  4R76 A;  1MJ9 A;  4U5Y A;  2B4B A;  4W9Y A;  1RXT A;  4NGM A;  2K5T A;  2B4D B;  3BI0 A;  3QNV A;  4Z65 A;  2G0B A;  4KSF A;  2Z3M A;  4X5K A;  4OP4 A;  5THW A;  3NE8 A;  1QQ9 A;  1LRZ A;  4NJQ A;  4P4J A;  5E96 A;  3S9N A;  2VQY A;  3KQZ A;  1KWM A;  1LAN A;  3DGV A;  4P6Y A;  2OH1 A;  1I21 A;  1ZLH A;  1QSO A;  2BUE A;  2FIA A;  3SJE A;  3D2M A;  3GLJ A;  2VZZ A;  1IU8 A;  1CBX A;  4LUA A;  3BXM A;  4M6H A;  3G8W A;  2FE7 A;  3FH4 A;  5D8N A;  2JEV A;  1M4L A;  4E2A A;  5CBM A;  4NXY A;  4B6Z A;  5JH9 A;  1SQH A;  4KUA A;  4UFW A;  4UCN A;  1J4J A;  5G21 A;  1R43 A;  4CAX A;  4EME A;  5LRK A;  2C6P A;  5HXD A;  5I4M A;  3H8G A;  1HDU A;  4OME A;  1KUY A;  4KOS A;  2Z10 A;  3ISX A;  3W6X A;  1F57 A;  1TIQ A;  3C26 A;  2V8D A;  3DNS A;  5LYF A;  1XEB A;  3I1U A;  3WR7 A;  3FBU A;  4FD4 A;  4XNH B;  1XRY A;  2FT0 A;  2YNC C;  4R3L A;  2PE3 A;  2Q0Y A;  3A9L A;  4OC0 A;  4MFJ A;  1ARL A;  2B5G B;  1XJO A;  2ZOG A;  2PJA A;  2EK9 A;  1YR0 A;  2EVN A;  1FNO A;  2Z3P A;  4JD6 A;  4KOU A;  3S6G A;  4CYP A;  4EFD A;  4RUH A;  1TF9 A;  2Z3N A;  4KSI A;  3TO7 A;  1JQG A;  2REF A;  3B35 A;  3MGD A;  2DEA A;  2GIV A;  2AFZ A;  4UCP A;  3PB7 X;  2DF5 A;  4CPA A;  2Q4Y A;  1TKH A;  1GHE A;  4A32 A;  1ZG7 A;  3K9U A;  4F0Y A;  4RI1 A;  1FY7 A;  3R9F A;  3ISZ A;  4CYQ A;  4II9 A;  1LAM A;  3PRT A;  4AG7 A;  4IK2 A;  4LQ6 A;  5AGE A;  4B5O A;  1XE4 A;  2PJC A;  2Q7B A;  1I1D A;  2JLM A;  2REE A;  3FVL A;  4KS9 A;  1X12 A;  2ZOF A;  4IAV A;  5HVG A;  1F2O A;  2VZY A;  2JEW A;  4IF5 A;  4ZY0 A;  1V0C A;  4KOV A;  5G22 A;  2RB7 A;  4FAI A;  5K8O A;  2ZW5 A;  4AB7 A;  5HH1 A;  1FT7 A;  2VL1 A;  2F7V A;  4RN7 A;  2GRE A;  1Y7R A;  3I3G A;  4XPL A;  4EWT A;  4CGO A;  4CGN A;  4JYW A;  1MJB A;  3EFA A;  3IGR A;  2AFO A;  4C2Y A;  3KKW A;  5C88 A;  4RS2 A;  3NH4 A;  1XBU A;  1B6B A;  1LFW A;  4HNY B;  4QC6 A;  5LYL A;  2GE3 A;  2ZEO A;  4ONU A;  4B14 A;  3D67 A;  2OZH A;  1XMT A;  5JGF A;  2JDC A;  5HVH A;  3TOA A;  4OC4 A;  2PRB A;  7CPA A;  2R7H A;  1IYL A;  3IO1 A;  5IB0 A;  4NFR A;  3QB8 A;  4F9V A;  4BIN A;  3V38 A;  4KOY A;  1M1D A;  2RFH A;  4GXH A;  1IY7 A;  1DTD A;  2P6F A;  2ZEN A;  4KLV A;  5EC4 A;  2EUI A;  4NGP A;  2C6C A;  2CTC A;  1RO5 A;  3OWC A;  5H86 A;  3MN8 A;  1MK4 A;  5CPA A;  2VI7 A;  5EBV A;  3PB9 X;  4BD9 A;  4R9M A;  3TCV A;  2ANP A;  4M6G A;  4MFQ A;  2EO8 A;  2PC1 A;  1KUV A;  3G3S A;  1BLL E;  2EWB A;  2PRQ A;  4PK2 A;  4U9Z A;  2DXQ A;  4UIB A;  4BBH A;  4L8A A;  4NGQ A;  1JWQ A;  2PSW A;  2Z0Z A;  4PV6 A;  6CPA A;  3IJ3 A;  1TKJ A;  4A2Z A;  2RC4 A;  3D4U A;  4DNC A;  4YRH A;  5ELY A;  1RTQ A;  4KOR A;  4OID A;  1CPS A;  1EE3 P;  1BAV A;  4UWJ A;  5LRJ A;  4NF1 A;  3CDX A;  1AUG A;  1YQE A;  1Z8T A;  2PCU A;  4Y49 B;  5K8N A;  4YFJ A;  3K2K A;  5G20 A;  1DE4 C;  3R95 A;  1M4G A;  2AFS A;  5JPH A;  2P6E A;  5IX3 A;  4MXU A;  4MHD A;  3RZA A;  4KUB A;  4MCQ A;  5F47 A;  4JWP A;  3SHP A;  2I79 A;  2Q04 A;  2IL4 A;  3D7G A;  4R57 A;  2ZEF A;  4B10 A;  2OB0 A;  2ABZ A;  2ZEM A;  2ZW7 A;  1Z8X A;  3KR4 A;  4UIA A;  1NSL A;  2QEC A;  3FIX A;  3VAR A;  1M44 A;  3IWG A;  4A37 A;  3KAS A;  3FNC A;  2HV2 A;  2R1I A;  2X7B A;  3PFO A;  4JZ0 A;  5FVJ A;  4CRZ B;  4AG9 A;  3FJU A;  1Y7E A;  3F8K A;  4CGM A;  2Z3K A;  4CGL A;  1S60 A;  2ZEH A;  2FS5 A;  3SI0 A;  2DPT A;  4B5P B;  3SI2 A;  3R96 A;  3JRU A;  4AVB A;  2B58 A;  4ZX9 A;  3FEC A;  3H4Q A;  1Q7L A; 
#chains in the Genus database with same CATH homology
 4KOX A;  3EY5 A;  3TTH A;  2P6G A;  4MFL A;  3JVN A;  3NE7 A;  1M4D A;  4C2Z A;  3D2P A;  4MY0 A;  3TO9 A;  3V8I A;  1OZP A;  2OU2 A;  1P0H A;  4NSQ A;  2PDO A;  3SXN A;  3N7Z A;  1M4I A;  1Q2Y A;  2B3U A;  4B12 A;  4CAV A;  4KVO E;  5CNP A;  2BSW A;  2WUU A;  1XF8 A;  2ZW6 A;  1IB1 E;  1Z4R A;  2Z3O A;  3GY9 A;  1QSR A;  5AG4 A;  3E0K A;  4CAF A;  1IID A;  2WSA A;  4KSA A;  3ZJ0 A;  4XPD B;  5F46 A;  4M85 A;  2YND A;  2CNM A;  3W6S A;  3PGP A;  4JJX A;  2ZW4 A;  1S7L A;  2Z3L A;  4MFZ A;  4B13 A;  2YNE A;  5F49 A;  4K30 A;  1YLE A;  4I49 A;  5AG5 A;  4E0A A;  3PP9 A;  4KVM E;  3D3S A;  2A4N A;  2Q4V A;  4KOT A;  4MI4 A;  3GYA A;  1L0C A;  4KZT A;  4EVY A;  2J8R A;  1QST A;  3BJ7 A;  2P0W A;  2FIW A;  1MJA A;  2B4D A;  3FB3 A;  2OZU A;  2WPW A;  4QUS A;  2YGW A;  1QSN A;  2HQY A;  4MFP A;  1Z9U A;  4MFK A;  5J8C A;  4KLW A;  1WWZ A;  1KUX A;  4QBJ A;  5A28 A;  2PR1 A;  2R98 A;  2NMT A;  4C7I A;  2D4O A;  2ATR A;  4NCZ A;  3P2H A;  3EO4 A;  3T90 A;  3TE4 A;  2HUZ A;  4NEX A;  4UCM A;  4FD6 A;  2ZXV A;  1YGH A;  4HKF A;  2QML A;  4M3S A;  4C68 A;  1Z4E A;  2R8V A;  3TFY A;  4JLY A;  3D8P A;  2CNS A;  4Q36 A;  1Q2C A;  2JDD A;  4H89 A;  1I12 A;  4PSX A;  4KOW A;  2H5M A;  1PUA A;  4PSW A;  1NMT A;  5BWA B;  1K4J A;  2FXF A;  3FRM A;  4Q38 A;  5DWM A;  3TT2 A;  4R87 A;  2GAN A;  3LD2 A;  5IV0 A;  1IYK A;  3DR8 A;  4ORF A;  1ON0 A;  4YGO A;  1U6M A;  4JXR A;  1QSM A;  2J8M A;  1P4N A;  3DDD A;  2VBQ A;  4CYO A;  4UBR A;  4R3K A;  3JUW A;  3ZZI A;  4CYN A;  3FXT A;  4AVA A;  4BMH A;  1ZO0 A;  4B5P A;  3QAH A;  4QVT A;  3RYO A;  4AVC A;  4F0X A;  4C7H A;  3VWD A;  1XIX A;  2G3A A;  4OAE A;  5AG7 A;  2BEI A;  2VXK A;  4U9Y A;  4UWI A;  2QIR A;  1WK4 A;  3GKR A;  4KVX A;  1Q2D A;  3CXS A;  5JQ4 A;  1VKC A;  1CJW A;  3IWE A;  1R57 A;  4LX9 A;  4PK3 A;  3DSB A;  4FD5 A;  4J3G A;  4H6U A;  3CXQ A;  2F5I A;  4A30 A;  2B5G A;  1S7F A;  4UA3 A;  2PR8 A;  1S3Z A;  5DWN A;  2CY2 A;  5AG6 A;  4CS0 B;  4UFX A;  3SXO A;  2AJ6 A;  4CAE A;  4XPD C;  3F0A A;  2FL4 A;  5I0C A;  4XPK A;  3R9G A;  3BJ8 A;  4Y49 C;  5KTA A;  4CGP A;  3P2F A;  1S5K A;  2BL1 A;  1VHS A;  4ZBG A;  2VEZ A;  3R1K A;  5F48 A;  2CNT A;  2YNC A;  4ZGY B;  5KTC A;  1B87 A;  5G1Z A;  4OLL A;  4HNW B;  4XNH C;  2Q44 A;  5A27 A;  3I9S A;  4L89 A;  2FSR A;  3R9E A;  2ZPA A;  2ARH A;  2I00 A;  5KTD A;  1BOB A;  3H5Z A;  4B11 A;  1KZF A;  1UFH A;  4FD7 A;  3F5B A;  3JTK A;  1CM0 A;  2D4P A;  3VWE A;  4IUS A;  5HMN A;  1Y9W A;  5GCN A;  4MY3 A;  4A95 A;  4F6A A;  5C82 A;  3EXN A;  4H6Z A;  3TOB A;  5ISV A;  3W91 A;  2J8N A;  1YK3 A;  3IU1 A;  4A31 A;  2DPS A;  1IIC A;  2KCW A;  4JXQ A;  4C2X A;  1PU9 A;  2PQ8 A;  3B8G A;  1BO4 A;  3TO6 A;  4HNX B;  2Y0M A;  5H84 A;  2WPX A;  1YX0 A;  3PZJ A;  3EC4 A;  4CRY B;  2OZG A;  1S7K A;  1Y9K A;  2CXA A;  3BLN A;  4MBU A;  3T9Y A;  2FCK A;  1YVK A;  3UY5 A;  5J8F A;  1YVO A;  4E8O A;  4CAW A;  2C27 A;  3DR6 A;  4OAD A;  4GS4 A;  1N71 A;  2Z11 A;  1YRE A;  4MJ8 A;  1S7N A;  4QB9 A;  1NE9 A;  3CXP A;  3IU2 A;  4UFV A;  2AE6 A;  4A33 A;  3FYN A;  3S6K A;  2B3V A;  2G3T A;  3S6F A;  2O28 A;  3LOD A;  1MJ9 A;  4U5Y A;  2B4B A;  1RXT A;  2K5T A;  2B4D B;  2G0B A;  4KSF A;  2Z3M A;  4X5K A;  5E96 A;  1LRZ A;  2VQY A;  4R9M A;  3S6H A;  2OH1 A;  1I21 A;  1QSO A;  2BUE A;  2FIA A;  3D2M A;  2VZZ A;  4LUA A;  3G8W A;  2FE7 A;  2JEV A;  4E2A A;  4NXY A;  1SQH A;  4KUA A;  4UFW A;  4UCN A;  1J4J A;  5G21 A;  4CAX A;  1KUY A;  4KOS A;  2Z10 A;  3W6X A;  1TIQ A;  3C26 A;  3DNS A;  1XEB A;  3WR7 A;  3FBU A;  4FD4 A;  4XNH B;  2FT0 A;  2YNC C;  4R3L A;  2Q0Y A;  3A9L A;  4MFJ A;  2B5G B;  3S6G A;  1YR0 A;  4JD6 A;  2Z3P A;  4KOU A;  2EVN A;  4CYP A;  2Z3N A;  3TO7 A;  2REF A;  3MGD A;  2GIV A;  4UCP A;  2Q4Y A;  1GHE A;  4A32 A;  3K9U A;  4F0Y A;  4RI1 A;  1FY7 A;  3R9F A;  4CYQ A;  4II9 A;  4AG7 A;  5AGE A;  4B5O A;  1XE4 A;  2Q7B A;  1I1D A;  2JLM A;  2REE A;  4KS9 A;  2VZY A;  4IF5 A;  1V0C A;  4KOV A;  5G22 A;  2ZW5 A;  4AB7 A;  5HH1 A;  1Y7R A;  3I3G A;  4XPL A;  4CGO A;  4CGN A;  1MJB A;  3EFA A;  3IGR A;  4C2Y A;  5C88 A;  3KKW A;  4RS2 A;  1B6B A;  4QC6 A;  4HNY B;  2GE3 A;  4ONU A;  4B14 A;  2OZH A;  1XMT A;  2JDC A;  3TOA A;  2PRB A;  2R7H A;  1IYL A;  5IB0 A;  3QB8 A;  4KOY A;  1M1D A;  2P6F A;  4KLV A;  5EC4 A;  2EUI A;  1RO5 A;  3OWC A;  5H86 A;  1MK4 A;  5EBV A;  2VI7 A;  3TCV A;  4MFQ A;  2PC1 A;  1KUV A;  3G3S A;  4PK2 A;  4U9Z A;  2DXQ A;  4BBH A;  4L8A A;  4PV6 A;  2PSW A;  2Z0Z A;  4A2Z A;  2RC4 A;  4DNC A;  4YRH A;  4KOR A;  4UWJ A;  4NF1 A;  4Y49 B;  4YFJ A;  5G20 A;  3R95 A;  1M4G A;  5JPH A;  2P6E A;  5IX3 A;  4MHD A;  3SHP A;  4KUB A;  5F47 A;  4JWP A;  2I79 A;  2Q04 A;  2IL4 A;  4R57 A;  4B10 A;  2OB0 A;  2ZW7 A;  1NSL A;  2QEC A;  3FIX A;  1M44 A;  3IWG A;  3FNC A;  2HV2 A;  2R1I A;  2X7B A;  5FVJ A;  4CRZ B;  4AG9 A;  3F8K A;  4CGM A;  2Z3K A;  4CGL A;  1S60 A;  2FS5 A;  2DPT A;  4B5P B;  3R96 A;  4AVB A;  2B58 A;  3H4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...