4YGOA

Dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae in intermediate state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (atcc 39315 / el tor inaba n16961)
total genus 49
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ygoA00
4DNCA 1IIDA 2ZW6A 4KOVA 2OH1A 3FYNA 3JUWA 1KUXA 1YREA 2P6GA 4CAVA 2KCWA 2JLMA 4KORA 2FS5A 1Y9KA 1FY7A 2ATRA 4JD6A 4OADA 3UY5A 1M4DA 2P6FA 1BOBA 1B6BA 4LUAA 1J4JA 2VBQA 2P0WA 3I9SA 5I0CA 1UFHA 1MK4A 4CAWA 1YLEA 4L8AA 3D3SA 2Q4VA 3FBUA 4CRYB 2OZHA 3D2MA 5EBVA 5H86A 4OLLA 4IUSA 4MJ8A 4U5YA 5KTDA 2I79A 2Q44A 2FIWA 2Q0YA 4B5PA 3EO4A 1MJAA 1R57A 4MY3A 3G8WA 2B4DA 2BUEA 3TO7A 3N7ZA 1YX0A 4HKFA 4LX9A 3QAHA 1PU9A 1S60A 4I49A 3G3SA 5CNPA 3R96A 5JQ4A 5ISVA 5J8FA 4KOYA 3TO9A 3BJ7A 2CNSA 4UWJA 2RC4A 4FD4A 2OB0A 4UWIA 3SHPA 1Q2YA 3D2PA 3VWEA 1KZFA 3R95A 3EFAA 2VQYA 1XMTA 4Y49B 3TCVA 3B8GA 1CM0A 2F5IA 2VZYA 1PUAA 1WWZA 5F49A 4BMHA 4KOXA 2P6EA 4NSQA 2D4OA 2VXKA 2PQ8A 3BJ8A 4IF5A 4EVYA 1M44A 3GY9A 2G0BA 4MBUA 2AE6A 4JLYA 1QSNA 5FVJA 1TIQA 5DWMA 3W6XA 3V8IA 4ORFA 3CXPA 4M85A 4HNWB 2ZXVA 4U9YA 4UBRA 2Z0ZA 2D4PA 3S6GA 3EC4A 4MY0A 1M4GA 2HQYA 4JJXA 2K5TA 3LD2A 4M3SA 2ZPAA 1M4IA 3PP9A 4QC6A 4XPDC 1YGHA 4UA3A 3JVNA 2Q4YA 3DDDA 3P2FA 3WR7A 2G3AA 4F6AA 2QIRA 3CXSA 1Z4EA 2Z11A 1S7KA 5E96A 4CS0B 3TOBA 4KOSA 1NMTA 4KOUA 4H6ZA 2FE7A 1VKCA 5C88A 2R7HA 3DNSA 2B5GA 4AB7A 1QSTA 1S7LA 1OZPA 2B4BA 2FIAA 2PR1A 2PSWA 1Y7RA 4HNXB 4FD6A 1Y9WA 2FL4A 1BO4A 3SXOA 3SXNA 4AG7A 1MJ9A 3ZZIA 1Z4RA 4J3GA 2DXQA 2WPXA 2O28A 5F46A 3S6FA 2J8RA 2FXFA 3NE7A 4X5KA 2PDOA 1V0CA 2ZW5A 2QECA 4PK2A 4K30A 2PC1A 4U9ZA 5GCNA 3TE4A 4ZBGA 1YR0A 4MI4A 3FB3A 1K4JA 1XEBA 4F0YA 4GS4A 3S6HA 4FD7A 2I00A 2C27A 2QMLA 4QB9A 4XNHC 5KTAA 1YK3A 1Z9UA 4PSXA 1L0CA 2Q04A 1S7NA 5HH1A 3FRMA 1I21A 3PZJA 4JXRA 3DR8A 2G3TA 4R3KA 3CXQA 5JPHA 4FD5A 1IB1E 2GANA 5H84A 4AVCA 4E0AA 2PRBA 1Q2DA 1RXTA 3MGDA 2PR8A 4HNYB 4H6UA 1P0HA 3GYAA 4AG9A 1XF8A 3QB8A 2B3UA 2H5MA 3C26A 1NSLA 2NMTA 1QSRA 5IX3A 4NCZA 2ZW4A 3H4QA 3EXNA 2CNTA 4YGOA 2R98A 4RI1A 2ARHA 4KLWA 2BEIA 3DR6A 3KKWA 3IGRA 4ONUA 2R1IA 4B5OA 3TT2A 4E2AA 3E0KA 2EUIA 1LRZA 2A4NA 1IYKA 2B58A 2FSRA 2Z10A 4XPDB 3P2HA 3RYOA 2ZW7A 3F0AA 3T9YA 3R9EA 3I3GA 5DWNA 4KVME 4AVAA 1B87A 1IICA 1ON0A 1RO5A 2B4DB 5IB0A 1P4NA 2GIVA 3T90A 2AJ6A 3TOAA 4R3LA 3GKRA 4CAXA 1M1DA 1I1DA 1U6MA 2BL1A 2CNMA 1NE9A 3FXTA 4MHDA 2J8NA 2OU2A 4R9MA 4II9A 3ZJ0A 4XPLA 4R87A 3VWDA 4AVBA 4E8OA 3FIXA 4KUBA 1S3ZA 3D8PA 5F47A 2OZUA 3IWGA 2VI7A 4NXYA 1VHSA 3TFYA 1KUVA 4KOTA 2X7BA 5C82A 3R9FA 2VEZA 3PGPA 3K9UA 3F8KA 2B3VA 4KOWA 4QUSA 4KVXA 2R8VA 2GE3A 2HV2A 5J8CA 3BLNA 3EY5A 2CY2A 4KVOE 2REFA 3R9GA 2Q7BA 4JWPA 4XNHB 3DSBA 1XIXA 1S7FA 2Y0MA 2JDCA 2HUZA 4PSWA 4PV6A 5F48A 4H89A 1Q2CA 3TTHA 5KTCA 1CJWA 2BSWA 3F5BA 3TO6A 4XPKA 1QSOA 4JXQA 4NEXA 4QVTA 4KLVA 4YFJA 1KUYA 1SQHA 1WK4A 5IV0A 5EC4A 2EVNA 2JEVA 4R57A 1IYLA 4YRHA 3S6KA 2JDDA 3R1KA 1YVKA 4NF1A 2WPWA 2VZZA 3OWCA 5HMNA 4KZTA 2FCKA 2REEA 1N71A 2FT0A 3W6SA 2B5GB 1GHEA 4Y49C 4RS2A 1YVOA 4PK3A 1S5KA 2OZGA 3W91A 1XE4A 1MJBA 4CRZB 4OAEA 4KUAA 2J8MA 4L89A 2IL4A 1QSMA 3FNCA 4QBJA 3LODA 4B5PB 1I12A
chains in the Genus database with same CATH superfamily
1AUGA 2IJZA 4DNCA 1IIDA 2ZW6A 4KOVA 5LYFA 2CTCA 2OH1A 2VL1A 3FYNA 2ANPA 3NFZA 3JUWA 3ISXA 3KI9A 4ONWA 1KUXA 1VHOA 1YREA 2P6GA 4ZY0A 3SJXA 4CAEA 1Z8TA 4CAVA 2V8VA 2KCWA 3H8EA 2JLMA 2YNEA 4A94A 4KORA 1TKFA 2FS5A 1CBXA 1FY7A 1TF8A 1Y9KA 2ATRA 2PJ1A 4JD6A 4C7IA 4OADA 2PIZA 2ZELA 4ZYQA 4CYQA 3UY5A 5CPAA 1XBUA 2ODFA 4OP4A 5HVFA 1ARLA 1F2PA 1Y0RA 3BI0A 1M4DA 2P6FA 1BOBA 5IB9A 2V8GA 1B6BA 4LUAA 1J4JA 4P6YA 2VBQA 4R8FA 2P0WA 3I9SA 5I0CA 1UFHA 1MK4A 4CAWA 1YLEA 1YQEA 4M6IA 1VGYA 5G20A 2IQ6A 3BXMA 2J9AA 4L8AA 3V38A 4FWUA 2O4HA 3IU1A 3D3SA 5K8MA 2Q4VA 2HC9A 1FNOA 3FBUA 4F9UA 4CRYB 3KQZA 2OZHA 3D2MA 3B3SA 5EBVA 5H86A 3I1UA 2ZOFA 4OLLA 3SJEA 2CXAA 4IUSA 3QAYA 5JM6A 4MJ8A 1TKJA 4U5YA 4A95A 2Q51A 3HLPA 2F8HA 2JBJA 4UCMA 5K8PA 2I79A 2Q44A 3WT4A 3NH4A 5KTDA 2FIWA 2Q0YA 3PFEA 4B5PA 5A27A 2O53A 5HXDA 3EO4A 4R6TA 4MHNA 1MJAA 1R57A 4UIAA 2G9DA 1CG2A 3FMCA 1RTQA 4MY3A 3G8WA 4CAFA 3N5FA 2B4DA 3GUXA 3D66A 2BUEA 2PJ3A 3N7ZA 1CPSA 3S9MA 3TO7A 1YX0A 4ZGYB 4HKFA 4LX9A 5AG5A 3QAHA 1QQ9A 1PU9A 1S60A 4I49A 3G3SA 5CNPA 3IFEA 2ZEOA 3DLJA 3R96A 3RAMA 3NE8A 5JQ4A 1KWMA 2EWBA 3SI0A 2YNDA 3KL9A 3B7IA 5ISVA 2YGWA 5J8FA 1GYTA 2WZNA 2Q7SA 4KOYA 3TO9A 3BJ7A 2ABZA 3B35A 2CNSA 1YLOA 4UWJA 3D7DA 2IMOA 5CBMA 2RC4A 4FD4A 3VARA 4NJQA 1LOKA 2OB0A 2AFOA 3FVLA 4UWIA 5LRGA 5G1ZA 4OMEA 1Q2YA 3D2PA 4OIDA 3SHPA 3VWEA 4FAIA 1KZFA 1NSAA 3R95A 4MFLA 3JTKA 2PJ8A 3EFAA 4NJRA 4GXHA 2VQYA 3FX6A 4Y49B 3TCVA 3B8GA 2DF5A 1CM0A 2F5IA 2VZYA 2ZEMA 1Q7LA 1Y0YA 1PUAA 1WWZA 5F49A 4BMHA 4KOXA 4P44A 2P6EA 4OC1A 3T8WA 1IY7A 4MCPA 4NSQA 2D4OA 2VXKA 3K9TA 2PQ8A 1AMPA 3BJ8A 4IF5A 4EVYA 1M44A 3GY9A 2G0BA 2GFQA 3LWUA 4MBUA 3H8GA 4R76A 1YMEA 3RNZA 2AE6A 2AFUA 4JLYA 1QSNA 5FVJA 1TIQA 5DWMA 3W6XA 3V8IA 1XFOA 4ORFA 3CT9A 1Z8WA 4TWEA 3CXPA 2EK9A 4M85A 4HNWB 2PJCA 2Z3NA 2ZXVA 5AG7A 4U9YA 2Q4ZA 4UBRA 2NSMA 3KZWA 4FUUA 2Z0ZA 1ELLP 2D4PA 3S6GA 8CPAA 4PXDA 2PJ2A 3EC4A 4Q36A 4MY0A 5HVHA 1M4GA 2HQYA 4MCQA 3V7ZA 4JJXA 2K5TA 4F8ZA 3LD2A 4M3SA 1LANA 2ZPAA 2PVWA 1M4IA 3KASA 3PP9A 4UF4A 5G22A 4QC6A 1ELMP 4OC4A 4XPDC 4F0XA 5I4MA 2PCUA 1YGHA 4B6ZA 4UA3A 3JVNA 4EMEA 2Q4YA 4P4IA 3DDDA 3P2FA 3WR7A 2G3AA 2XEFA 4F6AA 4RN7A 2QIRA 3IO1A 2OOTA 4P4DA 3CXSA 1Z4EA 2Z11A 1S7KA 5E96A 3RBUA 3TOBA 4CS0B 2PJ7A 4KOSA 1NMTA 1IOIA 2JEWA 3WC5A 4KOUA 4H6ZA 3TC8A 3D4UA 2FE7A 1EE3P 2JBKA 2ZEDA 1JQGA 1VKCA 5C88A 1FT7A 1XRYA 2R7HA 4IK2A 5LYIA 2PJ9A 4CYPA 4M6HA 3DNSA 2B5GA 4AB7A 1QSTA 2BO9A 1S7LA 3BI1A 2EK8A 4C2ZA 4UCNA 1OZPA 3B3WA 4KSAA 3KHXA 2B4BA 3GB0A 4A2ZA 2FIAA 4MMOA 2PR1A 2PSWA 1Y7RA 3NA6A 1M4LA 3MRUA 4FD6A 4HNXB 5JH9A 1Y9WA 2FL4A 4NGSA 4CGLA 4O23A 2Z3PA 3NH8A 1IU8A 1BO4A 4AG9A 1LAPA 3IIBA 3SXOA 3SXNA 1LCPA 4AG7A 1MJ9A 3ZZIA 2C6CA 1Z4RA 4J3GA 2F7VA 2DXQA 2WPXA 1TKHA 2O28A 5F46A 3S6FA 2J8RA 2FXFA 3FEDA 3NE7A 4X5KA 4BBHA 2PDOA 5BWAB 1I12A 1V0CA 2ZW5A 2FVGA 4NGPA 1ZG9A 2QECA 4PK2A 4K30A 3CPAA 2PC1A 4U9ZA 1CP6A 3PB9X 4K3NA 2XEGA 4B14A 5GCNA 3FECA 3TE4A 1BPNA 4ZBGA 1YR0A 4MI4A 3D7HA 3FB3A 2GREA 3PB6X 4A32A 1UWYA 2YNCA 1K4JA 4DJLA 1XEBA 4X2TA 4UFXA 4F0YA 1VHEA 4GS4A 3S6HA 4FD7A 1A2ZA 4C7HA 5A28A 1LAMA 2XEIA 3RO0A 2I00A 4B13A 5F09A 2C27A 2QMLA 4DYOA 2AFMA 3CZXA 4PXBA 4IAVA 3B3CA 3PB8X 4RUHA 4P4FA 4QB9A 4XNHC 3CPXA 3SJFA 2PVVA 5KTAA 1ZLHA 1PCAA 1YK3A 3PBEA 1Z9UA 4LQ6A 3WABA 1CX8A 3PFOA 4MCRA 4MFQA 4PSXA 3D7GA 3K2KA 4CGMA 1L0CA 1R43A 2Q04A 3ISZA 4KS9A 1S7NA 4NGQA 5AGEA 5HH1A 3FRMA 3IC1A 3NH5A 1I21A 4MXUA 2DPTA 4DUKA 3PZJA 2Q43A 2ZEFA 3D68A 2WYRA 2PIYA 2WSAA 5AG6A 1HDQA 1IOFA 5K8OA 4R7MA 2C1CA 3KGQA 4JXRA 4UIBA 4G1PA 3DR8A 1ZO0A 2G3TA 2GLFA 4R3KA 3FF3A 3CXQA 3QNVA 5JPHA 6CPAA 4PPZA 4FD5A 1ZG7A 1IB1E 2GANA 2NYQA 3LMSA 3HUVA 5H84A 4AVCA 4B11A 2CF4A 4B12A 4E0AA 2CTBA 3BHXA 2PRBA 1Q2DA 1X12A 1RXTA 3MGDA 1Z8LA 2PR8A 4HNYB 4X8IA 1BLLE 2PJ4A 1P0HA 3GYAA 4H6UA 4MHYA 1XF8A 1H8LA 3QB8A 2B3UA 2H5MA 1X10A 2GU2A 3C26A 3SI1A 1NSLA 2NMTA 2V8HA 1HDUA 2Z3MA 1QSRA 3CDXA 4P4BA 1OBRA 4UEFA 5EMIA 5IX3A 4NCZA 2ZW4A 1ZG8A 4OC3A 3B3TA 2ZOGA 1DTDA 3H4QA 3EXNA 2CNTA 4YGOA 2R98A 4CYOA 4RI1A 2QYVA 2ARHA 2BCOA 4KLWA 3PBBA 2BEIA 2PJ5A 4YWYA 3DR6A 3KKWA 3IGRA 1ZLIA 4ONUA 3JRUA 2R1IA 4B5OA 3TT2A 3D7FA 4E2AA 3E0KA 2EUIA 1LRZA 2A4NA 4WJBA 1IYKA 4P10A 2B58A 2FSRA 2Z10A 4ZY2A 3H8FA 4HPSA 4KSFA 4XPDB 3TX8A 4JZ0A 2V8DA 2WUUA 3P2HA 2ZW7A 3IU2A 2ZENA 3F0AA 5LRJA 3RYOA 3T9YA 3R9EA 4X3RA 4MHPA 3I3GA 4P4EA 5DWNA 5THWA 2QJ8A 3IJ3A 3WC6A 3KR4A 2ZEGA 4KVME 4AVAA 1B87A 1IICA 1ON0A 1RO5A 3WC7A 4OKOA 3FH4A 2B4DB 3B2YA 2Z3KA 5HVGA 5IB0A 1P4NA 1R3NA 1XJOA 2GIVA 3T90A 3S9NA 2EBJA 2AJ6A 4A33A 5D8NA 1CP7A 2PJAA 2PJBA 4UEZA 3TOAA 4R3LA 4KSIA 4CPAA 3GKRA 4CAXA 1XOVA 2DPSA 2HB6A 3SI2A 3A9LA 1M1DA 2YNCC 4PXEA 1I1DA 4UCPA 3H5ZA 2AFSA 1U6MA 2BL1A 2CNMA 4ZX9A 1NE9A 1F57A 3DGVA 1TF9A 3FXTA 4JYWA 5AG4A 4MHDA 2C6PA 5DS0A 4GM5A 2J8NA 4A37A 2EO8A 2AFXA 2OU2A 3GLJA 4R9MA 4UEEA 5ELYA 4II9A 4MHZA 3ZJ0A 4Z65A 4XPLA 5G21A 4R87A 3VWDA 4AVBA 4E8OA 2OR4A 3FIXA 3SJGA 4KUBA 1S3ZA 3D8PA 1PYTB 3IEHA 2AFZA 4Q7AA 5F47A 2OZUA 4FBEA 3IWGA 2VI7A 3KR5A 1VHSA 3IWWA 4NXYA 2RB7A 4AXVA 1Z2LA 1KUVA 3TFYA 1YSJA 4IHMA 4ZX8A 4A39A 4KOTA 5LRKA 2X7BA 2PJ0A 3VH9A 4BINA 5C82A 2Z3OA 3R9FA 2VEZA 3PGPA 3K9UA 3F8KA 2B3VA 4NFRA 4KOWA 4QUSA 2DEAA 4KVXA 4TNUA 5J1QA 4OC2A 4W9YA 3S9LA 4CYNA 2R8VA 2GE3A 2HV2A 2Z3LA 5J8CA 4PXCA 3PRTA 3BLNA 4H2KA 2QVPA 4ZI6A 3EY5A 1CPXA 2ZEPA 2CY2A 4KVOE 4A30A 2REFA 4LQGA 2Q7BA 3R9GA 4JWPA 4BD9A 4PQAA 4EFDA 3GIUA 3MN8A 4XNHB 2C6GA 3DSBA 1XIXA 1S7FA 1DE4C 1XMBA 2Y0MA 4NGTA 2JDCA 2HUZA 3L2NA 4NGMA 2PRQA 4Q38A 3FJUA 4MFZA 4PSWA 2ZEEA 4CGNA 4F9VA 4PV6A 4A31A 2RFHA 4MFPA 4P45A 5F48A 4H89A 1Q2CA 4UFVA 3TTHA 4CGPA 5KTCA 4C2YA 3LACA 3IWEA 1CJWA 5LYLA 2BSWA 1BAVA 3F5BA 3VATA 3TO6A 4OC5A 4OC0A 4CGOA 4MFKA 4XPKA 1QSOA 1Z8XA 4JXQA 3D67A 4NEXA 4KLVA 4QVTA 4YFJA 1KUYA 1SQHA 1ARMA 1WK4A 5IV0A 4WWVA 5EC4A 2EVNA 2JEVA 2XEJA 4R57A 3KHZA 1IYLA 4YRHA 3S6KA 4C2XA 3FEEA 2I3CA 2JDDA 3R1KA 1YVKA 4NF1A 4MFJA 2WPWA 4NGRA 2VZZA 4UFWA 4YU9A 4C68A 3OWCA 5HMNA 4KZTA 2FCKA 3PEIA 1HEEA 2REEA 4A38A 1AYEA 1N71A 2CIJA 2ZEHA 4MCSA 4MRIA 4P4JA 2FT0A 1IGBA 2BOAA 5D29A 2B5GB 3W6SA 1GHEA 4Y49C 4RS2A 1YVOA 3PB7X 4NGNA 4PK3A 1S5KA 2OZGA 3W91A 2POKA 1YW4A 1XE4A 1YW6A 5LYDA 2PE3A 1MJBA 1Z5RA 4CRZB 4EWTA 3KQXA 2AFWA 2GLJA 7CPAA 3B3VA 4OIWA 4ZY1A 4OAEA 3PB4X 2V77A 4KUAA 2J8MA 4M6GA 4L89A 1Y7EA 1QMUA 2IL4A 1TXRA 1F2OA 1JWQA 1QSMA 3FNCA 4QBJA 1BPMA 3LODA 1LFWA 4B5PB 3RZAA 2PJ6A 5JGFA 4B10A 1VIXA 1XMTA 5K8NA
chains in the Genus database with same CATH topology
4DNCA 1IIDA 2ZW6A 4KOVA 2OH1A 3FYNA 3JUWA 1KUXA 1YREA 2P6GA 4CAEA 4CAVA 2KCWA 2JLMA 2YNEA 4KORA 2FS5A 1Y9KA 1FY7A 2ATRA 4JD6A 4C7IA 4OADA 4CYQA 3UY5A 1M4DA 2P6FA 1BOBA 1B6BA 4LUAA 1J4JA 2VBQA 2P0WA 3I9SA 5I0CA 1UFHA 1MK4A 4CAWA 1YLEA 5G20A 4L8AA 3IU1A 3D3SA 2Q4VA 3FBUA 4CRYB 2OZHA 3D2MA 5EBVA 5H86A 4OLLA 2CXAA 4IUSA 4MJ8A 4U5YA 4A95A 4UCMA 5KTDA 2I79A 2Q44A 2FIWA 2Q0YA 4B5PA 5A27A 3EO4A 1MJAA 1R57A 4MY3A 3G8WA 4CAFA 2B4DA 2BUEA 3TO7A 3N7ZA 4ZGYB 1YX0A 4HKFA 4LX9A 5AG5A 3QAHA 1PU9A 1S60A 4I49A 3G3SA 5CNPA 3R96A 5JQ4A 2YNDA 5ISVA 2YGWA 5J8FA 4KOYA 3TO9A 3BJ7A 2CNSA 4UWJA 2RC4A 4FD4A 2OB0A 4UWIA 5G1ZA 3SHPA 1Q2YA 3D2PA 3VWEA 1KZFA 3R95A 4MFLA 3JTKA 3EFAA 2VQYA 1XMTA 4Y49B 3TCVA 3B8GA 1CM0A 2F5IA 2VZYA 1PUAA 1WWZA 5F49A 4BMHA 4KOXA 2P6EA 4NSQA 2D4OA 2VXKA 2PQ8A 3BJ8A 4IF5A 4EVYA 1M44A 3GY9A 2G0BA 4MBUA 2AE6A 4JLYA 1QSNA 5FVJA 1TIQA 5DWMA 3W6XA 3V8IA 4ORFA 3CXPA 4M85A 4HNWB 2ZXVA 2Z3NA 5AG7A 4U9YA 4UBRA 2Z0ZA 2D4PA 3S6GA 3EC4A 4Q36A 4MY0A 1M4GA 2HQYA 4JJXA 2K5TA 3LD2A 4M3SA 2ZPAA 1M4IA 3PP9A 5G22A 4QC6A 4XPDC 4F0XA 1YGHA 4UA3A 3JVNA 2Q4YA 3DDDA 3P2FA 3WR7A 2G3AA 4F6AA 2QIRA 3CXSA 1Z4EA 2Z11A 1S7KA 5E96A 4CS0B 3TOBA 4KOSA 1NMTA 4KOUA 4H6ZA 2FE7A 1VKCA 5C88A 2R7HA 4CYPA 3DNSA 2B5GA 4AB7A 1QSTA 1S7LA 4C2ZA 4UCNA 1OZPA 4KSAA 4A2ZA 2B4BA 2FIAA 2PR1A 2PSWA 1Y7RA 4HNXB 4FD6A 1Y9WA 2FL4A 4CGLA 2Z3PA 1BO4A 3SXOA 3SXNA 4AG7A 1MJ9A 3ZZIA 1Z4RA 4J3GA 2DXQA 2WPXA 2O28A 5F46A 3S6FA 2J8RA 2FXFA 3NE7A 4X5KA 4BBHA 2PDOA 5BWAB 1V0CA 2ZW5A 2QECA 4PK2A 4K30A 2PC1A 4U9ZA 4B14A 5GCNA 3TE4A 4ZBGA 1YR0A 4MI4A 3FB3A 4A32A 2YNCA 1K4JA 1XEBA 4UFXA 4F0YA 4GS4A 3S6HA 5A28A 4FD7A 4C7HA 4B13A 2I00A 2C27A 2QMLA 4QB9A 4XNHC 5KTAA 1YK3A 1Z9UA 4MFQA 4PSXA 4CGMA 1L0CA 2Q04A 4KS9A 1S7NA 5HH1A 5AGEA 3FRMA 1I21A 2DPTA 3PZJA 2WSAA 5AG6A 4JXRA 3DR8A 1ZO0A 2G3TA 4R3KA 3CXQA 5JPHA 4FD5A 1IB1E 2GANA 5H84A 4AVCA 4B11A 4B12A 4E0AA 2PRBA 1Q2DA 1RXTA 3MGDA 2PR8A 4HNYB 4H6UA 1P0HA 3GYAA 4AG9A 1XF8A 3QB8A 2B3UA 2H5MA 3C26A 1NSLA 2NMTA 2Z3MA 1QSRA 5IX3A 4NCZA 2ZW4A 3H4QA 3EXNA 2CNTA 4YGOA 2R98A 4CYOA 4RI1A 2ARHA 4KLWA 2BEIA 3DR6A 3KKWA 3IGRA 4ONUA 2R1IA 4B5OA 3TT2A 4E2AA 3E0KA 2EUIA 1LRZA 2A4NA 1IYKA 2B58A 2FSRA 2Z10A 4KSFA 4XPDB 2WUUA 3P2HA 2ZW7A 3IU2A 3F0AA 3RYOA 3T9YA 3R9EA 3I3GA 5DWNA 4KVME 4AVAA 1B87A 1IICA 1ON0A 1RO5A 2B4DB 2Z3KA 5IB0A 1P4NA 2GIVA 3T90A 2AJ6A 4A33A 3TOAA 4R3LA 3GKRA 4CAXA 2DPSA 3A9LA 1M1DA 2YNCC 1I1DA 4UCPA 3H5ZA 1U6MA 2BL1A 2CNMA 1NE9A 3FXTA 5AG4A 4MHDA 2J8NA 2OU2A 4R9MA 4II9A 3ZJ0A 4XPLA 5G21A 4R87A 3VWDA 4AVBA 4E8OA 3FIXA 4KUBA 1S3ZA 3D8PA 5F47A 2OZUA 3IWGA 2VI7A 4NXYA 1VHSA 3TFYA 1KUVA 4KOTA 2X7BA 5C82A 2Z3OA 3R9FA 2VEZA 3PGPA 3K9UA 3F8KA 2B3VA 4KOWA 4QUSA 4KVXA 4CYNA 2R8VA 2GE3A 2HV2A 2Z3LA 5J8CA 3BLNA 3EY5A 2CY2A 4KVOE 4A30A 2REFA 3R9GA 2Q7BA 4JWPA 4XNHB 3DSBA 1XIXA 1S7FA 2Y0MA 2JDCA 2HUZA 4Q38A 4MFZA 4PSWA 4CGNA 4PV6A 4A31A 5F48A 4MFPA 4H89A 1Q2CA 4UFVA 3TTHA 4CGPA 5KTCA 4C2YA 3IWEA 1CJWA 2BSWA 3F5BA 3TO6A 4CGOA 4MFKA 4XPKA 1QSOA 4JXQA 4NEXA 4QVTA 4KLVA 4YFJA 1KUYA 1SQHA 1WK4A 5IV0A 5EC4A 2EVNA 2JEVA 4R57A 1IYLA 4YRHA 3S6KA 4C2XA 2JDDA 3R1KA 1YVKA 4NF1A 4MFJA 2WPWA 2VZZA 4UFWA 4C68A 3OWCA 5HMNA 4KZTA 2FCKA 2REEA 1N71A 2FT0A 3W6SA 2B5GB 1GHEA 4Y49C 4RS2A 1YVOA 4PK3A 1S5KA 2OZGA 3W91A 1XE4A 1MJBA 4CRZB 4OAEA 4KUAA 2J8MA 4L89A 2IL4A 1QSMA 3FNCA 4QBJA 3LODA 4B5PB 4B10A 1I12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNC A;  1IID A;  2ZW6 A;  4KOV A;  2OH1 A;  3FYN A;  3JUW A;  1KUX A;  1YRE A;  2P6G A;  4CAV A;  2KCW A;  2JLM A;  4KOR A;  2FS5 A;  1Y9K A;  1FY7 A;  2ATR A;  4JD6 A;  4OAD A;  3UY5 A;  1M4D A;  2P6F A;  1BOB A;  1B6B A;  4LUA A;  1J4J A;  2VBQ A;  2P0W A;  3I9S A;  5I0C A;  1UFH A;  1MK4 A;  4CAW A;  1YLE A;  4L8A A;  3D3S A;  2Q4V A;  3FBU A;  4CRY B;  2OZH A;  3D2M A;  5EBV A;  5H86 A;  4OLL A;  4IUS A;  4MJ8 A;  4U5Y A;  5KTD A;  2I79 A;  2Q44 A;  2FIW A;  2Q0Y A;  4B5P A;  3EO4 A;  1MJA A;  1R57 A;  4MY3 A;  3G8W A;  2B4D A;  2BUE A;  3TO7 A;  3N7Z A;  1YX0 A;  4HKF A;  4LX9 A;  3QAH A;  1PU9 A;  1S60 A;  4I49 A;  3G3S A;  5CNP A;  3R96 A;  5JQ4 A;  5ISV A;  5J8F A;  4KOY A;  3TO9 A;  3BJ7 A;  2CNS A;  4UWJ A;  2RC4 A;  4FD4 A;  2OB0 A;  4UWI A;  3SHP A;  1Q2Y A;  3D2P A;  3VWE A;  1KZF A;  3R95 A;  3EFA A;  2VQY A;  1XMT A;  4Y49 B;  3TCV A;  3B8G A;  1CM0 A;  2F5I A;  2VZY A;  1PUA A;  1WWZ A;  5F49 A;  4BMH A;  4KOX A;  2P6E A;  4NSQ A;  2D4O A;  2VXK A;  2PQ8 A;  3BJ8 A;  4IF5 A;  4EVY A;  1M44 A;  3GY9 A;  2G0B A;  4MBU A;  2AE6 A;  4JLY A;  1QSN A;  5FVJ A;  1TIQ A;  5DWM A;  3W6X A;  3V8I A;  4ORF A;  3CXP A;  4M85 A;  4HNW B;  2ZXV A;  4U9Y A;  4UBR A;  2Z0Z A;  2D4P A;  3S6G A;  3EC4 A;  4MY0 A;  1M4G A;  2HQY A;  4JJX A;  2K5T A;  3LD2 A;  4M3S A;  2ZPA A;  1M4I A;  3PP9 A;  4QC6 A;  4XPD C;  1YGH A;  4UA3 A;  3JVN A;  2Q4Y A;  3DDD A;  3P2F A;  3WR7 A;  2G3A A;  4F6A A;  2QIR A;  3CXS A;  1Z4E A;  2Z11 A;  1S7K A;  5E96 A;  4CS0 B;  3TOB A;  4KOS A;  1NMT A;  4KOU A;  4H6Z A;  2FE7 A;  1VKC A;  5C88 A;  2R7H A;  3DNS A;  2B5G A;  4AB7 A;  1QST A;  1S7L A;  1OZP A;  2B4B A;  2FIA A;  2PR1 A;  2PSW A;  1Y7R A;  4HNX B;  4FD6 A;  1Y9W A;  2FL4 A;  1BO4 A;  3SXO A;  3SXN A;  4AG7 A;  1MJ9 A;  3ZZI A;  1Z4R A;  4J3G A;  2DXQ A;  2WPX A;  2O28 A;  5F46 A;  3S6F A;  2J8R A;  2FXF A;  3NE7 A;  4X5K A;  2PDO A;  1V0C A;  2ZW5 A;  2QEC A;  4PK2 A;  4K30 A;  2PC1 A;  4U9Z A;  5GCN A;  3TE4 A;  4ZBG A;  1YR0 A;  4MI4 A;  3FB3 A;  1K4J A;  1XEB A;  4F0Y A;  4GS4 A;  3S6H A;  4FD7 A;  2I00 A;  2C27 A;  2QML A;  4QB9 A;  4XNH C;  5KTA A;  1YK3 A;  1Z9U A;  4PSX A;  1L0C A;  2Q04 A;  1S7N A;  5HH1 A;  3FRM A;  1I21 A;  3PZJ A;  4JXR A;  3DR8 A;  2G3T A;  4R3K A;  3CXQ A;  5JPH A;  4FD5 A;  1IB1 E;  2GAN A;  5H84 A;  4AVC A;  4E0A A;  2PRB A;  1Q2D A;  1RXT A;  3MGD A;  2PR8 A;  4HNY B;  4H6U A;  1P0H A;  3GYA A;  4AG9 A;  1XF8 A;  3QB8 A;  2B3U A;  2H5M A;  3C26 A;  1NSL A;  2NMT A;  1QSR A;  5IX3 A;  4NCZ A;  2ZW4 A;  3H4Q A;  3EXN A;  2CNT A;  4YGO A;  2R98 A;  4RI1 A;  2ARH A;  4KLW A;  2BEI A;  3DR6 A;  3KKW A;  3IGR A;  4ONU A;  2R1I A;  4B5O A;  3TT2 A;  4E2A A;  3E0K A;  2EUI A;  1LRZ A;  2A4N A;  1IYK A;  2B58 A;  2FSR A;  2Z10 A;  4XPD B;  3P2H A;  3RYO A;  2ZW7 A;  3F0A A;  3T9Y A;  3R9E A;  3I3G A;  5DWN A;  4KVM E;  4AVA A;  1B87 A;  1IIC A;  1ON0 A;  1RO5 A;  2B4D B;  5IB0 A;  1P4N A;  2GIV A;  3T90 A;  2AJ6 A;  3TOA A;  4R3L A;  3GKR A;  4CAX A;  1M1D A;  1I1D A;  1U6M A;  2BL1 A;  2CNM A;  1NE9 A;  3FXT A;  4MHD A;  2J8N A;  2OU2 A;  4R9M A;  4II9 A;  3ZJ0 A;  4XPL A;  4R87 A;  3VWD A;  4AVB A;  4E8O A;  3FIX A;  4KUB A;  1S3Z A;  3D8P A;  5F47 A;  2OZU A;  3IWG A;  2VI7 A;  4NXY A;  1VHS A;  3TFY A;  1KUV A;  4KOT A;  2X7B A;  5C82 A;  3R9F A;  2VEZ A;  3PGP A;  3K9U A;  3F8K A;  2B3V A;  4KOW A;  4QUS A;  4KVX A;  2R8V A;  2GE3 A;  2HV2 A;  5J8C A;  3BLN A;  3EY5 A;  2CY2 A;  4KVO E;  2REF A;  3R9G A;  2Q7B A;  4JWP A;  4XNH B;  3DSB A;  1XIX A;  1S7F A;  2Y0M A;  2JDC A;  2HUZ A;  4PSW A;  4PV6 A;  5F48 A;  4H89 A;  1Q2C A;  3TTH A;  5KTC A;  1CJW A;  2BSW A;  3F5B A;  3TO6 A;  4XPK A;  1QSO A;  4JXQ A;  4NEX A;  4QVT A;  4KLV A;  4YFJ A;  1KUY A;  1SQH A;  1WK4 A;  5IV0 A;  5EC4 A;  2EVN A;  2JEV A;  4R57 A;  1IYL A;  4YRH A;  3S6K A;  2JDD A;  3R1K A;  1YVK A;  4NF1 A;  2WPW A;  2VZZ A;  3OWC A;  5HMN A;  4KZT A;  2FCK A;  2REE A;  1N71 A;  2FT0 A;  3W6S A;  2B5G B;  1GHE A;  4Y49 C;  4RS2 A;  1YVO A;  4PK3 A;  1S5K A;  2OZG A;  3W91 A;  1XE4 A;  1MJB A;  4CRZ B;  4OAE A;  4KUA A;  2J8M A;  4L89 A;  2IL4 A;  1QSM A;  3FNC A;  4QBJ A;  3LOD A;  4B5P B;  1I12 A; 
#chains in the Genus database with same CATH topology
 1AUG A;  2IJZ A;  4DNC A;  1IID A;  2ZW6 A;  4KOV A;  5LYF A;  2CTC A;  2OH1 A;  2VL1 A;  3FYN A;  2ANP A;  3NFZ A;  3JUW A;  3ISX A;  3KI9 A;  4ONW A;  1KUX A;  1VHO A;  1YRE A;  2P6G A;  4ZY0 A;  3SJX A;  4CAE A;  1Z8T A;  4CAV A;  2V8V A;  2KCW A;  3H8E A;  2JLM A;  2YNE A;  4A94 A;  4KOR A;  1TKF A;  2FS5 A;  1CBX A;  1FY7 A;  1TF8 A;  1Y9K A;  2ATR A;  2PJ1 A;  4JD6 A;  4C7I A;  4OAD A;  2PIZ A;  2ZEL A;  4ZYQ A;  4CYQ A;  3UY5 A;  5CPA A;  1XBU A;  2ODF A;  4OP4 A;  5HVF A;  1ARL A;  1F2P A;  1Y0R A;  3BI0 A;  1M4D A;  2P6F A;  1BOB A;  5IB9 A;  2V8G A;  1B6B A;  4LUA A;  1J4J A;  4P6Y A;  2VBQ A;  4R8F A;  2P0W A;  3I9S A;  5I0C A;  1UFH A;  1MK4 A;  4CAW A;  1YLE A;  1YQE A;  4M6I A;  1VGY A;  5G20 A;  2IQ6 A;  3BXM A;  2J9A A;  4L8A A;  3V38 A;  4FWU A;  2O4H A;  3IU1 A;  3D3S A;  5K8M A;  2Q4V A;  2HC9 A;  1FNO A;  3FBU A;  4F9U A;  4CRY B;  3KQZ A;  2OZH A;  3D2M A;  3B3S A;  5EBV A;  5H86 A;  3I1U A;  2ZOF A;  4OLL A;  3SJE A;  2CXA A;  4IUS A;  3QAY A;  5JM6 A;  4MJ8 A;  1TKJ A;  4U5Y A;  4A95 A;  2Q51 A;  3HLP A;  2F8H A;  2JBJ A;  4UCM A;  5K8P A;  2I79 A;  2Q44 A;  3WT4 A;  3NH4 A;  5KTD A;  2FIW A;  2Q0Y A;  3PFE A;  4B5P A;  5A27 A;  2O53 A;  5HXD A;  3EO4 A;  4R6T A;  4MHN A;  1MJA A;  1R57 A;  4UIA A;  2G9D A;  1CG2 A;  3FMC A;  1RTQ A;  4MY3 A;  3G8W A;  4CAF A;  3N5F A;  2B4D A;  3GUX A;  3D66 A;  2BUE A;  2PJ3 A;  3N7Z A;  1CPS A;  3S9M A;  3TO7 A;  1YX0 A;  4ZGY B;  4HKF A;  4LX9 A;  5AG5 A;  3QAH A;  1QQ9 A;  1PU9 A;  1S60 A;  4I49 A;  3G3S A;  5CNP A;  3IFE A;  2ZEO A;  3DLJ A;  3R96 A;  3RAM A;  3NE8 A;  5JQ4 A;  1KWM A;  2EWB A;  3SI0 A;  2YND A;  3KL9 A;  3B7I A;  5ISV A;  2YGW A;  5J8F A;  1GYT A;  2WZN A;  2Q7S A;  4KOY A;  3TO9 A;  3BJ7 A;  2ABZ A;  3B35 A;  2CNS A;  1YLO A;  4UWJ A;  3D7D A;  2IMO A;  5CBM A;  2RC4 A;  4FD4 A;  3VAR A;  4NJQ A;  1LOK A;  2OB0 A;  2AFO A;  3FVL A;  4UWI A;  5LRG A;  5G1Z A;  4OME A;  1Q2Y A;  3D2P A;  4OID A;  3SHP A;  3VWE A;  4FAI A;  1KZF A;  1NSA A;  3R95 A;  4MFL A;  3JTK A;  2PJ8 A;  3EFA A;  4NJR A;  4GXH A;  2VQY A;  3FX6 A;  4Y49 B;  3TCV A;  3B8G A;  2DF5 A;  1CM0 A;  2F5I A;  2VZY A;  2ZEM A;  1Q7L A;  1Y0Y A;  1PUA A;  1WWZ A;  5F49 A;  4BMH A;  4KOX A;  4P44 A;  2P6E A;  4OC1 A;  3T8W A;  1IY7 A;  4MCP A;  4NSQ A;  2D4O A;  2VXK A;  3K9T A;  2PQ8 A;  1AMP A;  3BJ8 A;  4IF5 A;  4EVY A;  1M44 A;  3GY9 A;  2G0B A;  2GFQ A;  3LWU A;  4MBU A;  3H8G A;  4R76 A;  1YME A;  3RNZ A;  2AE6 A;  2AFU A;  4JLY A;  1QSN A;  5FVJ A;  1TIQ A;  5DWM A;  3W6X A;  3V8I A;  1XFO A;  4ORF A;  3CT9 A;  1Z8W A;  4TWE A;  3CXP A;  2EK9 A;  4M85 A;  4HNW B;  2PJC A;  2Z3N A;  2ZXV A;  5AG7 A;  4U9Y A;  2Q4Z A;  4UBR A;  2NSM A;  3KZW A;  4FUU A;  2Z0Z A;  1ELL P;  2D4P A;  3S6G A;  8CPA A;  4PXD A;  2PJ2 A;  3EC4 A;  4Q36 A;  4MY0 A;  5HVH A;  1M4G A;  2HQY A;  4MCQ A;  3V7Z A;  4JJX A;  2K5T A;  4F8Z A;  3LD2 A;  4M3S A;  1LAN A;  2ZPA A;  2PVW A;  1M4I A;  3KAS A;  3PP9 A;  4UF4 A;  5G22 A;  4QC6 A;  1ELM P;  4OC4 A;  4XPD C;  4F0X A;  5I4M A;  2PCU A;  1YGH A;  4B6Z A;  4UA3 A;  3JVN A;  4EME A;  2Q4Y A;  4P4I A;  3DDD A;  3P2F A;  3WR7 A;  2G3A A;  2XEF A;  4F6A A;  4RN7 A;  2QIR A;  3IO1 A;  2OOT A;  4P4D A;  3CXS A;  1Z4E A;  2Z11 A;  1S7K A;  5E96 A;  3RBU A;  3TOB A;  4CS0 B;  2PJ7 A;  4KOS A;  1NMT A;  1IOI A;  2JEW A;  3WC5 A;  4KOU A;  4H6Z A;  3TC8 A;  3D4U A;  2FE7 A;  1EE3 P;  2JBK A;  2ZED A;  1JQG A;  1VKC A;  5C88 A;  1FT7 A;  1XRY A;  2R7H A;  4IK2 A;  5LYI A;  2PJ9 A;  4CYP A;  4M6H A;  3DNS A;  2B5G A;  4AB7 A;  1QST A;  2BO9 A;  1S7L A;  3BI1 A;  2EK8 A;  4C2Z A;  4UCN A;  1OZP A;  3B3W A;  4KSA A;  3KHX A;  2B4B A;  3GB0 A;  4A2Z A;  2FIA A;  4MMO A;  2PR1 A;  2PSW A;  1Y7R A;  3NA6 A;  1M4L A;  3MRU A;  4FD6 A;  4HNX B;  5JH9 A;  1Y9W A;  2FL4 A;  4NGS A;  4CGL A;  4O23 A;  2Z3P A;  3NH8 A;  1IU8 A;  1BO4 A;  4AG9 A;  1LAP A;  3IIB A;  3SXO A;  3SXN A;  1LCP A;  4AG7 A;  1MJ9 A;  3ZZI A;  2C6C A;  1Z4R A;  4J3G A;  2F7V A;  2DXQ A;  2WPX A;  1TKH A;  2O28 A;  5F46 A;  3S6F A;  2J8R A;  2FXF A;  3FED A;  3NE7 A;  4X5K A;  4BBH A;  2PDO A;  5BWA B;  1I12 A;  1V0C A;  2ZW5 A;  2FVG A;  4NGP A;  1ZG9 A;  2QEC A;  4PK2 A;  4K30 A;  3CPA A;  2PC1 A;  4U9Z A;  1CP6 A;  3PB9 X;  4K3N A;  2XEG A;  4B14 A;  5GCN A;  3FEC A;  3TE4 A;  1BPN A;  4ZBG A;  1YR0 A;  4MI4 A;  3D7H A;  3FB3 A;  2GRE A;  3PB6 X;  4A32 A;  1UWY A;  2YNC A;  1K4J A;  4DJL A;  1XEB A;  4X2T A;  4UFX A;  4F0Y A;  1VHE A;  4GS4 A;  3S6H A;  4FD7 A;  1A2Z A;  4C7H A;  5A28 A;  1LAM A;  2XEI A;  3RO0 A;  2I00 A;  4B13 A;  5F09 A;  2C27 A;  2QML A;  4DYO A;  2AFM A;  3CZX A;  4PXB A;  4IAV A;  3B3C A;  3PB8 X;  4RUH A;  4P4F A;  4QB9 A;  4XNH C;  3CPX A;  3SJF A;  2PVV A;  5KTA A;  1ZLH A;  1PCA A;  1YK3 A;  3PBE A;  1Z9U A;  4LQ6 A;  3WAB A;  1CX8 A;  3PFO A;  4MCR A;  4MFQ A;  4PSX A;  3D7G A;  3K2K A;  4CGM A;  1L0C A;  1R43 A;  2Q04 A;  3ISZ A;  4KS9 A;  1S7N A;  4NGQ A;  5AGE A;  5HH1 A;  3FRM A;  3IC1 A;  3NH5 A;  1I21 A;  4MXU A;  2DPT A;  4DUK A;  3PZJ A;  2Q43 A;  2ZEF A;  3D68 A;  2WYR A;  2PIY A;  2WSA A;  5AG6 A;  1HDQ A;  1IOF A;  5K8O A;  4R7M A;  2C1C A;  3KGQ A;  4JXR A;  4UIB A;  4G1P A;  3DR8 A;  1ZO0 A;  2G3T A;  2GLF A;  4R3K A;  3FF3 A;  3CXQ A;  3QNV A;  5JPH A;  6CPA A;  4PPZ A;  4FD5 A;  1ZG7 A;  1IB1 E;  2GAN A;  2NYQ A;  3LMS A;  3HUV A;  5H84 A;  4AVC A;  4B11 A;  2CF4 A;  4B12 A;  4E0A A;  2CTB A;  3BHX A;  2PRB A;  1Q2D A;  1X12 A;  1RXT A;  3MGD A;  1Z8L A;  2PR8 A;  4HNY B;  4X8I A;  1BLL E;  2PJ4 A;  1P0H A;  3GYA A;  4H6U A;  4MHY A;  1XF8 A;  1H8L A;  3QB8 A;  2B3U A;  2H5M A;  1X10 A;  2GU2 A;  3C26 A;  3SI1 A;  1NSL A;  2NMT A;  2V8H A;  1HDU A;  2Z3M A;  1QSR A;  3CDX A;  4P4B A;  1OBR A;  4UEF A;  5EMI A;  5IX3 A;  4NCZ A;  2ZW4 A;  1ZG8 A;  4OC3 A;  3B3T A;  2ZOG A;  1DTD A;  3H4Q A;  3EXN A;  2CNT A;  4YGO A;  2R98 A;  4CYO A;  4RI1 A;  2QYV A;  2ARH A;  2BCO A;  4KLW A;  3PBB A;  2BEI A;  2PJ5 A;  4YWY A;  3DR6 A;  3KKW A;  3IGR A;  1ZLI A;  4ONU A;  3JRU A;  2R1I A;  4B5O A;  3TT2 A;  3D7F A;  4E2A A;  3E0K A;  2EUI A;  1LRZ A;  2A4N A;  4WJB A;  1IYK A;  4P10 A;  2B58 A;  2FSR A;  2Z10 A;  4ZY2 A;  3H8F A;  4HPS A;  4KSF A;  4XPD B;  3TX8 A;  4JZ0 A;  2V8D A;  2WUU A;  3P2H A;  2ZW7 A;  3IU2 A;  2ZEN A;  3F0A A;  5LRJ A;  3RYO A;  3T9Y A;  3R9E A;  4X3R A;  4MHP A;  3I3G A;  4P4E A;  5DWN A;  5THW A;  2QJ8 A;  3IJ3 A;  3WC6 A;  3KR4 A;  2ZEG A;  4KVM E;  4AVA A;  1B87 A;  1IIC A;  1ON0 A;  1RO5 A;  3WC7 A;  4OKO A;  3FH4 A;  2B4D B;  3B2Y A;  2Z3K A;  5HVG A;  5IB0 A;  1P4N A;  1R3N A;  1XJO A;  2GIV A;  3T90 A;  3S9N A;  2EBJ A;  2AJ6 A;  4A33 A;  5D8N A;  1CP7 A;  2PJA A;  2PJB A;  4UEZ A;  3TOA A;  4R3L A;  4KSI A;  4CPA A;  3GKR A;  4CAX A;  1XOV A;  2DPS A;  2HB6 A;  3SI2 A;  3A9L A;  1M1D A;  2YNC C;  4PXE A;  1I1D A;  4UCP A;  3H5Z A;  2AFS A;  1U6M A;  2BL1 A;  2CNM A;  4ZX9 A;  1NE9 A;  1F57 A;  3DGV A;  1TF9 A;  3FXT A;  4JYW A;  5AG4 A;  4MHD A;  2C6P A;  5DS0 A;  4GM5 A;  2J8N A;  4A37 A;  2EO8 A;  2AFX A;  2OU2 A;  3GLJ A;  4R9M A;  4UEE A;  5ELY A;  4II9 A;  4MHZ A;  3ZJ0 A;  4Z65 A;  4XPL A;  5G21 A;  4R87 A;  3VWD A;  4AVB A;  4E8O A;  2OR4 A;  3FIX A;  3SJG A;  4KUB A;  1S3Z A;  3D8P A;  1PYT B;  3IEH A;  2AFZ A;  4Q7A A;  5F47 A;  2OZU A;  4FBE A;  3IWG A;  2VI7 A;  3KR5 A;  1VHS A;  3IWW A;  4NXY A;  2RB7 A;  4AXV A;  1Z2L A;  1KUV A;  3TFY A;  1YSJ A;  4IHM A;  4ZX8 A;  4A39 A;  4KOT A;  5LRK A;  2X7B A;  2PJ0 A;  3VH9 A;  4BIN A;  5C82 A;  2Z3O A;  3R9F A;  2VEZ A;  3PGP A;  3K9U A;  3F8K A;  2B3V A;  4NFR A;  4KOW A;  4QUS A;  2DEA A;  4KVX A;  4TNU A;  5J1Q A;  4OC2 A;  4W9Y A;  3S9L A;  4CYN A;  2R8V A;  2GE3 A;  2HV2 A;  2Z3L A;  5J8C A;  4PXC A;  3PRT A;  3BLN A;  4H2K A;  2QVP A;  4ZI6 A;  3EY5 A;  1CPX A;  2ZEP A;  2CY2 A;  4KVO E;  4A30 A;  2REF A;  4LQG A;  2Q7B A;  3R9G A;  4JWP A;  4BD9 A;  4PQA A;  4EFD A;  3GIU A;  3MN8 A;  4XNH B;  2C6G A;  3DSB A;  1XIX A;  1S7F A;  1DE4 C;  1XMB A;  2Y0M A;  4NGT A;  2JDC A;  2HUZ A;  3L2N A;  4NGM A;  2PRQ A;  4Q38 A;  3FJU A;  4MFZ A;  4PSW A;  2ZEE A;  4CGN A;  4F9V A;  4PV6 A;  4A31 A;  2RFH A;  4MFP A;  4P45 A;  5F48 A;  4H89 A;  1Q2C A;  4UFV A;  3TTH A;  4CGP A;  5KTC A;  4C2Y A;  3LAC A;  3IWE A;  1CJW A;  5LYL A;  2BSW A;  1BAV A;  3F5B A;  3VAT A;  3TO6 A;  4OC5 A;  4OC0 A;  4CGO A;  4MFK A;  4XPK A;  1QSO A;  1Z8X A;  4JXQ A;  3D67 A;  4NEX A;  4KLV A;  4QVT A;  4YFJ A;  1KUY A;  1SQH A;  1ARM A;  1WK4 A;  5IV0 A;  4WWV A;  5EC4 A;  2EVN A;  2JEV A;  2XEJ A;  4R57 A;  3KHZ A;  1IYL A;  4YRH A;  3S6K A;  4C2X A;  3FEE A;  2I3C A;  2JDD A;  3R1K A;  1YVK A;  4NF1 A;  4MFJ A;  2WPW A;  4NGR A;  2VZZ A;  4UFW A;  4YU9 A;  4C68 A;  3OWC A;  5HMN A;  4KZT A;  2FCK A;  3PEI A;  1HEE A;  2REE A;  4A38 A;  1AYE A;  1N71 A;  2CIJ A;  2ZEH A;  4MCS A;  4MRI A;  4P4J A;  2FT0 A;  1IGB A;  2BOA A;  5D29 A;  2B5G B;  3W6S A;  1GHE A;  4Y49 C;  4RS2 A;  1YVO A;  3PB7 X;  4NGN A;  4PK3 A;  1S5K A;  2OZG A;  3W91 A;  2POK A;  1YW4 A;  1XE4 A;  1YW6 A;  5LYD A;  2PE3 A;  1MJB A;  1Z5R A;  4CRZ B;  4EWT A;  3KQX A;  2AFW A;  2GLJ A;  7CPA A;  3B3V A;  4OIW A;  4ZY1 A;  4OAE A;  3PB4 X;  2V77 A;  4KUA A;  2J8M A;  4M6G A;  4L89 A;  1Y7E A;  1QMU A;  2IL4 A;  1TXR A;  1F2O A;  1JWQ A;  1QSM A;  3FNC A;  4QBJ A;  1BPM A;  3LOD A;  1LFW A;  4B5P B;  3RZA A;  2PJ6 A;  5JGF A;  4B10 A;  1VIX A;  1XMT A;  5K8N A; 
#chains in the Genus database with same CATH homology
 4DNC A;  1IID A;  2ZW6 A;  4KOV A;  2OH1 A;  3FYN A;  3JUW A;  1KUX A;  1YRE A;  2P6G A;  4CAE A;  4CAV A;  2KCW A;  2JLM A;  2YNE A;  4KOR A;  2FS5 A;  1Y9K A;  1FY7 A;  2ATR A;  4JD6 A;  4C7I A;  4OAD A;  4CYQ A;  3UY5 A;  1M4D A;  2P6F A;  1BOB A;  1B6B A;  4LUA A;  1J4J A;  2VBQ A;  2P0W A;  3I9S A;  5I0C A;  1UFH A;  1MK4 A;  4CAW A;  1YLE A;  5G20 A;  4L8A A;  3IU1 A;  3D3S A;  2Q4V A;  3FBU A;  4CRY B;  2OZH A;  3D2M A;  5EBV A;  5H86 A;  4OLL A;  2CXA A;  4IUS A;  4MJ8 A;  4U5Y A;  4A95 A;  4UCM A;  5KTD A;  2I79 A;  2Q44 A;  2FIW A;  2Q0Y A;  4B5P A;  5A27 A;  3EO4 A;  1MJA A;  1R57 A;  4MY3 A;  3G8W A;  4CAF A;  2B4D A;  2BUE A;  3TO7 A;  3N7Z A;  4ZGY B;  1YX0 A;  4HKF A;  4LX9 A;  5AG5 A;  3QAH A;  1PU9 A;  1S60 A;  4I49 A;  3G3S A;  5CNP A;  3R96 A;  5JQ4 A;  2YND A;  5ISV A;  2YGW A;  5J8F A;  4KOY A;  3TO9 A;  3BJ7 A;  2CNS A;  4UWJ A;  2RC4 A;  4FD4 A;  2OB0 A;  4UWI A;  5G1Z A;  3SHP A;  1Q2Y A;  3D2P A;  3VWE A;  1KZF A;  3R95 A;  4MFL A;  3JTK A;  3EFA A;  2VQY A;  1XMT A;  4Y49 B;  3TCV A;  3B8G A;  1CM0 A;  2F5I A;  2VZY A;  1PUA A;  1WWZ A;  5F49 A;  4BMH A;  4KOX A;  2P6E A;  4NSQ A;  2D4O A;  2VXK A;  2PQ8 A;  3BJ8 A;  4IF5 A;  4EVY A;  1M44 A;  3GY9 A;  2G0B A;  4MBU A;  2AE6 A;  4JLY A;  1QSN A;  5FVJ A;  1TIQ A;  5DWM A;  3W6X A;  3V8I A;  4ORF A;  3CXP A;  4M85 A;  4HNW B;  2ZXV A;  2Z3N A;  5AG7 A;  4U9Y A;  4UBR A;  2Z0Z A;  2D4P A;  3S6G A;  3EC4 A;  4Q36 A;  4MY0 A;  1M4G A;  2HQY A;  4JJX A;  2K5T A;  3LD2 A;  4M3S A;  2ZPA A;  1M4I A;  3PP9 A;  5G22 A;  4QC6 A;  4XPD C;  4F0X A;  1YGH A;  4UA3 A;  3JVN A;  2Q4Y A;  3DDD A;  3P2F A;  3WR7 A;  2G3A A;  4F6A A;  2QIR A;  3CXS A;  1Z4E A;  2Z11 A;  1S7K A;  5E96 A;  4CS0 B;  3TOB A;  4KOS A;  1NMT A;  4KOU A;  4H6Z A;  2FE7 A;  1VKC A;  5C88 A;  2R7H A;  4CYP A;  3DNS A;  2B5G A;  4AB7 A;  1QST A;  1S7L A;  4C2Z A;  4UCN A;  1OZP A;  4KSA A;  4A2Z A;  2B4B A;  2FIA A;  2PR1 A;  2PSW A;  1Y7R A;  4HNX B;  4FD6 A;  1Y9W A;  2FL4 A;  4CGL A;  2Z3P A;  1BO4 A;  3SXO A;  3SXN A;  4AG7 A;  1MJ9 A;  3ZZI A;  1Z4R A;  4J3G A;  2DXQ A;  2WPX A;  2O28 A;  5F46 A;  3S6F A;  2J8R A;  2FXF A;  3NE7 A;  4X5K A;  4BBH A;  2PDO A;  5BWA B;  1V0C A;  2ZW5 A;  2QEC A;  4PK2 A;  4K30 A;  2PC1 A;  4U9Z A;  4B14 A;  5GCN A;  3TE4 A;  4ZBG A;  1YR0 A;  4MI4 A;  3FB3 A;  4A32 A;  2YNC A;  1K4J A;  1XEB A;  4UFX A;  4F0Y A;  4GS4 A;  3S6H A;  5A28 A;  4FD7 A;  4C7H A;  4B13 A;  2I00 A;  2C27 A;  2QML A;  4QB9 A;  4XNH C;  5KTA A;  1YK3 A;  1Z9U A;  4MFQ A;  4PSX A;  4CGM A;  1L0C A;  2Q04 A;  4KS9 A;  1S7N A;  5HH1 A;  5AGE A;  3FRM A;  1I21 A;  2DPT A;  3PZJ A;  2WSA A;  5AG6 A;  4JXR A;  3DR8 A;  1ZO0 A;  2G3T A;  4R3K A;  3CXQ A;  5JPH A;  4FD5 A;  1IB1 E;  2GAN A;  5H84 A;  4AVC A;  4B11 A;  4B12 A;  4E0A A;  2PRB A;  1Q2D A;  1RXT A;  3MGD A;  2PR8 A;  4HNY B;  4H6U A;  1P0H A;  3GYA A;  4AG9 A;  1XF8 A;  3QB8 A;  2B3U A;  2H5M A;  3C26 A;  1NSL A;  2NMT A;  2Z3M A;  1QSR A;  5IX3 A;  4NCZ A;  2ZW4 A;  3H4Q A;  3EXN A;  2CNT A;  4YGO A;  2R98 A;  4CYO A;  4RI1 A;  2ARH A;  4KLW A;  2BEI A;  3DR6 A;  3KKW A;  3IGR A;  4ONU A;  2R1I A;  4B5O A;  3TT2 A;  4E2A A;  3E0K A;  2EUI A;  1LRZ A;  2A4N A;  1IYK A;  2B58 A;  2FSR A;  2Z10 A;  4KSF A;  4XPD B;  2WUU A;  3P2H A;  2ZW7 A;  3IU2 A;  3F0A A;  3RYO A;  3T9Y A;  3R9E A;  3I3G A;  5DWN A;  4KVM E;  4AVA A;  1B87 A;  1IIC A;  1ON0 A;  1RO5 A;  2B4D B;  2Z3K A;  5IB0 A;  1P4N A;  2GIV A;  3T90 A;  2AJ6 A;  4A33 A;  3TOA A;  4R3L A;  3GKR A;  4CAX A;  2DPS A;  3A9L A;  1M1D A;  2YNC C;  1I1D A;  4UCP A;  3H5Z A;  1U6M A;  2BL1 A;  2CNM A;  1NE9 A;  3FXT A;  5AG4 A;  4MHD A;  2J8N A;  2OU2 A;  4R9M A;  4II9 A;  3ZJ0 A;  4XPL A;  5G21 A;  4R87 A;  3VWD A;  4AVB A;  4E8O A;  3FIX A;  4KUB A;  1S3Z A;  3D8P A;  5F47 A;  2OZU A;  3IWG A;  2VI7 A;  4NXY A;  1VHS A;  3TFY A;  1KUV A;  4KOT A;  2X7B A;  5C82 A;  2Z3O A;  3R9F A;  2VEZ A;  3PGP A;  3K9U A;  3F8K A;  2B3V A;  4KOW A;  4QUS A;  4KVX A;  4CYN A;  2R8V A;  2GE3 A;  2HV2 A;  2Z3L A;  5J8C A;  3BLN A;  3EY5 A;  2CY2 A;  4KVO E;  4A30 A;  2REF A;  3R9G A;  2Q7B A;  4JWP A;  4XNH B;  3DSB A;  1XIX A;  1S7F A;  2Y0M A;  2JDC A;  2HUZ A;  4Q38 A;  4MFZ A;  4PSW A;  4CGN A;  4PV6 A;  4A31 A;  5F48 A;  4MFP A;  4H89 A;  1Q2C A;  4UFV A;  3TTH A;  4CGP A;  5KTC A;  4C2Y A;  3IWE A;  1CJW A;  2BSW A;  3F5B A;  3TO6 A;  4CGO A;  4MFK A;  4XPK A;  1QSO A;  4JXQ A;  4NEX A;  4QVT A;  4KLV A;  4YFJ A;  1KUY A;  1SQH A;  1WK4 A;  5IV0 A;  5EC4 A;  2EVN A;  2JEV A;  4R57 A;  1IYL A;  4YRH A;  3S6K A;  4C2X A;  2JDD A;  3R1K A;  1YVK A;  4NF1 A;  4MFJ A;  2WPW A;  2VZZ A;  4UFW A;  4C68 A;  3OWC A;  5HMN A;  4KZT A;  2FCK A;  2REE A;  1N71 A;  2FT0 A;  3W6S A;  2B5G B;  1GHE A;  4Y49 C;  4RS2 A;  1YVO A;  4PK3 A;  1S5K A;  2OZG A;  3W91 A;  1XE4 A;  1MJB A;  4CRZ B;  4OAE A;  4KUA A;  2J8M A;  4L89 A;  2IL4 A;  1QSM A;  3FNC A;  4QBJ A;  3LOD A;  4B5P B;  4B10 A;  1I12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...