4YGOA

Dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae in intermediate state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (atcc 39315 / el tor inaba n16961)
molecule tags Transferase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ygoA00
4KOYA 3R1KA 4UBRA 1IICA 3TOBA 4XPKA 4XPDB 1S3ZA 4KUAA 4PV6A 4AG9A 3TT2A 2ZW5A 2FIWA 5J8CA 3D8PA 3SHPA 1S7LA 3VWDA 1V0CA 3G8WA 3BJ7A 1YX0A 3DR8A 3S6KA 1PU9A 1I12A 1KUXA 4KOUA 3UY5A 4HNWB 3T90A 3R9FA 2B4DB 5HMNA 5EC4A 4QVTA 1P0HA 2R7HA 2OB0A 4UA3A 5IV0A 2Q7BA 3IGRA 3FB3A 5C82A 1I21A 5F49A 1S7NA 5IX3A 2ZW7A 1NSLA 1QSTA 4PK3A 1K4JA 4R3KA 1YGHA 2P0WA 4E0AA 2Z0ZA 3S6FA 2H5MA 2EVNA 4ZBGA 2BSWA 2HV2A 1S7FA 2FT0A 3DSBA 3F5BA 2QMLA 4QB9A 2OU2A 4R87A 1IYLA 2GIVA 2VBQA 4K30A 2VI7A 2ARHA 2B58A 4NCZA 3E0KA 2KCWA 4LUAA 2ZPAA 3RYOA 2VZYA 4CRYB 3PGPA 4H89A 4OLLA 3TCVA 4KVOE 2VQYA 2O28A 3CXQA 2PRBA 4MI4A 2B3VA 3D3SA 1Q2CA 4QBJA 4YRHA 3SXOA 4AVAA 3K9UA 4NF1A 1YVOA 1MJAA 5IB0A 1RXTA 3CXPA 2Z11A 3GYAA 2B3UA 4M3SA 2AJ6A 3KKWA 2OZHA 1M44A 4M85A 2JLMA 2K5TA 3BJ8A 1Y7RA 2FCKA 2REEA 2Z10A 1YREA 2ZW6A 4JLYA 3W91A 3QAHA 2ZXVA 4R57A 2JDDA 4JXRA 1Z4EA 2VEZA 3TO7A 1VHSA 1J4JA 1QSMA 3BLNA 4PSWA 4NEXA 4CAXA 4KVXA 4L89A 5F47A 3TTHA 4JD6A 3P2FA 1B6BA 3DR6A 4B5PB 4LX9A 5KTCA 4B5OA 1XIXA 4F0YA 2X7BA 4II9A 5C88A 3F8KA 3JVNA 2BUEA 4U9YA 1M4GA 3FRMA 4KLVA 1B87A 4IF5A 4GS4A 3GKRA 4QUSA 3JUWA 4FD7A 2NMTA 4Y49B 1VKCA 4YFJA 4ORFA 2G3TA 1YR0A 2VXKA 5E96A 1UFHA 2FSRA 1SQHA 5I0CA 4KZTA 5CNPA 3TFYA 2CNTA 4H6UA 4U9ZA 5DWNA 4E8OA 4EVYA 4L8AA 4NXYA 1Q2YA 4X5KA 4B5PA 5KTAA 1YK3A 3T9YA 3TO6A 2WPXA 1CJWA 4FD4A 4XPLA 3S6HA 1N71A 3NE7A 3TE4A 1XF8A 3LODA 1Z9UA 1LRZA 3PZJA 2CY2A 3R96A 1XE4A 1QSRA 1NMTA 3WR7A 4AVBA 1I1DA 1QSOA 3DDDA 4H6ZA 3W6XA 5KTDA 2FL4A 4I49A 5HH1A 4R3LA 2R8VA 1IIDA 4XNHC 2PQ8A 5ISVA 3OWCA 4MJ8A 5JPHA 4MHDA 1WK4A 1NE9A 4KOXA 1IB1E 5F46A 2GE3A 2JDCA 4OADA 3SXNA 4E2AA 1MJBA 2FXFA 2OZGA 2JEVA 1PUAA 2Q04A 4U5YA 4KUBA 2GANA 5H84A 2WPWA 4RS2A 5F48A 4PK2A 3I9SA 4KOSA 2PC1A 1KUYA 3FXTA 3FIXA 1RO5A 4MY3A 2ATRA 2A4NA 4XPDC 2Q44A 3DNSA 1XEBA 1L0CA 2CNSA 1Q2DA 4HNYB 2CNMA 2FIAA 2J8NA 4HNXB 2P6GA 1GHEA 4CRZB 2P6EA 3EFAA 4R9MA 4QC6A 3B8GA 1ON0A 2VZZA 2HUZA 2G0BA 1YLEA 2PSWA 3F0AA 4MY0A 2PR1A 1Y9WA 4PSXA 3LD2A 1M1DA 2B5GA 3R95A 2EUIA 2J8RA 3PP9A 1BOBA 1S60A 2R1IA 3H4QA 2QIRA 2Y0MA 3R9EA 1S5KA 1MK4A 4UWIA 4Y49C 2HQYA 1R57A 2BL1A 3EXNA 3CXSA 4KOTA 4RI1A 5GCNA 4KOVA 2OH1A 1M4DA 3FNCA 3TOAA 4JJXA 1S7KA 4ONUA 1KZFA 4HKFA 3FYNA 3EY5A 1BO4A 2D4PA 2QECA 2FS5A 2PR8A 3W6SA 4IUSA 5H86A 1Y9KA 4KORA 1YVKA 2BEIA 1XMTA 1QSNA 1P4NA 4AVCA 3GY9A 4KLWA 3MGDA 4J3GA 4JXQA 5JQ4A 2FE7A 3ZZIA 5EBVA 3QB8A 3C26A 1KUVA 4FD6A 4YGOA 2B4DA 2Q4VA 3D2MA 2F5IA 3G3SA 2ZW4A 2AE6A 4KVME 4DNCA 5FVJA 4FD5A 3TO9A 2IL4A 4CAWA 1CM0A 4OAEA 5J8FA 1FY7A 4MBUA 2Q4YA 3N7ZA 1M4IA 4CAVA 2REFA 2B4BA 2C27A 1U6MA 3V8IA 2I79A 3R9GA 4CS0B 3D2PA 3ZJ0A 1MJ9A 2RC4A 4AG7A 1IYKA 5DWMA 2G3AA 2OZUA 4XNHB 1OZPA 2Q0YA 2B5GB 4AB7A 3FBUA 1WWZA 2P6FA 2D4OA 4JWPA 2J8MA 4UWJA 3EC4A 4F6AA 2DXQA 2I00A 3IWGA 3P2HA 4NSQA 3EO4A 3VWEA 2R98A 1TIQA 3S6GA 4KOWA 3I3GA 4BMHA 2PDOA 1Z4RA
chains in the Genus database with same CATH superfamily
4KOYA 1CX8A 2PRQA 2ZEGA 2ZEPA 4DJLA 2VL1A 3R1KA 4UBRA 1X12A 1IICA 3TOBA 4WWVA 4XPKA 3LWUA 4XPDB 1S3ZA 4KUAA 4CAEA 4CYQA 4PV6A 4AG9A 3TT2A 4P4FA 2DPSA 2ZW5A 2FIWA 3PRTA 8CPAA 4C2XA 5J8CA 3D8PA 3SHPA 4M6HA 1S7LA 3VWDA 1V0CA 3G8WA 3K9TA 1R43A 1YX0A 3BJ7A 5EMIA 3DR8A 3S6KA 2IJZA 1PU9A 1I12A 4PXDA 1KUXA 2V8VA 3BI0A 3D7GA 4UFXA 1R3NA 4KOUA 2PJ0A 2CTCA 3IEHA 3LACA 1EE3P 4HNWB 4MFKA 3B3CA 3R9FA 3T90A 1ELMP 4B6ZA 3NH4A 3HLPA 3H8EA 2B4DB 4CPAA 5CPAA 5HMNA 4OC2A 1AMPA 3GB0A 4MCQA 5EC4A 5ELYA 4RN7A 4QVTA 3A9LA 1P0HA 2R7HA 2OB0A 1AUGA 2IMOA 2ZEOA 4C7IA 4UA3A 5HXDA 3KI9A 1ZO0A 2PJAA 2Q7BA 1F2OA 5IV0A 3IGRA 4MXUA 3FB3A 4UIAA 4CGLA 4MFPA 5C82A 1I21A 5F49A 1S7NA 2Q7SA 2ZENA 4P4IA 5IX3A 2DF5A 2PJ3A 2ZW7A 3KQZA 1NSLA 1QSTA 4PXCA 1Z8XA 2DPTA 3PFEA 4PK3A 1LCPA 1K4JA 1XOVA 1VIXA 2F7VA 1FNOA 3NFZA 1Y7EA 4IK2A 4OIWA 1BPNA 1YGHA 2P0WA 3ISXA 4R3KA 4E0AA 1IU8A 2Z0ZA 3S6FA 2H5MA 3CPAA 2EVNA 4Q38A 4X2TA 4B12A 4ZBGA 1CPSA 3ISZA 4BINA 4Q36A 5HVFA 1H8LA 4DYOA 3KZWA 4EMEA 2BSWA 4R8FA 4A32A 4P45A 2HV2A 4P10A 1S7FA 3S9NA 2QYVA 1CBXA 2FT0A 2WUUA 3DSBA 3F5BA 5G22A 3NH8A 2Z3MA 3NA6A 2QMLA 4M6IA 5AG4A 1XBUA 2Q4ZA 2ZOGA 2CF4A 4MHZA 3MRUA 4QB9A 4F8ZA 2OU2A 1LANA 3DGVA 3FECA 4R87A 3PBBA 1IYLA 2GIVA 2VBQA 4K30A 1YQEA 1XJOA 2VI7A 1Q7LA 2ARHA 2B58A 4NCZA 7CPAA 4UCMA 1BAVA 3E0KA 4OC1A 2KCWA 4HPSA 1YW6A 4LUAA 2ZPAA 4PXEA 3RYOA 2VZYA 4CRYB 4A2ZA 3H5ZA 1BLLE 3B35A 4P4EA 2J9AA 5D29A 3PGPA 4H89A 4OLLA 3TCVA 3TC8A 1LFWA 4KVOE 4NGPA 4W9YA 2VQYA 2O28A 1OBRA 2JBJA 2PRBA 2B3VA 1GYTA 2Z3PA 3CXQA 1LAPA 3KASA 3D3SA 4MI4A 4KS9A 1QQ9A 1Q2CA 4QBJA 4YRHA 4O23A 3SXOA 4AVAA 4KSIA 3K9UA 4UFVA 5AGEA 4NF1A 1YVOA 3B3TA 1TKHA 1MJAA 5IB0A 5K8NA 1RXTA 3CXPA 3B3SA 1CG2A 2Z11A 3GYAA 2B3UA 1ZG8A 2AFWA 2AJ6A 4M3SA 2PCUA 2XEJA 4G1PA 5J1QA 2HB6A 3KKWA 2OZHA 1ZLHA 2EWBA 2YNCA 4F9UA 1M44A 4A30A 4M85A 3PB9X 2JLMA 2K5TA 3BJ8A 3RAMA 2ZEDA 2PJ1A 1Y7RA 4UCNA 2ZEHA 2FCKA 4A95A 2REEA 2AFSA 3RO0A 3GIUA 2Z10A 4MFZA 4OC4A 4FBEA 3S9LA 1YREA 2ZW6A 1TXRA 4R76A 1FT7A 4JLYA 3DLJA 3W91A 4F9VA 2AFZA 3QAHA 2AFUA 2ZXVA 1F2PA 2GLJA 4R57A 2JDDA 2WYRA 3IFEA 1PYTB 4JXRA 4ZY0A 3FH4A 1Z4EA 3KQXA 2VEZA 3TO7A 4JZ0A 2EK9A 3D68A 3GLJA 1VHSA 1XFOA 1J4JA 1QSMA 4MFJA 4NJQA 1DTDA 4GM5A 2PVVA 4OC3A 4YU9A 2V8GA 3IU2A 3BLNA 4PSWA 3I1UA 2POKA 4A39A 1DE4C 4NEXA 4KVXA 4L89A 4CAXA 5F47A 3TTHA 3P2FA 4JD6A 1B6BA 3DR6A 1Z8WA 2RB7A 4B5PB 4LX9A 5JM6A 5KTCA 4B5OA 1XMBA 1IOFA 1XIXA 3IO1A 5I4MA 4F0YA 2X7BA 4II9A 5C88A 3F8KA 3T8WA 2IQ6A 1A2ZA 4CGOA 4P4DA 3JVNA 2BUEA 4PPZA 4CGMA 2Q51A 4U9YA 1M4GA 3FRMA 4ZGYB 1JQGA 3D7HA 4KLVA 1B87A 1XRYA 4C68A 4UEZA 4IF5A 4GS4A 3GKRA 4M6GA 4QUSA 2FVGA 2V8DA 3JUWA 3JTKA 4ZY2A 4MHYA 4FD7A 2NMTA 3SJEA 2O53A 1VKCA 2CTBA 4UIBA 4Y49B 3UY5A 4YFJA 3NH5A 4ORFA 1ZG7A 2G3TA 1YR0A 2VXKA 5E96A 5AG6A 1ZG9A 1UFHA 2ZOFA 1ARMA 5THWA 4DUKA 2FSRA 1SQHA 3IC1A 4KSFA 5I0CA 4NFRA 4C7HA 1Y0YA 2EO8A 4KZTA 5CNPA 3TFYA 2CNTA 4H6UA 4NJRA 1VGYA 4U9ZA 4MHNA 5DS0A 5DWNA 4E8OA 4CGPA 4EVYA 4BD9A 2XEFA 4L8AA 2C6PA 4NXYA 1Q2YA 4X5KA 4AXVA 4B5PA 2ZEMA 4R6TA 5KTAA 5K8OA 1YK3A 2Z3KA 1TKJA 3T9YA 1KWMA 2WPXA 3TO6A 1CJWA 4FD4A 4XPLA 4EFDA 3CT9A 4A33A 3S6HA 1N71A 4IAVA 3NE7A 3TE4A 4FWUA 5HVGA 1XF8A 3LODA 2XEIA 1Z9UA 1LRZA 3PZJA 2CY2A 3R96A 2PJ8A 4R7MA 1XE4A 2WSAA 1QSRA 1NMTA 5LYDA 5D8NA 3WR7A 5LRGA 4AVBA 2ZEEA 3CPXA 3H8FA 3LMSA 4FAIA 2BCOA 1I1DA 1QSOA 4PXBA 1IGBA 3DDDA 4A94A 2ABZA 2BOAA 3CDXA 4H6ZA 3BXMA 4ZX8A 3W6XA 5KTDA 2AFMA 1YSJA 2FL4A 2OR4A 4I49A 4R3LA 2R8VA 3D66A 5HH1A 3RBUA 1IIDA 5CBMA 1CPXA 4XNHC 4ZI6A 2PQ8A 5ISVA 4UF4A 3OWCA 4MJ8A 4CYOA 1Z5RA 5JPHA 4MHDA 2GLFA 3FEEA 3PBEA 1WK4A 2I3CA 1NE9A 4KOXA 2PIZA 1IB1E 1PCAA 1RTQA 1X10A 5F46A 3FJUA 5AG7A 2GREA 5JGFA 2GE3A 2JDCA 3N5FA 4MCSA 1ELLP 4MMOA 4OADA 2EBJA 4P6YA 3IIBA 3SXNA 2QVPA 4E2AA 1HEEA 4OP4A 2G9DA 1MJBA 2FXFA 2YGWA 2OZGA 3B2YA 4CGNA 2JEVA 3FF3A 1PUAA 4X8IA 2Q04A 3H8GA 1HDUA 2YNEA 4KUBA 4U5YA 4A38A 2GANA 5H84A 1VHEA 2WPWA 5BWAB 4MRIA 4RS2A 5F48A 4PK2A 3KR4A 3I9SA 2C1CA 2CXAA 4MHPA 2YNDA 4KOSA 2PC1A 2PJ9A 1KUYA 2DEAA 4BBHA 3FXTA 3FIXA 5LYLA 1ARLA 1RO5A 4MY3A 3SJFA 3B7IA 2ATRA 2A4NA 4XPDC 2Q44A 3DNSA 3SJXA 1XEBA 2PJBA 1L0CA 4GXHA 5G1ZA 4P4BA 2CNSA 1Q2DA 3GUXA 4A31A 4HNYB 4JYWA 2CNMA 2FIAA 3D7FA 4PQAA 2J8NA 4HNXB 2P6GA 5LRJA 1GHEA 3CZXA 4CRZB 1F57A 4B13A 4F0XA 2P6EA 3EFAA 4R9MA 3KHXA 5A27A 4K3NA 4TWEA 4WJBA 4QC6A 3TX8A 3B8GA 2C6CA 1ON0A 5K8MA 5IB9A 4CYNA 4ZX9A 2PIYA 2Q43A 2VZZA 4UFWA 2HUZA 2G0BA 4B14A 1YLEA 2PSWA 3F0AA 4MY0A 2PR1A 1YLOA 1Y9WA 5G21A 1YW4A 4PSXA 3LD2A 3IU1A 1CP6A 1M1DA 4UEFA 2B5GA 2Z3LA 3WABA 3B3WA 3R95A 3RZAA 2EUIA 3HUVA 4B10A 2PJCA 2J8RA 2BO9A 3PP9A 1BOBA 3VATA 3MN8A 1S60A 2R1IA 3H4QA 2QIRA 1CP7A 2Y0MA 3WC6A 3FX6A 3R9EA 2GFQA 4UEEA 3PB4X 2NSMA 4MCPA 1S5KA 1MK4A 4UWIA 4Y49C 1TF9A 4NGSA 1VHOA 3SJGA 2JBKA 6CPAA 2HQYA 1R57A 2BL1A 3EXNA 3JRUA 3KGQA 4NGNA 4NGMA 2EK8A 3CXSA 2HC9A 4KOTA 1YMEA 4RI1A 5GCNA 4KOVA 2OH1A 1M4DA 3B3VA 3FNCA 1Z2LA 4OC5A 2NYQA 3TOAA 2PJ6A 4JJXA 1S7KA 4ONUA 2Z3NA 2PJ5A 1KZFA 3D7DA 4HKFA 4ZYQA 5LYFA 3PFOA 4RUHA 4OMEA 4FUUA 2ZELA 3FYNA 3VARA 3FMCA 3EY5A 1Z8TA 1BO4A 1HDQA 2D4PA 2FS5A 2PR8A 2QECA 3WC5A 4IHMA 2ANPA 2PJ2A 4OIDA 3W6SA 2YNCC 3RNZA 4IUSA 4YWYA 2GU2A 4MFLA 2ODFA 3IWWA 5H86A 3SI1A 4UCPA 1Y9KA 2C6GA 4KORA 1UWYA 4Q7AA 3V7ZA 1YVKA 5AG5A 2AFOA 1TKFA 2BEIA 1XMTA 1QSNA 1P4NA 5A28A 4AVCA 4ZY1A 3BI1A 3GY9A 2XEGA 3QNVA 4KLWA 4MCRA 3MGDA 4OKOA 3KHZA 4CAFA 4J3GA 4JXQA 4P4JA 2FE7A 3ZZIA 2Z3OA 5JQ4A 5EBVA 1IY7A 3PB6X 2PJ7A 2CIJA 2F8HA 3QB8A 3C26A 5JH9A 1QMUA 1KUVA 4FD6A 4YGOA 2B4DA 2Q4VA 2QJ8A 3D2MA 2F5IA 3G3SA 2ZW4A 4H2KA 1Z8LA 4NGQA 1LAMA 2AE6A 4KVME 4DNCA 2ZEFA 5FVJA 3WC7A 4FD5A 3IJ3A 4OC0A 4EWTA 3TO9A 2IL4A 4CAWA 1CM0A 4OAEA 5LYIA 5J8FA 2WZNA 1FY7A 4MBUA 2Q4YA 1JWQA 3N7ZA 4B11A 1M4IA 4CAVA 3S9MA 2REFA 2B4BA 4X3RA 2C27A 1U6MA 3D67A 3VH9A 5LRKA 3V8IA 2I79A 1AYEA 4Z65A 3R9GA 4CS0B 4P44A 5F09A 3D2PA 3ZJ0A 1MJ9A 1ZLIA 2RC4A 3KL9A 4NGTA 4A37A 4AG7A 1IYKA 5DWMA 3FEDA 2G3AA 4TNUA 2OZUA 4XNHB 3BHXA 1OZPA 2PJ4A 2Q0YA 1TF8A 1Y0RA 2B5GB 2RFHA 3L2NA 4MFQA 1LOKA 2AFXA 2OOTA 4AB7A 3FBUA 2V8HA 3K2KA 1WWZA 2P6FA 4NGRA 2D4OA 3D4UA 3PB8X 4C2YA 2V77A 3SI2A 4JWPA 2J8MA 4UWJA 1BPMA 3EC4A 5G20A 4LQGA 4C2ZA 4F6AA 5HVHA 3WT4A 2DXQA 2I00A 3IWGA 3P2HA 3QAYA 4NSQA 2PE3A 3FVLA 3PB7X 1NSAA 4LQ6A 3EO4A 5K8PA 3V38A 3IWEA 4KSAA 3VWEA 3PEIA 2JEWA 2R98A 4ONWA 2PVWA 1TIQA 3KR5A 3SI0A 3S6GA 2O4HA 1IOIA 4KOWA 3NE8A 3I3GA 4BMHA 1M4LA 2PDOA 4CYPA 1Z4RA
chains in the Genus database with same CATH topology
4KOYA 3R1KA 4UBRA 1IICA 3TOBA 4XPKA 4XPDB 1S3ZA 4KUAA 4CAEA 4CYQA 4PV6A 4AG9A 3TT2A 2DPSA 2ZW5A 2FIWA 5J8CA 4C2XA 3D8PA 3SHPA 1S7LA 3VWDA 1V0CA 3G8WA 3BJ7A 1YX0A 3DR8A 3S6KA 1PU9A 1I12A 4UFXA 1KUXA 4KOUA 3UY5A 4HNWB 3T90A 4MFKA 3R9FA 2B4DB 5HMNA 5EC4A 4QVTA 3A9LA 1P0HA 2R7HA 2OB0A 4C7IA 4UA3A 1ZO0A 5IV0A 2Q7BA 3IGRA 4CGLA 3FB3A 4MFPA 5C82A 1I21A 5F49A 1S7NA 5IX3A 2ZW7A 1NSLA 1QSTA 2DPTA 4PK3A 1K4JA 4R3KA 1YGHA 2P0WA 4E0AA 2Z0ZA 3S6FA 2H5MA 4Q38A 2EVNA 4B12A 4ZBGA 4Q36A 2BSWA 4A32A 2HV2A 1S7FA 2WUUA 2FT0A 3DSBA 3F5BA 5G22A 2Z3MA 2QMLA 5AG4A 4QB9A 2OU2A 4R87A 1IYLA 2GIVA 2VBQA 4K30A 2VI7A 2ARHA 2B58A 4NCZA 4UCMA 3E0KA 2KCWA 4LUAA 2ZPAA 3RYOA 2VZYA 4CRYB 4A2ZA 3H5ZA 3PGPA 4H89A 4OLLA 3TCVA 4KVOE 2VQYA 2O28A 3CXQA 2PRBA 4MI4A 2B3VA 2Z3PA 3D3SA 4KS9A 1Q2CA 4QBJA 4YRHA 3SXOA 4AVAA 3K9UA 4UFVA 5AGEA 4NF1A 1YVOA 1MJAA 5IB0A 1RXTA 3CXPA 2Z11A 3GYAA 2B3UA 4M3SA 2AJ6A 3KKWA 2OZHA 2YNCA 1M44A 4A30A 4M85A 2JLMA 2K5TA 3BJ8A 1Y7RA 4UCNA 4A95A 2FCKA 2REEA 4MFZA 2Z10A 1YREA 2ZW6A 4JLYA 3W91A 3QAHA 2ZXVA 4R57A 2JDDA 4JXRA 1Z4EA 2VEZA 3TO7A 4MFJA 1VHSA 1J4JA 1QSMA 3IU2A 3BLNA 4PSWA 4NEXA 4CAXA 4KVXA 4L89A 5F47A 3TTHA 4JD6A 3P2FA 1B6BA 3DR6A 4B5PB 4LX9A 5KTCA 4B5OA 1XIXA 4F0YA 2X7BA 4II9A 5C88A 3F8KA 3JVNA 2BUEA 4CGMA 4U9YA 1M4GA 3FRMA 4ZGYB 4KLVA 1B87A 4C68A 4IF5A 4GS4A 3GKRA 4QUSA 3JTKA 3JUWA 4FD7A 2NMTA 4Y49B 1VKCA 4YFJA 4ORFA 2G3TA 1YR0A 2VXKA 5E96A 5AG6A 1UFHA 2FSRA 1SQHA 4KSFA 5I0CA 4C7HA 4KZTA 5CNPA 3TFYA 2CNTA 4H6UA 4U9ZA 5DWNA 4E8OA 4CGPA 4EVYA 4L8AA 4NXYA 1Q2YA 4X5KA 4B5PA 5KTAA 1YK3A 2Z3KA 3T9YA 3TO6A 2WPXA 1CJWA 4FD4A 4XPLA 4A33A 3S6HA 1N71A 3NE7A 3TE4A 1XF8A 3LODA 1Z9UA 1LRZA 3PZJA 2CY2A 3R96A 1XE4A 2WSAA 1QSRA 1NMTA 3WR7A 4AVBA 1I1DA 1QSOA 3DDDA 4H6ZA 3W6XA 5KTDA 2FL4A 4I49A 5HH1A 4R3LA 2R8VA 1IIDA 4XNHC 2PQ8A 5ISVA 3OWCA 4MJ8A 4CYOA 5JPHA 4MHDA 1WK4A 1NE9A 4KOXA 1IB1E 5F46A 5AG7A 2GE3A 2JDCA 4OADA 3SXNA 4E2AA 1MJBA 2FXFA 2YGWA 2OZGA 4CGNA 2JEVA 1PUAA 2Q04A 2YNEA 4U5YA 4KUBA 2GANA 5H84A 2WPWA 5BWAB 4RS2A 5F48A 4PK2A 3I9SA 2CXAA 2YNDA 4KOSA 2PC1A 1KUYA 4BBHA 3FXTA 3FIXA 1RO5A 4MY3A 2ATRA 2A4NA 4XPDC 2Q44A 3DNSA 1XEBA 1L0CA 5G1ZA 2CNSA 1Q2DA 4A31A 4HNYB 2CNMA 2FIAA 2J8NA 4HNXB 2P6GA 1GHEA 4CRZB 4B13A 4F0XA 2P6EA 3EFAA 4R9MA 5A27A 4QC6A 3B8GA 1ON0A 4CYNA 2VZZA 4UFWA 2HUZA 2G0BA 4B14A 1YLEA 2PSWA 3F0AA 4MY0A 2PR1A 1Y9WA 5G21A 4PSXA 3LD2A 3IU1A 1M1DA 2B5GA 2Z3LA 3R95A 2EUIA 4B10A 2J8RA 3PP9A 1BOBA 1S60A 2R1IA 3H4QA 2QIRA 2Y0MA 3R9EA 1S5KA 1MK4A 4UWIA 4Y49C 2HQYA 1R57A 2BL1A 3EXNA 3CXSA 4KOTA 4RI1A 5GCNA 4KOVA 2OH1A 1M4DA 3FNCA 3TOAA 4JJXA 1S7KA 4ONUA 2Z3NA 1KZFA 4HKFA 3FYNA 3EY5A 1BO4A 2D4PA 2QECA 2FS5A 2PR8A 3W6SA 2YNCC 4IUSA 4MFLA 5H86A 4UCPA 1Y9KA 4KORA 1YVKA 5AG5A 2BEIA 1XMTA 1QSNA 1P4NA 5A28A 4AVCA 3GY9A 4KLWA 3MGDA 4CAFA 4J3GA 4JXQA 5JQ4A 2FE7A 3ZZIA 2Z3OA 5EBVA 3QB8A 3C26A 1KUVA 4FD6A 4YGOA 2B4DA 2Q4VA 3D2MA 2F5IA 3G3SA 2ZW4A 2AE6A 4KVME 4DNCA 5FVJA 4FD5A 3TO9A 2IL4A 4CAWA 1CM0A 4OAEA 5J8FA 1FY7A 4MBUA 2Q4YA 3N7ZA 4B11A 1M4IA 4CAVA 2REFA 2B4BA 2C27A 1U6MA 3V8IA 2I79A 3R9GA 4CS0B 3D2PA 3ZJ0A 1MJ9A 2RC4A 4AG7A 1IYKA 5DWMA 2G3AA 2OZUA 4XNHB 1OZPA 2Q0YA 2B5GB 4MFQA 4AB7A 4CGOA 3FBUA 1WWZA 2P6FA 2D4OA 4C2YA 4JWPA 2J8MA 4UWJA 3EC4A 5G20A 4C2ZA 4F6AA 2DXQA 2I00A 3IWGA 3P2HA 4NSQA 3EO4A 3IWEA 4KSAA 3VWEA 2R98A 1TIQA 3S6GA 4KOWA 3I3GA 4BMHA 2PDOA 4CYPA 1Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOY A;  3R1K A;  4UBR A;  1IIC A;  3TOB A;  4XPK A;  4XPD B;  1S3Z A;  4KUA A;  4PV6 A;  4AG9 A;  3TT2 A;  2ZW5 A;  2FIW A;  5J8C A;  3D8P A;  3SHP A;  1S7L A;  3VWD A;  1V0C A;  3G8W A;  3BJ7 A;  1YX0 A;  3DR8 A;  3S6K A;  1PU9 A;  1I12 A;  1KUX A;  4KOU A;  3UY5 A;  4HNW B;  3T90 A;  3R9F A;  2B4D B;  5HMN A;  5EC4 A;  4QVT A;  1P0H A;  2R7H A;  2OB0 A;  4UA3 A;  5IV0 A;  2Q7B A;  3IGR A;  3FB3 A;  5C82 A;  1I21 A;  5F49 A;  1S7N A;  5IX3 A;  2ZW7 A;  1NSL A;  1QST A;  4PK3 A;  1K4J A;  4R3K A;  1YGH A;  2P0W A;  4E0A A;  2Z0Z A;  3S6F A;  2H5M A;  2EVN A;  4ZBG A;  2BSW A;  2HV2 A;  1S7F A;  2FT0 A;  3DSB A;  3F5B A;  2QML A;  4QB9 A;  2OU2 A;  4R87 A;  1IYL A;  2GIV A;  2VBQ A;  4K30 A;  2VI7 A;  2ARH A;  2B58 A;  4NCZ A;  3E0K A;  2KCW A;  4LUA A;  2ZPA A;  3RYO A;  2VZY A;  4CRY B;  3PGP A;  4H89 A;  4OLL A;  3TCV A;  4KVO E;  2VQY A;  2O28 A;  3CXQ A;  2PRB A;  4MI4 A;  2B3V A;  3D3S A;  1Q2C A;  4QBJ A;  4YRH A;  3SXO A;  4AVA A;  3K9U A;  4NF1 A;  1YVO A;  1MJA A;  5IB0 A;  1RXT A;  3CXP A;  2Z11 A;  3GYA A;  2B3U A;  4M3S A;  2AJ6 A;  3KKW A;  2OZH A;  1M44 A;  4M85 A;  2JLM A;  2K5T A;  3BJ8 A;  1Y7R A;  2FCK A;  2REE A;  2Z10 A;  1YRE A;  2ZW6 A;  4JLY A;  3W91 A;  3QAH A;  2ZXV A;  4R57 A;  2JDD A;  4JXR A;  1Z4E A;  2VEZ A;  3TO7 A;  1VHS A;  1J4J A;  1QSM A;  3BLN A;  4PSW A;  4NEX A;  4CAX A;  4KVX A;  4L89 A;  5F47 A;  3TTH A;  4JD6 A;  3P2F A;  1B6B A;  3DR6 A;  4B5P B;  4LX9 A;  5KTC A;  4B5O A;  1XIX A;  4F0Y A;  2X7B A;  4II9 A;  5C88 A;  3F8K A;  3JVN A;  2BUE A;  4U9Y A;  1M4G A;  3FRM A;  4KLV A;  1B87 A;  4IF5 A;  4GS4 A;  3GKR A;  4QUS A;  3JUW A;  4FD7 A;  2NMT A;  4Y49 B;  1VKC A;  4YFJ A;  4ORF A;  2G3T A;  1YR0 A;  2VXK A;  5E96 A;  1UFH A;  2FSR A;  1SQH A;  5I0C A;  4KZT A;  5CNP A;  3TFY A;  2CNT A;  4H6U A;  4U9Z A;  5DWN A;  4E8O A;  4EVY A;  4L8A A;  4NXY A;  1Q2Y A;  4X5K A;  4B5P A;  5KTA A;  1YK3 A;  3T9Y A;  3TO6 A;  2WPX A;  1CJW A;  4FD4 A;  4XPL A;  3S6H A;  1N71 A;  3NE7 A;  3TE4 A;  1XF8 A;  3LOD A;  1Z9U A;  1LRZ A;  3PZJ A;  2CY2 A;  3R96 A;  1XE4 A;  1QSR A;  1NMT A;  3WR7 A;  4AVB A;  1I1D A;  1QSO A;  3DDD A;  4H6Z A;  3W6X A;  5KTD A;  2FL4 A;  4I49 A;  5HH1 A;  4R3L A;  2R8V A;  1IID A;  4XNH C;  2PQ8 A;  5ISV A;  3OWC A;  4MJ8 A;  5JPH A;  4MHD A;  1WK4 A;  1NE9 A;  4KOX A;  1IB1 E;  5F46 A;  2GE3 A;  2JDC A;  4OAD A;  3SXN A;  4E2A A;  1MJB A;  2FXF A;  2OZG A;  2JEV A;  1PUA A;  2Q04 A;  4U5Y A;  4KUB A;  2GAN A;  5H84 A;  2WPW A;  4RS2 A;  5F48 A;  4PK2 A;  3I9S A;  4KOS A;  2PC1 A;  1KUY A;  3FXT A;  3FIX A;  1RO5 A;  4MY3 A;  2ATR A;  2A4N A;  4XPD C;  2Q44 A;  3DNS A;  1XEB A;  1L0C A;  2CNS A;  1Q2D A;  4HNY B;  2CNM A;  2FIA A;  2J8N A;  4HNX B;  2P6G A;  1GHE A;  4CRZ B;  2P6E A;  3EFA A;  4R9M A;  4QC6 A;  3B8G A;  1ON0 A;  2VZZ A;  2HUZ A;  2G0B A;  1YLE A;  2PSW A;  3F0A A;  4MY0 A;  2PR1 A;  1Y9W A;  4PSX A;  3LD2 A;  1M1D A;  2B5G A;  3R95 A;  2EUI A;  2J8R A;  3PP9 A;  1BOB A;  1S60 A;  2R1I A;  3H4Q A;  2QIR A;  2Y0M A;  3R9E A;  1S5K A;  1MK4 A;  4UWI A;  4Y49 C;  2HQY A;  1R57 A;  2BL1 A;  3EXN A;  3CXS A;  4KOT A;  4RI1 A;  5GCN A;  4KOV A;  2OH1 A;  1M4D A;  3FNC A;  3TOA A;  4JJX A;  1S7K A;  4ONU A;  1KZF A;  4HKF A;  3FYN A;  3EY5 A;  1BO4 A;  2D4P A;  2QEC A;  2FS5 A;  2PR8 A;  3W6S A;  4IUS A;  5H86 A;  1Y9K A;  4KOR A;  1YVK A;  2BEI A;  1XMT A;  1QSN A;  1P4N A;  4AVC A;  3GY9 A;  4KLW A;  3MGD A;  4J3G A;  4JXQ A;  5JQ4 A;  2FE7 A;  3ZZI A;  5EBV A;  3QB8 A;  3C26 A;  1KUV A;  4FD6 A;  4YGO A;  2B4D A;  2Q4V A;  3D2M A;  2F5I A;  3G3S A;  2ZW4 A;  2AE6 A;  4KVM E;  4DNC A;  5FVJ A;  4FD5 A;  3TO9 A;  2IL4 A;  4CAW A;  1CM0 A;  4OAE A;  5J8F A;  1FY7 A;  4MBU A;  2Q4Y A;  3N7Z A;  1M4I A;  4CAV A;  2REF A;  2B4B A;  2C27 A;  1U6M A;  3V8I A;  2I79 A;  3R9G A;  4CS0 B;  3D2P A;  3ZJ0 A;  1MJ9 A;  2RC4 A;  4AG7 A;  1IYK A;  5DWM A;  2G3A A;  2OZU A;  4XNH B;  1OZP A;  2Q0Y A;  2B5G B;  4AB7 A;  3FBU A;  1WWZ A;  2P6F A;  2D4O A;  4JWP A;  2J8M A;  4UWJ A;  3EC4 A;  4F6A A;  2DXQ A;  2I00 A;  3IWG A;  3P2H A;  4NSQ A;  3EO4 A;  3VWE A;  2R98 A;  1TIQ A;  3S6G A;  4KOW A;  3I3G A;  4BMH A;  2PDO A;  1Z4R A; 
#chains in the Genus database with same CATH topology
 4KOY A;  1CX8 A;  2PRQ A;  2ZEG A;  2ZEP A;  4DJL A;  2VL1 A;  3R1K A;  4UBR A;  1X12 A;  1IIC A;  3TOB A;  4WWV A;  4XPK A;  3LWU A;  4XPD B;  1S3Z A;  4KUA A;  4CAE A;  4CYQ A;  4PV6 A;  4AG9 A;  3TT2 A;  4P4F A;  2DPS A;  2ZW5 A;  2FIW A;  3PRT A;  8CPA A;  4C2X A;  5J8C A;  3D8P A;  3SHP A;  4M6H A;  1S7L A;  3VWD A;  1V0C A;  3G8W A;  3K9T A;  1R43 A;  1YX0 A;  3BJ7 A;  5EMI A;  3DR8 A;  3S6K A;  2IJZ A;  1PU9 A;  1I12 A;  4PXD A;  1KUX A;  2V8V A;  3BI0 A;  3D7G A;  4UFX A;  1R3N A;  4KOU A;  2PJ0 A;  2CTC A;  3IEH A;  3LAC A;  1EE3 P;  4HNW B;  4MFK A;  3B3C A;  3R9F A;  3T90 A;  1ELM P;  4B6Z A;  3NH4 A;  3HLP A;  3H8E A;  2B4D B;  4CPA A;  5CPA A;  5HMN A;  4OC2 A;  1AMP A;  3GB0 A;  4MCQ A;  5EC4 A;  5ELY A;  4RN7 A;  4QVT A;  3A9L A;  1P0H A;  2R7H A;  2OB0 A;  1AUG A;  2IMO A;  2ZEO A;  4C7I A;  4UA3 A;  5HXD A;  3KI9 A;  1ZO0 A;  2PJA A;  2Q7B A;  1F2O A;  5IV0 A;  3IGR A;  4MXU A;  3FB3 A;  4UIA A;  4CGL A;  4MFP A;  5C82 A;  1I21 A;  5F49 A;  1S7N A;  2Q7S A;  2ZEN A;  4P4I A;  5IX3 A;  2DF5 A;  2PJ3 A;  2ZW7 A;  3KQZ A;  1NSL A;  1QST A;  4PXC A;  1Z8X A;  2DPT A;  3PFE A;  4PK3 A;  1LCP A;  1K4J A;  1XOV A;  1VIX A;  2F7V A;  1FNO A;  3NFZ A;  1Y7E A;  4IK2 A;  4OIW A;  1BPN A;  1YGH A;  2P0W A;  3ISX A;  4R3K A;  4E0A A;  1IU8 A;  2Z0Z A;  3S6F A;  2H5M A;  3CPA A;  2EVN A;  4Q38 A;  4X2T A;  4B12 A;  4ZBG A;  1CPS A;  3ISZ A;  4BIN A;  4Q36 A;  5HVF A;  1H8L A;  4DYO A;  3KZW A;  4EME A;  2BSW A;  4R8F A;  4A32 A;  4P45 A;  2HV2 A;  4P10 A;  1S7F A;  3S9N A;  2QYV A;  1CBX A;  2FT0 A;  2WUU A;  3DSB A;  3F5B A;  5G22 A;  3NH8 A;  2Z3M A;  3NA6 A;  2QML A;  4M6I A;  5AG4 A;  1XBU A;  2Q4Z A;  2ZOG A;  2CF4 A;  4MHZ A;  3MRU A;  4QB9 A;  4F8Z A;  2OU2 A;  1LAN A;  3DGV A;  3FEC A;  4R87 A;  3PBB A;  1IYL A;  2GIV A;  2VBQ A;  4K30 A;  1YQE A;  1XJO A;  2VI7 A;  1Q7L A;  2ARH A;  2B58 A;  4NCZ A;  7CPA A;  4UCM A;  1BAV A;  3E0K A;  4OC1 A;  2KCW A;  4HPS A;  1YW6 A;  4LUA A;  2ZPA A;  4PXE A;  3RYO A;  2VZY A;  4CRY B;  4A2Z A;  3H5Z A;  1BLL E;  3B35 A;  4P4E A;  2J9A A;  5D29 A;  3PGP A;  4H89 A;  4OLL A;  3TCV A;  3TC8 A;  1LFW A;  4KVO E;  4NGP A;  4W9Y A;  2VQY A;  2O28 A;  1OBR A;  2JBJ A;  2PRB A;  2B3V A;  1GYT A;  2Z3P A;  3CXQ A;  1LAP A;  3KAS A;  3D3S A;  4MI4 A;  4KS9 A;  1QQ9 A;  1Q2C A;  4QBJ A;  4YRH A;  4O23 A;  3SXO A;  4AVA A;  4KSI A;  3K9U A;  4UFV A;  5AGE A;  4NF1 A;  1YVO A;  3B3T A;  1TKH A;  1MJA A;  5IB0 A;  5K8N A;  1RXT A;  3CXP A;  3B3S A;  1CG2 A;  2Z11 A;  3GYA A;  2B3U A;  1ZG8 A;  2AFW A;  2AJ6 A;  4M3S A;  2PCU A;  2XEJ A;  4G1P A;  5J1Q A;  2HB6 A;  3KKW A;  2OZH A;  1ZLH A;  2EWB A;  2YNC A;  4F9U A;  1M44 A;  4A30 A;  4M85 A;  3PB9 X;  2JLM A;  2K5T A;  3BJ8 A;  3RAM A;  2ZED A;  2PJ1 A;  1Y7R A;  4UCN A;  2ZEH A;  2FCK A;  4A95 A;  2REE A;  2AFS A;  3RO0 A;  3GIU A;  2Z10 A;  4MFZ A;  4OC4 A;  4FBE A;  3S9L A;  1YRE A;  2ZW6 A;  1TXR A;  4R76 A;  1FT7 A;  4JLY A;  3DLJ A;  3W91 A;  4F9V A;  2AFZ A;  3QAH A;  2AFU A;  2ZXV A;  1F2P A;  2GLJ A;  4R57 A;  2JDD A;  2WYR A;  3IFE A;  1PYT B;  4JXR A;  4ZY0 A;  3FH4 A;  1Z4E A;  3KQX A;  2VEZ A;  3TO7 A;  4JZ0 A;  2EK9 A;  3D68 A;  3GLJ A;  1VHS A;  1XFO A;  1J4J A;  1QSM A;  4MFJ A;  4NJQ A;  1DTD A;  4GM5 A;  2PVV A;  4OC3 A;  4YU9 A;  2V8G A;  3IU2 A;  3BLN A;  4PSW A;  3I1U A;  2POK A;  4A39 A;  1DE4 C;  4NEX A;  4KVX A;  4L89 A;  4CAX A;  5F47 A;  3TTH A;  3P2F A;  4JD6 A;  1B6B A;  3DR6 A;  1Z8W A;  2RB7 A;  4B5P B;  4LX9 A;  5JM6 A;  5KTC A;  4B5O A;  1XMB A;  1IOF A;  1XIX A;  3IO1 A;  5I4M A;  4F0Y A;  2X7B A;  4II9 A;  5C88 A;  3F8K A;  3T8W A;  2IQ6 A;  1A2Z A;  4CGO A;  4P4D A;  3JVN A;  2BUE A;  4PPZ A;  4CGM A;  2Q51 A;  4U9Y A;  1M4G A;  3FRM A;  4ZGY B;  1JQG A;  3D7H A;  4KLV A;  1B87 A;  1XRY A;  4C68 A;  4UEZ A;  4IF5 A;  4GS4 A;  3GKR A;  4M6G A;  4QUS A;  2FVG A;  2V8D A;  3JUW A;  3JTK A;  4ZY2 A;  4MHY A;  4FD7 A;  2NMT A;  3SJE A;  2O53 A;  1VKC A;  2CTB A;  4UIB A;  4Y49 B;  3UY5 A;  4YFJ A;  3NH5 A;  4ORF A;  1ZG7 A;  2G3T A;  1YR0 A;  2VXK A;  5E96 A;  5AG6 A;  1ZG9 A;  1UFH A;  2ZOF A;  1ARM A;  5THW A;  4DUK A;  2FSR A;  1SQH A;  3IC1 A;  4KSF A;  5I0C A;  4NFR A;  4C7H A;  1Y0Y A;  2EO8 A;  4KZT A;  5CNP A;  3TFY A;  2CNT A;  4H6U A;  4NJR A;  1VGY A;  4U9Z A;  4MHN A;  5DS0 A;  5DWN A;  4E8O A;  4CGP A;  4EVY A;  4BD9 A;  2XEF A;  4L8A A;  2C6P A;  4NXY A;  1Q2Y A;  4X5K A;  4AXV A;  4B5P A;  2ZEM A;  4R6T A;  5KTA A;  5K8O A;  1YK3 A;  2Z3K A;  1TKJ A;  3T9Y A;  1KWM A;  2WPX A;  3TO6 A;  1CJW A;  4FD4 A;  4XPL A;  4EFD A;  3CT9 A;  4A33 A;  3S6H A;  1N71 A;  4IAV A;  3NE7 A;  3TE4 A;  4FWU A;  5HVG A;  1XF8 A;  3LOD A;  2XEI A;  1Z9U A;  1LRZ A;  3PZJ A;  2CY2 A;  3R96 A;  2PJ8 A;  4R7M A;  1XE4 A;  2WSA A;  1QSR A;  1NMT A;  5LYD A;  5D8N A;  3WR7 A;  5LRG A;  4AVB A;  2ZEE A;  3CPX A;  3H8F A;  3LMS A;  4FAI A;  2BCO A;  1I1D A;  1QSO A;  4PXB A;  1IGB A;  3DDD A;  4A94 A;  2ABZ A;  2BOA A;  3CDX A;  4H6Z A;  3BXM A;  4ZX8 A;  3W6X A;  5KTD A;  2AFM A;  1YSJ A;  2FL4 A;  2OR4 A;  4I49 A;  4R3L A;  2R8V A;  3D66 A;  5HH1 A;  3RBU A;  1IID A;  5CBM A;  1CPX A;  4XNH C;  4ZI6 A;  2PQ8 A;  5ISV A;  4UF4 A;  3OWC A;  4MJ8 A;  4CYO A;  1Z5R A;  5JPH A;  4MHD A;  2GLF A;  3FEE A;  3PBE A;  1WK4 A;  2I3C A;  1NE9 A;  4KOX A;  2PIZ A;  1IB1 E;  1PCA A;  1RTQ A;  1X10 A;  5F46 A;  3FJU A;  5AG7 A;  2GRE A;  5JGF A;  2GE3 A;  2JDC A;  3N5F A;  4MCS A;  1ELL P;  4MMO A;  4OAD A;  2EBJ A;  4P6Y A;  3IIB A;  3SXN A;  2QVP A;  4E2A A;  1HEE A;  4OP4 A;  2G9D A;  1MJB A;  2FXF A;  2YGW A;  2OZG A;  3B2Y A;  4CGN A;  2JEV A;  3FF3 A;  1PUA A;  4X8I A;  2Q04 A;  3H8G A;  1HDU A;  2YNE A;  4KUB A;  4U5Y A;  4A38 A;  2GAN A;  5H84 A;  1VHE A;  2WPW A;  5BWA B;  4MRI A;  4RS2 A;  5F48 A;  4PK2 A;  3KR4 A;  3I9S A;  2C1C A;  2CXA A;  4MHP A;  2YND A;  4KOS A;  2PC1 A;  2PJ9 A;  1KUY A;  2DEA A;  4BBH A;  3FXT A;  3FIX A;  5LYL A;  1ARL A;  1RO5 A;  4MY3 A;  3SJF A;  3B7I A;  2ATR A;  2A4N A;  4XPD C;  2Q44 A;  3DNS A;  3SJX A;  1XEB A;  2PJB A;  1L0C A;  4GXH A;  5G1Z A;  4P4B A;  2CNS A;  1Q2D A;  3GUX A;  4A31 A;  4HNY B;  4JYW A;  2CNM A;  2FIA A;  3D7F A;  4PQA A;  2J8N A;  4HNX B;  2P6G A;  5LRJ A;  1GHE A;  3CZX A;  4CRZ B;  1F57 A;  4B13 A;  4F0X A;  2P6E A;  3EFA A;  4R9M A;  3KHX A;  5A27 A;  4K3N A;  4TWE A;  4WJB A;  4QC6 A;  3TX8 A;  3B8G A;  2C6C A;  1ON0 A;  5K8M A;  5IB9 A;  4CYN A;  4ZX9 A;  2PIY A;  2Q43 A;  2VZZ A;  4UFW A;  2HUZ A;  2G0B A;  4B14 A;  1YLE A;  2PSW A;  3F0A A;  4MY0 A;  2PR1 A;  1YLO A;  1Y9W A;  5G21 A;  1YW4 A;  4PSX A;  3LD2 A;  3IU1 A;  1CP6 A;  1M1D A;  4UEF A;  2B5G A;  2Z3L A;  3WAB A;  3B3W A;  3R95 A;  3RZA A;  2EUI A;  3HUV A;  4B10 A;  2PJC A;  2J8R A;  2BO9 A;  3PP9 A;  1BOB A;  3VAT A;  3MN8 A;  1S60 A;  2R1I A;  3H4Q A;  2QIR A;  1CP7 A;  2Y0M A;  3WC6 A;  3FX6 A;  3R9E A;  2GFQ A;  4UEE A;  3PB4 X;  2NSM A;  4MCP A;  1S5K A;  1MK4 A;  4UWI A;  4Y49 C;  1TF9 A;  4NGS A;  1VHO A;  3SJG A;  2JBK A;  6CPA A;  2HQY A;  1R57 A;  2BL1 A;  3EXN A;  3JRU A;  3KGQ A;  4NGN A;  4NGM A;  2EK8 A;  3CXS A;  2HC9 A;  4KOT A;  1YME A;  4RI1 A;  5GCN A;  4KOV A;  2OH1 A;  1M4D A;  3B3V A;  3FNC A;  1Z2L A;  4OC5 A;  2NYQ A;  3TOA A;  2PJ6 A;  4JJX A;  1S7K A;  4ONU A;  2Z3N A;  2PJ5 A;  1KZF A;  3D7D A;  4HKF A;  4ZYQ A;  5LYF A;  3PFO A;  4RUH A;  4OME A;  4FUU A;  2ZEL A;  3FYN A;  3VAR A;  3FMC A;  3EY5 A;  1Z8T A;  1BO4 A;  1HDQ A;  2D4P A;  2FS5 A;  2PR8 A;  2QEC A;  3WC5 A;  4IHM A;  2ANP A;  2PJ2 A;  4OID A;  3W6S A;  2YNC C;  3RNZ A;  4IUS A;  4YWY A;  2GU2 A;  4MFL A;  2ODF A;  3IWW A;  5H86 A;  3SI1 A;  4UCP A;  1Y9K A;  2C6G A;  4KOR A;  1UWY A;  4Q7A A;  3V7Z A;  1YVK A;  5AG5 A;  2AFO A;  1TKF A;  2BEI A;  1XMT A;  1QSN A;  1P4N A;  5A28 A;  4AVC A;  4ZY1 A;  3BI1 A;  3GY9 A;  2XEG A;  3QNV A;  4KLW A;  4MCR A;  3MGD A;  4OKO A;  3KHZ A;  4CAF A;  4J3G A;  4JXQ A;  4P4J A;  2FE7 A;  3ZZI A;  2Z3O A;  5JQ4 A;  5EBV A;  1IY7 A;  3PB6 X;  2PJ7 A;  2CIJ A;  2F8H A;  3QB8 A;  3C26 A;  5JH9 A;  1QMU A;  1KUV A;  4FD6 A;  4YGO A;  2B4D A;  2Q4V A;  2QJ8 A;  3D2M A;  2F5I A;  3G3S A;  2ZW4 A;  4H2K A;  1Z8L A;  4NGQ A;  1LAM A;  2AE6 A;  4KVM E;  4DNC A;  2ZEF A;  5FVJ A;  3WC7 A;  4FD5 A;  3IJ3 A;  4OC0 A;  4EWT A;  3TO9 A;  2IL4 A;  4CAW A;  1CM0 A;  4OAE A;  5LYI A;  5J8F A;  2WZN A;  1FY7 A;  4MBU A;  2Q4Y A;  1JWQ A;  3N7Z A;  4B11 A;  1M4I A;  4CAV A;  3S9M A;  2REF A;  2B4B A;  4X3R A;  2C27 A;  1U6M A;  3D67 A;  3VH9 A;  5LRK A;  3V8I A;  2I79 A;  1AYE A;  4Z65 A;  3R9G A;  4CS0 B;  4P44 A;  5F09 A;  3D2P A;  3ZJ0 A;  1MJ9 A;  1ZLI A;  2RC4 A;  3KL9 A;  4NGT A;  4A37 A;  4AG7 A;  1IYK A;  5DWM A;  3FED A;  2G3A A;  4TNU A;  2OZU A;  4XNH B;  3BHX A;  1OZP A;  2PJ4 A;  2Q0Y A;  1TF8 A;  1Y0R A;  2B5G B;  2RFH A;  3L2N A;  4MFQ A;  1LOK A;  2AFX A;  2OOT A;  4AB7 A;  3FBU A;  2V8H A;  3K2K A;  1WWZ A;  2P6F A;  4NGR A;  2D4O A;  3D4U A;  3PB8 X;  4C2Y A;  2V77 A;  3SI2 A;  4JWP A;  2J8M A;  4UWJ A;  1BPM A;  3EC4 A;  5G20 A;  4LQG A;  4C2Z A;  4F6A A;  5HVH A;  3WT4 A;  2DXQ A;  2I00 A;  3IWG A;  3P2H A;  3QAY A;  4NSQ A;  2PE3 A;  3FVL A;  3PB7 X;  1NSA A;  4LQ6 A;  3EO4 A;  5K8P A;  3V38 A;  3IWE A;  4KSA A;  3VWE A;  3PEI A;  2JEW A;  2R98 A;  4ONW A;  2PVW A;  1TIQ A;  3KR5 A;  3SI0 A;  3S6G A;  2O4H A;  1IOI A;  4KOW A;  3NE8 A;  3I3G A;  4BMH A;  1M4L A;  2PDO A;  4CYP A;  1Z4R A; 
#chains in the Genus database with same CATH homology
 4KOY A;  3R1K A;  4UBR A;  1IIC A;  3TOB A;  4XPK A;  4XPD B;  1S3Z A;  4KUA A;  4CAE A;  4CYQ A;  4PV6 A;  4AG9 A;  3TT2 A;  2DPS A;  2ZW5 A;  2FIW A;  5J8C A;  4C2X A;  3D8P A;  3SHP A;  1S7L A;  3VWD A;  1V0C A;  3G8W A;  3BJ7 A;  1YX0 A;  3DR8 A;  3S6K A;  1PU9 A;  1I12 A;  4UFX A;  1KUX A;  4KOU A;  3UY5 A;  4HNW B;  3T90 A;  4MFK A;  3R9F A;  2B4D B;  5HMN A;  5EC4 A;  4QVT A;  3A9L A;  1P0H A;  2R7H A;  2OB0 A;  4C7I A;  4UA3 A;  1ZO0 A;  5IV0 A;  2Q7B A;  3IGR A;  4CGL A;  3FB3 A;  4MFP A;  5C82 A;  1I21 A;  5F49 A;  1S7N A;  5IX3 A;  2ZW7 A;  1NSL A;  1QST A;  2DPT A;  4PK3 A;  1K4J A;  4R3K A;  1YGH A;  2P0W A;  4E0A A;  2Z0Z A;  3S6F A;  2H5M A;  4Q38 A;  2EVN A;  4B12 A;  4ZBG A;  4Q36 A;  2BSW A;  4A32 A;  2HV2 A;  1S7F A;  2WUU A;  2FT0 A;  3DSB A;  3F5B A;  5G22 A;  2Z3M A;  2QML A;  5AG4 A;  4QB9 A;  2OU2 A;  4R87 A;  1IYL A;  2GIV A;  2VBQ A;  4K30 A;  2VI7 A;  2ARH A;  2B58 A;  4NCZ A;  4UCM A;  3E0K A;  2KCW A;  4LUA A;  2ZPA A;  3RYO A;  2VZY A;  4CRY B;  4A2Z A;  3H5Z A;  3PGP A;  4H89 A;  4OLL A;  3TCV A;  4KVO E;  2VQY A;  2O28 A;  3CXQ A;  2PRB A;  4MI4 A;  2B3V A;  2Z3P A;  3D3S A;  4KS9 A;  1Q2C A;  4QBJ A;  4YRH A;  3SXO A;  4AVA A;  3K9U A;  4UFV A;  5AGE A;  4NF1 A;  1YVO A;  1MJA A;  5IB0 A;  1RXT A;  3CXP A;  2Z11 A;  3GYA A;  2B3U A;  4M3S A;  2AJ6 A;  3KKW A;  2OZH A;  2YNC A;  1M44 A;  4A30 A;  4M85 A;  2JLM A;  2K5T A;  3BJ8 A;  1Y7R A;  4UCN A;  4A95 A;  2FCK A;  2REE A;  4MFZ A;  2Z10 A;  1YRE A;  2ZW6 A;  4JLY A;  3W91 A;  3QAH A;  2ZXV A;  4R57 A;  2JDD A;  4JXR A;  1Z4E A;  2VEZ A;  3TO7 A;  4MFJ A;  1VHS A;  1J4J A;  1QSM A;  3IU2 A;  3BLN A;  4PSW A;  4NEX A;  4CAX A;  4KVX A;  4L89 A;  5F47 A;  3TTH A;  4JD6 A;  3P2F A;  1B6B A;  3DR6 A;  4B5P B;  4LX9 A;  5KTC A;  4B5O A;  1XIX A;  4F0Y A;  2X7B A;  4II9 A;  5C88 A;  3F8K A;  3JVN A;  2BUE A;  4CGM A;  4U9Y A;  1M4G A;  3FRM A;  4ZGY B;  4KLV A;  1B87 A;  4C68 A;  4IF5 A;  4GS4 A;  3GKR A;  4QUS A;  3JTK A;  3JUW A;  4FD7 A;  2NMT A;  4Y49 B;  1VKC A;  4YFJ A;  4ORF A;  2G3T A;  1YR0 A;  2VXK A;  5E96 A;  5AG6 A;  1UFH A;  2FSR A;  1SQH A;  4KSF A;  5I0C A;  4C7H A;  4KZT A;  5CNP A;  3TFY A;  2CNT A;  4H6U A;  4U9Z A;  5DWN A;  4E8O A;  4CGP A;  4EVY A;  4L8A A;  4NXY A;  1Q2Y A;  4X5K A;  4B5P A;  5KTA A;  1YK3 A;  2Z3K A;  3T9Y A;  3TO6 A;  2WPX A;  1CJW A;  4FD4 A;  4XPL A;  4A33 A;  3S6H A;  1N71 A;  3NE7 A;  3TE4 A;  1XF8 A;  3LOD A;  1Z9U A;  1LRZ A;  3PZJ A;  2CY2 A;  3R96 A;  1XE4 A;  2WSA A;  1QSR A;  1NMT A;  3WR7 A;  4AVB A;  1I1D A;  1QSO A;  3DDD A;  4H6Z A;  3W6X A;  5KTD A;  2FL4 A;  4I49 A;  5HH1 A;  4R3L A;  2R8V A;  1IID A;  4XNH C;  2PQ8 A;  5ISV A;  3OWC A;  4MJ8 A;  4CYO A;  5JPH A;  4MHD A;  1WK4 A;  1NE9 A;  4KOX A;  1IB1 E;  5F46 A;  5AG7 A;  2GE3 A;  2JDC A;  4OAD A;  3SXN A;  4E2A A;  1MJB A;  2FXF A;  2YGW A;  2OZG A;  4CGN A;  2JEV A;  1PUA A;  2Q04 A;  2YNE A;  4U5Y A;  4KUB A;  2GAN A;  5H84 A;  2WPW A;  5BWA B;  4RS2 A;  5F48 A;  4PK2 A;  3I9S A;  2CXA A;  2YND A;  4KOS A;  2PC1 A;  1KUY A;  4BBH A;  3FXT A;  3FIX A;  1RO5 A;  4MY3 A;  2ATR A;  2A4N A;  4XPD C;  2Q44 A;  3DNS A;  1XEB A;  1L0C A;  5G1Z A;  2CNS A;  1Q2D A;  4A31 A;  4HNY B;  2CNM A;  2FIA A;  2J8N A;  4HNX B;  2P6G A;  1GHE A;  4CRZ B;  4B13 A;  4F0X A;  2P6E A;  3EFA A;  4R9M A;  5A27 A;  4QC6 A;  3B8G A;  1ON0 A;  4CYN A;  2VZZ A;  4UFW A;  2HUZ A;  2G0B A;  4B14 A;  1YLE A;  2PSW A;  3F0A A;  4MY0 A;  2PR1 A;  1Y9W A;  5G21 A;  4PSX A;  3LD2 A;  3IU1 A;  1M1D A;  2B5G A;  2Z3L A;  3R95 A;  2EUI A;  4B10 A;  2J8R A;  3PP9 A;  1BOB A;  1S60 A;  2R1I A;  3H4Q A;  2QIR A;  2Y0M A;  3R9E A;  1S5K A;  1MK4 A;  4UWI A;  4Y49 C;  2HQY A;  1R57 A;  2BL1 A;  3EXN A;  3CXS A;  4KOT A;  4RI1 A;  5GCN A;  4KOV A;  2OH1 A;  1M4D A;  3FNC A;  3TOA A;  4JJX A;  1S7K A;  4ONU A;  2Z3N A;  1KZF A;  4HKF A;  3FYN A;  3EY5 A;  1BO4 A;  2D4P A;  2QEC A;  2FS5 A;  2PR8 A;  3W6S A;  2YNC C;  4IUS A;  4MFL A;  5H86 A;  4UCP A;  1Y9K A;  4KOR A;  1YVK A;  5AG5 A;  2BEI A;  1XMT A;  1QSN A;  1P4N A;  5A28 A;  4AVC A;  3GY9 A;  4KLW A;  3MGD A;  4CAF A;  4J3G A;  4JXQ A;  5JQ4 A;  2FE7 A;  3ZZI A;  2Z3O A;  5EBV A;  3QB8 A;  3C26 A;  1KUV A;  4FD6 A;  4YGO A;  2B4D A;  2Q4V A;  3D2M A;  2F5I A;  3G3S A;  2ZW4 A;  2AE6 A;  4KVM E;  4DNC A;  5FVJ A;  4FD5 A;  3TO9 A;  2IL4 A;  4CAW A;  1CM0 A;  4OAE A;  5J8F A;  1FY7 A;  4MBU A;  2Q4Y A;  3N7Z A;  4B11 A;  1M4I A;  4CAV A;  2REF A;  2B4B A;  2C27 A;  1U6M A;  3V8I A;  2I79 A;  3R9G A;  4CS0 B;  3D2P A;  3ZJ0 A;  1MJ9 A;  2RC4 A;  4AG7 A;  1IYK A;  5DWM A;  2G3A A;  2OZU A;  4XNH B;  1OZP A;  2Q0Y A;  2B5G B;  4MFQ A;  4AB7 A;  4CGO A;  3FBU A;  1WWZ A;  2P6F A;  2D4O A;  4C2Y A;  4JWP A;  2J8M A;  4UWJ A;  3EC4 A;  5G20 A;  4C2Z A;  4F6A A;  2DXQ A;  2I00 A;  3IWG A;  3P2H A;  4NSQ A;  3EO4 A;  3IWE A;  4KSA A;  3VWE A;  2R98 A;  1TIQ A;  3S6G A;  4KOW A;  3I3G A;  4BMH A;  2PDO A;  4CYP A;  1Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...