4CAFA

Plasmodium vivax n-myristoyltransferase in complex with a benzothiophene inhibitor (compound 34a)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
384
structure length
384
Chain Sequence
b'DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of High Affinity Inhibitors of Plasmodium Falciparum and Plasmodium Vivax N-Myristoyltransferases Directed by Ligand Efficiency Dependent Lipophilicity (Lelp).
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 117
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cafA00
5G20A 4A2ZA 4CGLA 5G1ZA 4CYPA 3H5ZA 4C68A 5AGEA 4C2ZA 4CGPA 4CYNA 4A32A 5A27A 4C2XA 4B14A 4UFVA 4UFWA 4UCNA 4C7IA 4B13A 5AG7A 4B12A 5G21A 2WUUA 4A95A 4CAEA 4UCMA 4C7HA 4CGMA 4A33A 3IWEA 4A31A 5AG5A 4CAFA 4CYQA 4UFXA 4CGOA 2YNDA 5A28A 4CGNA 4C2YA 5AG4A 3IU2A 5AG6A 5G22A 4B11A 4A30A 3IU1A 4BBHA 2YNEA 2WSAA 2YNCA 3JTKA 4B10A 4CYOA 2YNCC 4UCPA
chains in the Genus database with same CATH superfamily
4WJBA 1TKFA 1YW4A 2AFSA 2P0WA 2PJ5A 3VWDA 3QAYA 2OU2A 1HEEA 3D7GA 4XPDC 2F5IA 1QQ9A 2J8RA 3RAMA 2NYQA 2AFMA 4K3NA 4W9YA 1YMEA 3F8KA 4KLVA 5F48A 1IOFA 1ZLIA 3T9YA 3TO9A 4E8OA 2VI7A 3G3SA 3QNVA 4B13A 4C7IA 4MFKA 5BWAB 2DF5A 3BJ8A 4QUSA 4MY0A 3CXPA 4UIBA 3FBUA 3SXNA 3PEIA 4NGNA 2QECA 3B2YA 2ZXVA 4ZX9A 4I49A 3R95A 1QSOA 4Q7AA 3IIBA 4NGPA 4OC1A 3FIXA 4A30A 3B3WA 5EBVA 3BJ7A 4OC3A 3SHPA 2O4HA 3QB8A 1V0CA 1EE3P 3NH8A 2I00A 3D8PA 4KOVA 3H8EA 2FIWA 1MK4A 4KOYA 1B6BA 4LUAA 3TO7A 4A2ZA 1CX8A 3NA6A 2Z3NA 4F0XA 3H5ZA 2C6CA 2P6FA 4ZY1A 2BL1A 2HC9A 1LFWA 3B3TA 2FIAA 2XEIA 3KQXA 4IK2A 3T8WA 4B14A 4ZI6A 2D4OA 4R3LA 4JYWA 2WUUA 4P4DA 4EFDA 4HNWB 1P4NA 3W91A 4A31A 4CYQA 4R87A 1WK4A 2EUIA 4R57A 5ELYA 2J8NA 3RZAA 4M6IA 1IB1E 2AJ6A 2EO8A 4KSAA 2RC4A 5J8FA 3S6KA 3EY5A 3IU1A 4BBHA 3JTKA 1TKHA 2VQYA 2C27A 5LRKA 4P44A 4OAEA 3TCVA 1Y7EA 3D7HA 3PBEA 2PJ0A 4OC0A 2CY2A 2HUZA 3RNZA 3DR8A 3MRUA 3P2HA 4KOWA 1TF9A 3E0KA 3FEDA 4OIDA 5AGEA 1KUXA 3V7ZA 2Q43A 2GLFA 4NGMA 1M4LA 2KCWA 1A2ZA 5G21A 1GHEA 1BPMA 1NE9A 3D68A 3A9LA 4UCMA 2PJ9A 3SJFA 3RBUA 4M6GA 2REFA 3FJUA 3TFYA 1F57A 2PJ1A 4ONUA 1ZG9A 2I79A 3PB4X 3PFEA 5IB0A 2O28A 1CM0A 2ANPA 2EVNA 2B3UA 2YNCC 1KUYA 1VHOA 2CF4A 1XMBA 1VHSA 1TXRA 4MRIA 2OOTA 2Z3MA 3H8GA 4KOSA 2Y0MA 4FD5A 3BXMA 3IEHA 3H4QA 4AXVA 2EBJA 4ZX8A 3TTHA 1M44A 4MI4A 3NH5A 4UCNA 2J8MA 3PRTA 4KS9A 3VWEA 1WWZA 3CDXA 1YSJA 1YREA 4A33A 2P6GA 5JPHA 1YVOA 2OH1A 4WWVA 1YLEA 3WT4A 3I9SA 4B5PB 3KZWA 3LMSA 2WZNA 4B5PA 4P4IA 2ZEFA 5G22A 4O23A 4KSIA 2Q4YA 2Z3PA 3TX8A 4P6YA 4NEXA 4A32A 3B3CA 4L89A 4OC5A 4X3RA 4DUKA 3VH9A 2ODFA 4Q36A 4ZY0A 4UIAA 4FUUA 1XE4A 4H2KA 1ZG8A 3CXQA 4MCQA 1ARMA 2ABZA 3G8WA 3LWUA 4G1PA 2PIZA 2PVVA 1K4JA 4X5KA 5H86A 4CAWA 2XEJA 4OADA 2ZW4A 1XRYA 4FWUA 4Z65A 2GIVA 3I3GA 3LACA 1ZLHA 4KZTA 1DTDA 2IL4A 4B5OA 4CGMA 2ZW6A 3PZJA 2PR8A 3IFEA 4EWTA 2PJAA 3IWWA 4HPSA 3SXOA 1TF8A 1YK3A 1VKCA 4FD6A 1YGHA 3JVNA 5KTDA 1ARLA 1Z4EA 4X2TA 1Z8XA 5KTCA 1YR0A 1YW6A 4LX9A 4NCZA 4PXBA 2XEGA 3ZZIA 3W6SA 1M4DA 2Z11A 2VZYA 2Q51A 5CPAA 4IF5A 2WPWA 2ZEMA 3NE8A 4AVAA 1L0CA 2ZEOA 4UWIA 1PYTB 1HDQA 4R8FA 4XNHC 2GREA 4PQAA 4C68A 3B8GA 2JDCA 4OC2A 1ELLP 4CGPA 2B5GB 4P10A 4AG7A 4NFRA 2G3TA 2PDOA 1Q2DA 5K8PA 2O53A 3EFAA 4KOTA 4CS0B 8CPAA 4P4JA 4TWEA 4A38A 1GYTA 2BEIA 2XEFA 4QVTA 4EMEA 4ZGYB 4JZ0A 5LYFA 5DWNA 4R76A 1SQHA 2R7HA 2PJ8A 1CJWA 3IWEA 1BPNA 5CNPA 3B3VA 3VARA 3FEEA 4FD4A 5A28A 1S60A 4A39A 5AG6A 4TNUA 2BO9A 2PJ2A 2YNEA 2HB6A 4MHPA 2IJZA 4NSQA 2AE6A 2QYVA 2A4NA 4MBUA 4YRHA 3I1UA 1OBRA 4KOUA 4CGLA 1I1DA 5DWMA 3LD2A 1RTQA 4H89A 3NFZA 2BSWA 3IGRA 2AFOA 2IQ6A 1HDUA 2AFWA 2PR1A 4KUBA 5J1QA 1Z8LA 3FRMA 2REEA 1H8LA 3TO6A 3S6HA 2GFQA 3V38A 1CG2A 1XIXA 1Y7RA 4YWYA 1F2PA 1XF8A 4ORFA 3PP9A 4A37A 1CPSA 1S7LA 5AG5A 4HNYB 4CGOA 3WABA 4E2AA 1Z8TA 2C1CA 3FMCA 4QB9A 5HH1A 1XEBA 3D2PA 2JEWA 1S7KA 2DPTA 2Q4ZA 4R7MA 1Y0RA 2ATRA 4OC4A 1LAPA 2ZOFA 3QAHA 2ZW7A 4HNXB 4KORA 2H5MA 4MMOA 4NGQA 5JH9A 3IJ3A 4EVYA 1YX0A 2ARHA 4CPAA 1ELMP 4C2ZA 4OLLA 1Z9UA 1NSAA 1OZPA 2PSWA 1NMTA 1YQEA 2JEVA 2BUEA 5D8NA 5AG7A 4F0YA 4YFJA 2PJ6A 4NJRA 2PC1A 3FH4A 5THWA 1RXTA 2R1IA 2ZOGA 4F6AA 4NF1A 2YNDA 4JWPA 5GCNA 2PJ3A 5CBMA 2AFXA 1XJOA 3WC5A 4MHYA 1BLLE 2R8VA 1TIQA 2FVGA 3GIUA 4UCPA 2EK9A 4PK2A 4DNCA 5G20A 1JWQA 4XPDB 1IYKA 1CP7A 3D66A 1IY7A 3MGDA 4U5YA 5JQ4A 4P4FA 2FS5A 5IB9A 4UWJA 3KGQA 3KI9A 5EMIA 1I21A 4NGTA 4GXHA 4YU9A 2ZW5A 3PB7X 3WR7A 2Q7BA 4UFWA 3BLNA 3S6GA 3PBBA 1Z5RA 2FSRA 2PVWA 2ZEEA 4A95A 4F9UA 4JJXA 3DR6A 2BOAA 2F8HA 3B7IA 2Z3KA 1LANA 1R3NA 3EXNA 4UFXA 4AB7A 3GY9A 4BD9A 4YGOA 3D4UA 2JBKA 1Q7LA 1B87A 1N71A 5FVJA 5H84A 4MFPA 4P45A 2DXQA 4MXUA 1ZO0A 4MHZA 7CPAA 4QC6A 4CAXA 3ZJ0A 1P0HA 4II9A 5D29A 1QSNA 4OKOA 2F7VA 4MHNA 4IAVA 1KZFA 1QMUA 3SI0A 2QMLA 2Q4VA 4CAVA 2Z3OA 4NGSA 2CTBA 1MJAA 2PJBA 3BI0A 2VXKA 4K30A 4UEZA 3IWGA 2ZEDA 5I0CA 4LQ6A 1QSRA 2D4PA 2Q0YA 2JDDA 5C88A 3TC8A 4CAFA 3FB3A 4CRZB 5EC4A 1LRZA 2ZEPA 2YGWA 2DEAA 1XBUA 2ZPAA 4OMEA 1I12A 1S5KA 1S7NA 1TKJA 2Q44A 3GLJA 2GLJA 4Y49B 1S3ZA 3PB8X 5ISVA 3NH4A 4RN7A 3S6FA 3D7DA 2CNMA 3KL9A 3RO0A 3WC6A 1IU8A 4RI1A 4FD7A 4P4EA 3CPXA 2CNSA 2V77A 3PB6X 2ZEHA 2PRBA 1JQGA 2VL1A 3N7ZA 3S9MA 2B5GA 1X12A 4PXCA 3R9FA 1PCAA 3RYOA 4RUHA 4H6ZA 2VBQA 1UFHA 2Z10A 3K9TA 1M4GA 5C82A 2RFHA 2CIJA 4MCSA 2PRQA 4ONWA 4PK3A 1Z8WA 4E0AA 1BAVA 2PJCA 4IUSA 4ZBGA 3PGPA 5KTAA 4J3GA 2EK8A 1XOVA 2OZHA 3N5FA 1Z2LA 1Q2CA 2C6PA 2NMTA 2FT0A 5J8CA 2AFUA 4PXDA 1Y9WA 3K2KA 3F0AA 5DS0A 1YLOA 3JUWA 3B3SA 2K5TA 2CTCA 3EO4A 5HXDA 1CP6A 3F5BA 3ISXA 2QIRA 2GE3A 2JLMA 4AVBA 5IX3A 2Z0ZA 1AUGA 1AMPA 2GU2A 3BI1A 1M4IA 1FY7A 4B12A 1NSLA 4PSWA 4CAEA 1IICA 2PJ4A 2HV2A 3KHZA 1IOIA 3FVLA 4GM5A 4KSFA 1QSTA 3CXSA 4IHMA 4DYOA 4F9VA 1LOKA 4B11A 2CXAA 2ZENA 4MHDA 3IC1A 2V8DA 1MJ9A 1KWMA 2QVPA 2R98A 2J9AA 5F49A 4XPLA 3S9NA 3KKWA 4U9YA 1IYLA 1KUVA 5F47A 2B4DA 2B4DB 5LYIA 2FL4A 5G1ZA 1CBXA 4UBRA 3EC4A 3H8FA 2OZGA 3WC7A 1CPXA 5HVFA 1R57A 1R43A 2Q04A 3FXTA 3KR5A 4X8IA 4UEFA 2Z3LA 2AFZA 2PJ7A 5K8OA 4M3SA 2PE3A 1DE4C 1U6MA 1IIDA 3W6XA 1XMTA 3R9EA 2PIYA 2G3AA 4JLYA 1J4JA 3KR4A 3SI2A 2C6GA 2ZEGA 4C2YA 5AG4A 3D67A 4OP4A 5JGFA 4NXYA 5F09A 1M1DA 2PQ8A 2WSAA 3R1KA 4Y49C 1Y9KA 2B58A 3DGVA 3DDDA 1UWYA 3GKRA 1Q2YA 3T90A 2VZZA 3D2MA 4XNHB 3FX6A 2G0BA 4F8ZA 4P4BA 2B3VA 4MFLA 3ISZA 4MJ8A 4MCPA 4MCRA 4H6UA 4NGRA 2I3CA 3L2NA 3KHXA 4CYNA 4UA3A 1VGYA 1MJBA 4PV6A 4C2XA 4UFVA 5JM6A 3TT2A 4UF4A 3TOAA 3PB9X 3R96A 2WYRA 3FECA 3D3SA 3DLJA 4XPKA 4C7HA 2HQYA 2WPXA 3SI1A 4DJLA 3JRUA 1S7FA 4JXRA 4JD6A 2JBJA 3P2FA 3FYNA 5F46A 5K8MA 3SJXA 1BOBA 4M85A 4U9ZA 2FXFA 2P6EA 2FCKA 4AG9A 3GYAA 3UY5A 2QJ8A 3HUVA 4QBJA 2OB0A 1Z4RA 2V8VA 2NSMA 4GS4A 4BMHA 2BCOA 3FNCA 3IO1A 4CYPA 4FBEA 4OIWA 4UEEA 2EWBA 4BINA 5LRJA 4A94A 1RO5A 4R9MA 3SJEA 3V8IA 1BO4A 4MY3A 2PCUA 3KQZA 4JXQA 2V8HA 4NJQA 5HMNA 1PUAA 3LODA 3TOBA 1Y0YA 1FNOA 3OWCA 2G9DA 1ZG7A 2V8GA 4KVME 4Q38A 3SJGA 5HVHA 5E96A 4LQGA 4FAIA 4L8AA 4KVOE 2IMOA 4PXEA 4KLWA 5K8NA 3GUXA 4KVXA 2VEZA 3DSBA 3NE7A 4R3KA 4RS2A 5LRGA 5LYLA 1FT7A 1VIXA 6CPAA 3D7FA 3TE4A 3B35A 3FF3A 2Q7SA 3HLPA 2B4BA 4KUAA 4MFQA 3CT9A 4MFJA 5HVGA 2FE7A 4PSXA 2X7BA 4B6ZA 1F2OA 3DNSA 3S9LA 4ZYQA 4AVCA 2GANA 4M6HA 5A27A 1ON0A 2OR4A 1X10A 2ZELA 4PPZA 3GB0A 3PFOA 4R6TA 1IGBA 1YVKA 3K9UA 3CZXA 3KASA 1LAMA 1XFOA 3VATA 4MFZA 3CPAA 1PU9A 4HKFA 2OZUA 3C26A 1VHEA 1AYEA 5I4MA 5IV0A 3IU2A 1QSMA 2CNTA 4KOXA 4ZY2A 3R9GA 3BHXA 2YNCA 2DPSA 2RB7A 1LCPA 2POKA 3MN8A 4B10A 4CRYB 4CGNA 5LYDA 4CYOA
chains in the Genus database with same CATH topology
2P0WA 3VWDA 2OU2A 4XPDC 2F5IA 2J8RA 3F8KA 4KLVA 5F48A 3T9YA 3TO9A 4E8OA 2VI7A 3G3SA 4B13A 4C7IA 4MFKA 5BWAB 3BJ8A 4QUSA 4MY0A 3CXPA 3FBUA 3SXNA 2QECA 2ZXVA 4I49A 3R95A 1QSOA 3FIXA 4A30A 5EBVA 3BJ7A 3SHPA 3QB8A 1V0CA 2I00A 3D8PA 4KOVA 2FIWA 1MK4A 4KOYA 1B6BA 4LUAA 3TO7A 4A2ZA 2Z3NA 4F0XA 3H5ZA 2P6FA 2BL1A 2FIAA 4B14A 2D4OA 4R3LA 2WUUA 4HNWB 1P4NA 3W91A 4A31A 4CYQA 4R87A 1WK4A 2EUIA 4R57A 2J8NA 1IB1E 2AJ6A 4KSAA 2RC4A 5J8FA 3S6KA 3EY5A 3IU1A 4BBHA 3JTKA 2VQYA 2C27A 4OAEA 3TCVA 2CY2A 2HUZA 3DR8A 3P2HA 4KOWA 3E0KA 5AGEA 1KUXA 2KCWA 5G21A 1GHEA 1NE9A 4UCMA 3A9LA 2REFA 3TFYA 4ONUA 2I79A 5IB0A 2O28A 1CM0A 2EVNA 2B3UA 2YNCC 1KUYA 1VHSA 2Z3MA 4KOSA 2Y0MA 4FD5A 3H4QA 3TTHA 1M44A 4MI4A 4UCNA 2J8MA 4KS9A 3VWEA 1WWZA 1YREA 4A33A 2P6GA 5JPHA 1YVOA 2OH1A 1YLEA 4B5PB 3I9SA 4B5PA 5G22A 2Q4YA 2Z3PA 4NEXA 4A32A 4L89A 4Q36A 1XE4A 3CXQA 3G8WA 5H86A 4X5KA 1K4JA 4CAWA 4OADA 2ZW4A 2GIVA 3I3GA 4KZTA 2IL4A 4B5OA 4CGMA 2ZW6A 3PZJA 2PR8A 3SXOA 1YK3A 4FD6A 1VKCA 1YGHA 3JVNA 5KTDA 1Z4EA 5KTCA 1YR0A 4NCZA 4LX9A 3ZZIA 3W6SA 1M4DA 2Z11A 2VZYA 4IF5A 2WPWA 4AVAA 1L0CA 4UWIA 4XNHC 4C68A 3B8GA 2JDCA 4CGPA 2B5GB 4AG7A 2G3TA 2PDOA 1Q2DA 3EFAA 4KOTA 4CS0B 2BEIA 4ZGYB 4QVTA 5DWNA 1SQHA 2R7HA 1CJWA 3IWEA 5CNPA 4FD4A 5A28A 1S60A 5AG6A 2YNEA 4NSQA 2AE6A 2A4NA 4MBUA 4YRHA 4KOUA 4CGLA 1I1DA 5DWMA 3LD2A 4H89A 2BSWA 3IGRA 2PR1A 4KUBA 3FRMA 2REEA 3TO6A 3S6HA 1XIXA 1Y7RA 1XF8A 4ORFA 3PP9A 1S7LA 5AG5A 4HNYB 4CGOA 4E2AA 4QB9A 5HH1A 1XEBA 3D2PA 1S7KA 2DPTA 2ATRA 3QAHA 2ZW7A 4HNXB 4KORA 2H5MA 4EVYA 1YX0A 2ARHA 4C2ZA 4OLLA 1Z9UA 1OZPA 2PSWA 1NMTA 2JEVA 2BUEA 5AG7A 4F0YA 4YFJA 2PC1A 1RXTA 2R1IA 4F6AA 4NF1A 2YNDA 4JWPA 5GCNA 2R8VA 1TIQA 4UCPA 4DNCA 4PK2A 5G20A 4XPDB 1IYKA 5JQ4A 3MGDA 4U5YA 2FS5A 4UWJA 1I21A 2ZW5A 3WR7A 2Q7BA 4UFWA 3BLNA 3S6GA 2FSRA 4A95A 4JJXA 3DR6A 3EXNA 2Z3KA 4AB7A 4UFXA 3GY9A 4YGOA 1B87A 1N71A 5FVJA 5H84A 4MFPA 2DXQA 1ZO0A 4QC6A 4CAXA 3ZJ0A 1P0HA 4II9A 1QSNA 1KZFA 2QMLA 2Q4VA 4CAVA 2Z3OA 1MJAA 2VXKA 4K30A 3IWGA 5I0CA 1QSRA 2D4PA 2Q0YA 2JDDA 5C88A 4CAFA 3FB3A 4CRZB 5EC4A 1LRZA 2YGWA 2ZPAA 1I12A 1S5KA 1S7NA 2Q44A 4Y49B 1S3ZA 5ISVA 3S6FA 2CNMA 4RI1A 4FD7A 2CNSA 2PRBA 3N7ZA 2B5GA 3R9FA 3RYOA 4H6ZA 2VBQA 1UFHA 2Z10A 1M4GA 5C82A 4PK3A 4E0AA 4IUSA 4ZBGA 3PGPA 5KTAA 4J3GA 2OZHA 1Q2CA 2NMTA 2FT0A 5J8CA 1Y9WA 3F0AA 3JUWA 2K5TA 3EO4A 3F5BA 2QIRA 2GE3A 2JLMA 4AVBA 5IX3A 2Z0ZA 1M4IA 1FY7A 4B12A 1NSLA 4PSWA 4CAEA 1IICA 2HV2A 4KSFA 1QSTA 3CXSA 4B11A 2CXAA 4MHDA 1MJ9A 2R98A 5F49A 4XPLA 3KKWA 4U9YA 1IYLA 1KUVA 5F47A 2B4DA 2B4DB 2FL4A 5G1ZA 4UBRA 3EC4A 2OZGA 1R57A 2Q04A 3FXTA 2Z3LA 4M3SA 1U6MA 1IIDA 3W6XA 1XMTA 3R9EA 2G3AA 4JLYA 1J4JA 4C2YA 5AG4A 4NXYA 1M1DA 2PQ8A 2WSAA 3R1KA 4Y49C 1Y9KA 2B58A 3DDDA 3GKRA 1Q2YA 3T90A 2VZZA 3D2MA 4XNHB 2G0BA 2B3VA 4MFLA 4MJ8A 4H6UA 4CYNA 4UA3A 4PV6A 1MJBA 4C2XA 4UFVA 3TT2A 3TOAA 3R96A 4XPKA 3D3SA 4C7HA 2HQYA 2WPXA 1S7FA 4JXRA 4JD6A 3P2FA 3FYNA 5F46A 1BOBA 4M85A 4U9ZA 2FXFA 2P6EA 2FCKA 4AG9A 3GYAA 3UY5A 4QBJA 2OB0A 1Z4RA 4GS4A 4BMHA 3FNCA 4CYPA 1RO5A 4R9MA 3V8IA 1BO4A 4MY3A 4JXQA 5HMNA 1PUAA 3LODA 3TOBA 3OWCA 4KVME 4Q38A 5E96A 4L8AA 4KVOE 4KLWA 4KVXA 4R3KA 2VEZA 3DSBA 3NE7A 4RS2A 3TE4A 2B4BA 4KUAA 4MFQA 4MFJA 2FE7A 4PSXA 2X7BA 3DNSA 4AVCA 2GANA 5A27A 1ON0A 1YVKA 3K9UA 4MFZA 1PU9A 4HKFA 2OZUA 3C26A 5IV0A 3IU2A 1QSMA 2CNTA 4KOXA 3R9GA 2YNCA 2DPSA 4B10A 4CRYB 4CYOA 4CGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G20 A;  4A2Z A;  4CGL A;  5G1Z A;  4CYP A;  3H5Z A;  4C68 A;  5AGE A;  4C2Z A;  4CGP A;  4CYN A;  4A32 A;  5A27 A;  4C2X A;  4B14 A;  4UFV A;  4UFW A;  4UCN A;  4C7I A;  4B13 A;  5AG7 A;  4B12 A;  5G21 A;  2WUU A;  4A95 A;  4CAE A;  4UCM A;  4C7H A;  4CGM A;  4A33 A;  3IWE A;  4A31 A;  5AG5 A;  4CAF A;  4CYQ A;  4UFX A;  4CGO A;  2YND A;  5A28 A;  4CGN A;  4C2Y A;  5AG4 A;  3IU2 A;  5AG6 A;  5G22 A;  4B11 A;  4A30 A;  3IU1 A;  4BBH A;  2YNE A;  2WSA A;  2YNC A;  3JTK A;  4B10 A;  4CYO A;  2YNC C;  4UCP A; 
#chains in the Genus database with same CATH topology
 4WJB A;  1TKF A;  1YW4 A;  2AFS A;  2P0W A;  2PJ5 A;  3VWD A;  3QAY A;  2OU2 A;  1HEE A;  3D7G A;  4XPD C;  2F5I A;  1QQ9 A;  2J8R A;  3RAM A;  2NYQ A;  2AFM A;  4K3N A;  4W9Y A;  1YME A;  3F8K A;  4KLV A;  5F48 A;  1IOF A;  1ZLI A;  3T9Y A;  3TO9 A;  4E8O A;  2VI7 A;  3G3S A;  3QNV A;  4B13 A;  4C7I A;  4MFK A;  5BWA B;  2DF5 A;  3BJ8 A;  4QUS A;  4MY0 A;  3CXP A;  4UIB A;  3FBU A;  3SXN A;  3PEI A;  4NGN A;  2QEC A;  3B2Y A;  2ZXV A;  4ZX9 A;  4I49 A;  3R95 A;  1QSO A;  4Q7A A;  3IIB A;  4NGP A;  4OC1 A;  3FIX A;  4A30 A;  3B3W A;  5EBV A;  3BJ7 A;  4OC3 A;  3SHP A;  2O4H A;  3QB8 A;  1V0C A;  1EE3 P;  3NH8 A;  2I00 A;  3D8P A;  4KOV A;  3H8E A;  2FIW A;  1MK4 A;  4KOY A;  1B6B A;  4LUA A;  3TO7 A;  4A2Z A;  1CX8 A;  3NA6 A;  2Z3N A;  4F0X A;  3H5Z A;  2C6C A;  2P6F A;  4ZY1 A;  2BL1 A;  2HC9 A;  1LFW A;  3B3T A;  2FIA A;  2XEI A;  3KQX A;  4IK2 A;  3T8W A;  4B14 A;  4ZI6 A;  2D4O A;  4R3L A;  4JYW A;  2WUU A;  4P4D A;  4EFD A;  4HNW B;  1P4N A;  3W91 A;  4A31 A;  4CYQ A;  4R87 A;  1WK4 A;  2EUI A;  4R57 A;  5ELY A;  2J8N A;  3RZA A;  4M6I A;  1IB1 E;  2AJ6 A;  2EO8 A;  4KSA A;  2RC4 A;  5J8F A;  3S6K A;  3EY5 A;  3IU1 A;  4BBH A;  3JTK A;  1TKH A;  2VQY A;  2C27 A;  5LRK A;  4P44 A;  4OAE A;  3TCV A;  1Y7E A;  3D7H A;  3PBE A;  2PJ0 A;  4OC0 A;  2CY2 A;  2HUZ A;  3RNZ A;  3DR8 A;  3MRU A;  3P2H A;  4KOW A;  1TF9 A;  3E0K A;  3FED A;  4OID A;  5AGE A;  1KUX A;  3V7Z A;  2Q43 A;  2GLF A;  4NGM A;  1M4L A;  2KCW A;  1A2Z A;  5G21 A;  1GHE A;  1BPM A;  1NE9 A;  3D68 A;  3A9L A;  4UCM A;  2PJ9 A;  3SJF A;  3RBU A;  4M6G A;  2REF A;  3FJU A;  3TFY A;  1F57 A;  2PJ1 A;  4ONU A;  1ZG9 A;  2I79 A;  3PB4 X;  3PFE A;  5IB0 A;  2O28 A;  1CM0 A;  2ANP A;  2EVN A;  2B3U A;  2YNC C;  1KUY A;  1VHO A;  2CF4 A;  1XMB A;  1VHS A;  1TXR A;  4MRI A;  2OOT A;  2Z3M A;  3H8G A;  4KOS A;  2Y0M A;  4FD5 A;  3BXM A;  3IEH A;  3H4Q A;  4AXV A;  2EBJ A;  4ZX8 A;  3TTH A;  1M44 A;  4MI4 A;  3NH5 A;  4UCN A;  2J8M A;  3PRT A;  4KS9 A;  3VWE A;  1WWZ A;  3CDX A;  1YSJ A;  1YRE A;  4A33 A;  2P6G A;  5JPH A;  1YVO A;  2OH1 A;  4WWV A;  1YLE A;  3WT4 A;  3I9S A;  4B5P B;  3KZW A;  3LMS A;  2WZN A;  4B5P A;  4P4I A;  2ZEF A;  5G22 A;  4O23 A;  4KSI A;  2Q4Y A;  2Z3P A;  3TX8 A;  4P6Y A;  4NEX A;  4A32 A;  3B3C A;  4L89 A;  4OC5 A;  4X3R A;  4DUK A;  3VH9 A;  2ODF A;  4Q36 A;  4ZY0 A;  4UIA A;  4FUU A;  1XE4 A;  4H2K A;  1ZG8 A;  3CXQ A;  4MCQ A;  1ARM A;  2ABZ A;  3G8W A;  3LWU A;  4G1P A;  2PIZ A;  2PVV A;  1K4J A;  4X5K A;  5H86 A;  4CAW A;  2XEJ A;  4OAD A;  2ZW4 A;  1XRY A;  4FWU A;  4Z65 A;  2GIV A;  3I3G A;  3LAC A;  1ZLH A;  4KZT A;  1DTD A;  2IL4 A;  4B5O A;  4CGM A;  2ZW6 A;  3PZJ A;  2PR8 A;  3IFE A;  4EWT A;  2PJA A;  3IWW A;  4HPS A;  3SXO A;  1TF8 A;  1YK3 A;  1VKC A;  4FD6 A;  1YGH A;  3JVN A;  5KTD A;  1ARL A;  1Z4E A;  4X2T A;  1Z8X A;  5KTC A;  1YR0 A;  1YW6 A;  4LX9 A;  4NCZ A;  4PXB A;  2XEG A;  3ZZI A;  3W6S A;  1M4D A;  2Z11 A;  2VZY A;  2Q51 A;  5CPA A;  4IF5 A;  2WPW A;  2ZEM A;  3NE8 A;  4AVA A;  1L0C A;  2ZEO A;  4UWI A;  1PYT B;  1HDQ A;  4R8F A;  4XNH C;  2GRE A;  4PQA A;  4C68 A;  3B8G A;  2JDC A;  4OC2 A;  1ELL P;  4CGP A;  2B5G B;  4P10 A;  4AG7 A;  4NFR A;  2G3T A;  2PDO A;  1Q2D A;  5K8P A;  2O53 A;  3EFA A;  4KOT A;  4CS0 B;  8CPA A;  4P4J A;  4TWE A;  4A38 A;  1GYT A;  2BEI A;  2XEF A;  4QVT A;  4EME A;  4ZGY B;  4JZ0 A;  5LYF A;  5DWN A;  4R76 A;  1SQH A;  2R7H A;  2PJ8 A;  1CJW A;  3IWE A;  1BPN A;  5CNP A;  3B3V A;  3VAR A;  3FEE A;  4FD4 A;  5A28 A;  1S60 A;  4A39 A;  5AG6 A;  4TNU A;  2BO9 A;  2PJ2 A;  2YNE A;  2HB6 A;  4MHP A;  2IJZ A;  4NSQ A;  2AE6 A;  2QYV A;  2A4N A;  4MBU A;  4YRH A;  3I1U A;  1OBR A;  4KOU A;  4CGL A;  1I1D A;  5DWM A;  3LD2 A;  1RTQ A;  4H89 A;  3NFZ A;  2BSW A;  3IGR A;  2AFO A;  2IQ6 A;  1HDU A;  2AFW A;  2PR1 A;  4KUB A;  5J1Q A;  1Z8L A;  3FRM A;  2REE A;  1H8L A;  3TO6 A;  3S6H A;  2GFQ A;  3V38 A;  1CG2 A;  1XIX A;  1Y7R A;  4YWY A;  1F2P A;  1XF8 A;  4ORF A;  3PP9 A;  4A37 A;  1CPS A;  1S7L A;  5AG5 A;  4HNY B;  4CGO A;  3WAB A;  4E2A A;  1Z8T A;  2C1C A;  3FMC A;  4QB9 A;  5HH1 A;  1XEB A;  3D2P A;  2JEW A;  1S7K A;  2DPT A;  2Q4Z A;  4R7M A;  1Y0R A;  2ATR A;  4OC4 A;  1LAP A;  2ZOF A;  3QAH A;  2ZW7 A;  4HNX B;  4KOR A;  2H5M A;  4MMO A;  4NGQ A;  5JH9 A;  3IJ3 A;  4EVY A;  1YX0 A;  2ARH A;  4CPA A;  1ELM P;  4C2Z A;  4OLL A;  1Z9U A;  1NSA A;  1OZP A;  2PSW A;  1NMT A;  1YQE A;  2JEV A;  2BUE A;  5D8N A;  5AG7 A;  4F0Y A;  4YFJ A;  2PJ6 A;  4NJR A;  2PC1 A;  3FH4 A;  5THW A;  1RXT A;  2R1I A;  2ZOG A;  4F6A A;  4NF1 A;  2YND A;  4JWP A;  5GCN A;  2PJ3 A;  5CBM A;  2AFX A;  1XJO A;  3WC5 A;  4MHY A;  1BLL E;  2R8V A;  1TIQ A;  2FVG A;  3GIU A;  4UCP A;  2EK9 A;  4PK2 A;  4DNC A;  5G20 A;  1JWQ A;  4XPD B;  1IYK A;  1CP7 A;  3D66 A;  1IY7 A;  3MGD A;  4U5Y A;  5JQ4 A;  4P4F A;  2FS5 A;  5IB9 A;  4UWJ A;  3KGQ A;  3KI9 A;  5EMI A;  1I21 A;  4NGT A;  4GXH A;  4YU9 A;  2ZW5 A;  3PB7 X;  3WR7 A;  2Q7B A;  4UFW A;  3BLN A;  3S6G A;  3PBB A;  1Z5R A;  2FSR A;  2PVW A;  2ZEE A;  4A95 A;  4F9U A;  4JJX A;  3DR6 A;  2BOA A;  2F8H A;  3B7I A;  2Z3K A;  1LAN A;  1R3N A;  3EXN A;  4UFX A;  4AB7 A;  3GY9 A;  4BD9 A;  4YGO A;  3D4U A;  2JBK A;  1Q7L A;  1B87 A;  1N71 A;  5FVJ A;  5H84 A;  4MFP A;  4P45 A;  2DXQ A;  4MXU A;  1ZO0 A;  4MHZ A;  7CPA A;  4QC6 A;  4CAX A;  3ZJ0 A;  1P0H A;  4II9 A;  5D29 A;  1QSN A;  4OKO A;  2F7V A;  4MHN A;  4IAV A;  1KZF A;  1QMU A;  3SI0 A;  2QML A;  2Q4V A;  4CAV A;  2Z3O A;  4NGS A;  2CTB A;  1MJA A;  2PJB A;  3BI0 A;  2VXK A;  4K30 A;  4UEZ A;  3IWG A;  2ZED A;  5I0C A;  4LQ6 A;  1QSR A;  2D4P A;  2Q0Y A;  2JDD A;  5C88 A;  3TC8 A;  4CAF A;  3FB3 A;  4CRZ B;  5EC4 A;  1LRZ A;  2ZEP A;  2YGW A;  2DEA A;  1XBU A;  2ZPA A;  4OME A;  1I12 A;  1S5K A;  1S7N A;  1TKJ A;  2Q44 A;  3GLJ A;  2GLJ A;  4Y49 B;  1S3Z A;  3PB8 X;  5ISV A;  3NH4 A;  4RN7 A;  3S6F A;  3D7D A;  2CNM A;  3KL9 A;  3RO0 A;  3WC6 A;  1IU8 A;  4RI1 A;  4FD7 A;  4P4E A;  3CPX A;  2CNS A;  2V77 A;  3PB6 X;  2ZEH A;  2PRB A;  1JQG A;  2VL1 A;  3N7Z A;  3S9M A;  2B5G A;  1X12 A;  4PXC A;  3R9F A;  1PCA A;  3RYO A;  4RUH A;  4H6Z A;  2VBQ A;  1UFH A;  2Z10 A;  3K9T A;  1M4G A;  5C82 A;  2RFH A;  2CIJ A;  4MCS A;  2PRQ A;  4ONW A;  4PK3 A;  1Z8W A;  4E0A A;  1BAV A;  2PJC A;  4IUS A;  4ZBG A;  3PGP A;  5KTA A;  4J3G A;  2EK8 A;  1XOV A;  2OZH A;  3N5F A;  1Z2L A;  1Q2C A;  2C6P A;  2NMT A;  2FT0 A;  5J8C A;  2AFU A;  4PXD A;  1Y9W A;  3K2K A;  3F0A A;  5DS0 A;  1YLO A;  3JUW A;  3B3S A;  2K5T A;  2CTC A;  3EO4 A;  5HXD A;  1CP6 A;  3F5B A;  3ISX A;  2QIR A;  2GE3 A;  2JLM A;  4AVB A;  5IX3 A;  2Z0Z A;  1AUG A;  1AMP A;  2GU2 A;  3BI1 A;  1M4I A;  1FY7 A;  4B12 A;  1NSL A;  4PSW A;  4CAE A;  1IIC A;  2PJ4 A;  2HV2 A;  3KHZ A;  1IOI A;  3FVL A;  4GM5 A;  4KSF A;  1QST A;  3CXS A;  4IHM A;  4DYO A;  4F9V A;  1LOK A;  4B11 A;  2CXA A;  2ZEN A;  4MHD A;  3IC1 A;  2V8D A;  1MJ9 A;  1KWM A;  2QVP A;  2R98 A;  2J9A A;  5F49 A;  4XPL A;  3S9N A;  3KKW A;  4U9Y A;  1IYL A;  1KUV A;  5F47 A;  2B4D A;  2B4D B;  5LYI A;  2FL4 A;  5G1Z A;  1CBX A;  4UBR A;  3EC4 A;  3H8F A;  2OZG A;  3WC7 A;  1CPX A;  5HVF A;  1R57 A;  1R43 A;  2Q04 A;  3FXT A;  3KR5 A;  4X8I A;  4UEF A;  2Z3L A;  2AFZ A;  2PJ7 A;  5K8O A;  4M3S A;  2PE3 A;  1DE4 C;  1U6M A;  1IID A;  3W6X A;  1XMT A;  3R9E A;  2PIY A;  2G3A A;  4JLY A;  1J4J A;  3KR4 A;  3SI2 A;  2C6G A;  2ZEG A;  4C2Y A;  5AG4 A;  3D67 A;  4OP4 A;  5JGF A;  4NXY A;  5F09 A;  1M1D A;  2PQ8 A;  2WSA A;  3R1K A;  4Y49 C;  1Y9K A;  2B58 A;  3DGV A;  3DDD A;  1UWY A;  3GKR A;  1Q2Y A;  3T90 A;  2VZZ A;  3D2M A;  4XNH B;  3FX6 A;  2G0B A;  4F8Z A;  4P4B A;  2B3V A;  4MFL A;  3ISZ A;  4MJ8 A;  4MCP A;  4MCR A;  4H6U A;  4NGR A;  2I3C A;  3L2N A;  3KHX A;  4CYN A;  4UA3 A;  1VGY A;  1MJB A;  4PV6 A;  4C2X A;  4UFV A;  5JM6 A;  3TT2 A;  4UF4 A;  3TOA A;  3PB9 X;  3R96 A;  2WYR A;  3FEC A;  3D3S A;  3DLJ A;  4XPK A;  4C7H A;  2HQY A;  2WPX A;  3SI1 A;  4DJL A;  3JRU A;  1S7F A;  4JXR A;  4JD6 A;  2JBJ A;  3P2F A;  3FYN A;  5F46 A;  5K8M A;  3SJX A;  1BOB A;  4M85 A;  4U9Z A;  2FXF A;  2P6E A;  2FCK A;  4AG9 A;  3GYA A;  3UY5 A;  2QJ8 A;  3HUV A;  4QBJ A;  2OB0 A;  1Z4R A;  2V8V A;  2NSM A;  4GS4 A;  4BMH A;  2BCO A;  3FNC A;  3IO1 A;  4CYP A;  4FBE A;  4OIW A;  4UEE A;  2EWB A;  4BIN A;  5LRJ A;  4A94 A;  1RO5 A;  4R9M A;  3SJE A;  3V8I A;  1BO4 A;  4MY3 A;  2PCU A;  3KQZ A;  4JXQ A;  2V8H A;  4NJQ A;  5HMN A;  1PUA A;  3LOD A;  3TOB A;  1Y0Y A;  1FNO A;  3OWC A;  2G9D A;  1ZG7 A;  2V8G A;  4KVM E;  4Q38 A;  3SJG A;  5HVH A;  5E96 A;  4LQG A;  4FAI A;  4L8A A;  4KVO E;  2IMO A;  4PXE A;  4KLW A;  5K8N A;  3GUX A;  4KVX A;  2VEZ A;  3DSB A;  3NE7 A;  4R3K A;  4RS2 A;  5LRG A;  5LYL A;  1FT7 A;  1VIX A;  6CPA A;  3D7F A;  3TE4 A;  3B35 A;  3FF3 A;  2Q7S A;  3HLP A;  2B4B A;  4KUA A;  4MFQ A;  3CT9 A;  4MFJ A;  5HVG A;  2FE7 A;  4PSX A;  2X7B A;  4B6Z A;  1F2O A;  3DNS A;  3S9L A;  4ZYQ A;  4AVC A;  2GAN A;  4M6H A;  5A27 A;  1ON0 A;  2OR4 A;  1X10 A;  2ZEL A;  4PPZ A;  3GB0 A;  3PFO A;  4R6T A;  1IGB A;  1YVK A;  3K9U A;  3CZX A;  3KAS A;  1LAM A;  1XFO A;  3VAT A;  4MFZ A;  3CPA A;  1PU9 A;  4HKF A;  2OZU A;  3C26 A;  1VHE A;  1AYE A;  5I4M A;  5IV0 A;  3IU2 A;  1QSM A;  2CNT A;  4KOX A;  4ZY2 A;  3R9G A;  3BHX A;  2YNC A;  2DPS A;  2RB7 A;  1LCP A;  2POK A;  3MN8 A;  4B10 A;  4CRY B;  4CGN A;  5LYD A;  4CYO A; 
#chains in the Genus database with same CATH homology
 2P0W A;  3VWD A;  2OU2 A;  4XPD C;  2F5I A;  2J8R A;  3F8K A;  4KLV A;  5F48 A;  3T9Y A;  3TO9 A;  4E8O A;  2VI7 A;  3G3S A;  4B13 A;  4C7I A;  4MFK A;  5BWA B;  3BJ8 A;  4QUS A;  4MY0 A;  3CXP A;  3FBU A;  3SXN A;  2QEC A;  2ZXV A;  4I49 A;  3R95 A;  1QSO A;  3FIX A;  4A30 A;  5EBV A;  3BJ7 A;  3SHP A;  3QB8 A;  1V0C A;  2I00 A;  3D8P A;  4KOV A;  2FIW A;  1MK4 A;  4KOY A;  1B6B A;  4LUA A;  3TO7 A;  4A2Z A;  2Z3N A;  4F0X A;  3H5Z A;  2P6F A;  2BL1 A;  2FIA A;  4B14 A;  2D4O A;  4R3L A;  2WUU A;  4HNW B;  1P4N A;  3W91 A;  4A31 A;  4CYQ A;  4R87 A;  1WK4 A;  2EUI A;  4R57 A;  2J8N A;  1IB1 E;  2AJ6 A;  4KSA A;  2RC4 A;  5J8F A;  3S6K A;  3EY5 A;  3IU1 A;  4BBH A;  3JTK A;  2VQY A;  2C27 A;  4OAE A;  3TCV A;  2CY2 A;  2HUZ A;  3DR8 A;  3P2H A;  4KOW A;  3E0K A;  5AGE A;  1KUX A;  2KCW A;  5G21 A;  1GHE A;  1NE9 A;  4UCM A;  3A9L A;  2REF A;  3TFY A;  4ONU A;  2I79 A;  5IB0 A;  2O28 A;  1CM0 A;  2EVN A;  2B3U A;  2YNC C;  1KUY A;  1VHS A;  2Z3M A;  4KOS A;  2Y0M A;  4FD5 A;  3H4Q A;  3TTH A;  1M44 A;  4MI4 A;  4UCN A;  2J8M A;  4KS9 A;  3VWE A;  1WWZ A;  1YRE A;  4A33 A;  2P6G A;  5JPH A;  1YVO A;  2OH1 A;  1YLE A;  4B5P B;  3I9S A;  4B5P A;  5G22 A;  2Q4Y A;  2Z3P A;  4NEX A;  4A32 A;  4L89 A;  4Q36 A;  1XE4 A;  3CXQ A;  3G8W A;  5H86 A;  4X5K A;  1K4J A;  4CAW A;  4OAD A;  2ZW4 A;  2GIV A;  3I3G A;  4KZT A;  2IL4 A;  4B5O A;  4CGM A;  2ZW6 A;  3PZJ A;  2PR8 A;  3SXO A;  1YK3 A;  4FD6 A;  1VKC A;  1YGH A;  3JVN A;  5KTD A;  1Z4E A;  5KTC A;  1YR0 A;  4NCZ A;  4LX9 A;  3ZZI A;  3W6S A;  1M4D A;  2Z11 A;  2VZY A;  4IF5 A;  2WPW A;  4AVA A;  1L0C A;  4UWI A;  4XNH C;  4C68 A;  3B8G A;  2JDC A;  4CGP A;  2B5G B;  4AG7 A;  2G3T A;  2PDO A;  1Q2D A;  3EFA A;  4KOT A;  4CS0 B;  2BEI A;  4ZGY B;  4QVT A;  5DWN A;  1SQH A;  2R7H A;  1CJW A;  3IWE A;  5CNP A;  4FD4 A;  5A28 A;  1S60 A;  5AG6 A;  2YNE A;  4NSQ A;  2AE6 A;  2A4N A;  4MBU A;  4YRH A;  4KOU A;  4CGL A;  1I1D A;  5DWM A;  3LD2 A;  4H89 A;  2BSW A;  3IGR A;  2PR1 A;  4KUB A;  3FRM A;  2REE A;  3TO6 A;  3S6H A;  1XIX A;  1Y7R A;  1XF8 A;  4ORF A;  3PP9 A;  1S7L A;  5AG5 A;  4HNY B;  4CGO A;  4E2A A;  4QB9 A;  5HH1 A;  1XEB A;  3D2P A;  1S7K A;  2DPT A;  2ATR A;  3QAH A;  2ZW7 A;  4HNX B;  4KOR A;  2H5M A;  4EVY A;  1YX0 A;  2ARH A;  4C2Z A;  4OLL A;  1Z9U A;  1OZP A;  2PSW A;  1NMT A;  2JEV A;  2BUE A;  5AG7 A;  4F0Y A;  4YFJ A;  2PC1 A;  1RXT A;  2R1I A;  4F6A A;  4NF1 A;  2YND A;  4JWP A;  5GCN A;  2R8V A;  1TIQ A;  4UCP A;  4DNC A;  4PK2 A;  5G20 A;  4XPD B;  1IYK A;  5JQ4 A;  3MGD A;  4U5Y A;  2FS5 A;  4UWJ A;  1I21 A;  2ZW5 A;  3WR7 A;  2Q7B A;  4UFW A;  3BLN A;  3S6G A;  2FSR A;  4A95 A;  4JJX A;  3DR6 A;  3EXN A;  2Z3K A;  4AB7 A;  4UFX A;  3GY9 A;  4YGO A;  1B87 A;  1N71 A;  5FVJ A;  5H84 A;  4MFP A;  2DXQ A;  1ZO0 A;  4QC6 A;  4CAX A;  3ZJ0 A;  1P0H A;  4II9 A;  1QSN A;  1KZF A;  2QML A;  2Q4V A;  4CAV A;  2Z3O A;  1MJA A;  2VXK A;  4K30 A;  3IWG A;  5I0C A;  1QSR A;  2D4P A;  2Q0Y A;  2JDD A;  5C88 A;  4CAF A;  3FB3 A;  4CRZ B;  5EC4 A;  1LRZ A;  2YGW A;  2ZPA A;  1I12 A;  1S5K A;  1S7N A;  2Q44 A;  4Y49 B;  1S3Z A;  5ISV A;  3S6F A;  2CNM A;  4RI1 A;  4FD7 A;  2CNS A;  2PRB A;  3N7Z A;  2B5G A;  3R9F A;  3RYO A;  4H6Z A;  2VBQ A;  1UFH A;  2Z10 A;  1M4G A;  5C82 A;  4PK3 A;  4E0A A;  4IUS A;  4ZBG A;  3PGP A;  5KTA A;  4J3G A;  2OZH A;  1Q2C A;  2NMT A;  2FT0 A;  5J8C A;  1Y9W A;  3F0A A;  3JUW A;  2K5T A;  3EO4 A;  3F5B A;  2QIR A;  2GE3 A;  2JLM A;  4AVB A;  5IX3 A;  2Z0Z A;  1M4I A;  1FY7 A;  4B12 A;  1NSL A;  4PSW A;  4CAE A;  1IIC A;  2HV2 A;  4KSF A;  1QST A;  3CXS A;  4B11 A;  2CXA A;  4MHD A;  1MJ9 A;  2R98 A;  5F49 A;  4XPL A;  3KKW A;  4U9Y A;  1IYL A;  1KUV A;  5F47 A;  2B4D A;  2B4D B;  2FL4 A;  5G1Z A;  4UBR A;  3EC4 A;  2OZG A;  1R57 A;  2Q04 A;  3FXT A;  2Z3L A;  4M3S A;  1U6M A;  1IID A;  3W6X A;  1XMT A;  3R9E A;  2G3A A;  4JLY A;  1J4J A;  4C2Y A;  5AG4 A;  4NXY A;  1M1D A;  2PQ8 A;  2WSA A;  3R1K A;  4Y49 C;  1Y9K A;  2B58 A;  3DDD A;  3GKR A;  1Q2Y A;  3T90 A;  2VZZ A;  3D2M A;  4XNH B;  2G0B A;  2B3V A;  4MFL A;  4MJ8 A;  4H6U A;  4CYN A;  4UA3 A;  4PV6 A;  1MJB A;  4C2X A;  4UFV A;  3TT2 A;  3TOA A;  3R96 A;  4XPK A;  3D3S A;  4C7H A;  2HQY A;  2WPX A;  1S7F A;  4JXR A;  4JD6 A;  3P2F A;  3FYN A;  5F46 A;  1BOB A;  4M85 A;  4U9Z A;  2FXF A;  2P6E A;  2FCK A;  4AG9 A;  3GYA A;  3UY5 A;  4QBJ A;  2OB0 A;  1Z4R A;  4GS4 A;  4BMH A;  3FNC A;  4CYP A;  1RO5 A;  4R9M A;  3V8I A;  1BO4 A;  4MY3 A;  4JXQ A;  5HMN A;  1PUA A;  3LOD A;  3TOB A;  3OWC A;  4KVM E;  4Q38 A;  5E96 A;  4L8A A;  4KVO E;  4KLW A;  4KVX A;  4R3K A;  2VEZ A;  3DSB A;  3NE7 A;  4RS2 A;  3TE4 A;  2B4B A;  4KUA A;  4MFQ A;  4MFJ A;  2FE7 A;  4PSX A;  2X7B A;  3DNS A;  4AVC A;  2GAN A;  5A27 A;  1ON0 A;  1YVK A;  3K9U A;  4MFZ A;  1PU9 A;  4HKF A;  2OZU A;  3C26 A;  5IV0 A;  3IU2 A;  1QSM A;  2CNT A;  4KOX A;  3R9G A;  2YNC A;  2DPS A;  4B10 A;  4CRY B;  4CYO A;  4CGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...