4CAFA

Plasmodium vivax n-myristoyltransferase in complex with a benzothiophene inhibitor (compound 34a)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of High Affinity Inhibitors of Plasmodium Falciparum and Plasmodium Vivax N-Myristoyltransferases Directed by Ligand Efficiency Dependent Lipophilicity (Lelp).
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 117
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cafA00
4B10A 5AG5A 5AGEA 4A33A 2YNDA 4B12A 5A28A 5A27A 5AG4A 4A2ZA 4A31A 4C2ZA 5G1ZA 4CAFA 4CGOA 2YNEA 4B13A 5G20A 4CGMA 2YNCC 4CYQA 4A95A 4UCMA 4C7HA 3IU2A 4CYNA 4CYPA 4C68A 2YNCA 4UFVA 4UCPA 4A30A 3JTKA 4C7IA 4CYOA 4CGLA 5AG7A 5G21A 4B14A 5G22A 4CGPA 4UCNA 3H5ZA 4C2YA 4BBHA 2WSAA 3IWEA 4C2XA 3IU1A 2WUUA 4UFWA 5AG6A 4B11A 4CGNA 4A32A 4UFXA 4CAEA
chains in the Genus database with same CATH superfamily
4OKOA 1B6BA 3GY9A 2DEAA 3SI0A 4JLYA 3T8WA 3S9LA 3ISZA 1Z8WA 3RYOA 4FD6A 3TOBA 1QSTA 1YW4A 3WT4A 4C2ZA 1Q2YA 1VHEA 3F8KA 3KL9A 1M4DA 1FT7A 1XRYA 4KLVA 2PSWA 4NGMA 3S6HA 3TC8A 2Q4VA 5LYFA 5LYLA 1R3NA 3NFZA 2D4OA 2ZEFA 2GIVA 3T90A 1NE9A 2OU2A 2VZZA 2ZW6A 1KUVA 1BPNA 1IICA 4JJXA 3B3SA 2PIZA 4ONUA 1X12A 1UFHA 4KOVA 3B8GA 1P4NA 4CGNA 4PSXA 3DR8A 2Z3PA 3CXSA 3E0KA 3R9FA 1QSOA 4JXRA 1AYEA 2XEJA 4A37A 2B3VA 4A33A 3H8FA 1IOFA 4KVME 3FX6A 3VARA 3RNZA 3CXQA 2ZW7A 4P4BA 2XEGA 4B5PA 1BO4A 2CNMA 3D4UA 4OC0A 2O53A 2ZOFA 4OADA 4KOUA 3S9NA 4FWUA 2B4DA 2PE3A 3CPAA 3D7GA 3GUXA 3CT9A 3IWGA 3PBBA 4UIBA 2B3UA 3LWUA 4B5PB 1Z8TA 3JTKA 3VH9A 4AG7A 3KR4A 1YSJA 4GS4A 1R57A 2PJ1A 4K30A 4B11A 4KSAA 4JD6A 1QSRA 2AFZA 3F5BA 2QECA 1HDQA 1ELMP 1CG2A 2DPTA 4JXQA 3SJGA 4CAEA 5F46A 3GYAA 1LCPA 1S7LA 5AGEA 4NSQA 4Q38A 2Q4ZA 2PJ7A 4M3SA 1VHOA 2CXAA 3PB8X 4A2ZA 2NSMA 4OAEA 4B6ZA 3D66A 3FF3A 1IYKA 2F7VA 2JDCA 2QJ8A 4BINA 2G3AA 1S7NA 2ODFA 2V8VA 1S7FA 2GANA 4MI4A 1Z4EA 5H86A 2REFA 4RN7A 4A30A 1ON0A 3PFEA 2B5GA 4CPAA 2P6FA 5G22A 1TIQA 1YLOA 1YR0A 2EK8A 2O4HA 3SJFA 4C2XA 1DTDA 1H8LA 2WUUA 4UFWA 5JGFA 2PVWA 4GM5A 4HKFA 4CAXA 1TF8A 4A32A 5J1QA 1M4GA 1JQGA 4H89A 4QC6A 1MK4A 3K9UA 5A27A 2ZEOA 3FMCA 3I1UA 4WWVA 4B5OA 4UF4A 2Z0ZA 3SXNA 1S60A 2P6EA 3KGQA 1Q7LA 2PJ2A 1NSLA 2ZENA 1TF9A 4CYQA 2J8RA 4E8OA 3D3SA 4E2AA 4G1PA 2WYRA 2I79A 2J9AA 5K8OA 2C1CA 1IIDA 3ISXA 2D4PA 2HUZA 3SJXA 3S9MA 2AJ6A 4CGLA 4XPDC 3EO4A 5AG7A 3TT2A 1Y9KA 4L8AA 4MHYA 1QSMA 1PUAA 4AVCA 3RBUA 1Z4RA 2P0WA 3SHPA 2VBQA 4MY0A 4BD9A 1GHEA 2KCWA 3FEEA 5F49A 1ARMA 3V38A 2Z3OA 4MCRA 4IHMA 2PJBA 2DXQA 2BSWA 5C82A 4FUUA 4UEFA 4QUSA 4CGMA 2EBJA 2JBKA 2PJAA 4OIWA 5E96A 5THWA 4CRYB 4UWIA 3G8WA 5DWNA 4MFJA 3L2NA 4OC5A 1KZFA 3DGVA 3LACA 1YW6A 1Q2DA 1Z8LA 2CTBA 1U6MA 2C6GA 2WZNA 4KVOE 4ONWA 1ARLA 2G0BA 1TKFA 2QMLA 3D7HA 3IJ3A 4MCQA 1RXTA 1IOIA 1ZLIA 2VXKA 2WSAA 5F09A 2Q04A 2ZW5A 4DUKA 4H6ZA 2I00A 4Y49B 5LRKA 2O28A 2OZUA 4R6TA 2OOTA 1Y9WA 3S6GA 2PR1A 4NFRA 5A28A 5LRGA 3NH5A 2Q44A 4P4FA 1XE4A 2XEFA 4XNHB 4KLWA 4ZI6A 4NF1A 4DYOA 1PU9A 4F6AA 3PFOA 3H8GA 3JRUA 4JZ0A 3D68A 4NGNA 4OC4A 2JEVA 4DNCA 5KTCA 2F5IA 4R9MA 5IB9A 2PJ4A 4PK3A 4BBHA 2CIJA 4MHZA 2ARHA 4XPLA 4KOYA 3VWDA 4PXEA 2Z3KA 4YFJA 4MBUA 5JPHA 2B4BA 2Q7BA 1LFWA 3W91A 3PBEA 1ELLP 2X7BA 3H5ZA 4UCNA 1XOVA 4YWYA 1AMPA 2HC9A 3BHXA 2VQYA 4NEXA 3DR6A 2PIYA 2Z11A 3D8PA 4ZX8A 1F57A 4KORA 4B10A 4E0AA 4U9YA 2YNDA 2AFSA 2Z10A 3VWEA 4Q36A 3PB9X 3DSBA 4J3GA 4KVXA 1SQHA 1XIXA 5HH1A 1F2OA 2Z3NA 1TKJA 2IL4A 3N5FA 4MCSA 4X2TA 1M4IA 2EK9A 3I9SA 2YNCA 4KOWA 4KS9A 3FIXA 5KTDA 3GIUA 3SJEA 2PRBA 3IC1A 4I49A 3BI1A 3GKRA 3R9GA 4CAVA 4F9VA 3KHZA 1VIXA 3HUVA 3V7ZA 5K8NA 2B4DB 4FAIA 1XMBA 1M4LA 3B3TA 4NJQA 1YX0A 1CBXA 2JEWA 4F0YA 5HVFA 1ZG8A 3W6SA 4KOTA 3JVNA 4PSWA 7CPAA 4R8FA 2ZPAA 4FBEA 5F48A 2PJ9A 1DE4C 3EY5A 4GXHA 2HV2A 4MFLA 1RO5A 4A39A 1P0HA 2P6GA 1XJOA 1QMUA 4UWJA 4U5YA 4P10A 4ZYQA 5IX3A 2PVVA 1ZLHA 1S3ZA 4CYPA 3HLPA 5DWMA 2GREA 4YGOA 3TOAA 4A94A 4UEEA 2EVNA 4WJBA 5K8MA 2CY2A 2BL1A 4F9UA 4OC1A 4R57A 3PRTA 1ZG7A 1YK3A 2FCKA 3BJ8A 4EMEA 4FD7A 2B5GB 3IGRA 1QQ9A 3H8EA 1WWZA 3RZAA 1GYTA 4YU9A 3D7FA 4MHPA 4CAFA 4PXCA 4OC3A 1I1DA 3D67A 3MN8A 3NE7A 3QAHA 3IEHA 4NGQA 4A95A 4CYNA 4HPSA 4EVYA 3PP9A 3B3WA 4ORFA 4NGTA 3FEDA 4C68A 2DF5A 4ZY1A 2JBJA 1CX8A 1VKCA 1BPMA 2CNTA 3CDXA 3F0AA 3FECA 3KKWA 4M6HA 3C26A 4CYOA 1S5KA 1IB1E 2EWBA 4QB9A 4AVAA 4EFDA 2AFOA 3FXTA 4NCZA 3TX8A 4MMOA 2Q43A 1JWQA 1X10A 1Y0RA 2POKA 2V8DA 3CZXA 2VEZA 3R1KA 3FRMA 3S6KA 3GB0A 5HVHA 5I4MA 4NJRA 2BUEA 4UBRA 1N71A 2CNSA 1BOBA 2Z3MA 2B58A 3PZJA 2ZXVA 3B2YA 4PPZA 1VGYA 1Y0YA 5J8CA 1Z9UA 3RAMA 3EXNA 4HNYB 3DNSA 1IY7A 4LUAA 5D29A 1YQEA 3W6XA 2IJZA 2ZOGA 4R7MA 4P45A 3BXMA 4AG9A 2JDDA 1ZO0A 4OIDA 8CPAA 3S6FA 3TO6A 4DJLA 2WPXA 1I21A 3G3SA 5ISVA 1IYLA 4CGPA 2PDOA 1F2PA 2AE6A 2Q0YA 5LRJA 2PC1A 3EFAA 4BMHA 3TO9A 4MCPA 5HXDA 2Q51A 1TKHA 4F8ZA 2ZEEA 4IK2A 4MFQA 1XEBA 4MY3A 2G9DA 5EBVA 4II9A 4AXVA 4MHDA 1FY7A 2BCOA 1CP6A 4ZX9A 3LODA 4KOSA 4R76A 5JH9A 3KZWA 2YNEA 3TCVA 1Y7RA 1AUGA 2OZHA 4NGRA 1XMTA 2K5TA 4L89A 3NH4A 3K9TA 2PJCA 3JUWA 2V8GA 3TE4A 3KR5A 3KQXA 4C7HA 5IV0A 3BLNA 3PEIA 5CNPA 4PV6A 3QAYA 2J8MA 1YGHA 2R1IA 4M85A 4R3LA 1Y7EA 2J8NA 2QIRA 1YMEA 2BEIA 3FYNA 4NGSA 4C7IA 2FS5A 2FVGA 4MJ8A 3DDDA 1CPSA 1LOKA 2GLJA 4JYWA 5AG6A 1Z8XA 3D2PA 3GLJA 1Z2LA 1J4JA 5FVJA 3QB8A 5F47A 1WK4A 2C27A 2PJ6A 3K2KA 2ZW4A 4LQ6A 2FL4A 4AB7A 5KTAA 2V8HA 1HDUA 1L0CA 4OP4A 2DPSA 2BOAA 1PCAA 3PGPA 2CF4A 1M1DA 3B7IA 4LX9A 2C6CA 2CTCA 4UA3A 2GE3A 2FE7A 4UCMA 4X3RA 4ZY2A 4QBJA 3NA6A 1K4JA 3IU2A 4MHNA 3TTHA 4ZGYB 2EO8A 3ZZIA 3CPXA 4P44A 3TFYA 4X8IA 4XPDB 4IUSA 3CXPA 3WABA 1LANA 2VZYA 1EE3P 4KSIA 4MXUA 5G21A 4Q7AA 4B14A 4R87A 4Z65A 3R9EA 3VATA 2F8HA 3FNCA 3SXOA 4QVTA 4EWTA 4P4IA 2RC4A 5ELYA 3IIBA 4A38A 2C6PA 5AG5A 3D7DA 3LMSA 3MGDA 4B12A 1YLEA 1XBUA 2AFMA 3FB3A 4ZBGA 4A31A 1IU8A 4P4JA 2EUIA 4AVBA 4CGOA 1R43A 2R7HA 2PJ0A 2IQ6A 4R3KA 3WC6A 5EC4A 1XF8A 4HNWB 4IAVA 2ZEPA 5EMIA 3FVLA 3R95A 2WPWA 3D2MA 1V0CA 4MFZA 4LQGA 3H4QA 2AFUA 5DS0A 3EC4A 4OC2A 3FBUA 3R96A 2Y0MA 5JM6A 4P6YA 2FIWA 2FSRA 4OMEA 5HVGA 1XFOA 5IB0A 4UFXA 1LRZA 1MJBA 3IO1A 4Y49C 2QYVA 2ZELA 1MJ9A 1HEEA 1QSNA 2ABZA 2VL1A 3TO7A 3FH4A 2PJ8A 5AG4A 4UEZA 6CPAA 5J8FA 4IF5A 5G1ZA 1S7KA 3NE8A 5LYIA 2AFWA 4XNHC 4X5KA 3QNVA 4NXYA 4FD4A 1NMTA 1UWYA 4P4DA 2QVPA 3I3GA 2RFHA 2R98A 3B3CA 5D8NA 5HMNA 3FJUA 4KOXA 2HB6A 3SI2A 2OH1A 1TXRA 3KQZA 3P2FA 2BO9A 2XEIA 3P2HA 4TWEA 1OZPA 4MFPA 2REEA 3DLJA 4C2YA 4PXDA 4CS0B 2ZEHA 2GLFA 3N7ZA 3WC7A 1LAMA 4CRZB 4RUHA 2HQYA 5K8PA 1YVKA 4H6UA 4M6IA 2ANPA 5JQ4A 2NYQA 2PR8A 1OBRA 2A4NA 4H2KA 1KUXA 3B3VA 4K3NA 2GU2A 4KUBA 4PQAA 1VHSA 1Q2CA 1RTQA 4OLLA 4CAWA 2Q4YA 3WR7A 3PB7X 2PJ3A 2V77A 4RI1A 2GFQA 2PRQA 5G20A 4KSFA 3B35A 2ATRA 2OB0A 3KHXA 2Q7SA 3A9LA 4TNUA 1KUYA 4YRHA 2FXFA 4UFVA 3SI1A 4RS2A 1IGBA 3IFEA 1CP7A 2PJ5A 4KZTA 1PYTB 2FIAA 3KASA 1YVOA 3LD2A 4M6GA 4PXBA 3IWEA 3MRUA 2OR4A 2RB7A 3IU1A 4NGPA 4UIAA 5LYDA 2ZEDA 4FD5A 1BAVA 4W9YA 2IMOA 3ZJ0A 1CJWA 2I3CA 2YNCC 1FNOA 1CM0A 4PK2A 3UY5A 2JLMA 3WC5A 1M44A 5C88A 4P4EA 5I0CA 3T9YA 3OWCA 2ZEGA 5BWAB 4HNXB 5CBMA 2G3TA 2OZGA 4B13A 1A2ZA 2FT0A 3NH8A 3PB6X 3IWWA 4F0XA 5H84A 2NMTA 1KWMA 2YGWA 1NSAA 5CPAA 1B87A 2ZEMA 4UCPA 3V8IA 2Z3LA 1ZG9A 2AFXA 1Z5RA 4O23A 4XPKA 4MRIA 3BJ7A 2PCUA 1LAPA 3BI0A 5GCNA 1BLLE 1YREA 2R8VA 4KUAA 4ZY0A 2PQ8A 1I12A 3KI9A 1MJAA 2H5MA 4U9ZA 2VI7A 4JWPA 3RO0A 3PB4X 1CPXA 4MFKA
chains in the Genus database with same CATH topology
1B6BA 3GY9A 4JLYA 3RYOA 3TOBA 4FD6A 1QSTA 4C2ZA 1Q2YA 3F8KA 4KLVA 1M4DA 3S6HA 2PSWA 2Q4VA 2D4OA 2GIVA 3T90A 1NE9A 2OU2A 2VZZA 2ZW6A 1KUVA 1IICA 4JJXA 4ONUA 1UFHA 4KOVA 3B8GA 1P4NA 4CGNA 4PSXA 3DR8A 2Z3PA 3CXSA 3E0KA 3R9FA 1QSOA 4JXRA 2B3VA 4A33A 4KVME 3CXQA 2ZW7A 4B5PA 1BO4A 2CNMA 4OADA 4KOUA 2B4DA 3IWGA 4B5PB 2B3UA 3JTKA 4AG7A 4GS4A 1R57A 4K30A 4B11A 4KSAA 4JD6A 1QSRA 3F5BA 2QECA 5F46A 2DPTA 4JXQA 4CAEA 3GYAA 1S7LA 5AGEA 4NSQA 4Q38A 4M3SA 2CXAA 4A2ZA 4OAEA 1IYKA 2JDCA 2G3AA 1S7NA 1S7FA 2GANA 4MI4A 1Z4EA 5H86A 2REFA 4A30A 1ON0A 2B5GA 2P6FA 5G22A 1TIQA 1YR0A 4C2XA 2WUUA 4UFWA 4HKFA 4CAXA 4A32A 1M4GA 4H89A 4QC6A 1MK4A 3K9UA 5A27A 4B5OA 3SXNA 2Z0ZA 1S60A 2P6EA 1NSLA 4CYQA 4E8OA 2J8RA 3D3SA 4E2AA 2I79A 1IIDA 2D4PA 2HUZA 2AJ6A 4CGLA 4XPDC 3EO4A 5AG7A 3TT2A 1Y9KA 4L8AA 1QSMA 1PUAA 4AVCA 1Z4RA 2P0WA 3SHPA 2VBQA 4MY0A 1GHEA 2KCWA 5F49A 2Z3OA 2DXQA 2BSWA 5C82A 4QUSA 4CGMA 4CRYB 5E96A 4UWIA 3G8WA 5DWNA 4MFJA 1KZFA 1Q2DA 1U6MA 4KVOE 2G0BA 2QMLA 1RXTA 2VXKA 2WSAA 2Q04A 2ZW5A 4H6ZA 2I00A 4Y49B 2O28A 2OZUA 1Y9WA 3S6GA 2PR1A 5A28A 2Q44A 1XE4A 4XNHB 4KLWA 4NF1A 1PU9A 4F6AA 2JEVA 4DNCA 5KTCA 2F5IA 4R9MA 4PK3A 4XPLA 2ARHA 4KOYA 3VWDA 4YFJA 2Z3KA 4MBUA 5JPHA 2B4BA 2Q7BA 3W91A 2X7BA 3H5ZA 4UCNA 4NEXA 2VQYA 3DR6A 2Z11A 3D8PA 4KORA 4B10A 4E0AA 4U9YA 2YNDA 2Z10A 3VWEA 4Q36A 3DSBA 4J3GA 4KVXA 1SQHA 1XIXA 5HH1A 2Z3NA 2IL4A 1M4IA 3I9SA 2YNCA 4KOWA 4KS9A 3FIXA 5KTDA 2PRBA 4I49A 3GKRA 4CAVA 3R9GA 2B4DB 1YX0A 4F0YA 3W6SA 4KOTA 3JVNA 4PSWA 2ZPAA 5F48A 3EY5A 2HV2A 4MFLA 1RO5A 1P0HA 2P6GA 4UWJA 4U5YA 5IX3A 1S3ZA 4CYPA 5DWMA 4YGOA 3TOAA 2EVNA 2CY2A 2BL1A 4R57A 3BJ8A 1YK3A 2FCKA 4FD7A 2B5GB 3IGRA 1WWZA 4CAFA 1I1DA 3NE7A 3QAHA 4A95A 4CYNA 4EVYA 3PP9A 4ORFA 4C68A 3F0AA 1VKCA 2CNTA 3KKWA 3C26A 4CYOA 1S5KA 1IB1E 4QB9A 4AVAA 3FXTA 4NCZA 3R1KA 3S6KA 2VEZA 3FRMA 2BUEA 4UBRA 1N71A 2CNSA 1BOBA 2Z3MA 2B58A 3PZJA 2ZXVA 5J8CA 1Z9UA 3EXNA 4HNYB 3DNSA 4LUAA 3W6XA 4AG9A 2JDDA 1ZO0A 3S6FA 3TO6A 2WPXA 1I21A 3G3SA 5ISVA 1IYLA 4CGPA 2PDOA 2AE6A 2Q0YA 2PC1A 3EFAA 4BMHA 3TO9A 4MFQA 1XEBA 4MY3A 5EBVA 4II9A 4MHDA 1FY7A 3LODA 4KOSA 2YNEA 3TCVA 1Y7RA 2OZHA 1XMTA 2K5TA 4L89A 3JUWA 3TE4A 4C7HA 5IV0A 3BLNA 5CNPA 4PV6A 2J8MA 1YGHA 2R1IA 4M85A 4R3LA 2J8NA 2QIRA 2BEIA 3FYNA 4C7IA 2FS5A 4MJ8A 3DDDA 5AG6A 3D2PA 5FVJA 1J4JA 3QB8A 5F47A 1WK4A 2C27A 4AB7A 2ZW4A 5KTAA 2FL4A 1L0CA 2DPSA 3PGPA 1M1DA 4LX9A 4UA3A 2GE3A 2FE7A 4UCMA 4QBJA 3TTHA 1K4JA 3IU2A 4ZGYB 3ZZIA 4XPDB 4IUSA 3CXPA 2VZYA 5G21A 4B14A 4R87A 3R9EA 3SXOA 3FNCA 4QVTA 2RC4A 5AG5A 3MGDA 4B12A 1YLEA 3FB3A 4ZBGA 4A31A 3TFYA 2EUIA 4AVBA 4CGOA 2R7HA 4R3KA 5EC4A 1XF8A 4HNWB 3R95A 2WPWA 3D2MA 1V0CA 4MFZA 3H4QA 3EC4A 3FBUA 3R96A 2Y0MA 2FIWA 2FSRA 5IB0A 4UFXA 1LRZA 1MJBA 4Y49C 1MJ9A 1QSNA 3TO7A 5J8FA 5AG4A 4IF5A 5G1ZA 1S7KA 4XNHC 4X5KA 4NXYA 4FD4A 1NMTA 3I3GA 5HMNA 2R98A 4KOXA 2OH1A 3P2FA 3P2HA 1OZPA 4MFPA 2REEA 4C2YA 4CS0B 3N7ZA 4CRZB 2HQYA 1YVKA 4H6UA 5JQ4A 2PR8A 2A4NA 4KUBA 1KUXA 4CAWA 1VHSA 1Q2CA 4OLLA 2Q4YA 3WR7A 4RI1A 5G20A 4KSFA 2ATRA 2OB0A 3A9LA 1KUYA 4YRHA 2FXFA 4UFVA 4RS2A 4KZTA 2FIAA 3LD2A 1YVOA 4BBHA 3IWEA 3IU1A 4FD5A 3ZJ0A 1CJWA 2YNCC 1CM0A 4PK2A 3UY5A 2JLMA 1M44A 5C88A 5I0CA 3T9YA 3OWCA 5BWAB 4HNXB 2G3TA 2OZGA 4B13A 2FT0A 4F0XA 5H84A 2NMTA 2YGWA 1B87A 4UCPA 3V8IA 2Z3LA 4XPKA 3BJ7A 5GCNA 1YREA 2R8VA 4KUAA 2PQ8A 1I12A 1MJAA 2H5MA 4U9ZA 2VI7A 4JWPA 4MFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B10 A;  5AG5 A;  5AGE A;  4A33 A;  2YND A;  4B12 A;  5A28 A;  5A27 A;  5AG4 A;  4A2Z A;  4A31 A;  4C2Z A;  5G1Z A;  4CAF A;  4CGO A;  2YNE A;  4B13 A;  5G20 A;  4CGM A;  2YNC C;  4CYQ A;  4A95 A;  4UCM A;  4C7H A;  3IU2 A;  4CYN A;  4CYP A;  4C68 A;  2YNC A;  4UFV A;  4UCP A;  4A30 A;  3JTK A;  4C7I A;  4CYO A;  4CGL A;  5AG7 A;  5G21 A;  4B14 A;  5G22 A;  4CGP A;  4UCN A;  3H5Z A;  4C2Y A;  4BBH A;  2WSA A;  3IWE A;  4C2X A;  3IU1 A;  2WUU A;  4UFW A;  5AG6 A;  4B11 A;  4CGN A;  4A32 A;  4UFX A;  4CAE A; 
#chains in the Genus database with same CATH topology
 4OKO A;  1B6B A;  3GY9 A;  2DEA A;  3SI0 A;  4JLY A;  3T8W A;  3S9L A;  3ISZ A;  1Z8W A;  3RYO A;  4FD6 A;  3TOB A;  1QST A;  1YW4 A;  3WT4 A;  4C2Z A;  1Q2Y A;  1VHE A;  3F8K A;  3KL9 A;  1M4D A;  1FT7 A;  1XRY A;  4KLV A;  2PSW A;  4NGM A;  3S6H A;  3TC8 A;  2Q4V A;  5LYF A;  5LYL A;  1R3N A;  3NFZ A;  2D4O A;  2ZEF A;  2GIV A;  3T90 A;  1NE9 A;  2OU2 A;  2VZZ A;  2ZW6 A;  1KUV A;  1BPN A;  1IIC A;  4JJX A;  3B3S A;  2PIZ A;  4ONU A;  1X12 A;  1UFH A;  4KOV A;  3B8G A;  1P4N A;  4CGN A;  4PSX A;  3DR8 A;  2Z3P A;  3CXS A;  3E0K A;  3R9F A;  1QSO A;  4JXR A;  1AYE A;  2XEJ A;  4A37 A;  2B3V A;  4A33 A;  3H8F A;  1IOF A;  4KVM E;  3FX6 A;  3VAR A;  3RNZ A;  3CXQ A;  2ZW7 A;  4P4B A;  2XEG A;  4B5P A;  1BO4 A;  2CNM A;  3D4U A;  4OC0 A;  2O53 A;  2ZOF A;  4OAD A;  4KOU A;  3S9N A;  4FWU A;  2B4D A;  2PE3 A;  3CPA A;  3D7G A;  3GUX A;  3CT9 A;  3IWG A;  3PBB A;  4UIB A;  2B3U A;  3LWU A;  4B5P B;  1Z8T A;  3JTK A;  3VH9 A;  4AG7 A;  3KR4 A;  1YSJ A;  4GS4 A;  1R57 A;  2PJ1 A;  4K30 A;  4B11 A;  4KSA A;  4JD6 A;  1QSR A;  2AFZ A;  3F5B A;  2QEC A;  1HDQ A;  1ELM P;  1CG2 A;  2DPT A;  4JXQ A;  3SJG A;  4CAE A;  5F46 A;  3GYA A;  1LCP A;  1S7L A;  5AGE A;  4NSQ A;  4Q38 A;  2Q4Z A;  2PJ7 A;  4M3S A;  1VHO A;  2CXA A;  3PB8 X;  4A2Z A;  2NSM A;  4OAE A;  4B6Z A;  3D66 A;  3FF3 A;  1IYK A;  2F7V A;  2JDC A;  2QJ8 A;  4BIN A;  2G3A A;  1S7N A;  2ODF A;  2V8V A;  1S7F A;  2GAN A;  4MI4 A;  1Z4E A;  5H86 A;  2REF A;  4RN7 A;  4A30 A;  1ON0 A;  3PFE A;  2B5G A;  4CPA A;  2P6F A;  5G22 A;  1TIQ A;  1YLO A;  1YR0 A;  2EK8 A;  2O4H A;  3SJF A;  4C2X A;  1DTD A;  1H8L A;  2WUU A;  4UFW A;  5JGF A;  2PVW A;  4GM5 A;  4HKF A;  4CAX A;  1TF8 A;  4A32 A;  5J1Q A;  1M4G A;  1JQG A;  4H89 A;  4QC6 A;  1MK4 A;  3K9U A;  5A27 A;  2ZEO A;  3FMC A;  3I1U A;  4WWV A;  4B5O A;  4UF4 A;  2Z0Z A;  3SXN A;  1S60 A;  2P6E A;  3KGQ A;  1Q7L A;  2PJ2 A;  1NSL A;  2ZEN A;  1TF9 A;  4CYQ A;  2J8R A;  4E8O A;  3D3S A;  4E2A A;  4G1P A;  2WYR A;  2I79 A;  2J9A A;  5K8O A;  2C1C A;  1IID A;  3ISX A;  2D4P A;  2HUZ A;  3SJX A;  3S9M A;  2AJ6 A;  4CGL A;  4XPD C;  3EO4 A;  5AG7 A;  3TT2 A;  1Y9K A;  4L8A A;  4MHY A;  1QSM A;  1PUA A;  4AVC A;  3RBU A;  1Z4R A;  2P0W A;  3SHP A;  2VBQ A;  4MY0 A;  4BD9 A;  1GHE A;  2KCW A;  3FEE A;  5F49 A;  1ARM A;  3V38 A;  2Z3O A;  4MCR A;  4IHM A;  2PJB A;  2DXQ A;  2BSW A;  5C82 A;  4FUU A;  4UEF A;  4QUS A;  4CGM A;  2EBJ A;  2JBK A;  2PJA A;  4OIW A;  5E96 A;  5THW A;  4CRY B;  4UWI A;  3G8W A;  5DWN A;  4MFJ A;  3L2N A;  4OC5 A;  1KZF A;  3DGV A;  3LAC A;  1YW6 A;  1Q2D A;  1Z8L A;  2CTB A;  1U6M A;  2C6G A;  2WZN A;  4KVO E;  4ONW A;  1ARL A;  2G0B A;  1TKF A;  2QML A;  3D7H A;  3IJ3 A;  4MCQ A;  1RXT A;  1IOI A;  1ZLI A;  2VXK A;  2WSA A;  5F09 A;  2Q04 A;  2ZW5 A;  4DUK A;  4H6Z A;  2I00 A;  4Y49 B;  5LRK A;  2O28 A;  2OZU A;  4R6T A;  2OOT A;  1Y9W A;  3S6G A;  2PR1 A;  4NFR A;  5A28 A;  5LRG A;  3NH5 A;  2Q44 A;  4P4F A;  1XE4 A;  2XEF A;  4XNH B;  4KLW A;  4ZI6 A;  4NF1 A;  4DYO A;  1PU9 A;  4F6A A;  3PFO A;  3H8G A;  3JRU A;  4JZ0 A;  3D68 A;  4NGN A;  4OC4 A;  2JEV A;  4DNC A;  5KTC A;  2F5I A;  4R9M A;  5IB9 A;  2PJ4 A;  4PK3 A;  4BBH A;  2CIJ A;  4MHZ A;  2ARH A;  4XPL A;  4KOY A;  3VWD A;  4PXE A;  2Z3K A;  4YFJ A;  4MBU A;  5JPH A;  2B4B A;  2Q7B A;  1LFW A;  3W91 A;  3PBE A;  1ELL P;  2X7B A;  3H5Z A;  4UCN A;  1XOV A;  4YWY A;  1AMP A;  2HC9 A;  3BHX A;  2VQY A;  4NEX A;  3DR6 A;  2PIY A;  2Z11 A;  3D8P A;  4ZX8 A;  1F57 A;  4KOR A;  4B10 A;  4E0A A;  4U9Y A;  2YND A;  2AFS A;  2Z10 A;  3VWE A;  4Q36 A;  3PB9 X;  3DSB A;  4J3G A;  4KVX A;  1SQH A;  1XIX A;  5HH1 A;  1F2O A;  2Z3N A;  1TKJ A;  2IL4 A;  3N5F A;  4MCS A;  4X2T A;  1M4I A;  2EK9 A;  3I9S A;  2YNC A;  4KOW A;  4KS9 A;  3FIX A;  5KTD A;  3GIU A;  3SJE A;  2PRB A;  3IC1 A;  4I49 A;  3BI1 A;  3GKR A;  3R9G A;  4CAV A;  4F9V A;  3KHZ A;  1VIX A;  3HUV A;  3V7Z A;  5K8N A;  2B4D B;  4FAI A;  1XMB A;  1M4L A;  3B3T A;  4NJQ A;  1YX0 A;  1CBX A;  2JEW A;  4F0Y A;  5HVF A;  1ZG8 A;  3W6S A;  4KOT A;  3JVN A;  4PSW A;  7CPA A;  4R8F A;  2ZPA A;  4FBE A;  5F48 A;  2PJ9 A;  1DE4 C;  3EY5 A;  4GXH A;  2HV2 A;  4MFL A;  1RO5 A;  4A39 A;  1P0H A;  2P6G A;  1XJO A;  1QMU A;  4UWJ A;  4U5Y A;  4P10 A;  4ZYQ A;  5IX3 A;  2PVV A;  1ZLH A;  1S3Z A;  4CYP A;  3HLP A;  5DWM A;  2GRE A;  4YGO A;  3TOA A;  4A94 A;  4UEE A;  2EVN A;  4WJB A;  5K8M A;  2CY2 A;  2BL1 A;  4F9U A;  4OC1 A;  4R57 A;  3PRT A;  1ZG7 A;  1YK3 A;  2FCK A;  3BJ8 A;  4EME A;  4FD7 A;  2B5G B;  3IGR A;  1QQ9 A;  3H8E A;  1WWZ A;  3RZA A;  1GYT A;  4YU9 A;  3D7F A;  4MHP A;  4CAF A;  4PXC A;  4OC3 A;  1I1D A;  3D67 A;  3MN8 A;  3NE7 A;  3QAH A;  3IEH A;  4NGQ A;  4A95 A;  4CYN A;  4HPS A;  4EVY A;  3PP9 A;  3B3W A;  4ORF A;  4NGT A;  3FED A;  4C68 A;  2DF5 A;  4ZY1 A;  2JBJ A;  1CX8 A;  1VKC A;  1BPM A;  2CNT A;  3CDX A;  3F0A A;  3FEC A;  3KKW A;  4M6H A;  3C26 A;  4CYO A;  1S5K A;  1IB1 E;  2EWB A;  4QB9 A;  4AVA A;  4EFD A;  2AFO A;  3FXT A;  4NCZ A;  3TX8 A;  4MMO A;  2Q43 A;  1JWQ A;  1X10 A;  1Y0R A;  2POK A;  2V8D A;  3CZX A;  2VEZ A;  3R1K A;  3FRM A;  3S6K A;  3GB0 A;  5HVH A;  5I4M A;  4NJR A;  2BUE A;  4UBR A;  1N71 A;  2CNS A;  1BOB A;  2Z3M A;  2B58 A;  3PZJ A;  2ZXV A;  3B2Y A;  4PPZ A;  1VGY A;  1Y0Y A;  5J8C A;  1Z9U A;  3RAM A;  3EXN A;  4HNY B;  3DNS A;  1IY7 A;  4LUA A;  5D29 A;  1YQE A;  3W6X A;  2IJZ A;  2ZOG A;  4R7M A;  4P45 A;  3BXM A;  4AG9 A;  2JDD A;  1ZO0 A;  4OID A;  8CPA A;  3S6F A;  3TO6 A;  4DJL A;  2WPX A;  1I21 A;  3G3S A;  5ISV A;  1IYL A;  4CGP A;  2PDO A;  1F2P A;  2AE6 A;  2Q0Y A;  5LRJ A;  2PC1 A;  3EFA A;  4BMH A;  3TO9 A;  4MCP A;  5HXD A;  2Q51 A;  1TKH A;  4F8Z A;  2ZEE A;  4IK2 A;  4MFQ A;  1XEB A;  4MY3 A;  2G9D A;  5EBV A;  4II9 A;  4AXV A;  4MHD A;  1FY7 A;  2BCO A;  1CP6 A;  4ZX9 A;  3LOD A;  4KOS A;  4R76 A;  5JH9 A;  3KZW A;  2YNE A;  3TCV A;  1Y7R A;  1AUG A;  2OZH A;  4NGR A;  1XMT A;  2K5T A;  4L89 A;  3NH4 A;  3K9T A;  2PJC A;  3JUW A;  2V8G A;  3TE4 A;  3KR5 A;  3KQX A;  4C7H A;  5IV0 A;  3BLN A;  3PEI A;  5CNP A;  4PV6 A;  3QAY A;  2J8M A;  1YGH A;  2R1I A;  4M85 A;  4R3L A;  1Y7E A;  2J8N A;  2QIR A;  1YME A;  2BEI A;  3FYN A;  4NGS A;  4C7I A;  2FS5 A;  2FVG A;  4MJ8 A;  3DDD A;  1CPS A;  1LOK A;  2GLJ A;  4JYW A;  5AG6 A;  1Z8X A;  3D2P A;  3GLJ A;  1Z2L A;  1J4J A;  5FVJ A;  3QB8 A;  5F47 A;  1WK4 A;  2C27 A;  2PJ6 A;  3K2K A;  2ZW4 A;  4LQ6 A;  2FL4 A;  4AB7 A;  5KTA A;  2V8H A;  1HDU A;  1L0C A;  4OP4 A;  2DPS A;  2BOA A;  1PCA A;  3PGP A;  2CF4 A;  1M1D A;  3B7I A;  4LX9 A;  2C6C A;  2CTC A;  4UA3 A;  2GE3 A;  2FE7 A;  4UCM A;  4X3R A;  4ZY2 A;  4QBJ A;  3NA6 A;  1K4J A;  3IU2 A;  4MHN A;  3TTH A;  4ZGY B;  2EO8 A;  3ZZI A;  3CPX A;  4P44 A;  3TFY A;  4X8I A;  4XPD B;  4IUS A;  3CXP A;  3WAB A;  1LAN A;  2VZY A;  1EE3 P;  4KSI A;  4MXU A;  5G21 A;  4Q7A A;  4B14 A;  4R87 A;  4Z65 A;  3R9E A;  3VAT A;  2F8H A;  3FNC A;  3SXO A;  4QVT A;  4EWT A;  4P4I A;  2RC4 A;  5ELY A;  3IIB A;  4A38 A;  2C6P A;  5AG5 A;  3D7D A;  3LMS A;  3MGD A;  4B12 A;  1YLE A;  1XBU A;  2AFM A;  3FB3 A;  4ZBG A;  4A31 A;  1IU8 A;  4P4J A;  2EUI A;  4AVB A;  4CGO A;  1R43 A;  2R7H A;  2PJ0 A;  2IQ6 A;  4R3K A;  3WC6 A;  5EC4 A;  1XF8 A;  4HNW B;  4IAV A;  2ZEP A;  5EMI A;  3FVL A;  3R95 A;  2WPW A;  3D2M A;  1V0C A;  4MFZ A;  4LQG A;  3H4Q A;  2AFU A;  5DS0 A;  3EC4 A;  4OC2 A;  3FBU A;  3R96 A;  2Y0M A;  5JM6 A;  4P6Y A;  2FIW A;  2FSR A;  4OME A;  5HVG A;  1XFO A;  5IB0 A;  4UFX A;  1LRZ A;  1MJB A;  3IO1 A;  4Y49 C;  2QYV A;  2ZEL A;  1MJ9 A;  1HEE A;  1QSN A;  2ABZ A;  2VL1 A;  3TO7 A;  3FH4 A;  2PJ8 A;  5AG4 A;  4UEZ A;  6CPA A;  5J8F A;  4IF5 A;  5G1Z A;  1S7K A;  3NE8 A;  5LYI A;  2AFW A;  4XNH C;  4X5K A;  3QNV A;  4NXY A;  4FD4 A;  1NMT A;  1UWY A;  4P4D A;  2QVP A;  3I3G A;  2RFH A;  2R98 A;  3B3C A;  5D8N A;  5HMN A;  3FJU A;  4KOX A;  2HB6 A;  3SI2 A;  2OH1 A;  1TXR A;  3KQZ A;  3P2F A;  2BO9 A;  2XEI A;  3P2H A;  4TWE A;  1OZP A;  4MFP A;  2REE A;  3DLJ A;  4C2Y A;  4PXD A;  4CS0 B;  2ZEH A;  2GLF A;  3N7Z A;  3WC7 A;  1LAM A;  4CRZ B;  4RUH A;  2HQY A;  5K8P A;  1YVK A;  4H6U A;  4M6I A;  2ANP A;  5JQ4 A;  2NYQ A;  2PR8 A;  1OBR A;  2A4N A;  4H2K A;  1KUX A;  3B3V A;  4K3N A;  2GU2 A;  4KUB A;  4PQA A;  1VHS A;  1Q2C A;  1RTQ A;  4OLL A;  4CAW A;  2Q4Y A;  3WR7 A;  3PB7 X;  2PJ3 A;  2V77 A;  4RI1 A;  2GFQ A;  2PRQ A;  5G20 A;  4KSF A;  3B35 A;  2ATR A;  2OB0 A;  3KHX A;  2Q7S A;  3A9L A;  4TNU A;  1KUY A;  4YRH A;  2FXF A;  4UFV A;  3SI1 A;  4RS2 A;  1IGB A;  3IFE A;  1CP7 A;  2PJ5 A;  4KZT A;  1PYT B;  2FIA A;  3KAS A;  1YVO A;  3LD2 A;  4M6G A;  4PXB A;  3IWE A;  3MRU A;  2OR4 A;  2RB7 A;  3IU1 A;  4NGP A;  4UIA A;  5LYD A;  2ZED A;  4FD5 A;  1BAV A;  4W9Y A;  2IMO A;  3ZJ0 A;  1CJW A;  2I3C A;  2YNC C;  1FNO A;  1CM0 A;  4PK2 A;  3UY5 A;  2JLM A;  3WC5 A;  1M44 A;  5C88 A;  4P4E A;  5I0C A;  3T9Y A;  3OWC A;  2ZEG A;  5BWA B;  4HNX B;  5CBM A;  2G3T A;  2OZG A;  4B13 A;  1A2Z A;  2FT0 A;  3NH8 A;  3PB6 X;  3IWW A;  4F0X A;  5H84 A;  2NMT A;  1KWM A;  2YGW A;  1NSA A;  5CPA A;  1B87 A;  2ZEM A;  4UCP A;  3V8I A;  2Z3L A;  1ZG9 A;  2AFX A;  1Z5R A;  4O23 A;  4XPK A;  4MRI A;  3BJ7 A;  2PCU A;  1LAP A;  3BI0 A;  5GCN A;  1BLL E;  1YRE A;  2R8V A;  4KUA A;  4ZY0 A;  2PQ8 A;  1I12 A;  3KI9 A;  1MJA A;  2H5M A;  4U9Z A;  2VI7 A;  4JWP A;  3RO0 A;  3PB4 X;  1CPX A;  4MFK A; 
#chains in the Genus database with same CATH homology
 1B6B A;  3GY9 A;  4JLY A;  3RYO A;  3TOB A;  4FD6 A;  1QST A;  4C2Z A;  1Q2Y A;  3F8K A;  4KLV A;  1M4D A;  3S6H A;  2PSW A;  2Q4V A;  2D4O A;  2GIV A;  3T90 A;  1NE9 A;  2OU2 A;  2VZZ A;  2ZW6 A;  1KUV A;  1IIC A;  4JJX A;  4ONU A;  1UFH A;  4KOV A;  3B8G A;  1P4N A;  4CGN A;  4PSX A;  3DR8 A;  2Z3P A;  3CXS A;  3E0K A;  3R9F A;  1QSO A;  4JXR A;  2B3V A;  4A33 A;  4KVM E;  3CXQ A;  2ZW7 A;  4B5P A;  1BO4 A;  2CNM A;  4OAD A;  4KOU A;  2B4D A;  3IWG A;  4B5P B;  2B3U A;  3JTK A;  4AG7 A;  4GS4 A;  1R57 A;  4K30 A;  4B11 A;  4KSA A;  4JD6 A;  1QSR A;  3F5B A;  2QEC A;  5F46 A;  2DPT A;  4JXQ A;  4CAE A;  3GYA A;  1S7L A;  5AGE A;  4NSQ A;  4Q38 A;  4M3S A;  2CXA A;  4A2Z A;  4OAE A;  1IYK A;  2JDC A;  2G3A A;  1S7N A;  1S7F A;  2GAN A;  4MI4 A;  1Z4E A;  5H86 A;  2REF A;  4A30 A;  1ON0 A;  2B5G A;  2P6F A;  5G22 A;  1TIQ A;  1YR0 A;  4C2X A;  2WUU A;  4UFW A;  4HKF A;  4CAX A;  4A32 A;  1M4G A;  4H89 A;  4QC6 A;  1MK4 A;  3K9U A;  5A27 A;  4B5O A;  3SXN A;  2Z0Z A;  1S60 A;  2P6E A;  1NSL A;  4CYQ A;  4E8O A;  2J8R A;  3D3S A;  4E2A A;  2I79 A;  1IID A;  2D4P A;  2HUZ A;  2AJ6 A;  4CGL A;  4XPD C;  3EO4 A;  5AG7 A;  3TT2 A;  1Y9K A;  4L8A A;  1QSM A;  1PUA A;  4AVC A;  1Z4R A;  2P0W A;  3SHP A;  2VBQ A;  4MY0 A;  1GHE A;  2KCW A;  5F49 A;  2Z3O A;  2DXQ A;  2BSW A;  5C82 A;  4QUS A;  4CGM A;  4CRY B;  5E96 A;  4UWI A;  3G8W A;  5DWN A;  4MFJ A;  1KZF A;  1Q2D A;  1U6M A;  4KVO E;  2G0B A;  2QML A;  1RXT A;  2VXK A;  2WSA A;  2Q04 A;  2ZW5 A;  4H6Z A;  2I00 A;  4Y49 B;  2O28 A;  2OZU A;  1Y9W A;  3S6G A;  2PR1 A;  5A28 A;  2Q44 A;  1XE4 A;  4XNH B;  4KLW A;  4NF1 A;  1PU9 A;  4F6A A;  2JEV A;  4DNC A;  5KTC A;  2F5I A;  4R9M A;  4PK3 A;  4XPL A;  2ARH A;  4KOY A;  3VWD A;  4YFJ A;  2Z3K A;  4MBU A;  5JPH A;  2B4B A;  2Q7B A;  3W91 A;  2X7B A;  3H5Z A;  4UCN A;  4NEX A;  2VQY A;  3DR6 A;  2Z11 A;  3D8P A;  4KOR A;  4B10 A;  4E0A A;  4U9Y A;  2YND A;  2Z10 A;  3VWE A;  4Q36 A;  3DSB A;  4J3G A;  4KVX A;  1SQH A;  1XIX A;  5HH1 A;  2Z3N A;  2IL4 A;  1M4I A;  3I9S A;  2YNC A;  4KOW A;  4KS9 A;  3FIX A;  5KTD A;  2PRB A;  4I49 A;  3GKR A;  4CAV A;  3R9G A;  2B4D B;  1YX0 A;  4F0Y A;  3W6S A;  4KOT A;  3JVN A;  4PSW A;  2ZPA A;  5F48 A;  3EY5 A;  2HV2 A;  4MFL A;  1RO5 A;  1P0H A;  2P6G A;  4UWJ A;  4U5Y A;  5IX3 A;  1S3Z A;  4CYP A;  5DWM A;  4YGO A;  3TOA A;  2EVN A;  2CY2 A;  2BL1 A;  4R57 A;  3BJ8 A;  1YK3 A;  2FCK A;  4FD7 A;  2B5G B;  3IGR A;  1WWZ A;  4CAF A;  1I1D A;  3NE7 A;  3QAH A;  4A95 A;  4CYN A;  4EVY A;  3PP9 A;  4ORF A;  4C68 A;  3F0A A;  1VKC A;  2CNT A;  3KKW A;  3C26 A;  4CYO A;  1S5K A;  1IB1 E;  4QB9 A;  4AVA A;  3FXT A;  4NCZ A;  3R1K A;  3S6K A;  2VEZ A;  3FRM A;  2BUE A;  4UBR A;  1N71 A;  2CNS A;  1BOB A;  2Z3M A;  2B58 A;  3PZJ A;  2ZXV A;  5J8C A;  1Z9U A;  3EXN A;  4HNY B;  3DNS A;  4LUA A;  3W6X A;  4AG9 A;  2JDD A;  1ZO0 A;  3S6F A;  3TO6 A;  2WPX A;  1I21 A;  3G3S A;  5ISV A;  1IYL A;  4CGP A;  2PDO A;  2AE6 A;  2Q0Y A;  2PC1 A;  3EFA A;  4BMH A;  3TO9 A;  4MFQ A;  1XEB A;  4MY3 A;  5EBV A;  4II9 A;  4MHD A;  1FY7 A;  3LOD A;  4KOS A;  2YNE A;  3TCV A;  1Y7R A;  2OZH A;  1XMT A;  2K5T A;  4L89 A;  3JUW A;  3TE4 A;  4C7H A;  5IV0 A;  3BLN A;  5CNP A;  4PV6 A;  2J8M A;  1YGH A;  2R1I A;  4M85 A;  4R3L A;  2J8N A;  2QIR A;  2BEI A;  3FYN A;  4C7I A;  2FS5 A;  4MJ8 A;  3DDD A;  5AG6 A;  3D2P A;  5FVJ A;  1J4J A;  3QB8 A;  5F47 A;  1WK4 A;  2C27 A;  4AB7 A;  2ZW4 A;  5KTA A;  2FL4 A;  1L0C A;  2DPS A;  3PGP A;  1M1D A;  4LX9 A;  4UA3 A;  2GE3 A;  2FE7 A;  4UCM A;  4QBJ A;  3TTH A;  1K4J A;  3IU2 A;  4ZGY B;  3ZZI A;  4XPD B;  4IUS A;  3CXP A;  2VZY A;  5G21 A;  4B14 A;  4R87 A;  3R9E A;  3SXO A;  3FNC A;  4QVT A;  2RC4 A;  5AG5 A;  3MGD A;  4B12 A;  1YLE A;  3FB3 A;  4ZBG A;  4A31 A;  3TFY A;  2EUI A;  4AVB A;  4CGO A;  2R7H A;  4R3K A;  5EC4 A;  1XF8 A;  4HNW B;  3R95 A;  2WPW A;  3D2M A;  1V0C A;  4MFZ A;  3H4Q A;  3EC4 A;  3FBU A;  3R96 A;  2Y0M A;  2FIW A;  2FSR A;  5IB0 A;  4UFX A;  1LRZ A;  1MJB A;  4Y49 C;  1MJ9 A;  1QSN A;  3TO7 A;  5J8F A;  5AG4 A;  4IF5 A;  5G1Z A;  1S7K A;  4XNH C;  4X5K A;  4NXY A;  4FD4 A;  1NMT A;  3I3G A;  5HMN A;  2R98 A;  4KOX A;  2OH1 A;  3P2F A;  3P2H A;  1OZP A;  4MFP A;  2REE A;  4C2Y A;  4CS0 B;  3N7Z A;  4CRZ B;  2HQY A;  1YVK A;  4H6U A;  5JQ4 A;  2PR8 A;  2A4N A;  4KUB A;  1KUX A;  4CAW A;  1VHS A;  1Q2C A;  4OLL A;  2Q4Y A;  3WR7 A;  4RI1 A;  5G20 A;  4KSF A;  2ATR A;  2OB0 A;  3A9L A;  1KUY A;  4YRH A;  2FXF A;  4UFV A;  4RS2 A;  4KZT A;  2FIA A;  3LD2 A;  1YVO A;  4BBH A;  3IWE A;  3IU1 A;  4FD5 A;  3ZJ0 A;  1CJW A;  2YNC C;  1CM0 A;  4PK2 A;  3UY5 A;  2JLM A;  1M44 A;  5C88 A;  5I0C A;  3T9Y A;  3OWC A;  5BWA B;  4HNX B;  2G3T A;  2OZG A;  4B13 A;  2FT0 A;  4F0X A;  5H84 A;  2NMT A;  2YGW A;  1B87 A;  4UCP A;  3V8I A;  2Z3L A;  4XPK A;  3BJ7 A;  5GCN A;  1YRE A;  2R8V A;  4KUA A;  2PQ8 A;  1I12 A;  1MJA A;  2H5M A;  4U9Z A;  2VI7 A;  4JWP A;  4MFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...