4CAFA

Plasmodium vivax n-myristoyltransferase in complex with a benzothiophene inhibitor (compound 34a)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of High Affinity Inhibitors of Plasmodium Falciparum and Plasmodium Vivax N-Myristoyltransferases Directed by Ligand Efficiency Dependent Lipophilicity (Lelp).
pubmed doi rcsb
source organism Plasmodium vivax
total genus 117
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cafA00
4CGLA 4B11A 5AG5A 4UFXA 4A2ZA 3IU2A 4CAEA 5A28A 4CYPA 5G21A 2YNDA 4B14A 4CYQA 4CYNA 4C2YA 4CGNA 4B12A 4UFWA 2WUUA 5AGEA 5G1ZA 4BBHA 4C2XA 2YNCC 4C2ZA 4CYOA 5A27A 3IWEA 3H5ZA 4A31A 4CAFA 4UCNA 4CGOA 3JTKA 4UCPA 4B13A 4CGPA 4UFVA 5AG7A 2YNCA 5AG4A 5AG6A 4C68A 4A32A 3IU1A 2YNEA 5G22A 2WSAA 4A33A 4UCMA 4A95A 4C7HA 4B10A 5G20A 4CGMA 4C7IA 4A30A
chains in the Genus database with same CATH superfamily
1I1DA 5LRKA 1VHOA 3D4UA 4UWJA 4J3GA 3TCVA 4NGNA 3S6HA 3BJ8A 4ONUA 2F5IA 3F5BA 3JUWA 1Z8TA 3NFZA 4KSIA 2FT0A 1GYTA 1CG2A 4RI1A 4P45A 3R9GA 3T9YA 2HUZA 2POKA 2EVNA 3FEEA 1X10A 2WUUA 3DLJA 1S7FA 4NJQA 3CXPA 4E8OA 4UCNA 1V0CA 5AG7A 4MFLA 5LYDA 4KOVA 5DS0A 3NH5A 1KUVA 2BEIA 2CTBA 5DWNA 5D29A 4H6ZA 5JM6A 1K4JA 2Z3LA 3SXOA 1Y0RA 3PB7X 2O28A 4Y49B 2V8VA 1ZO0A 2ZW4A 5J8CA 1VGYA 4DJLA 2VL1A 4UEZA 2WPXA 2R7HA 1ZG8A 4XNHC 2F7VA 2Z3NA 2FXFA 4CGNA 2FIAA 3WC7A 2OOTA 4KOXA 2RFHA 3GYAA 3IEHA 1Q7LA 4RUHA 6CPAA 5JPHA 3VWEA 3IWGA 3S9MA 4MFQA 2CXAA 4AG9A 4MMOA 2ODFA 2PDOA 4YGOA 2R1IA 2YNEA 3LMSA 4R87A 4IF5A 1SQHA 4F0YA 3B3CA 4KLVA 2REFA 1Z4RA 4FWUA 2JEVA 4H2KA 2Q4YA 1TKFA 1YVOA 4B5PA 3B2YA 4LQGA 4B11A 4IHMA 3B7IA 2B3VA 1XEBA 2FIWA 2PJ6A 4KOYA 4PK2A 2PJ2A 3HLPA 1ZG9A 3R1KA 2IL4A 4NSQA 1MK4A 1Y7RA 2JBJA 4NGQA 2G3AA 2FS5A 2DF5A 3V7ZA 2EK8A 5AGEA 2OZHA 4BBHA 4Z65A 4Y49C 2YNCC 2QECA 5HVFA 4BD9A 1HEEA 2ATRA 4ZGYB 1EE3P 3PBBA 1YVKA 2CIJA 1RTQA 4JD6A 4KVXA 1KWMA 3DNSA 4MBUA 4HNWB 3SI1A 2VQYA 3D2PA 3RO0A 3TTHA 4F0XA 3FJUA 2PIZA 3IO1A 5KTCA 2AFZA 4E0AA 1ZG7A 3D67A 1KZFA 2O53A 2Z10A 3F8KA 4NXYA 4Q38A 4C7IA 1QSRA 2JDCA 2J9AA 3A9LA 4MHZA 3GIUA 5H84A 3TOBA 1NSAA 1IYLA 4QC6A 2GLJA 2ZEMA 2BUEA 3IGRA 3V38A 4KSAA 4CYPA 1XOVA 2VZYA 3K2KA 1LCPA 4KZTA 3LACA 5ELYA 2CNMA 3RZAA 1XMBA 2OU2A 4FD4A 4X2TA 4B12A 3B3TA 3W6SA 1OBRA 3FXTA 1P0HA 2PCUA 2Z3MA 2NSMA 4C2XA 2V8DA 2DEAA 4JZ0A 4B13A 2ZW5A 4MRIA 1RO5A 1YK3A 2AJ6A 2PE3A 2PJ9A 3FBUA 8CPAA 4UWIA 1XE4A 2GLFA 2D4PA 3FB3A 2G0BA 5F46A 4HNXB 3MGDA 4KUBA 4DYOA 1JQGA 3D66A 4O23A 4ZI6A 2FL4A 1BPMA 3P2FA 4A30A 2Z11A 2RC4A 1QSOA 2BL1A 1Y9WA 2EWBA 3DR6A 4OIWA 3G3SA 1WK4A 3FIXA 4OP4A 4W9YA 2PJ0A 3KI9A 5KTDA 4XPDC 1LAMA 2CF4A 3KL9A 4OMEA 4BINA 4KOUA 2ZW6A 4CYOA 3G8WA 1IGBA 2AFOA 2ZXVA 4MFZA 4CGOA 1A2ZA 1S7LA 4KVOE 4DUKA 1YW4A 4KOSA 5D8NA 2DPTA 2CNTA 2ZPAA 5LYIA 4UCMA 5HMNA 2PSWA 4EMEA 4A39A 2H5MA 4XNHB 4FD6A 3NH8A 3VATA 4M6GA 5EMIA 3T8WA 4MFPA 1HDUA 1ZLIA 2AFMA 2R8VA 1XBUA 1YLOA 2WZNA 5CBMA 4MY0A 3WC6A 4FUUA 3GUXA 3IIBA 4X5KA 4A94A 2DPSA 3KQZA 2ZEGA 4NJRA 4R8FA 5F09A 2C27A 5K8MA 1VHEA 1XRYA 4YU9A 1KUXA 3VARA 5J1QA 2IJZA 4YRHA 1YX0A 1ARLA 2PJ8A 4IUSA 3CZXA 4H89A 3B3VA 2PIYA 3PGPA 3FF3A 3QAHA 3CPAA 2ZEFA 4P6YA 4MFKA 3WABA 1TIQA 5F49A 4B10A 2C1CA 3N7ZA 1BAVA 4OC2A 3SJFA 1M44A 1IICA 2J8RA 3PP9A 3R9EA 2J8MA 2VBQA 4EWTA 3PEIA 4ZY1A 1Z5RA 4CRZB 4G1PA 3FH4A 4NF1A 1IB1E 4GXHA 5I4MA 2ZOGA 1LAPA 5EBVA 5C82A 2AFSA 3R9FA 2J8NA 1LOKA 2EBJA 3FX6A 4JLYA 1CPSA 3VH9A 5IX3A 4OIDA 1ARMA 2PJ4A 2PJ3A 1MJ9A 3H8EA 4Q36A 2ABZA 1M1DA 3JRUA 1CP7A 2AE6A 2BO9A 1CJWA 2OB0A 3D3SA 3H5ZA 4RN7A 4DNCA 2B4DA 3TO9A 2QJ8A 1ON0A 4GS4A 3DDDA 2B58A 2Q43A 2ZEDA 2JDDA 1LANA 3IU1A 5F48A 1I12A 4NGMA 2GE3A 4P4JA 4NGTA 5IB0A 1Q2YA 3OWCA 4F8ZA 2G9DA 2P0WA 5GCNA 1IYKA 2PJ7A 4CGMA 1CP6A 2FCKA 2QVPA 2BOAA 2PRQA 5AG5A 1LFWA 2QYVA 3S9NA 2XEJA 1U6MA 1S7KA 5G21A 4B14A 4ONWA 3F0AA 2Z3OA 2V77A 1CBXA 1FT7A 3GKRA 4A37A 4ZYQA 5EC4A 5K8NA 2RB7A 4GM5A 4ZY2A 2VZZA 3CDXA 1Z9UA 3NE8A 5LYLA 3SXNA 3CXSA 2P6EA 2Z3KA 3KASA 3MN8A 4QVTA 2IMOA 2BCOA 1QQ9A 2B4BA 3EC4A 4HKFA 3LD2A 5AG6A 2P6GA 2ZEPA 3T90A 3FEDA 2XEIA 4I49A 4U9ZA 1TF8A 4MHDA 4UBRA 3SHPA 4A95A 3PFOA 4UF4A 1Q2DA 4FD7A 4XPDB 3BJ7A 2CTCA 2KCWA 2A4NA 1XF8A 2GIVA 2JLMA 3D7DA 3DR8A 4EFDA 4R7MA 4JXRA 5JQ4A 3RNZA 4OC0A 4CYQA 4CS0B 2B3UA 3D68A 1ZLHA 2ZOFA 3VWDA 4F9UA 3S6GA 1OZPA 2B5GB 3ZJ0A 4UFWA 4B6ZA 4E2AA 2AFXA 1GHEA 3CXQA 4FBEA 3R95A 3PB6X 4C2ZA 5C88A 4LQ6A 3QAYA 3BLNA 4CGPA 4OC5A 5CPAA 3UY5A 1XMTA 1AYEA 2Q04A 1PYTB 3BI1A 3BXMA 2C6PA 2ZELA 2FSRA 4QB9A 4XPKA 2HQYA 4KVME 4PK3A 4C7HA 1R57A 3B35A 4II9A 1S5KA 4KOTA 3V8IA 2Q51A 4FAIA 4UFXA 4P4EA 2WYRA 3QNVA 2PVVA 3KR5A 4M6IA 3ISXA 4P4DA 5K8OA 4QUSA 4CPAA 3E0KA 4R6TA 4AVBA 3S9LA 4MCRA 3NH4A 4TNUA 3FYNA 2V8HA 4P4FA 3FECA 5LRJA 1S3ZA 3TX8A 1J4JA 3C26A 3SJXA 1CPXA 3PB8X 2OZGA 4CAFA 4CGLA 1I21A 5A27A 3TO6A 4UCPA 4XPLA 3FRMA 4UIBA 4OC3A 5AG4A 3IC1A 4HNYB 1YLEA 3WR7A 4IAVA 4PXCA 4ORFA 5FVJA 3R96A 4LX9A 4A33A 4P44A 1YGHA 4KORA 3KQXA 4JYWA 2Q0YA 2PVWA 5K8PA 4UIAA 1L0CA 1P4NA 1TXRA 3TC8A 2QIRA 2EK9A 4R3LA 4H6UA 5H86A 3NE7A 1N71A 1R43A 3JVNA 3TE4A 1IU8A 2ZW7A 2XEFA 4IK2A 4AB7A 5JGFA 4PXBA 2AFWA 4B5PB 1AMPA 1QSTA 5G1ZA 1YMEA 4ZX9A 2PJCA 5DWMA 1YREA 3CPXA 1B6BA 1R3NA 1PU9A 2PJ5A 3GLJA 3JTKA 3LWUA 4UFVA 4L89A 4AG7A 3EY5A 4CRYB 4NGRA 4AVAA 5BWAB 1FNOA 5HVGA 3FVLA 3BI0A 4OC1A 1Q2CA 1LRZA 2R98A 5JH9A 2ZEOA 2ARHA 2O4HA 4NCZA 4UEFA 2C6CA 3IWWA 4BMHA 3PZJA 4PXDA 1KUYA 1B87A 2REEA 2NMTA 4KSFA 1TKJA 3W91A 4M85A 4PXEA 1IY7A 1UWYA 1RXTA 2I79A 4MJ8A 3RYOA 4X8IA 4X3RA 2GU2A 3GY9A 3KKWA 3S6KA 4C2YA 1TF9A 1Y9KA 1IOIA 4AVCA 1ELLP 2ANPA 4F9VA 1BOBA 4MCPA 4MFJA 3TT2A 4OADA 1Y0YA 2I3CA 1YSJA 2P6FA 4UEEA 4LUAA 3RBUA 2I00A 3EO4A 4F6AA 5J8FA 1TKHA 1X12A 2VI7A 5HH1A 4MHYA 2HB6A 2QMLA 1M4IA 1VHSA 3SI0A 2GREA 2WSAA 2Z3PA 3BHXA 4PSXA 1FY7A 1BPNA 1UFHA 5LRGA 2D4OA 3D7HA 1QSNA 2NYQA 3H4QA 4MHPA 4ZX8A 5I0CA 2GFQA 4R3KA 4U5YA 4P4IA 4PSWA 1M4DA 2CY2A 3MRUA 4YFJA 4KS9A 4OLLA 1Z2LA 1DE4C 3IJ3A 1YQEA 3GB0A 4NGPA 4OC4A 1HDQA 2K5TA 4JJXA 3B8GA 2OR4A 4R9MA 4UA3A 3HUVA 3KGQA 4NFRA 3S6FA 4P4BA 1BO4A 4EVYA 2Q7BA 1YR0A 5ISVA 1Y7EA 4U9YA 4PQAA 3H8FA 3L2NA 2GANA 3PFEA 3SJGA 1VKCA 1IOFA 5HXDA 3I3GA 1MJBA 2X7BA 1S60A 4CAVA 3K9UA 4M6HA 4B5OA 1WWZA 3N5FA 4JXQA 1ELMP 3D8PA 3D7GA 4QBJA 1JWQA 1MJAA 4P10A 3IU2A 1DTDA 2ZEEA 4TWEA 1NSLA 3EXNA 4MCQA 2DXQA 4K30A 2HV2A 4FD5A 2VEZA 1VIXA 2Q44A 5THWA 5KTAA 1PCAA 4ZY0A 3B3WA 4A38A 3ISZA 5IB9A 4NGSA 1QSMA 2PRBA 3KR4A 3NA6A 1M4GA 2YNCA 1XFOA 4MXUA 4R57A 4R76A 2G3TA 1YW6A 1M4LA 4C68A 4OAEA 3TO7A 3P2HA 2PR8A 4MY3A 3DSBA 5LYFA 1CM0A 3SJEA 2Z0ZA 3LODA 2EUIA 3KHZA 2FE7A 3KZWA 4AXVA 4RS2A 4WWVA 5IV0A 4A2ZA 1PUAA 5E96A 2WPWA 1AUGA 1XJOA 1BLLE 3PB4X 4CAXA 3KHXA 3B3SA 3RAMA 4WJBA 3EFAA 3TOAA 1Z8WA 1NMTA 2PJAA 5HVHA 3PRTA 3QB8A 1S7NA 4KLWA 2YGWA 2VXKA 3FMCA 3W6XA 4A31A 3H8GA 2PJ1A 2OZUA 2FVGA 2PQ8A 4MHNA 7CPAA 2Q4ZA 2F8HA 4KOWA 3IFEA 4JWPA 5G22A 3D2MA 3WT4A 2EO8A 4M3SA 1NE9A 3CT9A 4CAWA 2Q4VA 1F2OA 1Z8XA 2PJBA 2Q7SA 4HPSA 4K3NA 4MI4A 5G20A 2V8GA 3FNCA 3PB9X 2C6GA 1H8LA 4L8AA 5F47A 2B4DB 4NEXA 3D7FA 1Z8LA 2ZENA 2BSWA 1F57A 2JEWA 3TFYA 3I1UA 4CAEA 5A28A 1XIXA 2PR1A 4YWYA 3WC5A 2YNDA 4CYNA 4OKOA 2JBKA 1F2PA 2IQ6A 3DGVA 5CNPA 3PBEA 4Q7AA 2OH1A 3IWEA 1QMUA 4KUAA 3SI2A 4PPZA 4PV6A 2PC1A 2CNSA 1CX8A 4A32A 3ZZIA 1Z4EA 1IIDA 3I9SA 2HC9A 2Y0MA 3K9TA 4MCSA 2ZEHA 2B5GA 4ZBGA 2AFUA 2XEGA
chains in the Genus database with same CATH topology
1I1DA 4UWJA 4J3GA 3TCVA 3S6HA 3BJ8A 4ONUA 2F5IA 3F5BA 3JUWA 4RI1A 3T9YA 2FT0A 3R9GA 2HUZA 2EVNA 2WUUA 1S7FA 3CXPA 4E8OA 4UCNA 1V0CA 5AG7A 4MFLA 4KOVA 1KUVA 2BEIA 5DWNA 4H6ZA 1K4JA 2Z3LA 3SXOA 2O28A 4Y49B 1ZO0A 2ZW4A 5J8CA 2WPXA 2R7HA 4XNHC 2Z3NA 2FXFA 4CGNA 2FIAA 4KOXA 3GYAA 5JPHA 3VWEA 3IWGA 4MFQA 2CXAA 4AG9A 4YGOA 2R1IA 2YNEA 4R87A 4IF5A 1SQHA 4F0YA 4KLVA 2REFA 1Z4RA 2JEVA 2Q4YA 1YVOA 4B5PA 4B11A 2B3VA 1XEBA 2FIWA 4KOYA 4PK2A 3R1KA 2IL4A 4NSQA 1MK4A 1Y7RA 2G3AA 2FS5A 5AGEA 2OZHA 4BBHA 4Y49C 2YNCC 2QECA 2ATRA 4ZGYB 1YVKA 4JD6A 4KVXA 3DNSA 4MBUA 4HNWB 2VQYA 3D2PA 3TTHA 4F0XA 5KTCA 4E0AA 4NXYA 1KZFA 3F8KA 2Z10A 4Q38A 4C7IA 1QSRA 2JDCA 3A9LA 3TOBA 5H84A 1IYLA 4QC6A 3IGRA 2BUEA 4KSAA 4CYPA 2VZYA 4KZTA 2CNMA 2OU2A 4FD4A 4B12A 3W6SA 3FXTA 1P0HA 2Z3MA 4C2XA 4B13A 2ZW5A 1RO5A 1YK3A 2AJ6A 3FBUA 4UWIA 1XE4A 2D4PA 3FB3A 2G0BA 5F46A 4HNXB 3MGDA 4KUBA 2FL4A 4A30A 3P2FA 2Z11A 2RC4A 1QSOA 2BL1A 1Y9WA 3DR6A 3G3SA 1WK4A 3FIXA 5KTDA 4XPDC 4KOUA 2ZW6A 4CYOA 3G8WA 2ZXVA 4MFZA 4CGOA 1S7LA 4KVOE 4KOSA 2DPTA 2CNTA 2ZPAA 4UCMA 5HMNA 2PSWA 2H5MA 4XNHB 4FD6A 4MFPA 2R8VA 4MY0A 4X5KA 2DPSA 2C27A 1KUXA 4YRHA 1YX0A 4IUSA 4H89A 3PGPA 3QAHA 4MFKA 1TIQA 5F49A 4B10A 3N7ZA 1M44A 1IICA 2J8RA 3PP9A 3R9EA 2J8MA 2VBQA 4CRZB 2B5GA 4NF1A 1IB1E 5EBVA 5C82A 3R9FA 2J8NA 4JLYA 5IX3A 4Q36A 1MJ9A 1M1DA 2AE6A 1CJWA 2OB0A 3D3SA 3H5ZA 4DNCA 2B4DA 3TO9A 1ON0A 4GS4A 3DDDA 2B58A 3IU1A 2JDDA 5F48A 1I12A 2GE3A 5IB0A 1Q2YA 3OWCA 5GCNA 2P0WA 1IYKA 4CGMA 2FCKA 5AG5A 1U6MA 1S7KA 5G21A 4B14A 3F0AA 2Z3OA 3GKRA 5EC4A 2VZZA 1Z9UA 3SXNA 3CXSA 2P6EA 2Z3KA 4QVTA 4HKFA 2B4BA 3EC4A 3LD2A 5AG6A 2P6GA 3T90A 4I49A 4U9ZA 4MHDA 3SHPA 4UBRA 4A95A 1Q2DA 4FD7A 4XPDB 3BJ7A 2KCWA 2A4NA 1XF8A 2GIVA 2JLMA 3DR8A 4JXRA 5JQ4A 4CYQA 4CS0B 2B3UA 3VWDA 3S6GA 1OZPA 2B5GB 3ZJ0A 4UFWA 4E2AA 1GHEA 3CXQA 5C88A 3R95A 4C2ZA 3BLNA 4CGPA 3UY5A 1XMTA 2Q04A 2FSRA 4QB9A 4XPKA 2HQYA 4KVME 4PK3A 4C7HA 1R57A 4II9A 1S5KA 4KOTA 3V8IA 4UFXA 4QUSA 3E0KA 4AVBA 3FYNA 1S3ZA 1J4JA 3C26A 5A27A 2OZGA 4CAFA 4CGLA 1I21A 3TO6A 4UCPA 4XPLA 3FRMA 5AG4A 4HNYB 1YLEA 3WR7A 4ORFA 5FVJA 3R96A 4LX9A 4A33A 1YGHA 4KORA 2Q0YA 1L0CA 1P4NA 2QIRA 4R3LA 4H6UA 5H86A 3NE7A 1N71A 3JVNA 3TE4A 2ZW7A 4AB7A 4B5PB 1QSTA 5G1ZA 5DWMA 1YREA 1B6BA 1PU9A 3JTKA 4CRYB 4UFVA 4L89A 4AG7A 3EY5A 4AVAA 5BWAB 1Q2CA 1LRZA 2R98A 2ARHA 4BMHA 4NCZA 3PZJA 1KUYA 1B87A 2REEA 2NMTA 4KSFA 3W91A 4M85A 1RXTA 2I79A 4MJ8A 3RYOA 3S6KA 3GY9A 3KKWA 4C2YA 1Y9KA 4AVCA 1BOBA 4MFJA 3TT2A 4OADA 4F6AA 2P6FA 4LUAA 2I00A 3EO4A 5J8FA 2VI7A 5HH1A 2QMLA 1M4IA 1VHSA 2WSAA 2Z3PA 4PSXA 1FY7A 1UFHA 2D4OA 1QSNA 5I0CA 3H4QA 4R3KA 4U5YA 4PSWA 1M4DA 2CY2A 4YFJA 4KS9A 4OLLA 2K5TA 4JJXA 3B8GA 4R9MA 4UA3A 3S6FA 1BO4A 4EVYA 2Q7BA 1YR0A 5ISVA 4U9YA 2GANA 1VKCA 3I3GA 1MJBA 2X7BA 1S60A 4CAVA 3K9UA 4B5OA 1WWZA 4JXQA 3D8PA 4QBJA 1MJAA 3IU2A 1NSLA 3EXNA 2DXQA 4K30A 2HV2A 4FD5A 2VEZA 2Q44A 5KTAA 1QSMA 2PRBA 1M4GA 2YNCA 4R57A 4C68A 2G3TA 4OAEA 3TO7A 3P2HA 2PR8A 4MY3A 3DSBA 1CM0A 2Z0ZA 3LODA 2EUIA 2FE7A 4RS2A 5IV0A 4A2ZA 1PUAA 5E96A 2WPWA 4CAXA 3EFAA 3TOAA 1NMTA 3QB8A 1S7NA 4KLWA 2YGWA 2VXKA 4A31A 3W6XA 2OZUA 2PQ8A 4KOWA 4JWPA 5G22A 3D2MA 4M3SA 1NE9A 4CAWA 2Q4VA 4MI4A 5G20A 3FNCA 4L8AA 5F47A 2B4DB 4NEXA 2BSWA 3TFYA 4CAEA 5A28A 1XIXA 2PR1A 2YNDA 4CYNA 5CNPA 2OH1A 3IWEA 4KUAA 4PV6A 2PC1A 2CNSA 4A32A 3ZZIA 1Z4EA 1IIDA 3I9SA 2Y0MA 2PDOA 4ZBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGL A;  4B11 A;  5AG5 A;  4UFX A;  4A2Z A;  3IU2 A;  4CAE A;  5A28 A;  4CYP A;  5G21 A;  2YND A;  4B14 A;  4CYQ A;  4CYN A;  4C2Y A;  4CGN A;  4B12 A;  4UFW A;  2WUU A;  5AGE A;  5G1Z A;  4BBH A;  4C2X A;  2YNC C;  4C2Z A;  4CYO A;  5A27 A;  3IWE A;  3H5Z A;  4A31 A;  4CAF A;  4UCN A;  4CGO A;  3JTK A;  4UCP A;  4B13 A;  4CGP A;  4UFV A;  5AG7 A;  2YNC A;  5AG4 A;  5AG6 A;  4C68 A;  4A32 A;  3IU1 A;  2YNE A;  5G22 A;  2WSA A;  4A33 A;  4UCM A;  4A95 A;  4C7H A;  4B10 A;  5G20 A;  4CGM A;  4C7I A;  4A30 A; 
#chains in the Genus database with same CATH topology
 1I1D A;  5LRK A;  1VHO A;  3D4U A;  4UWJ A;  4J3G A;  3TCV A;  4NGN A;  3S6H A;  3BJ8 A;  4ONU A;  2F5I A;  3F5B A;  3JUW A;  1Z8T A;  3NFZ A;  4KSI A;  2FT0 A;  1GYT A;  1CG2 A;  4RI1 A;  4P45 A;  3R9G A;  3T9Y A;  2HUZ A;  2POK A;  2EVN A;  3FEE A;  1X10 A;  2WUU A;  3DLJ A;  1S7F A;  4NJQ A;  3CXP A;  4E8O A;  4UCN A;  1V0C A;  5AG7 A;  4MFL A;  5LYD A;  4KOV A;  5DS0 A;  3NH5 A;  1KUV A;  2BEI A;  2CTB A;  5DWN A;  5D29 A;  4H6Z A;  5JM6 A;  1K4J A;  2Z3L A;  3SXO A;  1Y0R A;  3PB7 X;  2O28 A;  4Y49 B;  2V8V A;  1ZO0 A;  2ZW4 A;  5J8C A;  1VGY A;  4DJL A;  2VL1 A;  4UEZ A;  2WPX A;  2R7H A;  1ZG8 A;  4XNH C;  2F7V A;  2Z3N A;  2FXF A;  4CGN A;  2FIA A;  3WC7 A;  2OOT A;  4KOX A;  2RFH A;  3GYA A;  3IEH A;  1Q7L A;  4RUH A;  6CPA A;  5JPH A;  3VWE A;  3IWG A;  3S9M A;  4MFQ A;  2CXA A;  4AG9 A;  4MMO A;  2ODF A;  2PDO A;  4YGO A;  2R1I A;  2YNE A;  3LMS A;  4R87 A;  4IF5 A;  1SQH A;  4F0Y A;  3B3C A;  4KLV A;  2REF A;  1Z4R A;  4FWU A;  2JEV A;  4H2K A;  2Q4Y A;  1TKF A;  1YVO A;  4B5P A;  3B2Y A;  4LQG A;  4B11 A;  4IHM A;  3B7I A;  2B3V A;  1XEB A;  2FIW A;  2PJ6 A;  4KOY A;  4PK2 A;  2PJ2 A;  3HLP A;  1ZG9 A;  3R1K A;  2IL4 A;  4NSQ A;  1MK4 A;  1Y7R A;  2JBJ A;  4NGQ A;  2G3A A;  2FS5 A;  2DF5 A;  3V7Z A;  2EK8 A;  5AGE A;  2OZH A;  4BBH A;  4Z65 A;  4Y49 C;  2YNC C;  2QEC A;  5HVF A;  4BD9 A;  1HEE A;  2ATR A;  4ZGY B;  1EE3 P;  3PBB A;  1YVK A;  2CIJ A;  1RTQ A;  4JD6 A;  4KVX A;  1KWM A;  3DNS A;  4MBU A;  4HNW B;  3SI1 A;  2VQY A;  3D2P A;  3RO0 A;  3TTH A;  4F0X A;  3FJU A;  2PIZ A;  3IO1 A;  5KTC A;  2AFZ A;  4E0A A;  1ZG7 A;  3D67 A;  1KZF A;  2O53 A;  2Z10 A;  3F8K A;  4NXY A;  4Q38 A;  4C7I A;  1QSR A;  2JDC A;  2J9A A;  3A9L A;  4MHZ A;  3GIU A;  5H84 A;  3TOB A;  1NSA A;  1IYL A;  4QC6 A;  2GLJ A;  2ZEM A;  2BUE A;  3IGR A;  3V38 A;  4KSA A;  4CYP A;  1XOV A;  2VZY A;  3K2K A;  1LCP A;  4KZT A;  3LAC A;  5ELY A;  2CNM A;  3RZA A;  1XMB A;  2OU2 A;  4FD4 A;  4X2T A;  4B12 A;  3B3T A;  3W6S A;  1OBR A;  3FXT A;  1P0H A;  2PCU A;  2Z3M A;  2NSM A;  4C2X A;  2V8D A;  2DEA A;  4JZ0 A;  4B13 A;  2ZW5 A;  4MRI A;  1RO5 A;  1YK3 A;  2AJ6 A;  2PE3 A;  2PJ9 A;  3FBU A;  8CPA A;  4UWI A;  1XE4 A;  2GLF A;  2D4P A;  3FB3 A;  2G0B A;  5F46 A;  4HNX B;  3MGD A;  4KUB A;  4DYO A;  1JQG A;  3D66 A;  4O23 A;  4ZI6 A;  2FL4 A;  1BPM A;  3P2F A;  4A30 A;  2Z11 A;  2RC4 A;  1QSO A;  2BL1 A;  1Y9W A;  2EWB A;  3DR6 A;  4OIW A;  3G3S A;  1WK4 A;  3FIX A;  4OP4 A;  4W9Y A;  2PJ0 A;  3KI9 A;  5KTD A;  4XPD C;  1LAM A;  2CF4 A;  3KL9 A;  4OME A;  4BIN A;  4KOU A;  2ZW6 A;  4CYO A;  3G8W A;  1IGB A;  2AFO A;  2ZXV A;  4MFZ A;  4CGO A;  1A2Z A;  1S7L A;  4KVO E;  4DUK A;  1YW4 A;  4KOS A;  5D8N A;  2DPT A;  2CNT A;  2ZPA A;  5LYI A;  4UCM A;  5HMN A;  2PSW A;  4EME A;  4A39 A;  2H5M A;  4XNH B;  4FD6 A;  3NH8 A;  3VAT A;  4M6G A;  5EMI A;  3T8W A;  4MFP A;  1HDU A;  1ZLI A;  2AFM A;  2R8V A;  1XBU A;  1YLO A;  2WZN A;  5CBM A;  4MY0 A;  3WC6 A;  4FUU A;  3GUX A;  3IIB A;  4X5K A;  4A94 A;  2DPS A;  3KQZ A;  2ZEG A;  4NJR A;  4R8F A;  5F09 A;  2C27 A;  5K8M A;  1VHE A;  1XRY A;  4YU9 A;  1KUX A;  3VAR A;  5J1Q A;  2IJZ A;  4YRH A;  1YX0 A;  1ARL A;  2PJ8 A;  4IUS A;  3CZX A;  4H89 A;  3B3V A;  2PIY A;  3PGP A;  3FF3 A;  3QAH A;  3CPA A;  2ZEF A;  4P6Y A;  4MFK A;  3WAB A;  1TIQ A;  5F49 A;  4B10 A;  2C1C A;  3N7Z A;  1BAV A;  4OC2 A;  3SJF A;  1M44 A;  1IIC A;  2J8R A;  3PP9 A;  3R9E A;  2J8M A;  2VBQ A;  4EWT A;  3PEI A;  4ZY1 A;  1Z5R A;  4CRZ B;  4G1P A;  3FH4 A;  4NF1 A;  1IB1 E;  4GXH A;  5I4M A;  2ZOG A;  1LAP A;  5EBV A;  5C82 A;  2AFS A;  3R9F A;  2J8N A;  1LOK A;  2EBJ A;  3FX6 A;  4JLY A;  1CPS A;  3VH9 A;  5IX3 A;  4OID A;  1ARM A;  2PJ4 A;  2PJ3 A;  1MJ9 A;  3H8E A;  4Q36 A;  2ABZ A;  1M1D A;  3JRU A;  1CP7 A;  2AE6 A;  2BO9 A;  1CJW A;  2OB0 A;  3D3S A;  3H5Z A;  4RN7 A;  4DNC A;  2B4D A;  3TO9 A;  2QJ8 A;  1ON0 A;  4GS4 A;  3DDD A;  2B58 A;  2Q43 A;  2ZED A;  2JDD A;  1LAN A;  3IU1 A;  5F48 A;  1I12 A;  4NGM A;  2GE3 A;  4P4J A;  4NGT A;  5IB0 A;  1Q2Y A;  3OWC A;  4F8Z A;  2G9D A;  2P0W A;  5GCN A;  1IYK A;  2PJ7 A;  4CGM A;  1CP6 A;  2FCK A;  2QVP A;  2BOA A;  2PRQ A;  5AG5 A;  1LFW A;  2QYV A;  3S9N A;  2XEJ A;  1U6M A;  1S7K A;  5G21 A;  4B14 A;  4ONW A;  3F0A A;  2Z3O A;  2V77 A;  1CBX A;  1FT7 A;  3GKR A;  4A37 A;  4ZYQ A;  5EC4 A;  5K8N A;  2RB7 A;  4GM5 A;  4ZY2 A;  2VZZ A;  3CDX A;  1Z9U A;  3NE8 A;  5LYL A;  3SXN A;  3CXS A;  2P6E A;  2Z3K A;  3KAS A;  3MN8 A;  4QVT A;  2IMO A;  2BCO A;  1QQ9 A;  2B4B A;  3EC4 A;  4HKF A;  3LD2 A;  5AG6 A;  2P6G A;  2ZEP A;  3T90 A;  3FED A;  2XEI A;  4I49 A;  4U9Z A;  1TF8 A;  4MHD A;  4UBR A;  3SHP A;  4A95 A;  3PFO A;  4UF4 A;  1Q2D A;  4FD7 A;  4XPD B;  3BJ7 A;  2CTC A;  2KCW A;  2A4N A;  1XF8 A;  2GIV A;  2JLM A;  3D7D A;  3DR8 A;  4EFD A;  4R7M A;  4JXR A;  5JQ4 A;  3RNZ A;  4OC0 A;  4CYQ A;  4CS0 B;  2B3U A;  3D68 A;  1ZLH A;  2ZOF A;  3VWD A;  4F9U A;  3S6G A;  1OZP A;  2B5G B;  3ZJ0 A;  4UFW A;  4B6Z A;  4E2A A;  2AFX A;  1GHE A;  3CXQ A;  4FBE A;  3R95 A;  3PB6 X;  4C2Z A;  5C88 A;  4LQ6 A;  3QAY A;  3BLN A;  4CGP A;  4OC5 A;  5CPA A;  3UY5 A;  1XMT A;  1AYE A;  2Q04 A;  1PYT B;  3BI1 A;  3BXM A;  2C6P A;  2ZEL A;  2FSR A;  4QB9 A;  4XPK A;  2HQY A;  4KVM E;  4PK3 A;  4C7H A;  1R57 A;  3B35 A;  4II9 A;  1S5K A;  4KOT A;  3V8I A;  2Q51 A;  4FAI A;  4UFX A;  4P4E A;  2WYR A;  3QNV A;  2PVV A;  3KR5 A;  4M6I A;  3ISX A;  4P4D A;  5K8O A;  4QUS A;  4CPA A;  3E0K A;  4R6T A;  4AVB A;  3S9L A;  4MCR A;  3NH4 A;  4TNU A;  3FYN A;  2V8H A;  4P4F A;  3FEC A;  5LRJ A;  1S3Z A;  3TX8 A;  1J4J A;  3C26 A;  3SJX A;  1CPX A;  3PB8 X;  2OZG A;  4CAF A;  4CGL A;  1I21 A;  5A27 A;  3TO6 A;  4UCP A;  4XPL A;  3FRM A;  4UIB A;  4OC3 A;  5AG4 A;  3IC1 A;  4HNY B;  1YLE A;  3WR7 A;  4IAV A;  4PXC A;  4ORF A;  5FVJ A;  3R96 A;  4LX9 A;  4A33 A;  4P44 A;  1YGH A;  4KOR A;  3KQX A;  4JYW A;  2Q0Y A;  2PVW A;  5K8P A;  4UIA A;  1L0C A;  1P4N A;  1TXR A;  3TC8 A;  2QIR A;  2EK9 A;  4R3L A;  4H6U A;  5H86 A;  3NE7 A;  1N71 A;  1R43 A;  3JVN A;  3TE4 A;  1IU8 A;  2ZW7 A;  2XEF A;  4IK2 A;  4AB7 A;  5JGF A;  4PXB A;  2AFW A;  4B5P B;  1AMP A;  1QST A;  5G1Z A;  1YME A;  4ZX9 A;  2PJC A;  5DWM A;  1YRE A;  3CPX A;  1B6B A;  1R3N A;  1PU9 A;  2PJ5 A;  3GLJ A;  3JTK A;  3LWU A;  4UFV A;  4L89 A;  4AG7 A;  3EY5 A;  4CRY B;  4NGR A;  4AVA A;  5BWA B;  1FNO A;  5HVG A;  3FVL A;  3BI0 A;  4OC1 A;  1Q2C A;  1LRZ A;  2R98 A;  5JH9 A;  2ZEO A;  2ARH A;  2O4H A;  4NCZ A;  4UEF A;  2C6C A;  3IWW A;  4BMH A;  3PZJ A;  4PXD A;  1KUY A;  1B87 A;  2REE A;  2NMT A;  4KSF A;  1TKJ A;  3W91 A;  4M85 A;  4PXE A;  1IY7 A;  1UWY A;  1RXT A;  2I79 A;  4MJ8 A;  3RYO A;  4X8I A;  4X3R A;  2GU2 A;  3GY9 A;  3KKW A;  3S6K A;  4C2Y A;  1TF9 A;  1Y9K A;  1IOI A;  4AVC A;  1ELL P;  2ANP A;  4F9V A;  1BOB A;  4MCP A;  4MFJ A;  3TT2 A;  4OAD A;  1Y0Y A;  2I3C A;  1YSJ A;  2P6F A;  4UEE A;  4LUA A;  3RBU A;  2I00 A;  3EO4 A;  4F6A A;  5J8F A;  1TKH A;  1X12 A;  2VI7 A;  5HH1 A;  4MHY A;  2HB6 A;  2QML A;  1M4I A;  1VHS A;  3SI0 A;  2GRE A;  2WSA A;  2Z3P A;  3BHX A;  4PSX A;  1FY7 A;  1BPN A;  1UFH A;  5LRG A;  2D4O A;  3D7H A;  1QSN A;  2NYQ A;  3H4Q A;  4MHP A;  4ZX8 A;  5I0C A;  2GFQ A;  4R3K A;  4U5Y A;  4P4I A;  4PSW A;  1M4D A;  2CY2 A;  3MRU A;  4YFJ A;  4KS9 A;  4OLL A;  1Z2L A;  1DE4 C;  3IJ3 A;  1YQE A;  3GB0 A;  4NGP A;  4OC4 A;  1HDQ A;  2K5T A;  4JJX A;  3B8G A;  2OR4 A;  4R9M A;  4UA3 A;  3HUV A;  3KGQ A;  4NFR A;  3S6F A;  4P4B A;  1BO4 A;  4EVY A;  2Q7B A;  1YR0 A;  5ISV A;  1Y7E A;  4U9Y A;  4PQA A;  3H8F A;  3L2N A;  2GAN A;  3PFE A;  3SJG A;  1VKC A;  1IOF A;  5HXD A;  3I3G A;  1MJB A;  2X7B A;  1S60 A;  4CAV A;  3K9U A;  4M6H A;  4B5O A;  1WWZ A;  3N5F A;  4JXQ A;  1ELM P;  3D8P A;  3D7G A;  4QBJ A;  1JWQ A;  1MJA A;  4P10 A;  3IU2 A;  1DTD A;  2ZEE A;  4TWE A;  1NSL A;  3EXN A;  4MCQ A;  2DXQ A;  4K30 A;  2HV2 A;  4FD5 A;  2VEZ A;  1VIX A;  2Q44 A;  5THW A;  5KTA A;  1PCA A;  4ZY0 A;  3B3W A;  4A38 A;  3ISZ A;  5IB9 A;  4NGS A;  1QSM A;  2PRB A;  3KR4 A;  3NA6 A;  1M4G A;  2YNC A;  1XFO A;  4MXU A;  4R57 A;  4R76 A;  2G3T A;  1YW6 A;  1M4L A;  4C68 A;  4OAE A;  3TO7 A;  3P2H A;  2PR8 A;  4MY3 A;  3DSB A;  5LYF A;  1CM0 A;  3SJE A;  2Z0Z A;  3LOD A;  2EUI A;  3KHZ A;  2FE7 A;  3KZW A;  4AXV A;  4RS2 A;  4WWV A;  5IV0 A;  4A2Z A;  1PUA A;  5E96 A;  2WPW A;  1AUG A;  1XJO A;  1BLL E;  3PB4 X;  4CAX A;  3KHX A;  3B3S A;  3RAM A;  4WJB A;  3EFA A;  3TOA A;  1Z8W A;  1NMT A;  2PJA A;  5HVH A;  3PRT A;  3QB8 A;  1S7N A;  4KLW A;  2YGW A;  2VXK A;  3FMC A;  3W6X A;  4A31 A;  3H8G A;  2PJ1 A;  2OZU A;  2FVG A;  2PQ8 A;  4MHN A;  7CPA A;  2Q4Z A;  2F8H A;  4KOW A;  3IFE A;  4JWP A;  5G22 A;  3D2M A;  3WT4 A;  2EO8 A;  4M3S A;  1NE9 A;  3CT9 A;  4CAW A;  2Q4V A;  1F2O A;  1Z8X A;  2PJB A;  2Q7S A;  4HPS A;  4K3N A;  4MI4 A;  5G20 A;  2V8G A;  3FNC A;  3PB9 X;  2C6G A;  1H8L A;  4L8A A;  5F47 A;  2B4D B;  4NEX A;  3D7F A;  1Z8L A;  2ZEN A;  2BSW A;  1F57 A;  2JEW A;  3TFY A;  3I1U A;  4CAE A;  5A28 A;  1XIX A;  2PR1 A;  4YWY A;  3WC5 A;  2YND A;  4CYN A;  4OKO A;  2JBK A;  1F2P A;  2IQ6 A;  3DGV A;  5CNP A;  3PBE A;  4Q7A A;  2OH1 A;  3IWE A;  1QMU A;  4KUA A;  3SI2 A;  4PPZ A;  4PV6 A;  2PC1 A;  2CNS A;  1CX8 A;  4A32 A;  3ZZI A;  1Z4E A;  1IID A;  3I9S A;  2HC9 A;  2Y0M A;  3K9T A;  4MCS A;  2ZEH A;  2B5G A;  4ZBG A;  2AFU A;  2XEG A; 
#chains in the Genus database with same CATH homology
 1I1D A;  4UWJ A;  4J3G A;  3TCV A;  3S6H A;  3BJ8 A;  4ONU A;  2F5I A;  3F5B A;  3JUW A;  4RI1 A;  3T9Y A;  2FT0 A;  3R9G A;  2HUZ A;  2EVN A;  2WUU A;  1S7F A;  3CXP A;  4E8O A;  4UCN A;  1V0C A;  5AG7 A;  4MFL A;  4KOV A;  1KUV A;  2BEI A;  5DWN A;  4H6Z A;  1K4J A;  2Z3L A;  3SXO A;  2O28 A;  4Y49 B;  1ZO0 A;  2ZW4 A;  5J8C A;  2WPX A;  2R7H A;  4XNH C;  2Z3N A;  2FXF A;  4CGN A;  2FIA A;  4KOX A;  3GYA A;  5JPH A;  3VWE A;  3IWG A;  4MFQ A;  2CXA A;  4AG9 A;  4YGO A;  2R1I A;  2YNE A;  4R87 A;  4IF5 A;  1SQH A;  4F0Y A;  4KLV A;  2REF A;  1Z4R A;  2JEV A;  2Q4Y A;  1YVO A;  4B5P A;  4B11 A;  2B3V A;  1XEB A;  2FIW A;  4KOY A;  4PK2 A;  3R1K A;  2IL4 A;  4NSQ A;  1MK4 A;  1Y7R A;  2G3A A;  2FS5 A;  5AGE A;  2OZH A;  4BBH A;  4Y49 C;  2YNC C;  2QEC A;  2ATR A;  4ZGY B;  1YVK A;  4JD6 A;  4KVX A;  3DNS A;  4MBU A;  4HNW B;  2VQY A;  3D2P A;  3TTH A;  4F0X A;  5KTC A;  4E0A A;  4NXY A;  1KZF A;  3F8K A;  2Z10 A;  4Q38 A;  4C7I A;  1QSR A;  2JDC A;  3A9L A;  3TOB A;  5H84 A;  1IYL A;  4QC6 A;  3IGR A;  2BUE A;  4KSA A;  4CYP A;  2VZY A;  4KZT A;  2CNM A;  2OU2 A;  4FD4 A;  4B12 A;  3W6S A;  3FXT A;  1P0H A;  2Z3M A;  4C2X A;  4B13 A;  2ZW5 A;  1RO5 A;  1YK3 A;  2AJ6 A;  3FBU A;  4UWI A;  1XE4 A;  2D4P A;  3FB3 A;  2G0B A;  5F46 A;  4HNX B;  3MGD A;  4KUB A;  2FL4 A;  4A30 A;  3P2F A;  2Z11 A;  2RC4 A;  1QSO A;  2BL1 A;  1Y9W A;  3DR6 A;  3G3S A;  1WK4 A;  3FIX A;  5KTD A;  4XPD C;  4KOU A;  2ZW6 A;  4CYO A;  3G8W A;  2ZXV A;  4MFZ A;  4CGO A;  1S7L A;  4KVO E;  4KOS A;  2DPT A;  2CNT A;  2ZPA A;  4UCM A;  5HMN A;  2PSW A;  2H5M A;  4XNH B;  4FD6 A;  4MFP A;  2R8V A;  4MY0 A;  4X5K A;  2DPS A;  2C27 A;  1KUX A;  4YRH A;  1YX0 A;  4IUS A;  4H89 A;  3PGP A;  3QAH A;  4MFK A;  1TIQ A;  5F49 A;  4B10 A;  3N7Z A;  1M44 A;  1IIC A;  2J8R A;  3PP9 A;  3R9E A;  2J8M A;  2VBQ A;  4CRZ B;  2B5G A;  4NF1 A;  1IB1 E;  5EBV A;  5C82 A;  3R9F A;  2J8N A;  4JLY A;  5IX3 A;  4Q36 A;  1MJ9 A;  1M1D A;  2AE6 A;  1CJW A;  2OB0 A;  3D3S A;  3H5Z A;  4DNC A;  2B4D A;  3TO9 A;  1ON0 A;  4GS4 A;  3DDD A;  2B58 A;  3IU1 A;  2JDD A;  5F48 A;  1I12 A;  2GE3 A;  5IB0 A;  1Q2Y A;  3OWC A;  5GCN A;  2P0W A;  1IYK A;  4CGM A;  2FCK A;  5AG5 A;  1U6M A;  1S7K A;  5G21 A;  4B14 A;  3F0A A;  2Z3O A;  3GKR A;  5EC4 A;  2VZZ A;  1Z9U A;  3SXN A;  3CXS A;  2P6E A;  2Z3K A;  4QVT A;  4HKF A;  2B4B A;  3EC4 A;  3LD2 A;  5AG6 A;  2P6G A;  3T90 A;  4I49 A;  4U9Z A;  4MHD A;  3SHP A;  4UBR A;  4A95 A;  1Q2D A;  4FD7 A;  4XPD B;  3BJ7 A;  2KCW A;  2A4N A;  1XF8 A;  2GIV A;  2JLM A;  3DR8 A;  4JXR A;  5JQ4 A;  4CYQ A;  4CS0 B;  2B3U A;  3VWD A;  3S6G A;  1OZP A;  2B5G B;  3ZJ0 A;  4UFW A;  4E2A A;  1GHE A;  3CXQ A;  5C88 A;  3R95 A;  4C2Z A;  3BLN A;  4CGP A;  3UY5 A;  1XMT A;  2Q04 A;  2FSR A;  4QB9 A;  4XPK A;  2HQY A;  4KVM E;  4PK3 A;  4C7H A;  1R57 A;  4II9 A;  1S5K A;  4KOT A;  3V8I A;  4UFX A;  4QUS A;  3E0K A;  4AVB A;  3FYN A;  1S3Z A;  1J4J A;  3C26 A;  5A27 A;  2OZG A;  4CAF A;  4CGL A;  1I21 A;  3TO6 A;  4UCP A;  4XPL A;  3FRM A;  5AG4 A;  4HNY B;  1YLE A;  3WR7 A;  4ORF A;  5FVJ A;  3R96 A;  4LX9 A;  4A33 A;  1YGH A;  4KOR A;  2Q0Y A;  1L0C A;  1P4N A;  2QIR A;  4R3L A;  4H6U A;  5H86 A;  3NE7 A;  1N71 A;  3JVN A;  3TE4 A;  2ZW7 A;  4AB7 A;  4B5P B;  1QST A;  5G1Z A;  5DWM A;  1YRE A;  1B6B A;  1PU9 A;  3JTK A;  4CRY B;  4UFV A;  4L89 A;  4AG7 A;  3EY5 A;  4AVA A;  5BWA B;  1Q2C A;  1LRZ A;  2R98 A;  2ARH A;  4BMH A;  4NCZ A;  3PZJ A;  1KUY A;  1B87 A;  2REE A;  2NMT A;  4KSF A;  3W91 A;  4M85 A;  1RXT A;  2I79 A;  4MJ8 A;  3RYO A;  3S6K A;  3GY9 A;  3KKW A;  4C2Y A;  1Y9K A;  4AVC A;  1BOB A;  4MFJ A;  3TT2 A;  4OAD A;  4F6A A;  2P6F A;  4LUA A;  2I00 A;  3EO4 A;  5J8F A;  2VI7 A;  5HH1 A;  2QML A;  1M4I A;  1VHS A;  2WSA A;  2Z3P A;  4PSX A;  1FY7 A;  1UFH A;  2D4O A;  1QSN A;  5I0C A;  3H4Q A;  4R3K A;  4U5Y A;  4PSW A;  1M4D A;  2CY2 A;  4YFJ A;  4KS9 A;  4OLL A;  2K5T A;  4JJX A;  3B8G A;  4R9M A;  4UA3 A;  3S6F A;  1BO4 A;  4EVY A;  2Q7B A;  1YR0 A;  5ISV A;  4U9Y A;  2GAN A;  1VKC A;  3I3G A;  1MJB A;  2X7B A;  1S60 A;  4CAV A;  3K9U A;  4B5O A;  1WWZ A;  4JXQ A;  3D8P A;  4QBJ A;  1MJA A;  3IU2 A;  1NSL A;  3EXN A;  2DXQ A;  4K30 A;  2HV2 A;  4FD5 A;  2VEZ A;  2Q44 A;  5KTA A;  1QSM A;  2PRB A;  1M4G A;  2YNC A;  4R57 A;  4C68 A;  2G3T A;  4OAE A;  3TO7 A;  3P2H A;  2PR8 A;  4MY3 A;  3DSB A;  1CM0 A;  2Z0Z A;  3LOD A;  2EUI A;  2FE7 A;  4RS2 A;  5IV0 A;  4A2Z A;  1PUA A;  5E96 A;  2WPW A;  4CAX A;  3EFA A;  3TOA A;  1NMT A;  3QB8 A;  1S7N A;  4KLW A;  2YGW A;  2VXK A;  4A31 A;  3W6X A;  2OZU A;  2PQ8 A;  4KOW A;  4JWP A;  5G22 A;  3D2M A;  4M3S A;  1NE9 A;  4CAW A;  2Q4V A;  4MI4 A;  5G20 A;  3FNC A;  4L8A A;  5F47 A;  2B4D B;  4NEX A;  2BSW A;  3TFY A;  4CAE A;  5A28 A;  1XIX A;  2PR1 A;  2YND A;  4CYN A;  5CNP A;  2OH1 A;  3IWE A;  4KUA A;  4PV6 A;  2PC1 A;  2CNS A;  4A32 A;  3ZZI A;  1Z4E A;  1IID A;  3I9S A;  2Y0M A;  2PDO A;  4ZBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...