2JEVA

Crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
169
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIAMINE ACETYLTRANSFERASE 1
publication title Mechanistic and Structural Analysis of Human Spermidine/Spermine N(1)-Acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jevA00
5EC4A 4MJ8A 3TOAA 5H86A 4E0AA 2H5MA 1MJAA 4PSWA 3FXTA 2R1IA 4R87A 4CRZB 2Q4YA 4XPKA 2REEA 5ISVA 4X5KA 1KUXA 4KORA 3TE4A 2JEVA 1CJWA 2CY2A 2ARHA 1S60A 1KUVA 2CNSA 1VKCA 4KOYA 4E2AA 3R9EA 1WWZA 4FD7A 3FNCA 1N71A 4XNHC 1Q2CA 3FB3A 3EC4A 4M3SA 4KOVA 2OU2A 1YX0A 4KOUA 1QSTA 1XE4A 3PGPA 5DWMA 3P2FA 1MJBA 4FD6A 3BLNA 2JLMA 1MJ9A 5KTCA 1M4GA 4LX9A 4QBJA 3TTHA 4Y49B 3PZJA 1S7KA 1I12A 1QSNA 1YGHA 3FIXA 3SXNA 2G3AA 2Z0ZA 4GS4A 1I1DA 2DXQA 1M4DA 3K9UA 4U5YA 3TO9A 4E8OA 5C82A 3MGDA 1OZPA 3S6GA 2FIWA 4KLWA 4OADA 2QMLA 3R9GA 4YGOA 2VQYA 3ZJ0A 4CAWA 4RI1A 4CRYB 2ZW4A 1B6BA 4KVOE 2NMTA 5GCNA 1P0HA 3QB8A 5HMNA 2BL1A 2R7HA 2QIRA 2ZPAA 2FXFA 1TIQA 1VHSA 3VWDA 4KLVA 4Y49C 2D4OA 2PR1A 1NE9A 3QAHA 3WR7A 1Q2YA 4RS2A 5C88A 1Z9UA 4F0YA 4AB7A 4KVXA 4KOTA 3GKRA 2ZW6A 2QECA 4NF1A 1B87A 4CAXA 4FD4A 2P6GA 5IV0A 4KOWA 2G0BA 2P6EA 3GY9A 3TOBA 3FRMA 2VI7A 2GE3A 1RXTA 3IWGA 4R3KA 1YVOA 2EUIA 3DDDA 4QB9A 1YVKA 2VZZA 4IF5A 2R8VA 4NSQA 3R9FA 3N7ZA 5HH1A 4PV6A 1M1DA 3R96A 5JQ4A 2FL4A 3W6XA 1IYLA 2Q44A 3F8KA 4H6ZA 3W91A 3G8WA 1FY7A 3D2MA 5F47A 3CXSA 3EY5A 4NEXA 4KOXA 3TO7A 2ATRA 4JXQA 4K30A 5DWNA 1Y9KA 1IB1E 2B3UA 4B5PB 3I3GA 2B4BA 3P2HA 1BOBA 4YRHA 4XPLA 3V8IA 3UY5A 5CNPA 1XIXA 3FBUA 3R95A 4BMHA 4LUAA 2B3VA 1S7FA 2CNMA 2Z11A 1PUAA 4F6AA 1IYKA 4AG9A 2IL4A 2C27A 4JXRA 3BJ7A 4R57A 2HQYA 3T9YA 2PSWA 3W6SA 2GIVA 4M85A 2JDCA 2PRBA 1L0CA 4ONUA 4PK2A 2J8NA 1Y9WA 3IGRA 2VXKA 1YR0A 1MK4A 2Y0MA 2Q4VA 4JLYA 4KZTA 3S6KA 5IX3A 1QSOA 1PU9A 1RO5A 4HNYB 2EVNA 2FSRA 1BO4A 1XF8A 2HUZA 2X7BA 4UWJA 4CAVA 2VZYA 5E96A 4OAEA 4HKFA 4AVBA 3TCVA 2ZW5A 3G3SA 1XMTA 1S5KA 5EBVA 2KCWA 4QUSA 2D4PA 2I00A 3F5BA 4CS0B 2BUEA 4KUAA 1LRZA 3VWEA 4PSXA 3PP9A 5H84A 3DR6A 3C26A 2JDDA 1NSLA 1QSMA 1Y7RA 2REFA 4KOSA 5I0CA 3JVNA 2I79A 4MBUA 3SXOA 4B5PA 4MHDA 3D3SA 4DNCA 2FE7A 2G3TA 3I9SA 2J8MA 4MY3A 1M4IA 4R3LA 2VBQA 4U9ZA 2OZHA 4ORFA 3E0KA 1YLEA 4UBRA 4QVTA 4YFJA 1YREA 5F48A 4UA3A 1KUYA 3T90A 4XNHB 5F46A 2OZGA 4MY0A 5FVJA 5J8CA 3TO6A 4AVAA 4EVYA 4H6UA 4HNXB 4H89A 2PR8A 3LD2A 1V0CA 2PC1A 2K5TA 2ZXVA 4KUBA 3GYAA 4II9A 2CNTA 2B5GB 2A4NA 4L89A 2ZW7A 4QC6A 2WPXA 2FS5A 3EO4A 3DSBA 1NMTA 4B5OA 4U9YA 4NXYA 1S7NA 2B4DB 5KTAA 1U6MA 3S6FA 2F5IA 5F49A 1XEBA 3D8PA 3LODA 4NCZA 2P0WA 5J8FA 2AJ6A 1P4NA 3H4QA 1GHEA 4AVCA 2OH1A 2RC4A 2BEIA 2OB0A 1WK4A 1KZFA 3CXQA 4I49A 3SHPA 4AG7A 3FYNA 3OWCA 2FIAA 3B8GA 3DNSA 1YK3A 3DR8A 4HNWB 2Q0YA 2FT0A 1S7LA 1QSRA 2PDOA 3R1KA 2Q7BA 3CXPA 4J3GA 4JJXA 4JD6A 2Q04A 3F0AA 2AE6A 3D2PA 1IIDA 5JPHA 4ZBGA 5IB0A 3BJ8A 4XPDB 2Z10A 3TT2A 3RYOA 3TFYA 1Q2DA 1J4JA 4JWPA 3ZZIA 2B58A 1I21A 5KTDA 1IICA 2FCKA 2PQ8A 3JUWA 1S3ZA 2VEZA 2O28A 1UFHA 2B5GA 2BSWA 4PK3A 2GANA 4KVME 4UWIA 1CM0A 3EFAA 2HV2A 1K4JA 1Z4EA 3NE7A 2J8RA 3S6HA 2OZUA 4R9MA 2B4DA 3KKWA 4L8AA 3EXNA 2WPWA 1Z4RA 1SQHA 2P6FA 4XPDC 1ON0A 1M44A 4OLLA 2R98A 4MI4A 1R57A 4IUSA 4FD5A
chains in the Genus database with same CATH superfamily
5EC4A 4MJ8A 2QYVA 4GXHA 3I1UA 3D7GA 3KQXA 4DJLA 3TOAA 4OKOA 1HDUA 1PYTB 3SI0A 1LAPA 5H86A 2OR4A 4E0AA 5AG4A 2H5MA 2ANPA 1GYTA 5HVFA 1MJAA 3KQZA 4UEFA 3A9LA 5G22A 4B12A 1VIXA 3HLPA 4PSWA 1HEEA 4MMOA 2V8DA 4EMEA 2DPTA 2R1IA 3FXTA 4R87A 4CRZB 1CBXA 2Q4YA 4XPKA 4C68A 2REEA 5ISVA 3ISXA 4X5KA 1KUXA 4KORA 3TE4A 2JEVA 4C7HA 5LRKA 1Z2LA 1CJWA 4M6IA 2CY2A 2ARHA 5CPAA 1S60A 1KUVA 2CNSA 1VKCA 4A2ZA 2Q43A 1YQEA 1M4LA 4KOYA 3D7FA 4TWEA 3NA6A 4E2AA 2AFZA 1Y0YA 5G20A 3ISZA 3R9EA 2XEJA 2ODFA 4OC2A 1WWZA 2O4HA 2ZELA 4FD7A 4CYNA 3FNCA 1ZLIA 4R6TA 3KZWA 5LRJA 1N71A 2Q51A 4XNHC 4P45A 1Q2CA 4OMEA 3FB3A 4FAIA 4MCRA 3EC4A 3LACA 3PB9X 2PJ8A 2NSMA 3PB4X 4M3SA 4KOVA 4P44A 3B3CA 4MFZA 1TF8A 1ZG8A 2FVGA 2OU2A 3GUXA 4UFWA 1YX0A 4KOUA 1QSTA 1XE4A 1Q7LA 2PVVA 3PGPA 3D68A 3K9TA 5DWMA 5A27A 3P2FA 1MJBA 3FX6A 3IEHA 4FD6A 4NGQA 2AFUA 1XJOA 3BLNA 4G1PA 2JLMA 2ZEOA 1XRYA 4WWVA 4CAFA 1MJ9A 5KTCA 1M4GA 2ZEHA 4LX9A 4QBJA 3TTHA 4GM5A 4Y49B 1VGYA 3PZJA 1S7KA 4KSFA 4Q7AA 2J9AA 2RFHA 1I12A 1QSNA 5G1ZA 4F8ZA 2C6GA 1YGHA 3FIXA 3GIUA 2PJ9A 3SXNA 2CTCA 4X2TA 2G3AA 3WT4A 2Z0ZA 1X12A 4GS4A 2XEIA 1I1DA 1CX8A 1M4DA 2DXQA 2AFSA 3K9UA 4U5YA 3TO9A 4E8OA 5C82A 3MGDA 1OZPA 3CPAA 1XMBA 3S6GA 1IY7A 2FIWA 4KLWA 4LQGA 4OADA 2ZENA 4MCPA 2QMLA 3R9GA 2PVWA 1ZO0A 4W9YA 4YGOA 2VQYA 5D29A 3ZJ0A 4CAWA 2ZEPA 4RI1A 4CRYB 1R3NA 2ZW4A 2Z3NA 4NGNA 4UF4A 1B6BA 2DF5A 4KVOE 4CGMA 2NMTA 5K8NA 5GCNA 2EO8A 1P0HA 4M6HA 4A94A 5A28A 3QB8A 5HMNA 2BL1A 2R7HA 1IU8A 2O53A 1ZG7A 2PJ5A 2QIRA 2ZPAA 2IMOA 3MRUA 2FXFA 4KS9A 4DYOA 5HVHA 1TIQA 1VHSA 4OIDA 4KLVA 3VWDA 4CGPA 2BO9A 2C6PA 1FNOA 2D4OA 4Y49C 5K8PA 2AFXA 2PR1A 3H5ZA 2Z3MA 4NJQA 1NE9A 3IWWA 4OC5A 3QAHA 3WR7A 1Q2YA 4RS2A 3NE8A 4R8FA 4P4DA 4A95A 2YGWA 5C88A 1Z9UA 8CPAA 4P4JA 1X10A 4F0YA 4AB7A 3PFOA 4Z65A 4KVXA 2PIYA 4A31A 1LFWA 4KOTA 1BLLE 3GKRA 4OC1A 4P4IA 1FT7A 2ZW6A 2QECA 3NFZA 4NF1A 1B87A 2YNEA 4O23A 4CAXA 1TXRA 4FD4A 2P6GA 2QJ8A 5IV0A 1ZLHA 4KOWA 4NJRA 2G0BA 4HPSA 4A37A 2P6EA 3QAYA 1OBRA 3GY9A 4OC3A 3TOBA 3FRMA 1Y7EA 2VI7A 4P6YA 2GE3A 2PCUA 1RXTA 2WYRA 2GLJA 3IWGA 4R3KA 1YVOA 2EUIA 2BOAA 5K8OA 3DDDA 2PJ1A 4QB9A 3SJGA 1YVKA 2VZZA 3FEDA 4IF5A 2R8VA 4NSQA 2PJCA 3R9FA 3FEEA 2BCOA 4P4BA 1ZG9A 2V8GA 3N7ZA 5HH1A 1F2PA 4PV6A 1M1DA 2PRQA 3R96A 4F9UA 5JQ4A 2ZOGA 4FBEA 2FL4A 3W6XA 1IYLA 5JGFA 3FF3A 1F2OA 2Q44A 3F8KA 4H6ZA 3W91A 2NYQA 3G8WA 1FY7A 3D2MA 5F47A 2GREA 2QVPA 2AFMA 3CXSA 3EY5A 2PJ4A 4NEXA 4KOXA 1XOVA 3SJFA 3TO7A 1YLOA 2ATRA 4JXQA 4K30A 4OIWA 2Z3PA 5DWNA 1Y9KA 1IB1E 2B3UA 3DLJA 3HUVA 4B5PB 3I3GA 2ZEGA 1ELLP 3K2KA 2B4BA 2PJ0A 2V8HA 3P2HA 4UFVA 1BOBA 4YRHA 4XPLA 3V8IA 4A38A 3S9LA 3UY5A 5J1QA 5CNPA 1XIXA 3FBUA 3R95A 4BMHA 4LUAA 1UWYA 2B3VA 1S7FA 4ZY2A 4UEZA 2CNMA 2AFOA 3N5FA 3WC6A 5LYIA 1Z8XA 4IAVA 2Z11A 3SJEA 1PUAA 1IOFA 4F6AA 5JM6A 1IYKA 4AG9A 4JYWA 1IGBA 2C27A 2IL4A 2WUUA 4JXRA 3RZAA 3BJ7A 3H8FA 4LQ6A 4R57A 4ZX8A 2HQYA 4PXEA 3T9YA 2PSWA 1CG2A 3W6SA 2I3CA 4UCPA 4CPAA 1BAVA 4MFJA 2GIVA 3QNVA 2JDCA 4M85A 2PRBA 1L0CA 4ONUA 4PK2A 3KHZA 2CIJA 2J8NA 3KASA 1ELMP 4KSIA 5LYFA 1Y9WA 3IGRA 2JEWA 4X8IA 3KGQA 4K3NA 2VXKA 1YR0A 4IK2A 1MK4A 2Y0MA 4P10A 2Q4VA 4JLYA 4KZTA 4M6GA 2ZEDA 2GFQA 2GLFA 3S6KA 1QSOA 4C2ZA 1PU9A 1RO5A 1TKJA 2F8HA 3S9NA 4HNYB 1YW4A 4CGOA 3CT9A 5AGEA 2EVNA 2EK8A 4KSAA 3TX8A 4ZY0A 2FSRA 1Y0RA 1AYEA 1BO4A 3JRUA 4MCSA 4P4EA 5AG7A 4CYPA 1XF8A 2HUZA 2X7BA 3IO1A 4UWJA 4CAVA 2VZYA 5E96A 4FUUA 1YW6A 4OAEA 2XEGA 4ZX9A 4HKFA 4CGNA 4AVBA 2AFWA 2Z3LA 3TCVA 2ZW5A 3G3SA 4UIBA 2EK9A 1XMTA 3PB6X 4AXVA 5LYLA 1S5KA 5DS0A 1CP6A 2KCWA 5EBVA 4QUSA 2D4PA 2I00A 3F5BA 4B13A 3B3SA 3WABA 4CS0B 2HB6A 2BUEA 4KUAA 3PFEA 1LRZA 1LCPA 2XEFA 3IU1A 4BD9A 5IB9A 3VWEA 4PSXA 3RBUA 4EWTA 3PP9A 4NGSA 4WJBA 5H84A 4F9VA 3DR6A 3D7DA 4BBHA 4MFPA 2ZEMA 2JDDA 3C26A 5HVGA 1VHOA 1EE3P 1HDQA 2PJ3A 1ARLA 1NSLA 3IFEA 1QSMA 1Y7RA 2REFA 3IWEA 4KOSA 5I0CA 1KWMA 4C2YA 5JH9A 1LAMA 3DGVA 3JVNA 2I79A 4MBUA 3SXOA 3IIBA 4DUKA 4B5PA 4MHDA 3D3SA 4A30A 4OC4A 4DNCA 2FE7A 2G3TA 4PXBA 1Z8LA 3I9SA 2JBJA 3B3VA 1Z8TA 2V77A 1TKFA 3BXMA 2J8MA 4UEEA 4MY3A 3JTKA 4NFRA 1M4IA 4R3LA 2PJAA 2VBQA 5LYDA 2C6CA 3CPXA 4U9ZA 2OZHA 1H8LA 1PCAA 3BI1A 3KR5A 4ORFA 5D8NA 2VL1A 4MRIA 3PBBA 3T8WA 2RB7A 4YWYA 4A32A 3IJ3A 5G21A 3E0KA 1YLEA 4UBRA 3B7IA 4QVTA 2C1CA 2ZOFA 4NGRA 5LRGA 4ZYQA 4YFJA 1Z8WA 2GU2A 3VARA 3SI1A 1YREA 2IJZA 3IC1A 4PXDA 4MXUA 3NH5A 5F48A 4UA3A 1KUYA 3PB8X 1XBUA 3CZXA 3T90A 4XNHB 4RN7A 5F46A 2OZGA 4MY0A 5FVJA 1JQGA 5J8CA 3LWUA 3TO6A 3L2NA 2V8VA 4AVAA 4EVYA 3VATA 4H6UA 4CAEA 4HNXB 3PB7X 4H89A 4YU9A 1DE4C 3B35A 3D67A 2PR8A 3BHXA 1V0CA 3LD2A 4FWUA 4MHNA 2PC1A 3FJUA 2PE3A 2K5TA 2ZXVA 4KUBA 4JZ0A 4A39A 4CGLA 3GYAA 4ONWA 2CNTA 5HXDA 4II9A 2JBKA 3FVLA 2B5GB 2A4NA 4L89A 4UCNA 3RNZA 2ZW7A 4QC6A 4R76A 5BWAB 3NH8A 2EBJA 5CBMA 2FS5A 2CF4A 2WPXA 1CPSA 3DSBA 3EO4A 1NMTA 4B5OA 1YSJA 4B10A 3GB0A 4UCMA 1LOKA 1Z5RA 2CTBA 2Z3OA 4U9YA 4NXYA 1S7NA 5F09A 3RAMA 2B4DB 4MCQA 1RTQA 5KTAA 1ARMA 1U6MA 5ELYA 3S6FA 4ZGYB 3VH9A 4IHMA 3WC5A 1QMUA 2F5IA 2Q7SA 5AG5A 5F49A 3WC7A 4B11A 1XEBA 4TNUA 3D8PA 3LODA 4NCZA 3TC8A 2P0WA 3FH4A 3SJXA 5J8FA 2AJ6A 1P4NA 3H4QA 4R7MA 1GHEA 3RO0A 2YNCC 4AVCA 4PPZA 2OH1A 4UIAA 4MFLA 3FMCA 2RC4A 1CPXA 2BEIA 4MHYA 2OB0A 1WK4A 4BINA 3KR4A 1KZFA 3CXQA 4I49A 4CYQA 4PXCA 2YNDA 3SHPA 4NGTA 4AG7A 3FYNA 3OWCA 2FIAA 5THWA 3PEIA 4OP4A 3B8GA 3DNSA 3KL9A 1AUGA 1YK3A 1R43A 4MFKA 2EWBA 3DR8A 4ZY1A 3B3TA 4A33A 4Q38A 4HNWB 2Q0YA 3BI0A 3B2YA 2FT0A 1S7LA 7CPAA 2WZNA 3CDXA 3V38A 5EMIA 4NGMA 1QSRA 2PDOA 3R1KA 4OC0A 2Q7BA 3CXPA 4J3GA 1JWQA 4RUHA 4JJXA 4ZI6A 1CP7A 1NSAA 4F0XA 4JD6A 2Z3KA 3B3WA 2Q04A 3F0AA 2AE6A 3D2PA 3D7HA 4B6ZA 2OOTA 1IIDA 2G9DA 2POKA 5IX3A 2DEAA 2Q4ZA 3MN8A 3S9MA 3KI9A 5JPHA 4ZBGA 5IB0A 3BJ8A 2PJ7A 4XPDB 1TKHA 5AG6A 3V7ZA 1F57A 3LMSA 3H8GA 2Z10A 4Q36A 3TT2A 3RYOA 1IOIA 3TFYA 1BPNA 4NGPA 1Q2DA 2F7VA 3D66A 1J4JA 4JWPA 1BPMA 3ZZIA 2B58A 1I21A 2YNCA 5KTDA 2PJBA 1YMEA 2DPSA 1IICA 3PBEA 2FCKA 2PJ6A 4EFDA 1QQ9A 3FECA 4X3RA 2PQ8A 3JUWA 3GLJA 3H8EA 1S3ZA 2VEZA 3PRTA 4CYOA 5K8MA 2O28A 1UFHA 2B5GA 2PJ2A 4MFQA 2BSWA 1XFOA 4MHPA 4PK3A 4P4FA 2GANA 2ABZA 4H2KA 4KVME 4B14A 4C2XA 1AMPA 4UWIA 2ZEEA 1CM0A 2WSAA 3EFAA 2PIZA 2HV2A 1K4JA 2ZEFA 1Z4EA 2IQ6A 1DTDA 2J8RA 3NE7A 3S6HA 1VHEA 2OZUA 4R9MA 2HC9A 4MHZA 2B4DA 5I4MA 1Z4RA 2P6FA 1SQHA 2WPWA 3EXNA 3KKWA 4L8AA 4PQAA 4XPDC 3SI2A 1ON0A 1LANA 1TF9A 6CPAA 3D4UA 1M44A 4OLLA 2R98A 4C7IA 3KHXA 3NH4A 3IU2A 4UFXA 4MI4A 2CXAA 1R57A 4IUSA 4FD5A 1A2ZA
chains in the Genus database with same CATH topology
5EC4A 4MJ8A 3TOAA 5H86A 4E0AA 5AG4A 2H5MA 1MJAA 5G22A 4B12A 3A9LA 4PSWA 2DPTA 2R1IA 3FXTA 4R87A 4CRZB 2Q4YA 4XPKA 4C68A 2REEA 5ISVA 4X5KA 1KUXA 4KORA 3TE4A 2JEVA 4C7HA 1CJWA 2CY2A 2ARHA 1S60A 1KUVA 2CNSA 1VKCA 4A2ZA 4KOYA 4E2AA 5G20A 3R9EA 1WWZA 4FD7A 4CYNA 3FNCA 1N71A 4XNHC 1Q2CA 3FB3A 3EC4A 4M3SA 4KOVA 4MFZA 2OU2A 4UFWA 1YX0A 4KOUA 1QSTA 1XE4A 3PGPA 5DWMA 5A27A 3P2FA 1MJBA 4FD6A 3BLNA 2JLMA 4CAFA 1MJ9A 5KTCA 1M4GA 4LX9A 4QBJA 3TTHA 4Y49B 3PZJA 1S7KA 4KSFA 5G1ZA 1I12A 1QSNA 1YGHA 3FIXA 3SXNA 2G3AA 2Z0ZA 4GS4A 1I1DA 2DXQA 1M4DA 3K9UA 4U5YA 3TO9A 4E8OA 5C82A 3MGDA 1OZPA 3S6GA 2FIWA 4KLWA 4OADA 2QMLA 3R9GA 1ZO0A 4YGOA 2VQYA 3ZJ0A 4CAWA 4RI1A 4CRYB 2ZW4A 2Z3NA 1B6BA 4KVOE 4CGMA 2NMTA 5GCNA 1P0HA 5A28A 3QB8A 5HMNA 2BL1A 2R7HA 2QIRA 4KS9A 2ZPAA 2FXFA 1TIQA 1VHSA 3VWDA 4KLVA 4CGPA 4Y49C 2D4OA 2PR1A 3H5ZA 2Z3MA 1NE9A 3QAHA 3WR7A 1Q2YA 4RS2A 4A95A 2YGWA 5C88A 1Z9UA 4F0YA 4AB7A 4KVXA 4A31A 4KOTA 3GKRA 2ZW6A 2QECA 4NF1A 1B87A 2YNEA 4CAXA 4FD4A 2P6GA 5IV0A 4KOWA 2G0BA 2P6EA 3GY9A 3TOBA 3FRMA 2VI7A 2GE3A 1RXTA 3IWGA 4R3KA 1YVOA 2EUIA 3DDDA 4QB9A 1YVKA 2VZZA 4IF5A 2R8VA 4NSQA 3R9FA 3N7ZA 5HH1A 4PV6A 1M1DA 3R96A 5JQ4A 2FL4A 3W6XA 1IYLA 2Q44A 3F8KA 4H6ZA 3W91A 3G8WA 1FY7A 3D2MA 5F47A 3CXSA 3EY5A 4NEXA 4KOXA 3TO7A 2ATRA 4JXQA 4K30A 2Z3PA 5DWNA 1Y9KA 1IB1E 2B3UA 4B5PB 3I3GA 2B4BA 3P2HA 4UFVA 1BOBA 4YRHA 4XPLA 3V8IA 3UY5A 5CNPA 1XIXA 3FBUA 3R95A 4BMHA 4LUAA 2B3VA 1S7FA 2CNMA 2Z11A 1PUAA 4F6AA 1IYKA 4AG9A 2IL4A 2C27A 2WUUA 4JXRA 3BJ7A 4R57A 2HQYA 3T9YA 2PSWA 3W6SA 4UCPA 4MFJA 2GIVA 4M85A 2JDCA 2PRBA 1L0CA 4ONUA 4PK2A 2J8NA 1Y9WA 3IGRA 2VXKA 1YR0A 1MK4A 2Y0MA 2Q4VA 4JLYA 4KZTA 3S6KA 4C2ZA 5IX3A 1QSOA 1PU9A 1RO5A 4HNYB 4CGOA 5AGEA 2EVNA 4KSAA 2FSRA 5AG7A 1BO4A 4CYPA 1XF8A 2HUZA 2X7BA 4UWJA 4CAVA 2VZYA 5E96A 4OAEA 4HKFA 4CGNA 4AVBA 2Z3LA 3TCVA 2ZW5A 3G3SA 1XMTA 1S5KA 5EBVA 2KCWA 4QUSA 2D4PA 2I00A 3F5BA 4B13A 4CS0B 2BUEA 4KUAA 1LRZA 3IU1A 3VWEA 4PSXA 3PP9A 5H84A 3DR6A 4BBHA 4MFPA 3C26A 2JDDA 1NSLA 1QSMA 1Y7RA 2REFA 3IWEA 4KOSA 5I0CA 4C2YA 3JVNA 2I79A 4MBUA 3SXOA 4B5PA 4MHDA 3D3SA 4A30A 4DNCA 2FE7A 2G3TA 3I9SA 2J8MA 4MY3A 3JTKA 1M4IA 4R3LA 2VBQA 4U9ZA 2OZHA 4ORFA 4A32A 5G21A 3E0KA 1YLEA 4UBRA 4QVTA 4YFJA 1YREA 5F48A 4UA3A 1KUYA 3T90A 4XNHB 5F46A 2OZGA 4MY0A 5FVJA 5J8CA 3TO6A 4AVAA 4EVYA 4H6UA 4CAEA 4HNXB 4H89A 2PR8A 3LD2A 1V0CA 2PC1A 2K5TA 2ZXVA 4KUBA 4CGLA 3GYAA 4II9A 2CNTA 2B5GB 2A4NA 4L89A 4UCNA 2ZW7A 4QC6A 5BWAB 2WPXA 2FS5A 3EO4A 3DSBA 1NMTA 4B5OA 4B10A 4UCMA 2Z3OA 4U9YA 4NXYA 1S7NA 2B4DB 5KTAA 4ZGYB 1U6MA 3S6FA 2F5IA 5AG5A 5F49A 4B11A 1XEBA 3D8PA 3LODA 4NCZA 2P0WA 5J8FA 2AJ6A 1P4NA 3H4QA 1GHEA 2YNCC 4AVCA 2OH1A 4MFLA 2RC4A 2BEIA 2OB0A 1WK4A 1KZFA 3CXQA 4I49A 4CYQA 2YNDA 3SHPA 4AG7A 3FYNA 3OWCA 2FIAA 3B8GA 3DNSA 1YK3A 4MFKA 3DR8A 4A33A 4Q38A 4HNWB 2Q0YA 2FT0A 1S7LA 1QSRA 2PDOA 3R1KA 2Q7BA 3CXPA 4J3GA 4JJXA 4F0XA 4JD6A 2Z3KA 2Q04A 3F0AA 2AE6A 3D2PA 1IIDA 5JPHA 4ZBGA 5IB0A 3BJ8A 4XPDB 5AG6A 2Z10A 4Q36A 3TT2A 3RYOA 3TFYA 1Q2DA 1J4JA 4JWPA 3ZZIA 2B58A 1I21A 2YNCA 5KTDA 2DPSA 1IICA 2FCKA 2PQ8A 3JUWA 1S3ZA 2VEZA 4CYOA 2O28A 1UFHA 2B5GA 4MFQA 2BSWA 4PK3A 2GANA 4KVME 4B14A 4C2XA 4UWIA 1CM0A 2WSAA 3EFAA 2HV2A 1K4JA 1Z4EA 3NE7A 2J8RA 3S6HA 2OZUA 4R9MA 2B4DA 3KKWA 3EXNA 2WPWA 1Z4RA 1SQHA 2P6FA 4L8AA 4XPDC 1ON0A 1M44A 4OLLA 2R98A 4C7IA 3IU2A 4UFXA 4MI4A 2CXAA 1R57A 4IUSA 4FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC4 A;  4MJ8 A;  3TOA A;  5H86 A;  4E0A A;  2H5M A;  1MJA A;  4PSW A;  3FXT A;  2R1I A;  4R87 A;  4CRZ B;  2Q4Y A;  4XPK A;  2REE A;  5ISV A;  4X5K A;  1KUX A;  4KOR A;  3TE4 A;  2JEV A;  1CJW A;  2CY2 A;  2ARH A;  1S60 A;  1KUV A;  2CNS A;  1VKC A;  4KOY A;  4E2A A;  3R9E A;  1WWZ A;  4FD7 A;  3FNC A;  1N71 A;  4XNH C;  1Q2C A;  3FB3 A;  3EC4 A;  4M3S A;  4KOV A;  2OU2 A;  1YX0 A;  4KOU A;  1QST A;  1XE4 A;  3PGP A;  5DWM A;  3P2F A;  1MJB A;  4FD6 A;  3BLN A;  2JLM A;  1MJ9 A;  5KTC A;  1M4G A;  4LX9 A;  4QBJ A;  3TTH A;  4Y49 B;  3PZJ A;  1S7K A;  1I12 A;  1QSN A;  1YGH A;  3FIX A;  3SXN A;  2G3A A;  2Z0Z A;  4GS4 A;  1I1D A;  2DXQ A;  1M4D A;  3K9U A;  4U5Y A;  3TO9 A;  4E8O A;  5C82 A;  3MGD A;  1OZP A;  3S6G A;  2FIW A;  4KLW A;  4OAD A;  2QML A;  3R9G A;  4YGO A;  2VQY A;  3ZJ0 A;  4CAW A;  4RI1 A;  4CRY B;  2ZW4 A;  1B6B A;  4KVO E;  2NMT A;  5GCN A;  1P0H A;  3QB8 A;  5HMN A;  2BL1 A;  2R7H A;  2QIR A;  2ZPA A;  2FXF A;  1TIQ A;  1VHS A;  3VWD A;  4KLV A;  4Y49 C;  2D4O A;  2PR1 A;  1NE9 A;  3QAH A;  3WR7 A;  1Q2Y A;  4RS2 A;  5C88 A;  1Z9U A;  4F0Y A;  4AB7 A;  4KVX A;  4KOT A;  3GKR A;  2ZW6 A;  2QEC A;  4NF1 A;  1B87 A;  4CAX A;  4FD4 A;  2P6G A;  5IV0 A;  4KOW A;  2G0B A;  2P6E A;  3GY9 A;  3TOB A;  3FRM A;  2VI7 A;  2GE3 A;  1RXT A;  3IWG A;  4R3K A;  1YVO A;  2EUI A;  3DDD A;  4QB9 A;  1YVK A;  2VZZ A;  4IF5 A;  2R8V A;  4NSQ A;  3R9F A;  3N7Z A;  5HH1 A;  4PV6 A;  1M1D A;  3R96 A;  5JQ4 A;  2FL4 A;  3W6X A;  1IYL A;  2Q44 A;  3F8K A;  4H6Z A;  3W91 A;  3G8W A;  1FY7 A;  3D2M A;  5F47 A;  3CXS A;  3EY5 A;  4NEX A;  4KOX A;  3TO7 A;  2ATR A;  4JXQ A;  4K30 A;  5DWN A;  1Y9K A;  1IB1 E;  2B3U A;  4B5P B;  3I3G A;  2B4B A;  3P2H A;  1BOB A;  4YRH A;  4XPL A;  3V8I A;  3UY5 A;  5CNP A;  1XIX A;  3FBU A;  3R95 A;  4BMH A;  4LUA A;  2B3V A;  1S7F A;  2CNM A;  2Z11 A;  1PUA A;  4F6A A;  1IYK A;  4AG9 A;  2IL4 A;  2C27 A;  4JXR A;  3BJ7 A;  4R57 A;  2HQY A;  3T9Y A;  2PSW A;  3W6S A;  2GIV A;  4M85 A;  2JDC A;  2PRB A;  1L0C A;  4ONU A;  4PK2 A;  2J8N A;  1Y9W A;  3IGR A;  2VXK A;  1YR0 A;  1MK4 A;  2Y0M A;  2Q4V A;  4JLY A;  4KZT A;  3S6K A;  5IX3 A;  1QSO A;  1PU9 A;  1RO5 A;  4HNY B;  2EVN A;  2FSR A;  1BO4 A;  1XF8 A;  2HUZ A;  2X7B A;  4UWJ A;  4CAV A;  2VZY A;  5E96 A;  4OAE A;  4HKF A;  4AVB A;  3TCV A;  2ZW5 A;  3G3S A;  1XMT A;  1S5K A;  5EBV A;  2KCW A;  4QUS A;  2D4P A;  2I00 A;  3F5B A;  4CS0 B;  2BUE A;  4KUA A;  1LRZ A;  3VWE A;  4PSX A;  3PP9 A;  5H84 A;  3DR6 A;  3C26 A;  2JDD A;  1NSL A;  1QSM A;  1Y7R A;  2REF A;  4KOS A;  5I0C A;  3JVN A;  2I79 A;  4MBU A;  3SXO A;  4B5P A;  4MHD A;  3D3S A;  4DNC A;  2FE7 A;  2G3T A;  3I9S A;  2J8M A;  4MY3 A;  1M4I A;  4R3L A;  2VBQ A;  4U9Z A;  2OZH A;  4ORF A;  3E0K A;  1YLE A;  4UBR A;  4QVT A;  4YFJ A;  1YRE A;  5F48 A;  4UA3 A;  1KUY A;  3T90 A;  4XNH B;  5F46 A;  2OZG A;  4MY0 A;  5FVJ A;  5J8C A;  3TO6 A;  4AVA A;  4EVY A;  4H6U A;  4HNX B;  4H89 A;  2PR8 A;  3LD2 A;  1V0C A;  2PC1 A;  2K5T A;  2ZXV A;  4KUB A;  3GYA A;  4II9 A;  2CNT A;  2B5G B;  2A4N A;  4L89 A;  2ZW7 A;  4QC6 A;  2WPX A;  2FS5 A;  3EO4 A;  3DSB A;  1NMT A;  4B5O A;  4U9Y A;  4NXY A;  1S7N A;  2B4D B;  5KTA A;  1U6M A;  3S6F A;  2F5I A;  5F49 A;  1XEB A;  3D8P A;  3LOD A;  4NCZ A;  2P0W A;  5J8F A;  2AJ6 A;  1P4N A;  3H4Q A;  1GHE A;  4AVC A;  2OH1 A;  2RC4 A;  2BEI A;  2OB0 A;  1WK4 A;  1KZF A;  3CXQ A;  4I49 A;  3SHP A;  4AG7 A;  3FYN A;  3OWC A;  2FIA A;  3B8G A;  3DNS A;  1YK3 A;  3DR8 A;  4HNW B;  2Q0Y A;  2FT0 A;  1S7L A;  1QSR A;  2PDO A;  3R1K A;  2Q7B A;  3CXP A;  4J3G A;  4JJX A;  4JD6 A;  2Q04 A;  3F0A A;  2AE6 A;  3D2P A;  1IID A;  5JPH A;  4ZBG A;  5IB0 A;  3BJ8 A;  4XPD B;  2Z10 A;  3TT2 A;  3RYO A;  3TFY A;  1Q2D A;  1J4J A;  4JWP A;  3ZZI A;  2B58 A;  1I21 A;  5KTD A;  1IIC A;  2FCK A;  2PQ8 A;  3JUW A;  1S3Z A;  2VEZ A;  2O28 A;  1UFH A;  2B5G A;  2BSW A;  4PK3 A;  2GAN A;  4KVM E;  4UWI A;  1CM0 A;  3EFA A;  2HV2 A;  1K4J A;  1Z4E A;  3NE7 A;  2J8R A;  3S6H A;  2OZU A;  4R9M A;  2B4D A;  3KKW A;  4L8A A;  3EXN A;  2WPW A;  1Z4R A;  1SQH A;  2P6F A;  4XPD C;  1ON0 A;  1M44 A;  4OLL A;  2R98 A;  4MI4 A;  1R57 A;  4IUS A;  4FD5 A; 
#chains in the Genus database with same CATH topology
 5EC4 A;  4MJ8 A;  2QYV A;  4GXH A;  3I1U A;  3D7G A;  3KQX A;  4DJL A;  3TOA A;  4OKO A;  1HDU A;  1PYT B;  3SI0 A;  1LAP A;  5H86 A;  2OR4 A;  4E0A A;  5AG4 A;  2H5M A;  2ANP A;  1GYT A;  5HVF A;  1MJA A;  3KQZ A;  4UEF A;  3A9L A;  5G22 A;  4B12 A;  1VIX A;  3HLP A;  4PSW A;  1HEE A;  4MMO A;  2V8D A;  4EME A;  2DPT A;  2R1I A;  3FXT A;  4R87 A;  4CRZ B;  1CBX A;  2Q4Y A;  4XPK A;  4C68 A;  2REE A;  5ISV A;  3ISX A;  4X5K A;  1KUX A;  4KOR A;  3TE4 A;  2JEV A;  4C7H A;  5LRK A;  1Z2L A;  1CJW A;  4M6I A;  2CY2 A;  2ARH A;  5CPA A;  1S60 A;  1KUV A;  2CNS A;  1VKC A;  4A2Z A;  2Q43 A;  1YQE A;  1M4L A;  4KOY A;  3D7F A;  4TWE A;  3NA6 A;  4E2A A;  2AFZ A;  1Y0Y A;  5G20 A;  3ISZ A;  3R9E A;  2XEJ A;  2ODF A;  4OC2 A;  1WWZ A;  2O4H A;  2ZEL A;  4FD7 A;  4CYN A;  3FNC A;  1ZLI A;  4R6T A;  3KZW A;  5LRJ A;  1N71 A;  2Q51 A;  4XNH C;  4P45 A;  1Q2C A;  4OME A;  3FB3 A;  4FAI A;  4MCR A;  3EC4 A;  3LAC A;  3PB9 X;  2PJ8 A;  2NSM A;  3PB4 X;  4M3S A;  4KOV A;  4P44 A;  3B3C A;  4MFZ A;  1TF8 A;  1ZG8 A;  2FVG A;  2OU2 A;  3GUX A;  4UFW A;  1YX0 A;  4KOU A;  1QST A;  1XE4 A;  1Q7L A;  2PVV A;  3PGP A;  3D68 A;  3K9T A;  5DWM A;  5A27 A;  3P2F A;  1MJB A;  3FX6 A;  3IEH A;  4FD6 A;  4NGQ A;  2AFU A;  1XJO A;  3BLN A;  4G1P A;  2JLM A;  2ZEO A;  1XRY A;  4WWV A;  4CAF A;  1MJ9 A;  5KTC A;  1M4G A;  2ZEH A;  4LX9 A;  4QBJ A;  3TTH A;  4GM5 A;  4Y49 B;  1VGY A;  3PZJ A;  1S7K A;  4KSF A;  4Q7A A;  2J9A A;  2RFH A;  1I12 A;  1QSN A;  5G1Z A;  4F8Z A;  2C6G A;  1YGH A;  3FIX A;  3GIU A;  2PJ9 A;  3SXN A;  2CTC A;  4X2T A;  2G3A A;  3WT4 A;  2Z0Z A;  1X12 A;  4GS4 A;  2XEI A;  1I1D A;  1CX8 A;  1M4D A;  2DXQ A;  2AFS A;  3K9U A;  4U5Y A;  3TO9 A;  4E8O A;  5C82 A;  3MGD A;  1OZP A;  3CPA A;  1XMB A;  3S6G A;  1IY7 A;  2FIW A;  4KLW A;  4LQG A;  4OAD A;  2ZEN A;  4MCP A;  2QML A;  3R9G A;  2PVW A;  1ZO0 A;  4W9Y A;  4YGO A;  2VQY A;  5D29 A;  3ZJ0 A;  4CAW A;  2ZEP A;  4RI1 A;  4CRY B;  1R3N A;  2ZW4 A;  2Z3N A;  4NGN A;  4UF4 A;  1B6B A;  2DF5 A;  4KVO E;  4CGM A;  2NMT A;  5K8N A;  5GCN A;  2EO8 A;  1P0H A;  4M6H A;  4A94 A;  5A28 A;  3QB8 A;  5HMN A;  2BL1 A;  2R7H A;  1IU8 A;  2O53 A;  1ZG7 A;  2PJ5 A;  2QIR A;  2ZPA A;  2IMO A;  3MRU A;  2FXF A;  4KS9 A;  4DYO A;  5HVH A;  1TIQ A;  1VHS A;  4OID A;  4KLV A;  3VWD A;  4CGP A;  2BO9 A;  2C6P A;  1FNO A;  2D4O A;  4Y49 C;  5K8P A;  2AFX A;  2PR1 A;  3H5Z A;  2Z3M A;  4NJQ A;  1NE9 A;  3IWW A;  4OC5 A;  3QAH A;  3WR7 A;  1Q2Y A;  4RS2 A;  3NE8 A;  4R8F A;  4P4D A;  4A95 A;  2YGW A;  5C88 A;  1Z9U A;  8CPA A;  4P4J A;  1X10 A;  4F0Y A;  4AB7 A;  3PFO A;  4Z65 A;  4KVX A;  2PIY A;  4A31 A;  1LFW A;  4KOT A;  1BLL E;  3GKR A;  4OC1 A;  4P4I A;  1FT7 A;  2ZW6 A;  2QEC A;  3NFZ A;  4NF1 A;  1B87 A;  2YNE A;  4O23 A;  4CAX A;  1TXR A;  4FD4 A;  2P6G A;  2QJ8 A;  5IV0 A;  1ZLH A;  4KOW A;  4NJR A;  2G0B A;  4HPS A;  4A37 A;  2P6E A;  3QAY A;  1OBR A;  3GY9 A;  4OC3 A;  3TOB A;  3FRM A;  1Y7E A;  2VI7 A;  4P6Y A;  2GE3 A;  2PCU A;  1RXT A;  2WYR A;  2GLJ A;  3IWG A;  4R3K A;  1YVO A;  2EUI A;  2BOA A;  5K8O A;  3DDD A;  2PJ1 A;  4QB9 A;  3SJG A;  1YVK A;  2VZZ A;  3FED A;  4IF5 A;  2R8V A;  4NSQ A;  2PJC A;  3R9F A;  3FEE A;  2BCO A;  4P4B A;  1ZG9 A;  2V8G A;  3N7Z A;  5HH1 A;  1F2P A;  4PV6 A;  1M1D A;  2PRQ A;  3R96 A;  4F9U A;  5JQ4 A;  2ZOG A;  4FBE A;  2FL4 A;  3W6X A;  1IYL A;  5JGF A;  3FF3 A;  1F2O A;  2Q44 A;  3F8K A;  4H6Z A;  3W91 A;  2NYQ A;  3G8W A;  1FY7 A;  3D2M A;  5F47 A;  2GRE A;  2QVP A;  2AFM A;  3CXS A;  3EY5 A;  2PJ4 A;  4NEX A;  4KOX A;  1XOV A;  3SJF A;  3TO7 A;  1YLO A;  2ATR A;  4JXQ A;  4K30 A;  4OIW A;  2Z3P A;  5DWN A;  1Y9K A;  1IB1 E;  2B3U A;  3DLJ A;  3HUV A;  4B5P B;  3I3G A;  2ZEG A;  1ELL P;  3K2K A;  2B4B A;  2PJ0 A;  2V8H A;  3P2H A;  4UFV A;  1BOB A;  4YRH A;  4XPL A;  3V8I A;  4A38 A;  3S9L A;  3UY5 A;  5J1Q A;  5CNP A;  1XIX A;  3FBU A;  3R95 A;  4BMH A;  4LUA A;  1UWY A;  2B3V A;  1S7F A;  4ZY2 A;  4UEZ A;  2CNM A;  2AFO A;  3N5F A;  3WC6 A;  5LYI A;  1Z8X A;  4IAV A;  2Z11 A;  3SJE A;  1PUA A;  1IOF A;  4F6A A;  5JM6 A;  1IYK A;  4AG9 A;  4JYW A;  1IGB A;  2C27 A;  2IL4 A;  2WUU A;  4JXR A;  3RZA A;  3BJ7 A;  3H8F A;  4LQ6 A;  4R57 A;  4ZX8 A;  2HQY A;  4PXE A;  3T9Y A;  2PSW A;  1CG2 A;  3W6S A;  2I3C A;  4UCP A;  4CPA A;  1BAV A;  4MFJ A;  2GIV A;  3QNV A;  2JDC A;  4M85 A;  2PRB A;  1L0C A;  4ONU A;  4PK2 A;  3KHZ A;  2CIJ A;  2J8N A;  3KAS A;  1ELM P;  4KSI A;  5LYF A;  1Y9W A;  3IGR A;  2JEW A;  4X8I A;  3KGQ A;  4K3N A;  2VXK A;  1YR0 A;  4IK2 A;  1MK4 A;  2Y0M A;  4P10 A;  2Q4V A;  4JLY A;  4KZT A;  4M6G A;  2ZED A;  2GFQ A;  2GLF A;  3S6K A;  1QSO A;  4C2Z A;  1PU9 A;  1RO5 A;  1TKJ A;  2F8H A;  3S9N A;  4HNY B;  1YW4 A;  4CGO A;  3CT9 A;  5AGE A;  2EVN A;  2EK8 A;  4KSA A;  3TX8 A;  4ZY0 A;  2FSR A;  1Y0R A;  1AYE A;  1BO4 A;  3JRU A;  4MCS A;  4P4E A;  5AG7 A;  4CYP A;  1XF8 A;  2HUZ A;  2X7B A;  3IO1 A;  4UWJ A;  4CAV A;  2VZY A;  5E96 A;  4FUU A;  1YW6 A;  4OAE A;  2XEG A;  4ZX9 A;  4HKF A;  4CGN A;  4AVB A;  2AFW A;  2Z3L A;  3TCV A;  2ZW5 A;  3G3S A;  4UIB A;  2EK9 A;  1XMT A;  3PB6 X;  4AXV A;  5LYL A;  1S5K A;  5DS0 A;  1CP6 A;  2KCW A;  5EBV A;  4QUS A;  2D4P A;  2I00 A;  3F5B A;  4B13 A;  3B3S A;  3WAB A;  4CS0 B;  2HB6 A;  2BUE A;  4KUA A;  3PFE A;  1LRZ A;  1LCP A;  2XEF A;  3IU1 A;  4BD9 A;  5IB9 A;  3VWE A;  4PSX A;  3RBU A;  4EWT A;  3PP9 A;  4NGS A;  4WJB A;  5H84 A;  4F9V A;  3DR6 A;  3D7D A;  4BBH A;  4MFP A;  2ZEM A;  2JDD A;  3C26 A;  5HVG A;  1VHO A;  1EE3 P;  1HDQ A;  2PJ3 A;  1ARL A;  1NSL A;  3IFE A;  1QSM A;  1Y7R A;  2REF A;  3IWE A;  4KOS A;  5I0C A;  1KWM A;  4C2Y A;  5JH9 A;  1LAM A;  3DGV A;  3JVN A;  2I79 A;  4MBU A;  3SXO A;  3IIB A;  4DUK A;  4B5P A;  4MHD A;  3D3S A;  4A30 A;  4OC4 A;  4DNC A;  2FE7 A;  2G3T A;  4PXB A;  1Z8L A;  3I9S A;  2JBJ A;  3B3V A;  1Z8T A;  2V77 A;  1TKF A;  3BXM A;  2J8M A;  4UEE A;  4MY3 A;  3JTK A;  4NFR A;  1M4I A;  4R3L A;  2PJA A;  2VBQ A;  5LYD A;  2C6C A;  3CPX A;  4U9Z A;  2OZH A;  1H8L A;  1PCA A;  3BI1 A;  3KR5 A;  4ORF A;  5D8N A;  2VL1 A;  4MRI A;  3PBB A;  3T8W A;  2RB7 A;  4YWY A;  4A32 A;  3IJ3 A;  5G21 A;  3E0K A;  1YLE A;  4UBR A;  3B7I A;  4QVT A;  2C1C A;  2ZOF A;  4NGR A;  5LRG A;  4ZYQ A;  4YFJ A;  1Z8W A;  2GU2 A;  3VAR A;  3SI1 A;  1YRE A;  2IJZ A;  3IC1 A;  4PXD A;  4MXU A;  3NH5 A;  5F48 A;  4UA3 A;  1KUY A;  3PB8 X;  1XBU A;  3CZX A;  3T90 A;  4XNH B;  4RN7 A;  5F46 A;  2OZG A;  4MY0 A;  5FVJ A;  1JQG A;  5J8C A;  3LWU A;  3TO6 A;  3L2N A;  2V8V A;  4AVA A;  4EVY A;  3VAT A;  4H6U A;  4CAE A;  4HNX B;  3PB7 X;  4H89 A;  4YU9 A;  1DE4 C;  3B35 A;  3D67 A;  2PR8 A;  3BHX A;  1V0C A;  3LD2 A;  4FWU A;  4MHN A;  2PC1 A;  3FJU A;  2PE3 A;  2K5T A;  2ZXV A;  4KUB A;  4JZ0 A;  4A39 A;  4CGL A;  3GYA A;  4ONW A;  2CNT A;  5HXD A;  4II9 A;  2JBK A;  3FVL A;  2B5G B;  2A4N A;  4L89 A;  4UCN A;  3RNZ A;  2ZW7 A;  4QC6 A;  4R76 A;  5BWA B;  3NH8 A;  2EBJ A;  5CBM A;  2FS5 A;  2CF4 A;  2WPX A;  1CPS A;  3DSB A;  3EO4 A;  1NMT A;  4B5O A;  1YSJ A;  4B10 A;  3GB0 A;  4UCM A;  1LOK A;  1Z5R A;  2CTB A;  2Z3O A;  4U9Y A;  4NXY A;  1S7N A;  5F09 A;  3RAM A;  2B4D B;  4MCQ A;  1RTQ A;  5KTA A;  1ARM A;  1U6M A;  5ELY A;  3S6F A;  4ZGY B;  3VH9 A;  4IHM A;  3WC5 A;  1QMU A;  2F5I A;  2Q7S A;  5AG5 A;  5F49 A;  3WC7 A;  4B11 A;  1XEB A;  4TNU A;  3D8P A;  3LOD A;  4NCZ A;  3TC8 A;  2P0W A;  3FH4 A;  3SJX A;  5J8F A;  2AJ6 A;  1P4N A;  3H4Q A;  4R7M A;  1GHE A;  3RO0 A;  2YNC C;  4AVC A;  4PPZ A;  2OH1 A;  4UIA A;  4MFL A;  3FMC A;  2RC4 A;  1CPX A;  2BEI A;  4MHY A;  2OB0 A;  1WK4 A;  4BIN A;  3KR4 A;  1KZF A;  3CXQ A;  4I49 A;  4CYQ A;  4PXC A;  2YND A;  3SHP A;  4NGT A;  4AG7 A;  3FYN A;  3OWC A;  2FIA A;  5THW A;  3PEI A;  4OP4 A;  3B8G A;  3DNS A;  3KL9 A;  1AUG A;  1YK3 A;  1R43 A;  4MFK A;  2EWB A;  3DR8 A;  4ZY1 A;  3B3T A;  4A33 A;  4Q38 A;  4HNW B;  2Q0Y A;  3BI0 A;  3B2Y A;  2FT0 A;  1S7L A;  7CPA A;  2WZN A;  3CDX A;  3V38 A;  5EMI A;  4NGM A;  1QSR A;  2PDO A;  3R1K A;  4OC0 A;  2Q7B A;  3CXP A;  4J3G A;  1JWQ A;  4RUH A;  4JJX A;  4ZI6 A;  1CP7 A;  1NSA A;  4F0X A;  4JD6 A;  2Z3K A;  3B3W A;  2Q04 A;  3F0A A;  2AE6 A;  3D2P A;  3D7H A;  4B6Z A;  2OOT A;  1IID A;  2G9D A;  2POK A;  5IX3 A;  2DEA A;  2Q4Z A;  3MN8 A;  3S9M A;  3KI9 A;  5JPH A;  4ZBG A;  5IB0 A;  3BJ8 A;  2PJ7 A;  4XPD B;  1TKH A;  5AG6 A;  3V7Z A;  1F57 A;  3LMS A;  3H8G A;  2Z10 A;  4Q36 A;  3TT2 A;  3RYO A;  1IOI A;  3TFY A;  1BPN A;  4NGP A;  1Q2D A;  2F7V A;  3D66 A;  1J4J A;  4JWP A;  1BPM A;  3ZZI A;  2B58 A;  1I21 A;  2YNC A;  5KTD A;  2PJB A;  1YME A;  2DPS A;  1IIC A;  3PBE A;  2FCK A;  2PJ6 A;  4EFD A;  1QQ9 A;  3FEC A;  4X3R A;  2PQ8 A;  3JUW A;  3GLJ A;  3H8E A;  1S3Z A;  2VEZ A;  3PRT A;  4CYO A;  5K8M A;  2O28 A;  1UFH A;  2B5G A;  2PJ2 A;  4MFQ A;  2BSW A;  1XFO A;  4MHP A;  4PK3 A;  4P4F A;  2GAN A;  2ABZ A;  4H2K A;  4KVM E;  4B14 A;  4C2X A;  1AMP A;  4UWI A;  2ZEE A;  1CM0 A;  2WSA A;  3EFA A;  2PIZ A;  2HV2 A;  1K4J A;  2ZEF A;  1Z4E A;  2IQ6 A;  1DTD A;  2J8R A;  3NE7 A;  3S6H A;  1VHE A;  2OZU A;  4R9M A;  2HC9 A;  4MHZ A;  2B4D A;  5I4M A;  1Z4R A;  2P6F A;  1SQH A;  2WPW A;  3EXN A;  3KKW A;  4L8A A;  4PQA A;  4XPD C;  3SI2 A;  1ON0 A;  1LAN A;  1TF9 A;  6CPA A;  3D4U A;  1M44 A;  4OLL A;  2R98 A;  4C7I A;  3KHX A;  3NH4 A;  3IU2 A;  4UFX A;  4MI4 A;  2CXA A;  1R57 A;  4IUS A;  4FD5 A;  1A2Z A; 
#chains in the Genus database with same CATH homology
 5EC4 A;  4MJ8 A;  3TOA A;  5H86 A;  4E0A A;  5AG4 A;  2H5M A;  1MJA A;  5G22 A;  4B12 A;  3A9L A;  4PSW A;  2DPT A;  2R1I A;  3FXT A;  4R87 A;  4CRZ B;  2Q4Y A;  4XPK A;  4C68 A;  2REE A;  5ISV A;  4X5K A;  1KUX A;  4KOR A;  3TE4 A;  2JEV A;  4C7H A;  1CJW A;  2CY2 A;  2ARH A;  1S60 A;  1KUV A;  2CNS A;  1VKC A;  4A2Z A;  4KOY A;  4E2A A;  5G20 A;  3R9E A;  1WWZ A;  4FD7 A;  4CYN A;  3FNC A;  1N71 A;  4XNH C;  1Q2C A;  3FB3 A;  3EC4 A;  4M3S A;  4KOV A;  4MFZ A;  2OU2 A;  4UFW A;  1YX0 A;  4KOU A;  1QST A;  1XE4 A;  3PGP A;  5DWM A;  5A27 A;  3P2F A;  1MJB A;  4FD6 A;  3BLN A;  2JLM A;  4CAF A;  1MJ9 A;  5KTC A;  1M4G A;  4LX9 A;  4QBJ A;  3TTH A;  4Y49 B;  3PZJ A;  1S7K A;  4KSF A;  5G1Z A;  1I12 A;  1QSN A;  1YGH A;  3FIX A;  3SXN A;  2G3A A;  2Z0Z A;  4GS4 A;  1I1D A;  2DXQ A;  1M4D A;  3K9U A;  4U5Y A;  3TO9 A;  4E8O A;  5C82 A;  3MGD A;  1OZP A;  3S6G A;  2FIW A;  4KLW A;  4OAD A;  2QML A;  3R9G A;  1ZO0 A;  4YGO A;  2VQY A;  3ZJ0 A;  4CAW A;  4RI1 A;  4CRY B;  2ZW4 A;  2Z3N A;  1B6B A;  4KVO E;  4CGM A;  2NMT A;  5GCN A;  1P0H A;  5A28 A;  3QB8 A;  5HMN A;  2BL1 A;  2R7H A;  2QIR A;  4KS9 A;  2ZPA A;  2FXF A;  1TIQ A;  1VHS A;  3VWD A;  4KLV A;  4CGP A;  4Y49 C;  2D4O A;  2PR1 A;  3H5Z A;  2Z3M A;  1NE9 A;  3QAH A;  3WR7 A;  1Q2Y A;  4RS2 A;  4A95 A;  2YGW A;  5C88 A;  1Z9U A;  4F0Y A;  4AB7 A;  4KVX A;  4A31 A;  4KOT A;  3GKR A;  2ZW6 A;  2QEC A;  4NF1 A;  1B87 A;  2YNE A;  4CAX A;  4FD4 A;  2P6G A;  5IV0 A;  4KOW A;  2G0B A;  2P6E A;  3GY9 A;  3TOB A;  3FRM A;  2VI7 A;  2GE3 A;  1RXT A;  3IWG A;  4R3K A;  1YVO A;  2EUI A;  3DDD A;  4QB9 A;  1YVK A;  2VZZ A;  4IF5 A;  2R8V A;  4NSQ A;  3R9F A;  3N7Z A;  5HH1 A;  4PV6 A;  1M1D A;  3R96 A;  5JQ4 A;  2FL4 A;  3W6X A;  1IYL A;  2Q44 A;  3F8K A;  4H6Z A;  3W91 A;  3G8W A;  1FY7 A;  3D2M A;  5F47 A;  3CXS A;  3EY5 A;  4NEX A;  4KOX A;  3TO7 A;  2ATR A;  4JXQ A;  4K30 A;  2Z3P A;  5DWN A;  1Y9K A;  1IB1 E;  2B3U A;  4B5P B;  3I3G A;  2B4B A;  3P2H A;  4UFV A;  1BOB A;  4YRH A;  4XPL A;  3V8I A;  3UY5 A;  5CNP A;  1XIX A;  3FBU A;  3R95 A;  4BMH A;  4LUA A;  2B3V A;  1S7F A;  2CNM A;  2Z11 A;  1PUA A;  4F6A A;  1IYK A;  4AG9 A;  2IL4 A;  2C27 A;  2WUU A;  4JXR A;  3BJ7 A;  4R57 A;  2HQY A;  3T9Y A;  2PSW A;  3W6S A;  4UCP A;  4MFJ A;  2GIV A;  4M85 A;  2JDC A;  2PRB A;  1L0C A;  4ONU A;  4PK2 A;  2J8N A;  1Y9W A;  3IGR A;  2VXK A;  1YR0 A;  1MK4 A;  2Y0M A;  2Q4V A;  4JLY A;  4KZT A;  3S6K A;  4C2Z A;  5IX3 A;  1QSO A;  1PU9 A;  1RO5 A;  4HNY B;  4CGO A;  5AGE A;  2EVN A;  4KSA A;  2FSR A;  5AG7 A;  1BO4 A;  4CYP A;  1XF8 A;  2HUZ A;  2X7B A;  4UWJ A;  4CAV A;  2VZY A;  5E96 A;  4OAE A;  4HKF A;  4CGN A;  4AVB A;  2Z3L A;  3TCV A;  2ZW5 A;  3G3S A;  1XMT A;  1S5K A;  5EBV A;  2KCW A;  4QUS A;  2D4P A;  2I00 A;  3F5B A;  4B13 A;  4CS0 B;  2BUE A;  4KUA A;  1LRZ A;  3IU1 A;  3VWE A;  4PSX A;  3PP9 A;  5H84 A;  3DR6 A;  4BBH A;  4MFP A;  3C26 A;  2JDD A;  1NSL A;  1QSM A;  1Y7R A;  2REF A;  3IWE A;  4KOS A;  5I0C A;  4C2Y A;  3JVN A;  2I79 A;  4MBU A;  3SXO A;  4B5P A;  4MHD A;  3D3S A;  4A30 A;  4DNC A;  2FE7 A;  2G3T A;  3I9S A;  2J8M A;  4MY3 A;  3JTK A;  1M4I A;  4R3L A;  2VBQ A;  4U9Z A;  2OZH A;  4ORF A;  4A32 A;  5G21 A;  3E0K A;  1YLE A;  4UBR A;  4QVT A;  4YFJ A;  1YRE A;  5F48 A;  4UA3 A;  1KUY A;  3T90 A;  4XNH B;  5F46 A;  2OZG A;  4MY0 A;  5FVJ A;  5J8C A;  3TO6 A;  4AVA A;  4EVY A;  4H6U A;  4CAE A;  4HNX B;  4H89 A;  2PR8 A;  3LD2 A;  1V0C A;  2PC1 A;  2K5T A;  2ZXV A;  4KUB A;  4CGL A;  3GYA A;  4II9 A;  2CNT A;  2B5G B;  2A4N A;  4L89 A;  4UCN A;  2ZW7 A;  4QC6 A;  5BWA B;  2WPX A;  2FS5 A;  3EO4 A;  3DSB A;  1NMT A;  4B5O A;  4B10 A;  4UCM A;  2Z3O A;  4U9Y A;  4NXY A;  1S7N A;  2B4D B;  5KTA A;  4ZGY B;  1U6M A;  3S6F A;  2F5I A;  5AG5 A;  5F49 A;  4B11 A;  1XEB A;  3D8P A;  3LOD A;  4NCZ A;  2P0W A;  5J8F A;  2AJ6 A;  1P4N A;  3H4Q A;  1GHE A;  2YNC C;  4AVC A;  2OH1 A;  4MFL A;  2RC4 A;  2BEI A;  2OB0 A;  1WK4 A;  1KZF A;  3CXQ A;  4I49 A;  4CYQ A;  2YND A;  3SHP A;  4AG7 A;  3FYN A;  3OWC A;  2FIA A;  3B8G A;  3DNS A;  1YK3 A;  4MFK A;  3DR8 A;  4A33 A;  4Q38 A;  4HNW B;  2Q0Y A;  2FT0 A;  1S7L A;  1QSR A;  2PDO A;  3R1K A;  2Q7B A;  3CXP A;  4J3G A;  4JJX A;  4F0X A;  4JD6 A;  2Z3K A;  2Q04 A;  3F0A A;  2AE6 A;  3D2P A;  1IID A;  5JPH A;  4ZBG A;  5IB0 A;  3BJ8 A;  4XPD B;  5AG6 A;  2Z10 A;  4Q36 A;  3TT2 A;  3RYO A;  3TFY A;  1Q2D A;  1J4J A;  4JWP A;  3ZZI A;  2B58 A;  1I21 A;  2YNC A;  5KTD A;  2DPS A;  1IIC A;  2FCK A;  2PQ8 A;  3JUW A;  1S3Z A;  2VEZ A;  4CYO A;  2O28 A;  1UFH A;  2B5G A;  4MFQ A;  2BSW A;  4PK3 A;  2GAN A;  4KVM E;  4B14 A;  4C2X A;  4UWI A;  1CM0 A;  2WSA A;  3EFA A;  2HV2 A;  1K4J A;  1Z4E A;  3NE7 A;  2J8R A;  3S6H A;  2OZU A;  4R9M A;  2B4D A;  3KKW A;  3EXN A;  2WPW A;  1Z4R A;  1SQH A;  2P6F A;  4L8A A;  4XPD C;  1ON0 A;  1M44 A;  4OLL A;  2R98 A;  4C7I A;  3IU2 A;  4UFX A;  4MI4 A;  2CXA A;  1R57 A;  4IUS A;  4FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...