2JEVA

Crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
169
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DIAMINE ACETYLTRANSFERASE 1
publication title Mechanistic and Structural Analysis of Human Spermidine/Spermine N(1)-Acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jevA00
4JD6A 2HUZA 4U9ZA 4KOYA 5DWMA 5KTDA 1VHSA 2G3AA 3K9UA 4MBUA 3T90A 3E0KA 4OADA 3R9EA 4QC6A 4KVME 2D4OA 5IB0A 3R1KA 2PSWA 4KOUA 2P6EA 3CXPA 2C27A 1J4JA 3FYNA 2FIWA 4IF5A 2A4NA 5IX3A 1IYKA 3T9YA 3V8IA 1U6MA 1FY7A 5ISVA 2QECA 1MJ9A 1MJAA 2VZZA 1Y7RA 2Q44A 4KOSA 4CS0B 4E0AA 4HNWB 1YREA 4PSWA 2Q4VA 3RYOA 3S6FA 1S60A 4JWPA 5E96A 3SXOA 3UY5A 4KOXA 4UWJA 1N71A 2B5GA 1M4GA 2Z11A 1XF8A 3EC4A 4KOVA 2B3UA 1S3ZA 2O28A 2B58A 3DSBA 1ON0A 4NSQA 4JJXA 4YRHA 3FNCA 3CXSA 4FD4A 2R1IA 3D2PA 1WWZA 2J8RA 1XEBA 4XPDC 1GHEA 4Y49B 2Z0ZA 3EO4A 3PZJA 4NF1A 3JVNA 4UWIA 1Z4RA 3TOAA 4AB7A 2B4DB 4DNCA 1KZFA 3PGPA 3TOBA 2VQYA 1PUAA 1IB1E 1YVKA 5I0CA 3TE4A 4XNHB 4NCZA 5HH1A 4OAEA 2VZYA 1IICA 1S5KA 4U5YA 2OB0A 2G0BA 5DWNA 2CNSA 2Q7BA 3EXNA 1MJBA 4NEXA 2FE7A 4MHDA 3TFYA 4KZTA 2OZUA 4H6ZA 3FBUA 4H6UA 5GCNA 2CNTA 1B87A 3PP9A 3N7ZA 4CRZB 2I79A 2BL1A 2H5MA 4KOWA 1KUYA 2Q4YA 2FL4A 2RC4A 2KCWA 4KOTA 4HNYB 1I1DA 3D2MA 4UA3A 3P2HA 5C82A 1YVOA 1VKCA 1P0HA 4QUSA 3W6XA 1YR0A 2REFA 3R9GA 3TO6A 1SQHA 4UBRA 5KTCA 2ATRA 1V0CA 1I12A 5JPHA 1S7KA 4E8OA 2OZGA 3ZZIA 2ZPAA 4RS2A 2B3VA 3EFAA 4RI1A 4JLYA 1Q2CA 2BEIA 1KUVA 2X7BA 3DR6A 4CAXA 2ZW7A 1M4IA 4AVBA 3JUWA 4PV6A 5F47A 1Z4EA 2Z10A 2PR1A 1QSNA 1QSRA 4KLVA 1IIDA 2VXKA 3SHPA 4F6AA 2R7HA 2OU2A 3NE7A 1XMTA 2FCKA 2PR8A 3B8GA 3F5BA 4YGOA 2B5GB 4PK3A 4QB9A 4R57A 2FIAA 4OLLA 4II9A 2PRBA 4MJ8A 4IUSA 4ZBGA 2J8NA 4QBJA 3EY5A 2Q04A 4GS4A 4KUBA 2ARHA 3FB3A 3W91A 3W6SA 4F0YA 1KUXA 1YX0A 2FT0A 2R8VA 3GKRA 2WPXA 1XE4A 3C26A 1QSMA 1BO4A 5J8FA 2P0WA 4B5PA 3TO9A 3R95A 3D8PA 2FSRA 5F48A 2ZXVA 2Q0YA 1Y9KA 3TT2A 5F46A 1LRZA 1NSLA 3IGRA 3G3SA 1WK4A 4CAWA 4KVXA 3OWCA 2VBQA 2JEVA 4J3GA 1M1DA 1CJWA 4KLWA 3MGDA 2ZW6A 5JQ4A 1R57A 4M3SA 3VWDA 5H84A 3S6KA 4XPDB 1YLEA 4U9YA 1S7NA 4LX9A 4KORA 4AVAA 3D3SA 4CAVA 1PU9A 1IYLA 1S7FA 2F5IA 2JLMA 2Y0MA 5EC4A 1YK3A 3S6HA 2FS5A 2WPWA 2P6FA 3BJ7A 4R9MA 2JDCA 3G8WA 3I9SA 2AJ6A 2AE6A 4L8AA 2REEA 3R96A 2PDOA 2QMLA 2CY2A 3FRMA 2ZW4A 3DR8A 4YFJA 5J8CA 4JXRA 2CNMA 2D4PA 5H86A 5C88A 3BJ8A 4ORFA 4AVCA 4KVOE 3TCVA 1QSOA 3BLNA 1Y9WA 2HV2A 5CNPA 1CM0A 2B4BA 2ZW5A 1S7LA 2IL4A 4MY0A 3H4QA 2GANA 2NMTA 1B6BA 3DDDA 4Y49C 3VWEA 1Z9UA 2GE3A 2QIRA 1NMTA 1UFHA 4E2AA 1QSTA 1YGHA 2K5TA 1P4NA 4MY3A 4PK2A 4K30A 4FD5A 5KTAA 3FXTA 4LUAA 3WR7A 4HKFA 3GYAA 3TO7A 3FIXA 4KUAA 4XNHC 1TIQA 2JDDA 3LODA 4M85A 4ONUA 4NXYA 3LD2A 2BSWA 2OH1A 1I21A 4EVYA 2FXFA 3QAHA 4HNXB 2EUIA 1NE9A 4MI4A 2R98A 2GIVA 2I00A 3I3GA 2VI7A 5F49A 2BUEA 1XIXA 3R9FA 3F0AA 2B4DA 1RXTA 4H89A 1MK4A 3SXNA 2HQYA 4FD7A 4R3LA 4R87A 2P6GA 4XPLA 3IWGA 1M4DA 3DNSA 4R3KA 3ZJ0A 1K4JA 3F8KA 4BMHA 4FD6A 3QB8A 1OZPA 4CRYB 4B5PB 3KKWA 3P2FA 3TTHA 1BOBA 4L89A 1Q2YA 3CXQA 1Q2DA 4JXQA 5IV0A 2EVNA 2J8MA 4X5KA 1RO5A 4AG9A 5FVJA 5EBVA 4I49A 2VEZA 3S6GA 5HMNA 4PSXA 3GY9A 2G3TA 2PQ8A 4XPKA 4AG7A 1M44A 1L0CA 4B5OA 2OZHA 2PC1A 4QVTA 2DXQA
chains in the Genus database with same CATH superfamily
3D7DA 4JD6A 3KHZA 3PRTA 2XEIA 5AGEA 2HUZA 2RB7A 4U9ZA 3ISXA 4KOYA 3PEIA 5DWMA 5KTDA 1Y0YA 3KHXA 5D8NA 4BBHA 5LYFA 2VL1A 2GFQA 2NSMA 2PJAA 3PB7X 1VHSA 4P44A 2G3AA 4F8ZA 4NGSA 3K9UA 4MBUA 3T90A 3E0KA 4OADA 5K8PA 4OKOA 4OC1A 3R9EA 2AFZA 4KVME 4QC6A 4TNUA 5G22A 1Z8XA 2D4OA 5IB0A 3R1KA 4A2ZA 2DPTA 2PSWA 4KOUA 1XOVA 2PJ2A 3H8FA 3PB9X 2P6EA 3CPAA 3CXPA 4BD9A 4X2TA 2C27A 3RO0A 1J4JA 4MFPA 3FYNA 4EMEA 2FIWA 1VHOA 4IF5A 2A4NA 3FEEA 2EWBA 5IX3A 1IYKA 2C6GA 4MHZA 3T9YA 3V8IA 1U6MA 4MHPA 1FY7A 2PJ5A 5ISVA 2QECA 1MJ9A 3PB4X 2EK9A 2PJ9A 4DJLA 2PVWA 2OR4A 4B11A 1EE3P 1MJAA 1YMEA 3KQZA 1NSAA 4UFVA 2VZZA 1Y7RA 2Q44A 1Y7EA 4KOSA 2DF5A 4CS0B 4E0AA 4OIWA 4HNWB 1YREA 2Z3OA 4RN7A 1ZG7A 4PSWA 3SJFA 5K8NA 2EBJA 2Q4VA 3RYOA 3S6FA 3TC8A 1S60A 4JWPA 2PJ4A 5E96A 3SXOA 3D4UA 3D67A 4NGTA 4B12A 3UY5A 4KOXA 4UWJA 3S9MA 4RUHA 1N71A 4NFRA 2GLFA 2B5GA 1M4GA 2Z11A 4GXHA 1XF8A 3B35A 2V8VA 1X10A 3EC4A 4MHNA 1ELMP 4KOVA 5JGFA 4MFQA 2B3UA 4UEFA 4AXVA 2YNDA 3H5ZA 4LQGA 4C68A 5I4MA 1BPNA 1S3ZA 4P4BA 2O28A 3K9TA 2B58A 3DSBA 3B3TA 1ON0A 3K2KA 1F2PA 3GB0A 4FAIA 4NSQA 4JJXA 5CPAA 4UEZA 4YRHA 3FNCA 1IY7A 3CXSA 1H8LA 4FD4A 3RNZA 3NFZA 2R1IA 3D2PA 1CX8A 1WWZA 2ZEDA 2J8RA 1CG2A 1XEBA 2Z3MA 4XPDC 4MFJA 1GHEA 4Y49B 2AFWA 4YWYA 3CT9A 2Z0ZA 3EO4A 1BAVA 4LQ6A 3S9NA 1HEEA 2C6PA 3PZJA 4NF1A 3JVNA 1CBXA 4UWIA 1Z4RA 4MFZA 3TOAA 1CP7A 4AB7A 4YU9A 2ZOGA 2J9AA 2B4DB 3JTKA 4UCMA 4DNCA 1KZFA 3PGPA 3TOBA 2VQYA 1PUAA 5LYDA 1IB1E 1YVKA 5I0CA 1CP6A 4WJBA 3TE4A 4UF4A 1XMBA 4A33A 4JZ0A 4XNHB 4NCZA 5HH1A 1IOFA 1Z8LA 4OAEA 2VZYA 1IICA 1S5KA 4U5YA 2OB0A 2G0BA 2V8HA 5DWNA 4CGOA 2BOAA 2CNSA 2Q7BA 3EXNA 1MJBA 2DPSA 4ZI6A 4NEXA 5JH9A 2JBKA 1VHEA 1LAPA 2CXAA 2FE7A 3WC6A 2BCOA 3KR4A 4MHDA 4W9YA 2PJ3A 4NGNA 4KZTA 4B6ZA 3TFYA 2ZEFA 5HVHA 1BLLE 2OZUA 4H6ZA 3IU1A 2POKA 3FBUA 3IU2A 4H6UA 4P10A 4BINA 4FBEA 5HVGA 5GCNA 5A28A 5K8MA 2CNTA 1XBUA 1B87A 4ZX8A 2Z3KA 3PP9A 4CYQA 3N7ZA 4Z65A 3KL9A 4CRZB 1CPSA 5THWA 3PFOA 2OOTA 4F9UA 3VARA 2I79A 2BL1A 2WZNA 3N5FA 2H5MA 3BI0A 2O4HA 4OC3A 4GM5A 4KOWA 2V8GA 3DLJA 1KUYA 2Q4YA 1LANA 1PYTB 2FL4A 2RC4A 7CPAA 2KCWA 4OC2A 4KOTA 4Q36A 4ZY0A 1Y0RA 1Z5RA 4HNYB 1PCAA 1I1DA 4ONWA 4KS9A 3D2MA 8CPAA 1YQEA 1ZG9A 5AG5A 3T8WA 3KASA 4CGNA 5LRKA 2YNEA 4UA3A 3P2HA 5C82A 1TF9A 1YVOA 4MCRA 2IMOA 1Q7LA 1VKCA 1Z2LA 1P0HA 2PJ8A 2ZENA 2ZELA 4QUSA 3W6XA 3B3VA 1YR0A 2IQ6A 1ZLHA 5D29A 2REFA 2HB6A 3R9GA 3TO6A 2ZEMA 2XEFA 4ZY1A 1SQHA 4UBRA 5F09A 1A2ZA 1RTQA 4JYWA 5KTCA 1AYEA 2ATRA 1V0CA 4Q38A 3IWEA 3H8EA 1I12A 5JPHA 3KI9A 2PJ0A 1QQ9A 1ARMA 1S7KA 4E8OA 2OZGA 3ZZIA 2ZPAA 4RS2A 2B3VA 3B3SA 4WWVA 3EFAA 4RI1A 4JLYA 1LFWA 1ZO0A 1Q2CA 1TKHA 2CTCA 2BEIA 1KUVA 2X7BA 3DR6A 4CAXA 2ZW7A 2G9DA 1M4IA 4UIBA 3JUWA 4OP4A 4R6TA 4X8IA 4PV6A 4AVBA 3JRUA 3LMSA 5F47A 1DTDA 4IHMA 3VATA 1Z4EA 2Z10A 3MN8A 2PR1A 3A9LA 3FVLA 4M6HA 4UCPA 5JM6A 1QSNA 1AUGA 2PJBA 1QSRA 4OIDA 3KR5A 3WT4A 4KLVA 3RAMA 2PJ7A 1IIDA 2VXKA 4MMOA 3SHPA 3LWUA 4F6AA 2R7HA 4P4EA 4B14A 2CF4A 2OU2A 5EMIA 4CGMA 3NE7A 1XMTA 2FCKA 2PR8A 3B8GA 3F5BA 4YGOA 5BWAB 1GYTA 4DYOA 2ZEHA 4OMEA 2B5GB 3NE8A 4PK3A 4A30A 4QB9A 5G1ZA 4EFDA 4R57A 4NGQA 2FIAA 4C7HA 4P4DA 3FEDA 4NGRA 4OLLA 2ABZA 4II9A 3LACA 4A31A 4P4IA 2PRBA 1IGBA 4IUSA 4MJ8A 4NJRA 4ZBGA 2J8NA 3NH5A 4QBJA 3IEHA 3EY5A 3IFEA 3WABA 3V38A 1LAMA 3IO1A 3SI1A 1JWQA 3B7IA 5AG7A 2PRQA 2Q04A 4GS4A 4PPZA 2QJ8A 4KUBA 1KWMA 1BPMA 2ARHA 3BHXA 4NGMA 3FB3A 4CGPA 2GU2A 3W91A 2DEAA 3W6SA 2PIYA 5LRJA 4F0YA 4UEEA 1TKJA 1KUXA 1YX0A 1ELLP 4R7MA 2FT0A 4C2XA 2R8VA 3GKRA 2WPXA 4DUKA 5G21A 3GUXA 3NH4A 1XE4A 3C26A 3FECA 2C6CA 4R8FA 2YNCC 1QMUA 1JQGA 4R76A 2O53A 1QSMA 1BO4A 5J8FA 2P0WA 5A27A 4B5PA 2AFMA 3R95A 3D8PA 1VIXA 3PB6X 2WSAA 3TO9A 2FSRA 5F48A 1UWYA 4MFLA 2ZXVA 1IU8A 3IWWA 2Q0YA 1Y9KA 2ZOFA 3TT2A 1F57A 5G20A 5F46A 3B3CA 4MHYA 1LRZA 2F7VA 1NSLA 3IGRA 3G3SA 4P6YA 1WK4A 4MCQA 4X3RA 2ZEEA 2ANPA 4CAWA 4KVXA 3OWCA 2VBQA 2JEVA 4J3GA 1M1DA 1CJWA 4KLWA 3MGDA 2ZW6A 5JQ4A 1R57A 4P4JA 3NH8A 4M3SA 3VWDA 3IJ3A 4A39A 4F9VA 2AFUA 5H84A 3S6KA 4H2KA 4XPDB 2PVVA 4CAEA 1YLEA 4IAVA 4U9YA 4ZGYB 3KZWA 1S7NA 3RBUA 2ZEOA 4LX9A 2PJCA 1ARLA 4MCSA 3GIUA 2YNCA 1YW4A 4KORA 3MRUA 4AVAA 1ZG8A 3RZAA 4Q7AA 1F2OA 3D3SA 1PU9A 4UCNA 4CAFA 4CAVA 1FNOA 1IYLA 1S7FA 3B2YA 2F5IA 2JLMA 2Y0MA 5EC4A 1YK3A 4UIAA 4NJQA 4TWEA 3S6HA 4PXEA 2FS5A 3GLJA 2GLJA 2C1CA 2P6FA 2WPWA 2Z3LA 3BJ7A 4PXCA 4R9MA 2XEGA 2JDCA 3G8WA 1OBRA 3I9SA 4B10A 1R43A 2AJ6A 2AE6A 4L8AA 2REEA 3D7HA 3R96A 2PDOA 3D68A 2QMLA 2PJ6A 1M4LA 2CY2A 2ZEPA 3FRMA 2ZW4A 3DR8A 4YFJA 5HXDA 1XFOA 3CZXA 5J8CA 4JXRA 2CNMA 2XEJA 2AFSA 2QYVA 2Q51A 3I1UA 2D4PA 3CDXA 1ZLIA 1HDUA 4G1PA 4A32A 3WC5A 5H86A 5C88A 3BJ8A 4ORFA 4AVCA 2F8HA 2AFXA 4KVOE 4ZYQA 3TCVA 1QSOA 2ODFA 4OC0A 3BLNA 3D7GA 1Y9WA 3SJXA 2HV2A 2RFHA 3PB8X 5LRGA 5J1QA 4MCPA 5CNPA 1CM0A 3SI0A 2B4BA 4CYOA 2ZW5A 3SJEA 1S7LA 2IL4A 3QNVA 3FF3A 4MY0A 5DS0A 2Z3PA 1Z8WA 3H4QA 2GANA 5IB9A 2WUUA 2NMTA 4C7IA 1B6BA 4M6GA 4CPAA 3NA6A 3DDDA 4Y49C 3VWEA 2PJ1A 3PFEA 4A95A 1Z9UA 1X12A 2GE3A 4KSIA 2QIRA 3QAYA 3HUVA 1NMTA 1UFHA 4E2AA 1QSTA 1YGHA 2K5TA 1P4NA 4MY3A 4B13A 4PK2A 6CPAA 2ZEGA 4FD5A 4K30A 3FXTA 4LUAA 1TKFA 3KGQA 4HKFA 3WR7A 4CGLA 5KTAA 3H8GA 3GYAA 2HC9A 3TO7A 3FIXA 4K3NA 4KUAA 3V7ZA 3S9LA 4XNHC 5AG4A 1TIQA 2JDDA 1XJOA 3LODA 3D66A 4KSFA 3FX6A 4FWUA 1FT7A 4IK2A 4M6IA 2WYRA 4M85A 5HVFA 5K8OA 4ONUA 1TXRA 1XRYA 1HDQA 2PIZA 4O23A 4HPSA 4CYNA 1LCPA 4NXYA 3LD2A 2BSWA 3FMCA 1YW6A 2OH1A 1I21A 4EVYA 2FXFA 3D7FA 3QAHA 2Q4ZA 2Z3NA 1YLOA 4HNXB 1R3NA 4PQAA 2Q7SA 4A94A 2EUIA 3FH4A 1NE9A 1YSJA 2GREA 2R98A 4MI4A 3PBBA 2GIVA 2NYQA 2I00A 2CTBA 2VI7A 3I3GA 2BUEA 5F49A 3DGVA 1LOKA 1XIXA 2V8DA 3R9FA 2JBJA 3F0AA 2EO8A 3IC1A 3TX8A 2B4DA 2YGWA 1RXTA 4F0XA 3CPXA 4H89A 3SI2A 4MFKA 3BI1A 1MK4A 5LYIA 3SXNA 2PCUA 5LYLA 2HQYA 4FD7A 2V77A 4R3LA 4R87A 2FVGA 2P6GA 4XPLA 5CBMA 2PE3A 3IWGA 3HLPA 1M4DA 3DNSA 4MRIA 4R3KA 3ZJ0A 1K4JA 1AMPA 3F8KA 4UFXA 4CYPA 4BMHA 3VH9A 4ZY2A 2EK8A 4FD6A 1VGYA 3QB8A 1OZPA 4PXDA 4CRYB 4B5PB 4OC4A 3FJUA 4FUUA 4OC5A 2QVPA 3KKWA 3P2FA 3IIBA 3TTHA 1BOBA 1CPXA 4L89A 1Q2YA 1DE4C 1Q2DA 3CXQA 4JXQA 4A38A 2Q43A 3ISZA 1TF8A 3KQXA 5IV0A 5ELYA 4NGPA 2EVNA 2J8MA 4MXUA 4X5KA 1RO5A 4AG9A 4C2ZA 5FVJA 1IOIA 4I49A 2VEZA 5EBVA 2I3CA 4ZX9A 3S6GA 3PBEA 4P45A 2CIJA 3B3WA 3WC7A 1Z8TA 2JEWA 4EWTA 4PSXA 5HMNA 3GY9A 2G3TA 2PQ8A 3SJGA 4C2YA 4XPKA 4P4FA 4A37A 4AG7A 2BO9A 2AFOA 3L2NA 4PXBA 3BXMA 1M44A 5AG6A 1L0CA 4B5OA 4UFWA 2IJZA 2OZHA 2PC1A 4KSAA 4QVTA 2DXQA
chains in the Genus database with same CATH topology
4JD6A 5AGEA 2HUZA 4U9ZA 4KOYA 5DWMA 5KTDA 4BBHA 1VHSA 2G3AA 3K9UA 4MBUA 3T90A 3E0KA 4OADA 3R9EA 4QC6A 4KVME 5G22A 2D4OA 5IB0A 3R1KA 4A2ZA 2DPTA 2PSWA 4KOUA 2P6EA 3CXPA 2C27A 1J4JA 4MFPA 3FYNA 2FIWA 4IF5A 2A4NA 5IX3A 1IYKA 3T9YA 3V8IA 1U6MA 1FY7A 5ISVA 2QECA 1MJ9A 4B11A 1MJAA 4UFVA 2VZZA 1Y7RA 2Q44A 4KOSA 4CS0B 4E0AA 4HNWB 1YREA 2Z3OA 4PSWA 2Q4VA 3RYOA 3S6FA 1S60A 4JWPA 5E96A 3SXOA 4B12A 3UY5A 4KOXA 4UWJA 1N71A 2B5GA 1M4GA 2Z11A 1XF8A 3EC4A 4KOVA 4MFQA 2B3UA 2YNDA 3H5ZA 4C68A 1S3ZA 2O28A 2B58A 3DSBA 1ON0A 4NSQA 4JJXA 4YRHA 3FNCA 3CXSA 4FD4A 2R1IA 3D2PA 1WWZA 2J8RA 1XEBA 2Z3MA 4XPDC 4MFJA 1GHEA 4Y49B 2Z0ZA 3EO4A 3PZJA 4NF1A 3JVNA 4UWIA 1Z4RA 4MFZA 3TOAA 4AB7A 2B4DB 3JTKA 4UCMA 4DNCA 1KZFA 3PGPA 3TOBA 2VQYA 1PUAA 1IB1E 1YVKA 5I0CA 3TE4A 4A33A 4XNHB 4NCZA 5HH1A 4OAEA 2VZYA 1IICA 1S5KA 4U5YA 2OB0A 2G0BA 5DWNA 4CGOA 2CNSA 2Q7BA 3EXNA 1MJBA 2DPSA 4NEXA 2FE7A 2CXAA 4MHDA 3TFYA 4KZTA 2OZUA 4H6ZA 3IU1A 3FBUA 3IU2A 4H6UA 5GCNA 5A28A 2CNTA 1B87A 2Z3KA 3PP9A 4CYQA 3N7ZA 4CRZB 2I79A 2BL1A 2H5MA 4KOWA 1KUYA 2Q4YA 2FL4A 2RC4A 2KCWA 4KOTA 4Q36A 4HNYB 1I1DA 4KS9A 3D2MA 4CGNA 5AG5A 2YNEA 4UA3A 3P2HA 5C82A 1YVOA 1VKCA 1P0HA 4QUSA 3W6XA 1YR0A 2REFA 3R9GA 3TO6A 1SQHA 4UBRA 5KTCA 2ATRA 1V0CA 4Q38A 3IWEA 1I12A 5JPHA 1S7KA 4E8OA 2OZGA 3ZZIA 2ZPAA 4RS2A 2B3VA 3EFAA 4RI1A 4JLYA 1ZO0A 1Q2CA 2BEIA 1KUVA 2X7BA 3DR6A 4CAXA 2ZW7A 1M4IA 4AVBA 3JUWA 4PV6A 5F47A 1Z4EA 2Z10A 2PR1A 3A9LA 4UCPA 1QSNA 1QSRA 4KLVA 1IIDA 2VXKA 3SHPA 4F6AA 2R7HA 4B14A 2OU2A 4CGMA 3NE7A 1XMTA 2FCKA 2PR8A 3B8GA 3F5BA 4YGOA 5BWAB 2B5GB 4PK3A 4A30A 4QB9A 5G1ZA 4R57A 2FIAA 4C7HA 4OLLA 4II9A 4A31A 2PRBA 4MJ8A 4IUSA 4ZBGA 2J8NA 4QBJA 3EY5A 5AG7A 2Q04A 4GS4A 4KUBA 2ARHA 3FB3A 4CGPA 3W91A 3W6SA 4F0YA 1KUXA 1YX0A 4C2XA 2FT0A 2R8VA 3GKRA 2WPXA 5G21A 1XE4A 3C26A 2YNCC 1QSMA 1BO4A 5J8FA 2P0WA 5A27A 4B5PA 3TO9A 3R95A 3D8PA 2WSAA 2FSRA 5F48A 4MFLA 2ZXVA 2Q0YA 1Y9KA 3TT2A 5G20A 5F46A 1LRZA 1NSLA 3IGRA 3G3SA 1WK4A 4CAWA 4KVXA 3OWCA 2VBQA 2JEVA 4J3GA 1M1DA 1CJWA 4KLWA 3MGDA 2ZW6A 5JQ4A 1R57A 4M3SA 3VWDA 5H84A 3S6KA 4XPDB 4CAEA 1YLEA 4U9YA 4ZGYB 1S7NA 4LX9A 2YNCA 4KORA 4AVAA 3D3SA 4UCNA 1PU9A 4CAFA 4CAVA 1IYLA 1S7FA 2F5IA 2JLMA 2Y0MA 5EC4A 1YK3A 3S6HA 2FS5A 2WPWA 2P6FA 2Z3LA 3BJ7A 4R9MA 2JDCA 3G8WA 4B10A 3I9SA 2AJ6A 2AE6A 4L8AA 2REEA 3R96A 2PDOA 2QMLA 2CY2A 3FRMA 2ZW4A 3DR8A 4YFJA 5J8CA 4JXRA 2CNMA 2D4PA 4A32A 5H86A 5C88A 3BJ8A 4ORFA 4AVCA 4KVOE 3TCVA 1QSOA 3BLNA 1Y9WA 2HV2A 5CNPA 1CM0A 2B4BA 4CYOA 2ZW5A 1S7LA 2IL4A 4MY0A 2Z3PA 3H4QA 2GANA 2WUUA 2NMTA 4C7IA 1B6BA 3DDDA 4Y49C 3VWEA 4A95A 1Z9UA 2GE3A 2QIRA 1NMTA 1UFHA 4E2AA 1QSTA 1YGHA 2K5TA 1P4NA 4MY3A 4B13A 4PK2A 4K30A 4FD5A 4CGLA 3FXTA 4LUAA 3WR7A 5KTAA 4HKFA 3GYAA 3TO7A 3FIXA 4KUAA 4XNHC 5AG4A 1TIQA 2JDDA 3LODA 4KSFA 4M85A 4ONUA 4CYNA 4NXYA 3LD2A 2BSWA 2OH1A 1I21A 4EVYA 2FXFA 3QAHA 2Z3NA 4HNXB 2EUIA 1NE9A 4MI4A 2R98A 2GIVA 2I00A 3I3GA 2VI7A 5F49A 2BUEA 1XIXA 3R9FA 3F0AA 4F0XA 2B4DA 2YGWA 1RXTA 4H89A 4MFKA 1MK4A 3SXNA 2HQYA 4FD7A 4R3LA 4R87A 2P6GA 4XPLA 3IWGA 1M4DA 3DNSA 4R3KA 3ZJ0A 1K4JA 3F8KA 4UFXA 4CYPA 4BMHA 4FD6A 3QB8A 1OZPA 4CRYB 4B5PB 3KKWA 3P2FA 3TTHA 1BOBA 4L89A 1Q2YA 3CXQA 1Q2DA 4JXQA 5IV0A 2EVNA 2J8MA 4X5KA 1RO5A 4AG9A 4C2ZA 5FVJA 5EBVA 4I49A 2VEZA 3S6GA 5HMNA 4PSXA 3GY9A 2G3TA 2PQ8A 4C2YA 4XPKA 4AG7A 5AG6A 1M44A 1L0CA 4B5OA 4UFWA 2OZHA 2PC1A 4KSAA 4QVTA 2DXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD6 A;  2HUZ A;  4U9Z A;  4KOY A;  5DWM A;  5KTD A;  1VHS A;  2G3A A;  3K9U A;  4MBU A;  3T90 A;  3E0K A;  4OAD A;  3R9E A;  4QC6 A;  4KVM E;  2D4O A;  5IB0 A;  3R1K A;  2PSW A;  4KOU A;  2P6E A;  3CXP A;  2C27 A;  1J4J A;  3FYN A;  2FIW A;  4IF5 A;  2A4N A;  5IX3 A;  1IYK A;  3T9Y A;  3V8I A;  1U6M A;  1FY7 A;  5ISV A;  2QEC A;  1MJ9 A;  1MJA A;  2VZZ A;  1Y7R A;  2Q44 A;  4KOS A;  4CS0 B;  4E0A A;  4HNW B;  1YRE A;  4PSW A;  2Q4V A;  3RYO A;  3S6F A;  1S60 A;  4JWP A;  5E96 A;  3SXO A;  3UY5 A;  4KOX A;  4UWJ A;  1N71 A;  2B5G A;  1M4G A;  2Z11 A;  1XF8 A;  3EC4 A;  4KOV A;  2B3U A;  1S3Z A;  2O28 A;  2B58 A;  3DSB A;  1ON0 A;  4NSQ A;  4JJX A;  4YRH A;  3FNC A;  3CXS A;  4FD4 A;  2R1I A;  3D2P A;  1WWZ A;  2J8R A;  1XEB A;  4XPD C;  1GHE A;  4Y49 B;  2Z0Z A;  3EO4 A;  3PZJ A;  4NF1 A;  3JVN A;  4UWI A;  1Z4R A;  3TOA A;  4AB7 A;  2B4D B;  4DNC A;  1KZF A;  3PGP A;  3TOB A;  2VQY A;  1PUA A;  1IB1 E;  1YVK A;  5I0C A;  3TE4 A;  4XNH B;  4NCZ A;  5HH1 A;  4OAE A;  2VZY A;  1IIC A;  1S5K A;  4U5Y A;  2OB0 A;  2G0B A;  5DWN A;  2CNS A;  2Q7B A;  3EXN A;  1MJB A;  4NEX A;  2FE7 A;  4MHD A;  3TFY A;  4KZT A;  2OZU A;  4H6Z A;  3FBU A;  4H6U A;  5GCN A;  2CNT A;  1B87 A;  3PP9 A;  3N7Z A;  4CRZ B;  2I79 A;  2BL1 A;  2H5M A;  4KOW A;  1KUY A;  2Q4Y A;  2FL4 A;  2RC4 A;  2KCW A;  4KOT A;  4HNY B;  1I1D A;  3D2M A;  4UA3 A;  3P2H A;  5C82 A;  1YVO A;  1VKC A;  1P0H A;  4QUS A;  3W6X A;  1YR0 A;  2REF A;  3R9G A;  3TO6 A;  1SQH A;  4UBR A;  5KTC A;  2ATR A;  1V0C A;  1I12 A;  5JPH A;  1S7K A;  4E8O A;  2OZG A;  3ZZI A;  2ZPA A;  4RS2 A;  2B3V A;  3EFA A;  4RI1 A;  4JLY A;  1Q2C A;  2BEI A;  1KUV A;  2X7B A;  3DR6 A;  4CAX A;  2ZW7 A;  1M4I A;  4AVB A;  3JUW A;  4PV6 A;  5F47 A;  1Z4E A;  2Z10 A;  2PR1 A;  1QSN A;  1QSR A;  4KLV A;  1IID A;  2VXK A;  3SHP A;  4F6A A;  2R7H A;  2OU2 A;  3NE7 A;  1XMT A;  2FCK A;  2PR8 A;  3B8G A;  3F5B A;  4YGO A;  2B5G B;  4PK3 A;  4QB9 A;  4R57 A;  2FIA A;  4OLL A;  4II9 A;  2PRB A;  4MJ8 A;  4IUS A;  4ZBG A;  2J8N A;  4QBJ A;  3EY5 A;  2Q04 A;  4GS4 A;  4KUB A;  2ARH A;  3FB3 A;  3W91 A;  3W6S A;  4F0Y A;  1KUX A;  1YX0 A;  2FT0 A;  2R8V A;  3GKR A;  2WPX A;  1XE4 A;  3C26 A;  1QSM A;  1BO4 A;  5J8F A;  2P0W A;  4B5P A;  3TO9 A;  3R95 A;  3D8P A;  2FSR A;  5F48 A;  2ZXV A;  2Q0Y A;  1Y9K A;  3TT2 A;  5F46 A;  1LRZ A;  1NSL A;  3IGR A;  3G3S A;  1WK4 A;  4CAW A;  4KVX A;  3OWC A;  2VBQ A;  2JEV A;  4J3G A;  1M1D A;  1CJW A;  4KLW A;  3MGD A;  2ZW6 A;  5JQ4 A;  1R57 A;  4M3S A;  3VWD A;  5H84 A;  3S6K A;  4XPD B;  1YLE A;  4U9Y A;  1S7N A;  4LX9 A;  4KOR A;  4AVA A;  3D3S A;  4CAV A;  1PU9 A;  1IYL A;  1S7F A;  2F5I A;  2JLM A;  2Y0M A;  5EC4 A;  1YK3 A;  3S6H A;  2FS5 A;  2WPW A;  2P6F A;  3BJ7 A;  4R9M A;  2JDC A;  3G8W A;  3I9S A;  2AJ6 A;  2AE6 A;  4L8A A;  2REE A;  3R96 A;  2PDO A;  2QML A;  2CY2 A;  3FRM A;  2ZW4 A;  3DR8 A;  4YFJ A;  5J8C A;  4JXR A;  2CNM A;  2D4P A;  5H86 A;  5C88 A;  3BJ8 A;  4ORF A;  4AVC A;  4KVO E;  3TCV A;  1QSO A;  3BLN A;  1Y9W A;  2HV2 A;  5CNP A;  1CM0 A;  2B4B A;  2ZW5 A;  1S7L A;  2IL4 A;  4MY0 A;  3H4Q A;  2GAN A;  2NMT A;  1B6B A;  3DDD A;  4Y49 C;  3VWE A;  1Z9U A;  2GE3 A;  2QIR A;  1NMT A;  1UFH A;  4E2A A;  1QST A;  1YGH A;  2K5T A;  1P4N A;  4MY3 A;  4PK2 A;  4K30 A;  4FD5 A;  5KTA A;  3FXT A;  4LUA A;  3WR7 A;  4HKF A;  3GYA A;  3TO7 A;  3FIX A;  4KUA A;  4XNH C;  1TIQ A;  2JDD A;  3LOD A;  4M85 A;  4ONU A;  4NXY A;  3LD2 A;  2BSW A;  2OH1 A;  1I21 A;  4EVY A;  2FXF A;  3QAH A;  4HNX B;  2EUI A;  1NE9 A;  4MI4 A;  2R98 A;  2GIV A;  2I00 A;  3I3G A;  2VI7 A;  5F49 A;  2BUE A;  1XIX A;  3R9F A;  3F0A A;  2B4D A;  1RXT A;  4H89 A;  1MK4 A;  3SXN A;  2HQY A;  4FD7 A;  4R3L A;  4R87 A;  2P6G A;  4XPL A;  3IWG A;  1M4D A;  3DNS A;  4R3K A;  3ZJ0 A;  1K4J A;  3F8K A;  4BMH A;  4FD6 A;  3QB8 A;  1OZP A;  4CRY B;  4B5P B;  3KKW A;  3P2F A;  3TTH A;  1BOB A;  4L89 A;  1Q2Y A;  3CXQ A;  1Q2D A;  4JXQ A;  5IV0 A;  2EVN A;  2J8M A;  4X5K A;  1RO5 A;  4AG9 A;  5FVJ A;  5EBV A;  4I49 A;  2VEZ A;  3S6G A;  5HMN A;  4PSX A;  3GY9 A;  2G3T A;  2PQ8 A;  4XPK A;  4AG7 A;  1M44 A;  1L0C A;  4B5O A;  2OZH A;  2PC1 A;  4QVT A;  2DXQ A; 
#chains in the Genus database with same CATH topology
 3D7D A;  4JD6 A;  3KHZ A;  3PRT A;  2XEI A;  5AGE A;  2HUZ A;  2RB7 A;  4U9Z A;  3ISX A;  4KOY A;  3PEI A;  5DWM A;  5KTD A;  1Y0Y A;  3KHX A;  5D8N A;  4BBH A;  5LYF A;  2VL1 A;  2GFQ A;  2NSM A;  2PJA A;  3PB7 X;  1VHS A;  4P44 A;  2G3A A;  4F8Z A;  4NGS A;  3K9U A;  4MBU A;  3T90 A;  3E0K A;  4OAD A;  5K8P A;  4OKO A;  4OC1 A;  3R9E A;  2AFZ A;  4KVM E;  4QC6 A;  4TNU A;  5G22 A;  1Z8X A;  2D4O A;  5IB0 A;  3R1K A;  4A2Z A;  2DPT A;  2PSW A;  4KOU A;  1XOV A;  2PJ2 A;  3H8F A;  3PB9 X;  2P6E A;  3CPA A;  3CXP A;  4BD9 A;  4X2T A;  2C27 A;  3RO0 A;  1J4J A;  4MFP A;  3FYN A;  4EME A;  2FIW A;  1VHO A;  4IF5 A;  2A4N A;  3FEE A;  2EWB A;  5IX3 A;  1IYK A;  2C6G A;  4MHZ A;  3T9Y A;  3V8I A;  1U6M A;  4MHP A;  1FY7 A;  2PJ5 A;  5ISV A;  2QEC A;  1MJ9 A;  3PB4 X;  2EK9 A;  2PJ9 A;  4DJL A;  2PVW A;  2OR4 A;  4B11 A;  1EE3 P;  1MJA A;  1YME A;  3KQZ A;  1NSA A;  4UFV A;  2VZZ A;  1Y7R A;  2Q44 A;  1Y7E A;  4KOS A;  2DF5 A;  4CS0 B;  4E0A A;  4OIW A;  4HNW B;  1YRE A;  2Z3O A;  4RN7 A;  1ZG7 A;  4PSW A;  3SJF A;  5K8N A;  2EBJ A;  2Q4V A;  3RYO A;  3S6F A;  3TC8 A;  1S60 A;  4JWP A;  2PJ4 A;  5E96 A;  3SXO A;  3D4U A;  3D67 A;  4NGT A;  4B12 A;  3UY5 A;  4KOX A;  4UWJ A;  3S9M A;  4RUH A;  1N71 A;  4NFR A;  2GLF A;  2B5G A;  1M4G A;  2Z11 A;  4GXH A;  1XF8 A;  3B35 A;  2V8V A;  1X10 A;  3EC4 A;  4MHN A;  1ELM P;  4KOV A;  5JGF A;  4MFQ A;  2B3U A;  4UEF A;  4AXV A;  2YND A;  3H5Z A;  4LQG A;  4C68 A;  5I4M A;  1BPN A;  1S3Z A;  4P4B A;  2O28 A;  3K9T A;  2B58 A;  3DSB A;  3B3T A;  1ON0 A;  3K2K A;  1F2P A;  3GB0 A;  4FAI A;  4NSQ A;  4JJX A;  5CPA A;  4UEZ A;  4YRH A;  3FNC A;  1IY7 A;  3CXS A;  1H8L A;  4FD4 A;  3RNZ A;  3NFZ A;  2R1I A;  3D2P A;  1CX8 A;  1WWZ A;  2ZED A;  2J8R A;  1CG2 A;  1XEB A;  2Z3M A;  4XPD C;  4MFJ A;  1GHE A;  4Y49 B;  2AFW A;  4YWY A;  3CT9 A;  2Z0Z A;  3EO4 A;  1BAV A;  4LQ6 A;  3S9N A;  1HEE A;  2C6P A;  3PZJ A;  4NF1 A;  3JVN A;  1CBX A;  4UWI A;  1Z4R A;  4MFZ A;  3TOA A;  1CP7 A;  4AB7 A;  4YU9 A;  2ZOG A;  2J9A A;  2B4D B;  3JTK A;  4UCM A;  4DNC A;  1KZF A;  3PGP A;  3TOB A;  2VQY A;  1PUA A;  5LYD A;  1IB1 E;  1YVK A;  5I0C A;  1CP6 A;  4WJB A;  3TE4 A;  4UF4 A;  1XMB A;  4A33 A;  4JZ0 A;  4XNH B;  4NCZ A;  5HH1 A;  1IOF A;  1Z8L A;  4OAE A;  2VZY A;  1IIC A;  1S5K A;  4U5Y A;  2OB0 A;  2G0B A;  2V8H A;  5DWN A;  4CGO A;  2BOA A;  2CNS A;  2Q7B A;  3EXN A;  1MJB A;  2DPS A;  4ZI6 A;  4NEX A;  5JH9 A;  2JBK A;  1VHE A;  1LAP A;  2CXA A;  2FE7 A;  3WC6 A;  2BCO A;  3KR4 A;  4MHD A;  4W9Y A;  2PJ3 A;  4NGN A;  4KZT A;  4B6Z A;  3TFY A;  2ZEF A;  5HVH A;  1BLL E;  2OZU A;  4H6Z A;  3IU1 A;  2POK A;  3FBU A;  3IU2 A;  4H6U A;  4P10 A;  4BIN A;  4FBE A;  5HVG A;  5GCN A;  5A28 A;  5K8M A;  2CNT A;  1XBU A;  1B87 A;  4ZX8 A;  2Z3K A;  3PP9 A;  4CYQ A;  3N7Z A;  4Z65 A;  3KL9 A;  4CRZ B;  1CPS A;  5THW A;  3PFO A;  2OOT A;  4F9U A;  3VAR A;  2I79 A;  2BL1 A;  2WZN A;  3N5F A;  2H5M A;  3BI0 A;  2O4H A;  4OC3 A;  4GM5 A;  4KOW A;  2V8G A;  3DLJ A;  1KUY A;  2Q4Y A;  1LAN A;  1PYT B;  2FL4 A;  2RC4 A;  7CPA A;  2KCW A;  4OC2 A;  4KOT A;  4Q36 A;  4ZY0 A;  1Y0R A;  1Z5R A;  4HNY B;  1PCA A;  1I1D A;  4ONW A;  4KS9 A;  3D2M A;  8CPA A;  1YQE A;  1ZG9 A;  5AG5 A;  3T8W A;  3KAS A;  4CGN A;  5LRK A;  2YNE A;  4UA3 A;  3P2H A;  5C82 A;  1TF9 A;  1YVO A;  4MCR A;  2IMO A;  1Q7L A;  1VKC A;  1Z2L A;  1P0H A;  2PJ8 A;  2ZEN A;  2ZEL A;  4QUS A;  3W6X A;  3B3V A;  1YR0 A;  2IQ6 A;  1ZLH A;  5D29 A;  2REF A;  2HB6 A;  3R9G A;  3TO6 A;  2ZEM A;  2XEF A;  4ZY1 A;  1SQH A;  4UBR A;  5F09 A;  1A2Z A;  1RTQ A;  4JYW A;  5KTC A;  1AYE A;  2ATR A;  1V0C A;  4Q38 A;  3IWE A;  3H8E A;  1I12 A;  5JPH A;  3KI9 A;  2PJ0 A;  1QQ9 A;  1ARM A;  1S7K A;  4E8O A;  2OZG A;  3ZZI A;  2ZPA A;  4RS2 A;  2B3V A;  3B3S A;  4WWV A;  3EFA A;  4RI1 A;  4JLY A;  1LFW A;  1ZO0 A;  1Q2C A;  1TKH A;  2CTC A;  2BEI A;  1KUV A;  2X7B A;  3DR6 A;  4CAX A;  2ZW7 A;  2G9D A;  1M4I A;  4UIB A;  3JUW A;  4OP4 A;  4R6T A;  4X8I A;  4PV6 A;  4AVB A;  3JRU A;  3LMS A;  5F47 A;  1DTD A;  4IHM A;  3VAT A;  1Z4E A;  2Z10 A;  3MN8 A;  2PR1 A;  3A9L A;  3FVL A;  4M6H A;  4UCP A;  5JM6 A;  1QSN A;  1AUG A;  2PJB A;  1QSR A;  4OID A;  3KR5 A;  3WT4 A;  4KLV A;  3RAM A;  2PJ7 A;  1IID A;  2VXK A;  4MMO A;  3SHP A;  3LWU A;  4F6A A;  2R7H A;  4P4E A;  4B14 A;  2CF4 A;  2OU2 A;  5EMI A;  4CGM A;  3NE7 A;  1XMT A;  2FCK A;  2PR8 A;  3B8G A;  3F5B A;  4YGO A;  5BWA B;  1GYT A;  4DYO A;  2ZEH A;  4OME A;  2B5G B;  3NE8 A;  4PK3 A;  4A30 A;  4QB9 A;  5G1Z A;  4EFD A;  4R57 A;  4NGQ A;  2FIA A;  4C7H A;  4P4D A;  3FED A;  4NGR A;  4OLL A;  2ABZ A;  4II9 A;  3LAC A;  4A31 A;  4P4I A;  2PRB A;  1IGB A;  4IUS A;  4MJ8 A;  4NJR A;  4ZBG A;  2J8N A;  3NH5 A;  4QBJ A;  3IEH A;  3EY5 A;  3IFE A;  3WAB A;  3V38 A;  1LAM A;  3IO1 A;  3SI1 A;  1JWQ A;  3B7I A;  5AG7 A;  2PRQ A;  2Q04 A;  4GS4 A;  4PPZ A;  2QJ8 A;  4KUB A;  1KWM A;  1BPM A;  2ARH A;  3BHX A;  4NGM A;  3FB3 A;  4CGP A;  2GU2 A;  3W91 A;  2DEA A;  3W6S A;  2PIY A;  5LRJ A;  4F0Y A;  4UEE A;  1TKJ A;  1KUX A;  1YX0 A;  1ELL P;  4R7M A;  2FT0 A;  4C2X A;  2R8V A;  3GKR A;  2WPX A;  4DUK A;  5G21 A;  3GUX A;  3NH4 A;  1XE4 A;  3C26 A;  3FEC A;  2C6C A;  4R8F A;  2YNC C;  1QMU A;  1JQG A;  4R76 A;  2O53 A;  1QSM A;  1BO4 A;  5J8F A;  2P0W A;  5A27 A;  4B5P A;  2AFM A;  3R95 A;  3D8P A;  1VIX A;  3PB6 X;  2WSA A;  3TO9 A;  2FSR A;  5F48 A;  1UWY A;  4MFL A;  2ZXV A;  1IU8 A;  3IWW A;  2Q0Y A;  1Y9K A;  2ZOF A;  3TT2 A;  1F57 A;  5G20 A;  5F46 A;  3B3C A;  4MHY A;  1LRZ A;  2F7V A;  1NSL A;  3IGR A;  3G3S A;  4P6Y A;  1WK4 A;  4MCQ A;  4X3R A;  2ZEE A;  2ANP A;  4CAW A;  4KVX A;  3OWC A;  2VBQ A;  2JEV A;  4J3G A;  1M1D A;  1CJW A;  4KLW A;  3MGD A;  2ZW6 A;  5JQ4 A;  1R57 A;  4P4J A;  3NH8 A;  4M3S A;  3VWD A;  3IJ3 A;  4A39 A;  4F9V A;  2AFU A;  5H84 A;  3S6K A;  4H2K A;  4XPD B;  2PVV A;  4CAE A;  1YLE A;  4IAV A;  4U9Y A;  4ZGY B;  3KZW A;  1S7N A;  3RBU A;  2ZEO A;  4LX9 A;  2PJC A;  1ARL A;  4MCS A;  3GIU A;  2YNC A;  1YW4 A;  4KOR A;  3MRU A;  4AVA A;  1ZG8 A;  3RZA A;  4Q7A A;  1F2O A;  3D3S A;  1PU9 A;  4UCN A;  4CAF A;  4CAV A;  1FNO A;  1IYL A;  1S7F A;  3B2Y A;  2F5I A;  2JLM A;  2Y0M A;  5EC4 A;  1YK3 A;  4UIA A;  4NJQ A;  4TWE A;  3S6H A;  4PXE A;  2FS5 A;  3GLJ A;  2GLJ A;  2C1C A;  2P6F A;  2WPW A;  2Z3L A;  3BJ7 A;  4PXC A;  4R9M A;  2XEG A;  2JDC A;  3G8W A;  1OBR A;  3I9S A;  4B10 A;  1R43 A;  2AJ6 A;  2AE6 A;  4L8A A;  2REE A;  3D7H A;  3R96 A;  2PDO A;  3D68 A;  2QML A;  2PJ6 A;  1M4L A;  2CY2 A;  2ZEP A;  3FRM A;  2ZW4 A;  3DR8 A;  4YFJ A;  5HXD A;  1XFO A;  3CZX A;  5J8C A;  4JXR A;  2CNM A;  2XEJ A;  2AFS A;  2QYV A;  2Q51 A;  3I1U A;  2D4P A;  3CDX A;  1ZLI A;  1HDU A;  4G1P A;  4A32 A;  3WC5 A;  5H86 A;  5C88 A;  3BJ8 A;  4ORF A;  4AVC A;  2F8H A;  2AFX A;  4KVO E;  4ZYQ A;  3TCV A;  1QSO A;  2ODF A;  4OC0 A;  3BLN A;  3D7G A;  1Y9W A;  3SJX A;  2HV2 A;  2RFH A;  3PB8 X;  5LRG A;  5J1Q A;  4MCP A;  5CNP A;  1CM0 A;  3SI0 A;  2B4B A;  4CYO A;  2ZW5 A;  3SJE A;  1S7L A;  2IL4 A;  3QNV A;  3FF3 A;  4MY0 A;  5DS0 A;  2Z3P A;  1Z8W A;  3H4Q A;  2GAN A;  5IB9 A;  2WUU A;  2NMT A;  4C7I A;  1B6B A;  4M6G A;  4CPA A;  3NA6 A;  3DDD A;  4Y49 C;  3VWE A;  2PJ1 A;  3PFE A;  4A95 A;  1Z9U A;  1X12 A;  2GE3 A;  4KSI A;  2QIR A;  3QAY A;  3HUV A;  1NMT A;  1UFH A;  4E2A A;  1QST A;  1YGH A;  2K5T A;  1P4N A;  4MY3 A;  4B13 A;  4PK2 A;  6CPA A;  2ZEG A;  4FD5 A;  4K30 A;  3FXT A;  4LUA A;  1TKF A;  3KGQ A;  4HKF A;  3WR7 A;  4CGL A;  5KTA A;  3H8G A;  3GYA A;  2HC9 A;  3TO7 A;  3FIX A;  4K3N A;  4KUA A;  3V7Z A;  3S9L A;  4XNH C;  5AG4 A;  1TIQ A;  2JDD A;  1XJO A;  3LOD A;  3D66 A;  4KSF A;  3FX6 A;  4FWU A;  1FT7 A;  4IK2 A;  4M6I A;  2WYR A;  4M85 A;  5HVF A;  5K8O A;  4ONU A;  1TXR A;  1XRY A;  1HDQ A;  2PIZ A;  4O23 A;  4HPS A;  4CYN A;  1LCP A;  4NXY A;  3LD2 A;  2BSW A;  3FMC A;  1YW6 A;  2OH1 A;  1I21 A;  4EVY A;  2FXF A;  3D7F A;  3QAH A;  2Q4Z A;  2Z3N A;  1YLO A;  4HNX B;  1R3N A;  4PQA A;  2Q7S A;  4A94 A;  2EUI A;  3FH4 A;  1NE9 A;  1YSJ A;  2GRE A;  2R98 A;  4MI4 A;  3PBB A;  2GIV A;  2NYQ A;  2I00 A;  2CTB A;  2VI7 A;  3I3G A;  2BUE A;  5F49 A;  3DGV A;  1LOK A;  1XIX A;  2V8D A;  3R9F A;  2JBJ A;  3F0A A;  2EO8 A;  3IC1 A;  3TX8 A;  2B4D A;  2YGW A;  1RXT A;  4F0X A;  3CPX A;  4H89 A;  3SI2 A;  4MFK A;  3BI1 A;  1MK4 A;  5LYI A;  3SXN A;  2PCU A;  5LYL A;  2HQY A;  4FD7 A;  2V77 A;  4R3L A;  4R87 A;  2FVG A;  2P6G A;  4XPL A;  5CBM A;  2PE3 A;  3IWG A;  3HLP A;  1M4D A;  3DNS A;  4MRI A;  4R3K A;  3ZJ0 A;  1K4J A;  1AMP A;  3F8K A;  4UFX A;  4CYP A;  4BMH A;  3VH9 A;  4ZY2 A;  2EK8 A;  4FD6 A;  1VGY A;  3QB8 A;  1OZP A;  4PXD A;  4CRY B;  4B5P B;  4OC4 A;  3FJU A;  4FUU A;  4OC5 A;  2QVP A;  3KKW A;  3P2F A;  3IIB A;  3TTH A;  1BOB A;  1CPX A;  4L89 A;  1Q2Y A;  1DE4 C;  1Q2D A;  3CXQ A;  4JXQ A;  4A38 A;  2Q43 A;  3ISZ A;  1TF8 A;  3KQX A;  5IV0 A;  5ELY A;  4NGP A;  2EVN A;  2J8M A;  4MXU A;  4X5K A;  1RO5 A;  4AG9 A;  4C2Z A;  5FVJ A;  1IOI A;  4I49 A;  2VEZ A;  5EBV A;  2I3C A;  4ZX9 A;  3S6G A;  3PBE A;  4P45 A;  2CIJ A;  3B3W A;  3WC7 A;  1Z8T A;  2JEW A;  4EWT A;  4PSX A;  5HMN A;  3GY9 A;  2G3T A;  2PQ8 A;  3SJG A;  4C2Y A;  4XPK A;  4P4F A;  4A37 A;  4AG7 A;  2BO9 A;  2AFO A;  3L2N A;  4PXB A;  3BXM A;  1M44 A;  5AG6 A;  1L0C A;  4B5O A;  4UFW A;  2IJZ A;  2OZH A;  2PC1 A;  4KSA A;  4QVT A;  2DXQ A; 
#chains in the Genus database with same CATH homology
 4JD6 A;  5AGE A;  2HUZ A;  4U9Z A;  4KOY A;  5DWM A;  5KTD A;  4BBH A;  1VHS A;  2G3A A;  3K9U A;  4MBU A;  3T90 A;  3E0K A;  4OAD A;  3R9E A;  4QC6 A;  4KVM E;  5G22 A;  2D4O A;  5IB0 A;  3R1K A;  4A2Z A;  2DPT A;  2PSW A;  4KOU A;  2P6E A;  3CXP A;  2C27 A;  1J4J A;  4MFP A;  3FYN A;  2FIW A;  4IF5 A;  2A4N A;  5IX3 A;  1IYK A;  3T9Y A;  3V8I A;  1U6M A;  1FY7 A;  5ISV A;  2QEC A;  1MJ9 A;  4B11 A;  1MJA A;  4UFV A;  2VZZ A;  1Y7R A;  2Q44 A;  4KOS A;  4CS0 B;  4E0A A;  4HNW B;  1YRE A;  2Z3O A;  4PSW A;  2Q4V A;  3RYO A;  3S6F A;  1S60 A;  4JWP A;  5E96 A;  3SXO A;  4B12 A;  3UY5 A;  4KOX A;  4UWJ A;  1N71 A;  2B5G A;  1M4G A;  2Z11 A;  1XF8 A;  3EC4 A;  4KOV A;  4MFQ A;  2B3U A;  2YND A;  3H5Z A;  4C68 A;  1S3Z A;  2O28 A;  2B58 A;  3DSB A;  1ON0 A;  4NSQ A;  4JJX A;  4YRH A;  3FNC A;  3CXS A;  4FD4 A;  2R1I A;  3D2P A;  1WWZ A;  2J8R A;  1XEB A;  2Z3M A;  4XPD C;  4MFJ A;  1GHE A;  4Y49 B;  2Z0Z A;  3EO4 A;  3PZJ A;  4NF1 A;  3JVN A;  4UWI A;  1Z4R A;  4MFZ A;  3TOA A;  4AB7 A;  2B4D B;  3JTK A;  4UCM A;  4DNC A;  1KZF A;  3PGP A;  3TOB A;  2VQY A;  1PUA A;  1IB1 E;  1YVK A;  5I0C A;  3TE4 A;  4A33 A;  4XNH B;  4NCZ A;  5HH1 A;  4OAE A;  2VZY A;  1IIC A;  1S5K A;  4U5Y A;  2OB0 A;  2G0B A;  5DWN A;  4CGO A;  2CNS A;  2Q7B A;  3EXN A;  1MJB A;  2DPS A;  4NEX A;  2FE7 A;  2CXA A;  4MHD A;  3TFY A;  4KZT A;  2OZU A;  4H6Z A;  3IU1 A;  3FBU A;  3IU2 A;  4H6U A;  5GCN A;  5A28 A;  2CNT A;  1B87 A;  2Z3K A;  3PP9 A;  4CYQ A;  3N7Z A;  4CRZ B;  2I79 A;  2BL1 A;  2H5M A;  4KOW A;  1KUY A;  2Q4Y A;  2FL4 A;  2RC4 A;  2KCW A;  4KOT A;  4Q36 A;  4HNY B;  1I1D A;  4KS9 A;  3D2M A;  4CGN A;  5AG5 A;  2YNE A;  4UA3 A;  3P2H A;  5C82 A;  1YVO A;  1VKC A;  1P0H A;  4QUS A;  3W6X A;  1YR0 A;  2REF A;  3R9G A;  3TO6 A;  1SQH A;  4UBR A;  5KTC A;  2ATR A;  1V0C A;  4Q38 A;  3IWE A;  1I12 A;  5JPH A;  1S7K A;  4E8O A;  2OZG A;  3ZZI A;  2ZPA A;  4RS2 A;  2B3V A;  3EFA A;  4RI1 A;  4JLY A;  1ZO0 A;  1Q2C A;  2BEI A;  1KUV A;  2X7B A;  3DR6 A;  4CAX A;  2ZW7 A;  1M4I A;  4AVB A;  3JUW A;  4PV6 A;  5F47 A;  1Z4E A;  2Z10 A;  2PR1 A;  3A9L A;  4UCP A;  1QSN A;  1QSR A;  4KLV A;  1IID A;  2VXK A;  3SHP A;  4F6A A;  2R7H A;  4B14 A;  2OU2 A;  4CGM A;  3NE7 A;  1XMT A;  2FCK A;  2PR8 A;  3B8G A;  3F5B A;  4YGO A;  5BWA B;  2B5G B;  4PK3 A;  4A30 A;  4QB9 A;  5G1Z A;  4R57 A;  2FIA A;  4C7H A;  4OLL A;  4II9 A;  4A31 A;  2PRB A;  4MJ8 A;  4IUS A;  4ZBG A;  2J8N A;  4QBJ A;  3EY5 A;  5AG7 A;  2Q04 A;  4GS4 A;  4KUB A;  2ARH A;  3FB3 A;  4CGP A;  3W91 A;  3W6S A;  4F0Y A;  1KUX A;  1YX0 A;  4C2X A;  2FT0 A;  2R8V A;  3GKR A;  2WPX A;  5G21 A;  1XE4 A;  3C26 A;  2YNC C;  1QSM A;  1BO4 A;  5J8F A;  2P0W A;  5A27 A;  4B5P A;  3TO9 A;  3R95 A;  3D8P A;  2WSA A;  2FSR A;  5F48 A;  4MFL A;  2ZXV A;  2Q0Y A;  1Y9K A;  3TT2 A;  5G20 A;  5F46 A;  1LRZ A;  1NSL A;  3IGR A;  3G3S A;  1WK4 A;  4CAW A;  4KVX A;  3OWC A;  2VBQ A;  2JEV A;  4J3G A;  1M1D A;  1CJW A;  4KLW A;  3MGD A;  2ZW6 A;  5JQ4 A;  1R57 A;  4M3S A;  3VWD A;  5H84 A;  3S6K A;  4XPD B;  4CAE A;  1YLE A;  4U9Y A;  4ZGY B;  1S7N A;  4LX9 A;  2YNC A;  4KOR A;  4AVA A;  3D3S A;  4UCN A;  1PU9 A;  4CAF A;  4CAV A;  1IYL A;  1S7F A;  2F5I A;  2JLM A;  2Y0M A;  5EC4 A;  1YK3 A;  3S6H A;  2FS5 A;  2WPW A;  2P6F A;  2Z3L A;  3BJ7 A;  4R9M A;  2JDC A;  3G8W A;  4B10 A;  3I9S A;  2AJ6 A;  2AE6 A;  4L8A A;  2REE A;  3R96 A;  2PDO A;  2QML A;  2CY2 A;  3FRM A;  2ZW4 A;  3DR8 A;  4YFJ A;  5J8C A;  4JXR A;  2CNM A;  2D4P A;  4A32 A;  5H86 A;  5C88 A;  3BJ8 A;  4ORF A;  4AVC A;  4KVO E;  3TCV A;  1QSO A;  3BLN A;  1Y9W A;  2HV2 A;  5CNP A;  1CM0 A;  2B4B A;  4CYO A;  2ZW5 A;  1S7L A;  2IL4 A;  4MY0 A;  2Z3P A;  3H4Q A;  2GAN A;  2WUU A;  2NMT A;  4C7I A;  1B6B A;  3DDD A;  4Y49 C;  3VWE A;  4A95 A;  1Z9U A;  2GE3 A;  2QIR A;  1NMT A;  1UFH A;  4E2A A;  1QST A;  1YGH A;  2K5T A;  1P4N A;  4MY3 A;  4B13 A;  4PK2 A;  4K30 A;  4FD5 A;  4CGL A;  3FXT A;  4LUA A;  3WR7 A;  5KTA A;  4HKF A;  3GYA A;  3TO7 A;  3FIX A;  4KUA A;  4XNH C;  5AG4 A;  1TIQ A;  2JDD A;  3LOD A;  4KSF A;  4M85 A;  4ONU A;  4CYN A;  4NXY A;  3LD2 A;  2BSW A;  2OH1 A;  1I21 A;  4EVY A;  2FXF A;  3QAH A;  2Z3N A;  4HNX B;  2EUI A;  1NE9 A;  4MI4 A;  2R98 A;  2GIV A;  2I00 A;  3I3G A;  2VI7 A;  5F49 A;  2BUE A;  1XIX A;  3R9F A;  3F0A A;  4F0X A;  2B4D A;  2YGW A;  1RXT A;  4H89 A;  4MFK A;  1MK4 A;  3SXN A;  2HQY A;  4FD7 A;  4R3L A;  4R87 A;  2P6G A;  4XPL A;  3IWG A;  1M4D A;  3DNS A;  4R3K A;  3ZJ0 A;  1K4J A;  3F8K A;  4UFX A;  4CYP A;  4BMH A;  4FD6 A;  3QB8 A;  1OZP A;  4CRY B;  4B5P B;  3KKW A;  3P2F A;  3TTH A;  1BOB A;  4L89 A;  1Q2Y A;  3CXQ A;  1Q2D A;  4JXQ A;  5IV0 A;  2EVN A;  2J8M A;  4X5K A;  1RO5 A;  4AG9 A;  4C2Z A;  5FVJ A;  5EBV A;  4I49 A;  2VEZ A;  3S6G A;  5HMN A;  4PSX A;  3GY9 A;  2G3T A;  2PQ8 A;  4C2Y A;  4XPK A;  4AG7 A;  5AG6 A;  1M44 A;  1L0C A;  4B5O A;  4UFW A;  2OZH A;  2PC1 A;  4KSA A;  4QVT A;  2DXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...