2JEVA

Crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
169
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic and Structural Analysis of Human Spermidine/Spermine N(1)-Acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DIAMINE ACETYLTRANSFERASE 1
total genus 41
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jevA00
2Q0YA 3KKWA 2D4OA 1PUAA 1FY7A 5IB0A 3BJ8A 5HMNA 3RYOA 3JUWA 4J3GA 4F0YA 3R95A 1XF8A 1NSLA 1YR0A 4FD4A 3FRMA 3S6KA 4JXRA 4KLWA 1YX0A 1XEBA 2CNTA 4XPDB 3UY5A 3C26A 4AVBA 2ZW7A 3W6XA 4LUAA 4MY0A 1ON0A 1Q2DA 1Y9WA 4FD6A 2R7HA 1Y7RA 3W91A 5J8CA 4XPDC 4QB9A 3ZZIA 1IIDA 5C88A 1MJAA 4R3KA 2B4DA 3R96A 2GE3A 5KTDA 4B5PA 5IV0A 4HNWB 1CM0A 5H84A 4XPKA 2G3AA 2HQYA 3FB3A 1YGHA 3DNSA 4FD7A 4UWIA 1MK4A 4JJXA 4KUBA 2JEVA 2Z0ZA 4KOUA 2FXFA 3TCVA 5EC4A 2Z11A 3SXNA 5IX3A 4FD5A 1K4JA 2OZGA 3R9EA 2WPWA 4JLYA 2VBQA 1I21A 2I00A 2JDDA 4E2AA 5ISVA 4Y49B 3BJ7A 1BO4A 4PK3A 2AE6A 4UA3A 4AVCA 4H89A 2ATRA 4X5KA 3S6FA 3TOBA 2QMLA 4KOVA 2BUEA 2OZHA 2ZPAA 3B8GA 4JXQA 2VEZA 4B5OA 4YFJA 1KZFA 4BMHA 1M44A 5DWNA 1YVKA 3NE7A 1S3ZA 3CXSA 4U9YA 1QSNA 3F0AA 1I12A 1Z9UA 3CXPA 4U9ZA 3OWCA 4CAVA 1LRZA 2HUZA 2K5TA 3ZJ0A 4GS4A 2KCWA 3TO9A 4KOYA 2Q4YA 2PDOA 1NE9A 5JQ4A 3QB8A 1S60A 4Y49C 2FIWA 4UWJA 4MBUA 1S7NA 4QC6A 1M4GA 2VI7A 3QAHA 4M85A 2P6EA 4MHDA 5KTAA 1J4JA 5H86A 1WK4A 2J8RA 4R3LA 2NMTA 2PSWA 1Z4RA 2Z10A 4JD6A 4KOTA 5GCNA 2P6GA 5C82A 5F49A 4L8AA 4H6UA 2PRBA 2WPXA 1QSTA 1WWZA 1I1DA 2DXQA 4KZTA 5JPHA 3K9UA 2OB0A 1V0CA 1S5KA 1IB1E 2OH1A 1KUVA 2Y0MA 3EC4A 2G0BA 2G3TA 1XMTA 5F47A 4I49A 3T9YA 3GKRA 4NCZA 3IGRA 4E0AA 3D2PA 1IYKA 3P2FA 1KUYA 4XNHC 4KVOE 3R9FA 3PZJA 2BEIA 3R9GA 3JVNA 4AVAA 3H4QA 4YRHA 3DR8A 1YLEA 2B58A 2B5GA 3D8PA 4OAEA 4XNHB 1RXTA 1L0CA 3EFAA 2ZW4A 2ZW5A 5I0CA 1PU9A 1QSRA 2Q4VA 1B87A 4CAWA 1IYLA 2QIRA 5KTCA 2A4NA 5FVJA 4JWPA 1N71A 3GY9A 4MJ8A 2B4BA 3MGDA 2OZUA 2PQ8A 2GANA 2J8MA 3TTHA 4LX9A 4RI1A 3SXOA 1YREA 3TE4A 3I9SA 1QSOA 2H5MA 2FL4A 2VQYA 4R87A 1CJWA 2F5IA 4PSXA 3D3SA 3V8IA 4F6AA 2C27A 1NMTA 3S6GA 2B3VA 4NXYA 3W6SA 1VKCA 1SQHA 5EBVA 1UFHA 1MJ9A 4K30A 2QECA 1QSMA 2GIVA 3FYNA 3VWEA 4ORFA 4KORA 3VWDA 3FIXA 4B5PB 2B5GB 4II9A 4NSQA 4KOWA 5E96A 4AB7A 2B3UA 1B6BA 3GYAA 2Q7BA 3S6HA 2ARHA 3F5BA 2PC1A 1GHEA 1Q2YA 2Q04A 1Q2CA 3F8KA 3WR7A 2EVNA 1Y9KA 3FXTA 4H6ZA 2HV2A 2OU2A 3SHPA 3BLNA 2JLMA 3LD2A 1Z4EA 3PP9A 5HH1A 4E8OA 4HNYB 4PV6A 4MY3A 2REFA 4KOSA 1XIXA 2BSWA 1IICA 3EO4A 5F48A 4AG9A 2J8NA 2X7BA 1MJBA 1R57A 3DDDA 4OADA 3EY5A 1S7KA 1YK3A 1S7LA 2I79A 3DSBA 1XE4A 5J8FA 3LODA 4HKFA 2FS5A 1M1DA 2JDCA 2VXKA 5F46A 4DNCA 2O28A 4CRZB 3G8WA 4R9MA 3R1KA 2CNSA 3N7ZA 2EUIA 2FCKA 4QUSA 2ZW6A 1VHSA 3IWGA 2FSRA 2R1IA 2ZXVA 4OLLA 4M3SA 4NEXA 2Q44A 2FIAA 1M4IA 4CRYB 3G3SA 4QBJA 3I3GA 1S7FA 4KVME 3FBUA 4KVXA 2REEA 4RS2A 2P6FA 3P2HA 1U6MA 4YGOA 3TT2A 4IUSA 4CS0B 2FE7A 3T90A 1BOBA 4KLVA 2B4DB 1RO5A 4ZBGA 3D2MA 4U5YA 4UBRA 2P0WA 1P4NA 2R8VA 1YVOA 2PR8A 2CY2A 4EVYA 1OZPA 4L89A 3TO7A 2CNMA 3E0KA 2FT0A 4KOXA 3EXNA 4XPLA 3TFYA 4ONUA 4KUAA 2PR1A 2IL4A 4AG7A 3FNCA 2VZYA 5CNPA 3TO6A 2AJ6A 4NF1A 4MI4A 1KUXA 5DWMA 2D4PA 4QVTA 4CAXA 3DR6A 4PK2A 1TIQA 1P0HA 4R57A 2RC4A 2VZZA 3CXQA 2BL1A 4HNXB 3TOAA 2R98A 1M4DA 4IF5A 3PGPA 4PSWA
chains in the Genus database with same CATH superfamily
2Q0YA 2ZEDA 3D67A 5D8NA 3KKWA 2D4OA 1PUAA 4MHYA 1FY7A 5IB0A 3A9LA 2WSAA 1EE3P 3BJ8A 2PVVA 4OC2A 5HMNA 3RYOA 4CPAA 3JUWA 5J1QA 4ZY0A 4J3GA 4UFXA 4KSAA 1TKJA 3LWUA 6CPAA 3PB9X 2EK8A 3NH8A 4OMEA 4F0YA 3R95A 1XF8A 4FBEA 1NSLA 1YR0A 1ZLIA 2DPSA 2ZOGA 4FD4A 5K8MA 1IOFA 4Q36A 3FRMA 4MFLA 1VIXA 3S6KA 4JXRA 1VHOA 2GFQA 4KLWA 1YX0A 1XEBA 2CNTA 1IU8A 1CPSA 1ZLHA 4XPDB 2AFSA 3UY5A 3C26A 3KQXA 3VATA 4CYNA 4AVBA 3D7HA 2ZW7A 3W6XA 4LUAA 4MY0A 5D29A 1ON0A 1Q2DA 1Y9WA 4FD6A 2R7HA 1Y7RA 3W91A 5J8CA 4PXCA 4XPDC 4QB9A 2Z3MA 3ZZIA 1YMEA 1YW4A 3QNVA 1IIDA 4A32A 4P44A 1MJAA 5C88A 5LYIA 4R3KA 2B4DA 2V8VA 3R96A 2GE3A 2VL1A 4GM5A 5KTDA 1BPNA 4B5PA 4W9YA 5IV0A 1LANA 4CYPA 2XEIA 4HNWB 1CM0A 5H84A 3PB6X 2PJAA 4MHNA 4XPKA 2G3AA 2HQYA 3FB3A 1YGHA 3DNSA 4UFWA 3KR4A 4FD7A 4OC5A 4A2ZA 2PJ8A 2ZEPA 4UWIA 3CDXA 1MK4A 3IC1A 1ZG9A 4JJXA 2JEVA 3CPAA 4KUBA 5LRKA 3SJEA 4AXVA 3KZWA 2Z0ZA 4EMEA 4KOUA 4NFRA 4NGPA 2FXFA 4Q38A 3TCVA 2GLFA 1R3NA 1DE4C 1CX8A 1FT7A 3IEHA 3PB7X 4ZY2A 5EC4A 4UCMA 2Z11A 3SXNA 4DJLA 5IX3A 4FD5A 3B3VA 4B6ZA 1HDQA 4OIDA 1LCPA 5JGFA 1AYEA 5JH9A 1K4JA 3FH4A 4M6GA 2OZGA 3R9EA 4OC0A 2WPWA 1AUGA 4JLYA 2VBQA 1H8LA 1I21A 2Q7SA 2I00A 2JDDA 4E2AA 5ISVA 1XJOA 3D4UA 4R6TA 2PIZA 2ZELA 4NGRA 4CGLA 4B10A 4Y49B 3BJ7A 4X2TA 1BO4A 2YNDA 1XMBA 2PCUA 2YGWA 4PK3A 2AE6A 2XEJA 4UA3A 3GB0A 4AVCA 4H89A 2ATRA 4EWTA 2PJ7A 2Z3KA 4MMOA 2EO8A 2PJ3A 2ZEOA 4X5KA 4MRIA 3S6FA 3N5FA 3TOBA 3KI9A 2Z3NA 2QMLA 3JRUA 2BUEA 2OZHA 2ZPAA 3B8GA 4JXQA 4KOVA 1Z5RA 2VEZA 4PSWA 3SI1A 5K8PA 4UIAA 1TF9A 3PB8X 4KSFA 2GU2A 4B5OA 4LQGA 4F9VA 3IIBA 4YFJA 1IGBA 1KZFA 2XEFA 4BMHA 3KHXA 2V8HA 3NE8A 1M44A 4UCNA 2PJCA 1BLLE 5DWNA 1YVKA 2Q4ZA 2XEGA 1CG2A 3KGQA 3NE7A 4MCRA 4P45A 5F09A 1S3ZA 4F0XA 3CXSA 3TC8A 4U9YA 1QSNA 3F0AA 3H5ZA 3B3SA 2AFUA 3D7GA 2HB6A 1I12A 1Z9UA 2PJBA 3CXPA 2BO9A 3OWCA 4U9ZA 5HVFA 4CAVA 2QVPA 2ZEMA 4Q7AA 4R76A 1LRZA 2NSMA 2HUZA 3D68A 5AG5A 2V8GA 3KQZA 4ZX9A 3S9MA 2K5TA 1Z8TA 3K9TA 3ZJ0A 4OC1A 4GS4A 2DEAA 2KCWA 3KHZA 4NGNA 4K3NA 4P10A 2PE3A 4IK2A 3TO9A 4CGOA 1F2PA 4KOYA 2AFOA 2ZEFA 2QJ8A 2Q4YA 2PDOA 2O53A 1NE9A 2PJ9A 5JQ4A 3SI0A 3KASA 4M6IA 2EWBA 2PVWA 1TKHA 1Z8LA 3QB8A 1JWQA 1S60A 4A95A 4Y49C 2FIWA 1Q7LA 4MBUA 1S7NA 4UWJA 4C2YA 4QC6A 1M4GA 1RTQA 3FMCA 2VI7A 3QAHA 4M85A 5K8NA 2P6EA 2Q43A 3PB4X 3MRUA 3FF3A 3L2NA 2Z3OA 4MFKA 1NSAA 4MHDA 4OKOA 4TWEA 4X3RA 4ZYQA 1J4JA 5G20A 5LRJA 5H86A 5KTAA 1WK4A 2J8RA 4R3LA 2NMTA 2PSWA 4Z65A 5CPAA 5HXDA 2ZEEA 1Z4RA 4ZI6A 2Z10A 1A2ZA 2ZEHA 3ISXA 4JD6A 4KOTA 5GCNA 7CPAA 4MFZA 2P6GA 4P4EA 3CPXA 4WJBA 5C82A 5F49A 3S9LA 2PRQA 4L8AA 4H6UA 1M4LA 2CTCA 5G22A 1TXRA 2PRBA 4B13A 2WPXA 1QSTA 1WWZA 3SJFA 1TF8A 3RO0A 4B12A 1I1DA 2AFWA 2DXQA 4KZTA 3K9UA 5JPHA 4MCQA 4NGMA 2YNEA 2OB0A 1V0CA 1S5KA 3GLJA 1IB1E 2OH1A 4C68A 2DF5A 1KUVA 1X10A 3BI1A 4MCSA 4TNUA 3WC6A 4RUHA 2Y0MA 3EC4A 2CTBA 5LYFA 1ZG8A 4LQ6A 4A38A 2G0BA 2G3TA 1XMTA 2ODFA 3JTKA 5F47A 5LYDA 4I49A 3T9YA 4CGMA 3GKRA 4NCZA 5DS0A 3IGRA 4E0AA 3D2PA 3H8EA 1IYKA 5HVGA 2C6CA 3FVLA 2QYVA 3HUVA 3P2FA 4PXDA 1KUYA 4XNHC 3BXMA 3NFZA 4KVOE 3R9FA 1KWMA 3PZJA 2BEIA 3R9GA 1IY7A 4DYOA 3JVNA 1VHEA 4AVAA 1X12A 1LFWA 3H4QA 3QAYA 4YRHA 3SJGA 4MFJA 3DR8A 1YLEA 2B58A 2B5GA 3D8PA 4P4BA 4OAEA 2RFHA 4ZX8A 2WZNA 4ONWA 4XNHB 2IQ6A 1HDUA 1RXTA 1L0CA 2EBJA 4PXBA 1YSJA 2ZW4A 3EFAA 2ZW5A 5I0CA 1PU9A 4HPSA 1QSRA 2Q4VA 1B87A 4CAWA 4F9UA 3LMSA 1XFOA 1IYLA 3T8WA 2GLJA 2QIRA 4IAVA 4MCPA 4UEZA 3B3TA 4H2KA 5KTCA 3FX6A 4JYWA 3IU2A 3BHXA 2A4NA 3GUXA 4A94A 5FVJA 4JWPA 4YWYA 1N71A 3GY9A 3HLPA 4MJ8A 2Q51A 4A33A 2B4BA 3IU1A 3MGDA 2OZUA 5ELYA 4BINA 2PJ4A 2PQ8A 2GANA 1PCAA 2J8MA 3TTHA 1HEEA 2C6PA 3V7ZA 4FAIA 4GXHA 3H8FA 4EFDA 4LX9A 4YU9A 4RI1A 3H8GA 3SXOA 1YREA 3FECA 4P4FA 3TE4A 8CPAA 4NJRA 3I9SA 3VARA 1QSOA 2H5MA 2FL4A 2VQYA 2BCOA 4R87A 1CJWA 2AFMA 1F57A 1Y0YA 2F5IA 3D3SA 4PSXA 4CGPA 3V8IA 4F6AA 2PJ1A 2C27A 1LAPA 2HC9A 4B14A 1NMTA 3FJUA 4PPZA 3S6GA 4BBHA 3PBBA 1PYTB 2B3VA 4NXYA 2IMOA 3W6SA 1VKCA 3FEEA 1SQHA 5EBVA 2PJ2A 1BAVA 1UFHA 4NGSA 4F8ZA 1FNOA 1MJ9A 4K30A 2QECA 5A27A 4CYQA 1Y7EA 4JZ0A 3IWEA 3V38A 1QSMA 2GIVA 3MN8A 3TX8A 2J9AA 2AFZA 3FYNA 4A31A 2ANPA 3VWEA 4CYOA 2PJ5A 4ORFA 4KORA 3VWDA 3FIXA 4B5PB 2V77A 2B5GB 2IJZA 4NSQA 4KOWA 5E96A 4AB7A 4II9A 3ISZA 2B3UA 1B6BA 1IOIA 2I3CA 3GYAA 3RNZA 2Q7BA 3S6HA 2ZEGA 1QMUA 2Z3LA 2ARHA 4UEFA 5I4MA 4MHZA 3F5BA 4FUUA 3B7IA 2PC1A 3D7FA 5K8OA 1GHEA 1Q2YA 5LYLA 2Q04A 3RAMA 1Q2CA 3F8KA 5AG7A 4O23A 3WR7A 2EVNA 1Y9KA 3FXTA 4P4JA 4ZGYB 4H6ZA 2HV2A 3K2KA 4MXUA 2OU2A 3SHPA 3BLNA 2JLMA 3LD2A 1Z4EA 1XOVA 3PP9A 4UIBA 5HH1A 4E8OA 4KS9A 4NGTA 5BWAB 4HNYB 4PV6A 4UFVA 4MFQA 4MY3A 2REFA 4KOSA 1XIXA 1ZG7A 2BSWA 4BD9A 3CZXA 1IICA 3EO4A 2OOTA 5F48A 4AG9A 4R7MA 2J8NA 3DLJA 1QQ9A 4R8FA 3SJXA 2X7BA 1MJBA 4A30A 1CP6A 5AG6A 2JEWA 2ZOFA 1R57A 1Z2LA 5HVHA 2C1CA 3DDDA 3VH9A 1Y0RA 4OADA 3EY5A 1S7KA 2POKA 1YW6A 1YK3A 1S7LA 2ZENA 2CF4A 4OIWA 1Z8XA 3BI0A 2I79A 3DSBA 3B2YA 3B35A 3IO1A 5AG4A 1XE4A 3GIUA 5J8FA 3DGVA 3LODA 4HKFA 4NGQA 3SI2A 2FS5A 2CXAA 2C6GA 1M1DA 3PFOA 5A28A 2JDCA 3WC5A 4OC4A 2VXKA 2PJ6A 2WYRA 1GYTA 5F46A 4UEEA 4A37A 4DNCA 2OR4A 2O28A 4CRZB 5IB9A 3G8WA 3NH4A 4CAFA 4MHPA 4R9MA 4C7HA 3R1KA 2CNSA 3LACA 5CBMA 3N7ZA 1ARMA 4B11A 2V8DA 4P4DA 3RZAA 2EUIA 2FCKA 4QUSA 3B3WA 4CGNA 2ZW6A 1VHSA 3IWGA 2FSRA 2R1IA 2ZXVA 4OLLA 2PIYA 2BOAA 4PQAA 1Z8WA 4M3SA 4ZY1A 1CPXA 3NA6A 4NEXA 2Q44A 2WUUA 4NJQA 5G1ZA 2F7VA 3IWWA 2FIAA 3PBEA 1M4IA 5EMIA 4OP4A 4C2ZA 2FVGA 4CRYB 3G3SA 1YQEA 5LRGA 3PEIA 4A39A 2JBKA 4QBJA 4G1PA 4P4IA 4WWVA 3I3GA 1S7FA 4KVME 3D66A 1LOKA 3KR5A 3FBUA 3PRTA 3RBUA 4KVXA 2RB7A 1UWYA 2REEA 4RS2A 4FWUA 2DPTA 2P6FA 3P2HA 2Z3PA 1ELLP 2PJ0A 1U6MA 4YGOA 3TT2A 3D7DA 1XBUA 4IUSA 4CS0B 1YLOA 2FE7A 2O4HA 3PFEA 1F2OA 3T90A 1BOBA 4KLVA 4DUKA 2CIJA 2B4DB 1RO5A 4ZBGA 1BPMA 3D2MA 4KSIA 4C2XA 2NYQA 4U5YA 5JM6A 1ELMP 5G21A 4UBRA 2P0WA 1P4NA 2JBJA 1LAMA 2YNCA 2R8VA 1YVOA 2PR8A 2CY2A 1AMPA 4C7IA 4EVYA 3WABA 1OZPA 4L89A 4UCPA 3TO7A 2G9DA 2CNMA 2EK9A 4X8IA 3E0KA 1TKFA 4MFPA 2FT0A 4KOXA 3EXNA 2ABZA 4XPLA 3IJ3A 3TFYA 3I1UA 4ONUA 5THWA 4KUAA 3CT9A 4CAEA 1XRYA 2PR1A 1DTDA 3IFEA 4UF4A 2IL4A 4AG7A 3FNCA 2VZYA 5CNPA 3TO6A 2AFXA 2AJ6A 4RN7A 4NF1A 3WC7A 1CBXA 4MI4A 1VGYA 1KUXA 5DWMA 2D4PA 4IHMA 4QVTA 4CAXA 3DR6A 1JQGA 2YNCC 1CP7A 4PK2A 3WT4A 4M6HA 1TIQA 1P0HA 3FEDA 4R57A 1OBRA 4OC3A 2RC4A 5AGEA 1ARLA 2VZZA 3CXQA 2BL1A 4P6YA 2GREA 4HNXB 3S9NA 1ZO0A 4PXEA 2R98A 3NH5A 3TOAA 1R43A 1M4DA 3B3CA 4IF5A 3PGPA 2F8HA 3KL9A
chains in the Genus database with same CATH topology
2Q0YA 3KKWA 2D4OA 1PUAA 1FY7A 5IB0A 3A9LA 2WSAA 3BJ8A 5HMNA 3RYOA 3JUWA 4J3GA 4UFXA 4KSAA 4F0YA 3R95A 1XF8A 1NSLA 1YR0A 2DPSA 4FD4A 4Q36A 3FRMA 4MFLA 3S6KA 4JXRA 4KLWA 1YX0A 1XEBA 2CNTA 4XPDB 3UY5A 3C26A 4CYNA 4AVBA 2ZW7A 3W6XA 4LUAA 4MY0A 1ON0A 1Q2DA 1Y9WA 4FD6A 2R7HA 1Y7RA 3W91A 5J8CA 4XPDC 4QB9A 2Z3MA 3ZZIA 1IIDA 4A32A 5C88A 1MJAA 4R3KA 2B4DA 3R96A 2GE3A 5KTDA 4B5PA 5IV0A 4CYPA 4HNWB 1CM0A 5H84A 4XPKA 2G3AA 2HQYA 3FB3A 1YGHA 3DNSA 4UFWA 4FD7A 4A2ZA 4UWIA 1MK4A 4JJXA 4KUBA 2JEVA 2Z0ZA 4KOUA 2FXFA 4Q38A 3TCVA 5EC4A 4UCMA 2Z11A 3SXNA 5IX3A 4FD5A 1K4JA 2OZGA 3R9EA 2WPWA 4JLYA 2VBQA 1I21A 2I00A 2JDDA 4E2AA 5ISVA 4CGLA 4B10A 4Y49B 3BJ7A 1BO4A 2YNDA 2YGWA 4PK3A 2AE6A 4UA3A 4AVCA 4H89A 2ATRA 2Z3KA 4X5KA 3S6FA 3TOBA 2Z3NA 2QMLA 4KOVA 2BUEA 2OZHA 2ZPAA 3B8GA 4JXQA 2VEZA 4KSFA 4B5OA 4YFJA 1KZFA 4BMHA 1M44A 4UCNA 5DWNA 1YVKA 3NE7A 1S3ZA 4F0XA 3CXSA 4U9YA 1QSNA 3F0AA 3H5ZA 1I12A 1Z9UA 3CXPA 4U9ZA 3OWCA 4CAVA 1LRZA 2HUZA 5AG5A 2K5TA 3ZJ0A 4GS4A 2KCWA 3TO9A 4CGOA 4KOYA 2Q4YA 2PDOA 1NE9A 5JQ4A 3QB8A 1S60A 4A95A 4Y49C 2FIWA 4UWJA 4MBUA 1S7NA 4C2YA 4QC6A 1M4GA 2VI7A 3QAHA 4M85A 2P6EA 4MHDA 2Z3OA 4MFKA 5KTAA 1J4JA 5G20A 5H86A 1WK4A 2J8RA 4R3LA 2NMTA 2PSWA 1Z4RA 2Z10A 4JD6A 4KOTA 5GCNA 4MFZA 2P6GA 5C82A 5F49A 4L8AA 4H6UA 5G22A 2PRBA 4B13A 2WPXA 1QSTA 1WWZA 4B12A 1I1DA 2DXQA 4KZTA 5JPHA 3K9UA 2YNEA 2OB0A 1V0CA 1S5KA 1IB1E 2OH1A 4C68A 1KUVA 2Y0MA 3EC4A 2G0BA 2G3TA 1XMTA 3JTKA 5F47A 4CGMA 4I49A 3T9YA 3GKRA 4NCZA 3IGRA 4E0AA 3D2PA 1IYKA 3P2FA 1KUYA 4XNHC 4KVOE 3R9FA 3PZJA 2BEIA 3R9GA 3JVNA 4AVAA 3H4QA 4YRHA 4MFJA 3DR8A 1YLEA 2B58A 2B5GA 3D8PA 4OAEA 4XNHB 1RXTA 1L0CA 3EFAA 2ZW4A 2ZW5A 5I0CA 1PU9A 1QSRA 2Q4VA 1B87A 4CAWA 1IYLA 2QIRA 5KTCA 3IU2A 2A4NA 5FVJA 4JWPA 1N71A 3GY9A 4MJ8A 4A33A 2B4BA 3IU1A 3MGDA 2OZUA 2PQ8A 2GANA 2J8MA 3TTHA 4LX9A 4RI1A 3SXOA 1YREA 3TE4A 3I9SA 1QSOA 2H5MA 2FL4A 2VQYA 4R87A 1CJWA 2F5IA 4PSXA 4CGPA 3D3SA 3V8IA 4F6AA 2C27A 4B14A 1NMTA 4BBHA 3S6GA 2B3VA 4NXYA 3W6SA 1VKCA 1SQHA 5EBVA 1UFHA 1MJ9A 4K30A 2QECA 5A27A 4CYQA 3IWEA 1QSMA 2GIVA 4A31A 3FYNA 3VWEA 4CYOA 4ORFA 4KORA 3VWDA 3FIXA 4B5PB 2B5GB 4II9A 4NSQA 4KOWA 5E96A 4AB7A 2B3UA 1B6BA 3GYAA 2Q7BA 3S6HA 2Z3LA 2ARHA 3F5BA 2PC1A 1GHEA 1Q2YA 2Q04A 1Q2CA 3F8KA 5AG7A 3WR7A 2EVNA 1Y9KA 3FXTA 4ZGYB 4H6ZA 2HV2A 2OU2A 3SHPA 3BLNA 2JLMA 3LD2A 1Z4EA 3PP9A 5HH1A 4E8OA 4KS9A 5BWAB 4HNYB 4PV6A 4UFVA 4MFQA 4MY3A 2REFA 4KOSA 1XIXA 2BSWA 1IICA 3EO4A 5F48A 4AG9A 2J8NA 2X7BA 1MJBA 4A30A 5AG6A 1R57A 3DDDA 4OADA 3EY5A 1S7KA 1YK3A 1S7LA 2I79A 3DSBA 5AG4A 1XE4A 5J8FA 3LODA 4HKFA 2FS5A 2CXAA 1M1DA 5A28A 2JDCA 2VXKA 5F46A 4DNCA 2O28A 4CRZB 3G8WA 4CAFA 4R9MA 4C7HA 3R1KA 2CNSA 3N7ZA 4B11A 2EUIA 2FCKA 4QUSA 4CGNA 2ZW6A 1VHSA 3IWGA 2FSRA 2R1IA 2ZXVA 4OLLA 4M3SA 4NEXA 2Q44A 2WUUA 5G1ZA 2FIAA 1M4IA 4C2ZA 4CRYB 3G3SA 4QBJA 3I3GA 1S7FA 4KVME 3FBUA 4KVXA 2REEA 4RS2A 2DPTA 2P6FA 3P2HA 2Z3PA 1U6MA 4YGOA 3TT2A 4IUSA 4CS0B 2FE7A 3T90A 1BOBA 4KLVA 2B4DB 1RO5A 4ZBGA 3D2MA 4C2XA 4U5YA 5G21A 4UBRA 2P0WA 1P4NA 2YNCA 2R8VA 1YVOA 2PR8A 2CY2A 4C7IA 4EVYA 1OZPA 4L89A 4UCPA 3TO7A 2CNMA 3E0KA 4MFPA 2FT0A 4KOXA 3EXNA 4XPLA 3TFYA 4ONUA 4CAEA 4KUAA 2PR1A 2IL4A 4AG7A 3FNCA 2VZYA 5CNPA 3TO6A 2AJ6A 4NF1A 4MI4A 1KUXA 5DWMA 2D4PA 4QVTA 4CAXA 3DR6A 2YNCC 4PK2A 1TIQA 1P0HA 4R57A 2RC4A 5AGEA 2VZZA 3CXQA 2BL1A 4HNXB 1ZO0A 3TOAA 2R98A 1M4DA 4IF5A 3PGPA 4PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q0Y A;  3KKW A;  2D4O A;  1PUA A;  1FY7 A;  5IB0 A;  3BJ8 A;  5HMN A;  3RYO A;  3JUW A;  4J3G A;  4F0Y A;  3R95 A;  1XF8 A;  1NSL A;  1YR0 A;  4FD4 A;  3FRM A;  3S6K A;  4JXR A;  4KLW A;  1YX0 A;  1XEB A;  2CNT A;  4XPD B;  3UY5 A;  3C26 A;  4AVB A;  2ZW7 A;  3W6X A;  4LUA A;  4MY0 A;  1ON0 A;  1Q2D A;  1Y9W A;  4FD6 A;  2R7H A;  1Y7R A;  3W91 A;  5J8C A;  4XPD C;  4QB9 A;  3ZZI A;  1IID A;  5C88 A;  1MJA A;  4R3K A;  2B4D A;  3R96 A;  2GE3 A;  5KTD A;  4B5P A;  5IV0 A;  4HNW B;  1CM0 A;  5H84 A;  4XPK A;  2G3A A;  2HQY A;  3FB3 A;  1YGH A;  3DNS A;  4FD7 A;  4UWI A;  1MK4 A;  4JJX A;  4KUB A;  2JEV A;  2Z0Z A;  4KOU A;  2FXF A;  3TCV A;  5EC4 A;  2Z11 A;  3SXN A;  5IX3 A;  4FD5 A;  1K4J A;  2OZG A;  3R9E A;  2WPW A;  4JLY A;  2VBQ A;  1I21 A;  2I00 A;  2JDD A;  4E2A A;  5ISV A;  4Y49 B;  3BJ7 A;  1BO4 A;  4PK3 A;  2AE6 A;  4UA3 A;  4AVC A;  4H89 A;  2ATR A;  4X5K A;  3S6F A;  3TOB A;  2QML A;  4KOV A;  2BUE A;  2OZH A;  2ZPA A;  3B8G A;  4JXQ A;  2VEZ A;  4B5O A;  4YFJ A;  1KZF A;  4BMH A;  1M44 A;  5DWN A;  1YVK A;  3NE7 A;  1S3Z A;  3CXS A;  4U9Y A;  1QSN A;  3F0A A;  1I12 A;  1Z9U A;  3CXP A;  4U9Z A;  3OWC A;  4CAV A;  1LRZ A;  2HUZ A;  2K5T A;  3ZJ0 A;  4GS4 A;  2KCW A;  3TO9 A;  4KOY A;  2Q4Y A;  2PDO A;  1NE9 A;  5JQ4 A;  3QB8 A;  1S60 A;  4Y49 C;  2FIW A;  4UWJ A;  4MBU A;  1S7N A;  4QC6 A;  1M4G A;  2VI7 A;  3QAH A;  4M85 A;  2P6E A;  4MHD A;  5KTA A;  1J4J A;  5H86 A;  1WK4 A;  2J8R A;  4R3L A;  2NMT A;  2PSW A;  1Z4R A;  2Z10 A;  4JD6 A;  4KOT A;  5GCN A;  2P6G A;  5C82 A;  5F49 A;  4L8A A;  4H6U A;  2PRB A;  2WPX A;  1QST A;  1WWZ A;  1I1D A;  2DXQ A;  4KZT A;  5JPH A;  3K9U A;  2OB0 A;  1V0C A;  1S5K A;  1IB1 E;  2OH1 A;  1KUV A;  2Y0M A;  3EC4 A;  2G0B A;  2G3T A;  1XMT A;  5F47 A;  4I49 A;  3T9Y A;  3GKR A;  4NCZ A;  3IGR A;  4E0A A;  3D2P A;  1IYK A;  3P2F A;  1KUY A;  4XNH C;  4KVO E;  3R9F A;  3PZJ A;  2BEI A;  3R9G A;  3JVN A;  4AVA A;  3H4Q A;  4YRH A;  3DR8 A;  1YLE A;  2B58 A;  2B5G A;  3D8P A;  4OAE A;  4XNH B;  1RXT A;  1L0C A;  3EFA A;  2ZW4 A;  2ZW5 A;  5I0C A;  1PU9 A;  1QSR A;  2Q4V A;  1B87 A;  4CAW A;  1IYL A;  2QIR A;  5KTC A;  2A4N A;  5FVJ A;  4JWP A;  1N71 A;  3GY9 A;  4MJ8 A;  2B4B A;  3MGD A;  2OZU A;  2PQ8 A;  2GAN A;  2J8M A;  3TTH A;  4LX9 A;  4RI1 A;  3SXO A;  1YRE A;  3TE4 A;  3I9S A;  1QSO A;  2H5M A;  2FL4 A;  2VQY A;  4R87 A;  1CJW A;  2F5I A;  4PSX A;  3D3S A;  3V8I A;  4F6A A;  2C27 A;  1NMT A;  3S6G A;  2B3V A;  4NXY A;  3W6S A;  1VKC A;  1SQH A;  5EBV A;  1UFH A;  1MJ9 A;  4K30 A;  2QEC A;  1QSM A;  2GIV A;  3FYN A;  3VWE A;  4ORF A;  4KOR A;  3VWD A;  3FIX A;  4B5P B;  2B5G B;  4II9 A;  4NSQ A;  4KOW A;  5E96 A;  4AB7 A;  2B3U A;  1B6B A;  3GYA A;  2Q7B A;  3S6H A;  2ARH A;  3F5B A;  2PC1 A;  1GHE A;  1Q2Y A;  2Q04 A;  1Q2C A;  3F8K A;  3WR7 A;  2EVN A;  1Y9K A;  3FXT A;  4H6Z A;  2HV2 A;  2OU2 A;  3SHP A;  3BLN A;  2JLM A;  3LD2 A;  1Z4E A;  3PP9 A;  5HH1 A;  4E8O A;  4HNY B;  4PV6 A;  4MY3 A;  2REF A;  4KOS A;  1XIX A;  2BSW A;  1IIC A;  3EO4 A;  5F48 A;  4AG9 A;  2J8N A;  2X7B A;  1MJB A;  1R57 A;  3DDD A;  4OAD A;  3EY5 A;  1S7K A;  1YK3 A;  1S7L A;  2I79 A;  3DSB A;  1XE4 A;  5J8F A;  3LOD A;  4HKF A;  2FS5 A;  1M1D A;  2JDC A;  2VXK A;  5F46 A;  4DNC A;  2O28 A;  4CRZ B;  3G8W A;  4R9M A;  3R1K A;  2CNS A;  3N7Z A;  2EUI A;  2FCK A;  4QUS A;  2ZW6 A;  1VHS A;  3IWG A;  2FSR A;  2R1I A;  2ZXV A;  4OLL A;  4M3S A;  4NEX A;  2Q44 A;  2FIA A;  1M4I A;  4CRY B;  3G3S A;  4QBJ A;  3I3G A;  1S7F A;  4KVM E;  3FBU A;  4KVX A;  2REE A;  4RS2 A;  2P6F A;  3P2H A;  1U6M A;  4YGO A;  3TT2 A;  4IUS A;  4CS0 B;  2FE7 A;  3T90 A;  1BOB A;  4KLV A;  2B4D B;  1RO5 A;  4ZBG A;  3D2M A;  4U5Y A;  4UBR A;  2P0W A;  1P4N A;  2R8V A;  1YVO A;  2PR8 A;  2CY2 A;  4EVY A;  1OZP A;  4L89 A;  3TO7 A;  2CNM A;  3E0K A;  2FT0 A;  4KOX A;  3EXN A;  4XPL A;  3TFY A;  4ONU A;  4KUA A;  2PR1 A;  2IL4 A;  4AG7 A;  3FNC A;  2VZY A;  5CNP A;  3TO6 A;  2AJ6 A;  4NF1 A;  4MI4 A;  1KUX A;  5DWM A;  2D4P A;  4QVT A;  4CAX A;  3DR6 A;  4PK2 A;  1TIQ A;  1P0H A;  4R57 A;  2RC4 A;  2VZZ A;  3CXQ A;  2BL1 A;  4HNX B;  3TOA A;  2R98 A;  1M4D A;  4IF5 A;  3PGP A;  4PSW A; 
#chains in the Genus database with same CATH topology
 2Q0Y A;  2ZED A;  3D67 A;  5D8N A;  3KKW A;  2D4O A;  1PUA A;  4MHY A;  1FY7 A;  5IB0 A;  3A9L A;  2WSA A;  1EE3 P;  3BJ8 A;  2PVV A;  4OC2 A;  5HMN A;  3RYO A;  4CPA A;  3JUW A;  5J1Q A;  4ZY0 A;  4J3G A;  4UFX A;  4KSA A;  1TKJ A;  3LWU A;  6CPA A;  3PB9 X;  2EK8 A;  3NH8 A;  4OME A;  4F0Y A;  3R95 A;  1XF8 A;  4FBE A;  1NSL A;  1YR0 A;  1ZLI A;  2DPS A;  2ZOG A;  4FD4 A;  5K8M A;  1IOF A;  4Q36 A;  3FRM A;  4MFL A;  1VIX A;  3S6K A;  4JXR A;  1VHO A;  2GFQ A;  4KLW A;  1YX0 A;  1XEB A;  2CNT A;  1IU8 A;  1CPS A;  1ZLH A;  4XPD B;  2AFS A;  3UY5 A;  3C26 A;  3KQX A;  3VAT A;  4CYN A;  4AVB A;  3D7H A;  2ZW7 A;  3W6X A;  4LUA A;  4MY0 A;  5D29 A;  1ON0 A;  1Q2D A;  1Y9W A;  4FD6 A;  2R7H A;  1Y7R A;  3W91 A;  5J8C A;  4PXC A;  4XPD C;  4QB9 A;  2Z3M A;  3ZZI A;  1YME A;  1YW4 A;  3QNV A;  1IID A;  4A32 A;  4P44 A;  1MJA A;  5C88 A;  5LYI A;  4R3K A;  2B4D A;  2V8V A;  3R96 A;  2GE3 A;  2VL1 A;  4GM5 A;  5KTD A;  1BPN A;  4B5P A;  4W9Y A;  5IV0 A;  1LAN A;  4CYP A;  2XEI A;  4HNW B;  1CM0 A;  5H84 A;  3PB6 X;  2PJA A;  4MHN A;  4XPK A;  2G3A A;  2HQY A;  3FB3 A;  1YGH A;  3DNS A;  4UFW A;  3KR4 A;  4FD7 A;  4OC5 A;  4A2Z A;  2PJ8 A;  2ZEP A;  4UWI A;  3CDX A;  1MK4 A;  3IC1 A;  1ZG9 A;  4JJX A;  2JEV A;  3CPA A;  4KUB A;  5LRK A;  3SJE A;  4AXV A;  3KZW A;  2Z0Z A;  4EME A;  4KOU A;  4NFR A;  4NGP A;  2FXF A;  4Q38 A;  3TCV A;  2GLF A;  1R3N A;  1DE4 C;  1CX8 A;  1FT7 A;  3IEH A;  3PB7 X;  4ZY2 A;  5EC4 A;  4UCM A;  2Z11 A;  3SXN A;  4DJL A;  5IX3 A;  4FD5 A;  3B3V A;  4B6Z A;  1HDQ A;  4OID A;  1LCP A;  5JGF A;  1AYE A;  5JH9 A;  1K4J A;  3FH4 A;  4M6G A;  2OZG A;  3R9E A;  4OC0 A;  2WPW A;  1AUG A;  4JLY A;  2VBQ A;  1H8L A;  1I21 A;  2Q7S A;  2I00 A;  2JDD A;  4E2A A;  5ISV A;  1XJO A;  3D4U A;  4R6T A;  2PIZ A;  2ZEL A;  4NGR A;  4CGL A;  4B10 A;  4Y49 B;  3BJ7 A;  4X2T A;  1BO4 A;  2YND A;  1XMB A;  2PCU A;  2YGW A;  4PK3 A;  2AE6 A;  2XEJ A;  4UA3 A;  3GB0 A;  4AVC A;  4H89 A;  2ATR A;  4EWT A;  2PJ7 A;  2Z3K A;  4MMO A;  2EO8 A;  2PJ3 A;  2ZEO A;  4X5K A;  4MRI A;  3S6F A;  3N5F A;  3TOB A;  3KI9 A;  2Z3N A;  2QML A;  3JRU A;  2BUE A;  2OZH A;  2ZPA A;  3B8G A;  4JXQ A;  4KOV A;  1Z5R A;  2VEZ A;  4PSW A;  3SI1 A;  5K8P A;  4UIA A;  1TF9 A;  3PB8 X;  4KSF A;  2GU2 A;  4B5O A;  4LQG A;  4F9V A;  3IIB A;  4YFJ A;  1IGB A;  1KZF A;  2XEF A;  4BMH A;  3KHX A;  2V8H A;  3NE8 A;  1M44 A;  4UCN A;  2PJC A;  1BLL E;  5DWN A;  1YVK A;  2Q4Z A;  2XEG A;  1CG2 A;  3KGQ A;  3NE7 A;  4MCR A;  4P45 A;  5F09 A;  1S3Z A;  4F0X A;  3CXS A;  3TC8 A;  4U9Y A;  1QSN A;  3F0A A;  3H5Z A;  3B3S A;  2AFU A;  3D7G A;  2HB6 A;  1I12 A;  1Z9U A;  2PJB A;  3CXP A;  2BO9 A;  3OWC A;  4U9Z A;  5HVF A;  4CAV A;  2QVP A;  2ZEM A;  4Q7A A;  4R76 A;  1LRZ A;  2NSM A;  2HUZ A;  3D68 A;  5AG5 A;  2V8G A;  3KQZ A;  4ZX9 A;  3S9M A;  2K5T A;  1Z8T A;  3K9T A;  3ZJ0 A;  4OC1 A;  4GS4 A;  2DEA A;  2KCW A;  3KHZ A;  4NGN A;  4K3N A;  4P10 A;  2PE3 A;  4IK2 A;  3TO9 A;  4CGO A;  1F2P A;  4KOY A;  2AFO A;  2ZEF A;  2QJ8 A;  2Q4Y A;  2PDO A;  2O53 A;  1NE9 A;  2PJ9 A;  5JQ4 A;  3SI0 A;  3KAS A;  4M6I A;  2EWB A;  2PVW A;  1TKH A;  1Z8L A;  3QB8 A;  1JWQ A;  1S60 A;  4A95 A;  4Y49 C;  2FIW A;  1Q7L A;  4MBU A;  1S7N A;  4UWJ A;  4C2Y A;  4QC6 A;  1M4G A;  1RTQ A;  3FMC A;  2VI7 A;  3QAH A;  4M85 A;  5K8N A;  2P6E A;  2Q43 A;  3PB4 X;  3MRU A;  3FF3 A;  3L2N A;  2Z3O A;  4MFK A;  1NSA A;  4MHD A;  4OKO A;  4TWE A;  4X3R A;  4ZYQ A;  1J4J A;  5G20 A;  5LRJ A;  5H86 A;  5KTA A;  1WK4 A;  2J8R A;  4R3L A;  2NMT A;  2PSW A;  4Z65 A;  5CPA A;  5HXD A;  2ZEE A;  1Z4R A;  4ZI6 A;  2Z10 A;  1A2Z A;  2ZEH A;  3ISX A;  4JD6 A;  4KOT A;  5GCN A;  7CPA A;  4MFZ A;  2P6G A;  4P4E A;  3CPX A;  4WJB A;  5C82 A;  5F49 A;  3S9L A;  2PRQ A;  4L8A A;  4H6U A;  1M4L A;  2CTC A;  5G22 A;  1TXR A;  2PRB A;  4B13 A;  2WPX A;  1QST A;  1WWZ A;  3SJF A;  1TF8 A;  3RO0 A;  4B12 A;  1I1D A;  2AFW A;  2DXQ A;  4KZT A;  3K9U A;  5JPH A;  4MCQ A;  4NGM A;  2YNE A;  2OB0 A;  1V0C A;  1S5K A;  3GLJ A;  1IB1 E;  2OH1 A;  4C68 A;  2DF5 A;  1KUV A;  1X10 A;  3BI1 A;  4MCS A;  4TNU A;  3WC6 A;  4RUH A;  2Y0M A;  3EC4 A;  2CTB A;  5LYF A;  1ZG8 A;  4LQ6 A;  4A38 A;  2G0B A;  2G3T A;  1XMT A;  2ODF A;  3JTK A;  5F47 A;  5LYD A;  4I49 A;  3T9Y A;  4CGM A;  3GKR A;  4NCZ A;  5DS0 A;  3IGR A;  4E0A A;  3D2P A;  3H8E A;  1IYK A;  5HVG A;  2C6C A;  3FVL A;  2QYV A;  3HUV A;  3P2F A;  4PXD A;  1KUY A;  4XNH C;  3BXM A;  3NFZ A;  4KVO E;  3R9F A;  1KWM A;  3PZJ A;  2BEI A;  3R9G A;  1IY7 A;  4DYO A;  3JVN A;  1VHE A;  4AVA A;  1X12 A;  1LFW A;  3H4Q A;  3QAY A;  4YRH A;  3SJG A;  4MFJ A;  3DR8 A;  1YLE A;  2B58 A;  2B5G A;  3D8P A;  4P4B A;  4OAE A;  2RFH A;  4ZX8 A;  2WZN A;  4ONW A;  4XNH B;  2IQ6 A;  1HDU A;  1RXT A;  1L0C A;  2EBJ A;  4PXB A;  1YSJ A;  2ZW4 A;  3EFA A;  2ZW5 A;  5I0C A;  1PU9 A;  4HPS A;  1QSR A;  2Q4V A;  1B87 A;  4CAW A;  4F9U A;  3LMS A;  1XFO A;  1IYL A;  3T8W A;  2GLJ A;  2QIR A;  4IAV A;  4MCP A;  4UEZ A;  3B3T A;  4H2K A;  5KTC A;  3FX6 A;  4JYW A;  3IU2 A;  3BHX A;  2A4N A;  3GUX A;  4A94 A;  5FVJ A;  4JWP A;  4YWY A;  1N71 A;  3GY9 A;  3HLP A;  4MJ8 A;  2Q51 A;  4A33 A;  2B4B A;  3IU1 A;  3MGD A;  2OZU A;  5ELY A;  4BIN A;  2PJ4 A;  2PQ8 A;  2GAN A;  1PCA A;  2J8M A;  3TTH A;  1HEE A;  2C6P A;  3V7Z A;  4FAI A;  4GXH A;  3H8F A;  4EFD A;  4LX9 A;  4YU9 A;  4RI1 A;  3H8G A;  3SXO A;  1YRE A;  3FEC A;  4P4F A;  3TE4 A;  8CPA A;  4NJR A;  3I9S A;  3VAR A;  1QSO A;  2H5M A;  2FL4 A;  2VQY A;  2BCO A;  4R87 A;  1CJW A;  2AFM A;  1F57 A;  1Y0Y A;  2F5I A;  3D3S A;  4PSX A;  4CGP A;  3V8I A;  4F6A A;  2PJ1 A;  2C27 A;  1LAP A;  2HC9 A;  4B14 A;  1NMT A;  3FJU A;  4PPZ A;  3S6G A;  4BBH A;  3PBB A;  1PYT B;  2B3V A;  4NXY A;  2IMO A;  3W6S A;  1VKC A;  3FEE A;  1SQH A;  5EBV A;  2PJ2 A;  1BAV A;  1UFH A;  4NGS A;  4F8Z A;  1FNO A;  1MJ9 A;  4K30 A;  2QEC A;  5A27 A;  4CYQ A;  1Y7E A;  4JZ0 A;  3IWE A;  3V38 A;  1QSM A;  2GIV A;  3MN8 A;  3TX8 A;  2J9A A;  2AFZ A;  3FYN A;  4A31 A;  2ANP A;  3VWE A;  4CYO A;  2PJ5 A;  4ORF A;  4KOR A;  3VWD A;  3FIX A;  4B5P B;  2V77 A;  2B5G B;  2IJZ A;  4NSQ A;  4KOW A;  5E96 A;  4AB7 A;  4II9 A;  3ISZ A;  2B3U A;  1B6B A;  1IOI A;  2I3C A;  3GYA A;  3RNZ A;  2Q7B A;  3S6H A;  2ZEG A;  1QMU A;  2Z3L A;  2ARH A;  4UEF A;  5I4M A;  4MHZ A;  3F5B A;  4FUU A;  3B7I A;  2PC1 A;  3D7F A;  5K8O A;  1GHE A;  1Q2Y A;  5LYL A;  2Q04 A;  3RAM A;  1Q2C A;  3F8K A;  5AG7 A;  4O23 A;  3WR7 A;  2EVN A;  1Y9K A;  3FXT A;  4P4J A;  4ZGY B;  4H6Z A;  2HV2 A;  3K2K A;  4MXU A;  2OU2 A;  3SHP A;  3BLN A;  2JLM A;  3LD2 A;  1Z4E A;  1XOV A;  3PP9 A;  4UIB A;  5HH1 A;  4E8O A;  4KS9 A;  4NGT A;  5BWA B;  4HNY B;  4PV6 A;  4UFV A;  4MFQ A;  4MY3 A;  2REF A;  4KOS A;  1XIX A;  1ZG7 A;  2BSW A;  4BD9 A;  3CZX A;  1IIC A;  3EO4 A;  2OOT A;  5F48 A;  4AG9 A;  4R7M A;  2J8N A;  3DLJ A;  1QQ9 A;  4R8F A;  3SJX A;  2X7B A;  1MJB A;  4A30 A;  1CP6 A;  5AG6 A;  2JEW A;  2ZOF A;  1R57 A;  1Z2L A;  5HVH A;  2C1C A;  3DDD A;  3VH9 A;  1Y0R A;  4OAD A;  3EY5 A;  1S7K A;  2POK A;  1YW6 A;  1YK3 A;  1S7L A;  2ZEN A;  2CF4 A;  4OIW A;  1Z8X A;  3BI0 A;  2I79 A;  3DSB A;  3B2Y A;  3B35 A;  3IO1 A;  5AG4 A;  1XE4 A;  3GIU A;  5J8F A;  3DGV A;  3LOD A;  4HKF A;  4NGQ A;  3SI2 A;  2FS5 A;  2CXA A;  2C6G A;  1M1D A;  3PFO A;  5A28 A;  2JDC A;  3WC5 A;  4OC4 A;  2VXK A;  2PJ6 A;  2WYR A;  1GYT A;  5F46 A;  4UEE A;  4A37 A;  4DNC A;  2OR4 A;  2O28 A;  4CRZ B;  5IB9 A;  3G8W A;  3NH4 A;  4CAF A;  4MHP A;  4R9M A;  4C7H A;  3R1K A;  2CNS A;  3LAC A;  5CBM A;  3N7Z A;  1ARM A;  4B11 A;  2V8D A;  4P4D A;  3RZA A;  2EUI A;  2FCK A;  4QUS A;  3B3W A;  4CGN A;  2ZW6 A;  1VHS A;  3IWG A;  2FSR A;  2R1I A;  2ZXV A;  4OLL A;  2PIY A;  2BOA A;  4PQA A;  1Z8W A;  4M3S A;  4ZY1 A;  1CPX A;  3NA6 A;  4NEX A;  2Q44 A;  2WUU A;  4NJQ A;  5G1Z A;  2F7V A;  3IWW A;  2FIA A;  3PBE A;  1M4I A;  5EMI A;  4OP4 A;  4C2Z A;  2FVG A;  4CRY B;  3G3S A;  1YQE A;  5LRG A;  3PEI A;  4A39 A;  2JBK A;  4QBJ A;  4G1P A;  4P4I A;  4WWV A;  3I3G A;  1S7F A;  4KVM E;  3D66 A;  1LOK A;  3KR5 A;  3FBU A;  3PRT A;  3RBU A;  4KVX A;  2RB7 A;  1UWY A;  2REE A;  4RS2 A;  4FWU A;  2DPT A;  2P6F A;  3P2H A;  2Z3P A;  1ELL P;  2PJ0 A;  1U6M A;  4YGO A;  3TT2 A;  3D7D A;  1XBU A;  4IUS A;  4CS0 B;  1YLO A;  2FE7 A;  2O4H A;  3PFE A;  1F2O A;  3T90 A;  1BOB A;  4KLV A;  4DUK A;  2CIJ A;  2B4D B;  1RO5 A;  4ZBG A;  1BPM A;  3D2M A;  4KSI A;  4C2X A;  2NYQ A;  4U5Y A;  5JM6 A;  1ELM P;  5G21 A;  4UBR A;  2P0W A;  1P4N A;  2JBJ A;  1LAM A;  2YNC A;  2R8V A;  1YVO A;  2PR8 A;  2CY2 A;  1AMP A;  4C7I A;  4EVY A;  3WAB A;  1OZP A;  4L89 A;  4UCP A;  3TO7 A;  2G9D A;  2CNM A;  2EK9 A;  4X8I A;  3E0K A;  1TKF A;  4MFP A;  2FT0 A;  4KOX A;  3EXN A;  2ABZ A;  4XPL A;  3IJ3 A;  3TFY A;  3I1U A;  4ONU A;  5THW A;  4KUA A;  3CT9 A;  4CAE A;  1XRY A;  2PR1 A;  1DTD A;  3IFE A;  4UF4 A;  2IL4 A;  4AG7 A;  3FNC A;  2VZY A;  5CNP A;  3TO6 A;  2AFX A;  2AJ6 A;  4RN7 A;  4NF1 A;  3WC7 A;  1CBX A;  4MI4 A;  1VGY A;  1KUX A;  5DWM A;  2D4P A;  4IHM A;  4QVT A;  4CAX A;  3DR6 A;  1JQG A;  2YNC C;  1CP7 A;  4PK2 A;  3WT4 A;  4M6H A;  1TIQ A;  1P0H A;  3FED A;  4R57 A;  1OBR A;  4OC3 A;  2RC4 A;  5AGE A;  1ARL A;  2VZZ A;  3CXQ A;  2BL1 A;  4P6Y A;  2GRE A;  4HNX B;  3S9N A;  1ZO0 A;  4PXE A;  2R98 A;  3NH5 A;  3TOA A;  1R43 A;  1M4D A;  3B3C A;  4IF5 A;  3PGP A;  2F8H A;  3KL9 A; 
#chains in the Genus database with same CATH homology
 2Q0Y A;  3KKW A;  2D4O A;  1PUA A;  1FY7 A;  5IB0 A;  3A9L A;  2WSA A;  3BJ8 A;  5HMN A;  3RYO A;  3JUW A;  4J3G A;  4UFX A;  4KSA A;  4F0Y A;  3R95 A;  1XF8 A;  1NSL A;  1YR0 A;  2DPS A;  4FD4 A;  4Q36 A;  3FRM A;  4MFL A;  3S6K A;  4JXR A;  4KLW A;  1YX0 A;  1XEB A;  2CNT A;  4XPD B;  3UY5 A;  3C26 A;  4CYN A;  4AVB A;  2ZW7 A;  3W6X A;  4LUA A;  4MY0 A;  1ON0 A;  1Q2D A;  1Y9W A;  4FD6 A;  2R7H A;  1Y7R A;  3W91 A;  5J8C A;  4XPD C;  4QB9 A;  2Z3M A;  3ZZI A;  1IID A;  4A32 A;  5C88 A;  1MJA A;  4R3K A;  2B4D A;  3R96 A;  2GE3 A;  5KTD A;  4B5P A;  5IV0 A;  4CYP A;  4HNW B;  1CM0 A;  5H84 A;  4XPK A;  2G3A A;  2HQY A;  3FB3 A;  1YGH A;  3DNS A;  4UFW A;  4FD7 A;  4A2Z A;  4UWI A;  1MK4 A;  4JJX A;  4KUB A;  2JEV A;  2Z0Z A;  4KOU A;  2FXF A;  4Q38 A;  3TCV A;  5EC4 A;  4UCM A;  2Z11 A;  3SXN A;  5IX3 A;  4FD5 A;  1K4J A;  2OZG A;  3R9E A;  2WPW A;  4JLY A;  2VBQ A;  1I21 A;  2I00 A;  2JDD A;  4E2A A;  5ISV A;  4CGL A;  4B10 A;  4Y49 B;  3BJ7 A;  1BO4 A;  2YND A;  2YGW A;  4PK3 A;  2AE6 A;  4UA3 A;  4AVC A;  4H89 A;  2ATR A;  2Z3K A;  4X5K A;  3S6F A;  3TOB A;  2Z3N A;  2QML A;  4KOV A;  2BUE A;  2OZH A;  2ZPA A;  3B8G A;  4JXQ A;  2VEZ A;  4KSF A;  4B5O A;  4YFJ A;  1KZF A;  4BMH A;  1M44 A;  4UCN A;  5DWN A;  1YVK A;  3NE7 A;  1S3Z A;  4F0X A;  3CXS A;  4U9Y A;  1QSN A;  3F0A A;  3H5Z A;  1I12 A;  1Z9U A;  3CXP A;  4U9Z A;  3OWC A;  4CAV A;  1LRZ A;  2HUZ A;  5AG5 A;  2K5T A;  3ZJ0 A;  4GS4 A;  2KCW A;  3TO9 A;  4CGO A;  4KOY A;  2Q4Y A;  2PDO A;  1NE9 A;  5JQ4 A;  3QB8 A;  1S60 A;  4A95 A;  4Y49 C;  2FIW A;  4UWJ A;  4MBU A;  1S7N A;  4C2Y A;  4QC6 A;  1M4G A;  2VI7 A;  3QAH A;  4M85 A;  2P6E A;  4MHD A;  2Z3O A;  4MFK A;  5KTA A;  1J4J A;  5G20 A;  5H86 A;  1WK4 A;  2J8R A;  4R3L A;  2NMT A;  2PSW A;  1Z4R A;  2Z10 A;  4JD6 A;  4KOT A;  5GCN A;  4MFZ A;  2P6G A;  5C82 A;  5F49 A;  4L8A A;  4H6U A;  5G22 A;  2PRB A;  4B13 A;  2WPX A;  1QST A;  1WWZ A;  4B12 A;  1I1D A;  2DXQ A;  4KZT A;  5JPH A;  3K9U A;  2YNE A;  2OB0 A;  1V0C A;  1S5K A;  1IB1 E;  2OH1 A;  4C68 A;  1KUV A;  2Y0M A;  3EC4 A;  2G0B A;  2G3T A;  1XMT A;  3JTK A;  5F47 A;  4CGM A;  4I49 A;  3T9Y A;  3GKR A;  4NCZ A;  3IGR A;  4E0A A;  3D2P A;  1IYK A;  3P2F A;  1KUY A;  4XNH C;  4KVO E;  3R9F A;  3PZJ A;  2BEI A;  3R9G A;  3JVN A;  4AVA A;  3H4Q A;  4YRH A;  4MFJ A;  3DR8 A;  1YLE A;  2B58 A;  2B5G A;  3D8P A;  4OAE A;  4XNH B;  1RXT A;  1L0C A;  3EFA A;  2ZW4 A;  2ZW5 A;  5I0C A;  1PU9 A;  1QSR A;  2Q4V A;  1B87 A;  4CAW A;  1IYL A;  2QIR A;  5KTC A;  3IU2 A;  2A4N A;  5FVJ A;  4JWP A;  1N71 A;  3GY9 A;  4MJ8 A;  4A33 A;  2B4B A;  3IU1 A;  3MGD A;  2OZU A;  2PQ8 A;  2GAN A;  2J8M A;  3TTH A;  4LX9 A;  4RI1 A;  3SXO A;  1YRE A;  3TE4 A;  3I9S A;  1QSO A;  2H5M A;  2FL4 A;  2VQY A;  4R87 A;  1CJW A;  2F5I A;  4PSX A;  4CGP A;  3D3S A;  3V8I A;  4F6A A;  2C27 A;  4B14 A;  1NMT A;  4BBH A;  3S6G A;  2B3V A;  4NXY A;  3W6S A;  1VKC A;  1SQH A;  5EBV A;  1UFH A;  1MJ9 A;  4K30 A;  2QEC A;  5A27 A;  4CYQ A;  3IWE A;  1QSM A;  2GIV A;  4A31 A;  3FYN A;  3VWE A;  4CYO A;  4ORF A;  4KOR A;  3VWD A;  3FIX A;  4B5P B;  2B5G B;  4II9 A;  4NSQ A;  4KOW A;  5E96 A;  4AB7 A;  2B3U A;  1B6B A;  3GYA A;  2Q7B A;  3S6H A;  2Z3L A;  2ARH A;  3F5B A;  2PC1 A;  1GHE A;  1Q2Y A;  2Q04 A;  1Q2C A;  3F8K A;  5AG7 A;  3WR7 A;  2EVN A;  1Y9K A;  3FXT A;  4ZGY B;  4H6Z A;  2HV2 A;  2OU2 A;  3SHP A;  3BLN A;  2JLM A;  3LD2 A;  1Z4E A;  3PP9 A;  5HH1 A;  4E8O A;  4KS9 A;  5BWA B;  4HNY B;  4PV6 A;  4UFV A;  4MFQ A;  4MY3 A;  2REF A;  4KOS A;  1XIX A;  2BSW A;  1IIC A;  3EO4 A;  5F48 A;  4AG9 A;  2J8N A;  2X7B A;  1MJB A;  4A30 A;  5AG6 A;  1R57 A;  3DDD A;  4OAD A;  3EY5 A;  1S7K A;  1YK3 A;  1S7L A;  2I79 A;  3DSB A;  5AG4 A;  1XE4 A;  5J8F A;  3LOD A;  4HKF A;  2FS5 A;  2CXA A;  1M1D A;  5A28 A;  2JDC A;  2VXK A;  5F46 A;  4DNC A;  2O28 A;  4CRZ B;  3G8W A;  4CAF A;  4R9M A;  4C7H A;  3R1K A;  2CNS A;  3N7Z A;  4B11 A;  2EUI A;  2FCK A;  4QUS A;  4CGN A;  2ZW6 A;  1VHS A;  3IWG A;  2FSR A;  2R1I A;  2ZXV A;  4OLL A;  4M3S A;  4NEX A;  2Q44 A;  2WUU A;  5G1Z A;  2FIA A;  1M4I A;  4C2Z A;  4CRY B;  3G3S A;  4QBJ A;  3I3G A;  1S7F A;  4KVM E;  3FBU A;  4KVX A;  2REE A;  4RS2 A;  2DPT A;  2P6F A;  3P2H A;  2Z3P A;  1U6M A;  4YGO A;  3TT2 A;  4IUS A;  4CS0 B;  2FE7 A;  3T90 A;  1BOB A;  4KLV A;  2B4D B;  1RO5 A;  4ZBG A;  3D2M A;  4C2X A;  4U5Y A;  5G21 A;  4UBR A;  2P0W A;  1P4N A;  2YNC A;  2R8V A;  1YVO A;  2PR8 A;  2CY2 A;  4C7I A;  4EVY A;  1OZP A;  4L89 A;  4UCP A;  3TO7 A;  2CNM A;  3E0K A;  4MFP A;  2FT0 A;  4KOX A;  3EXN A;  4XPL A;  3TFY A;  4ONU A;  4CAE A;  4KUA A;  2PR1 A;  2IL4 A;  4AG7 A;  3FNC A;  2VZY A;  5CNP A;  3TO6 A;  2AJ6 A;  4NF1 A;  4MI4 A;  1KUX A;  5DWM A;  2D4P A;  4QVT A;  4CAX A;  3DR6 A;  2YNC C;  4PK2 A;  1TIQ A;  1P0H A;  4R57 A;  2RC4 A;  5AGE A;  2VZZ A;  3CXQ A;  2BL1 A;  4HNX B;  1ZO0 A;  3TOA A;  2R98 A;  1M4D A;  4IF5 A;  3PGP A;  4PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...