2JEVA

Crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
169
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic and Structural Analysis of Human Spermidine/Spermine N(1)-Acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DIAMINE ACETYLTRANSFERASE 1
total genus 41
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jevA00
4HNYB 3D2MA 4F6AA 3R9GA 4I49A 2BSWA 1FY7A 2REFA 5C88A 3F5BA 1Y9KA 1KZFA 2VBQA 1S7LA 3BJ8A 4PSXA 2JEVA 3EY5A 4LX9A 1YX0A 2CNTA 2J8RA 2ZW4A 2B58A 1MK4A 4YRHA 2EVNA 2FIWA 3R9FA 1M1DA 4PV6A 2I00A 5F49A 4E8OA 4KLVA 4HNXB 1Z4EA 2VEZA 3EO4A 1M4DA 2GIVA 1I21A 2B3VA 2G3AA 2PRBA 1QSTA 4J3GA 1XEBA 2G0BA 4OADA 3GYAA 4AG9A 3TO9A 4L8AA 4LUAA 1IIDA 3CXSA 4XPDB 2IL4A 2P6EA 3FB3A 1IYKA 2A4NA 3R95A 4H6ZA 2VZYA 2CNMA 2OZHA 4QB9A 3TCVA 2QIRA 4KOWA 2REEA 4YGOA 1VHSA 4KVOE 4FD6A 3TTHA 3D3SA 1N71A 3RYOA 2NMTA 3EC4A 4R57A 2ZXVA 5F48A 3S6KA 4AB7A 3G8WA 5DWNA 2F5IA 2K5TA 3I3GA 1CJWA 1V0CA 2OU2A 4UWIA 4KOUA 2ZPAA 1VKCA 3TT2A 4AVCA 2OB0A 4II9A 4QC6A 3DDDA 4PK3A 1OZPA 1BOBA 4GS4A 1NMTA 1SQHA 4NEXA 4UBRA 5J8FA 1Z4RA 4B5PB 3T90A 4PSWA 2P6GA 3OWCA 3UY5A 1I1DA 5KTDA 3PGPA 2Z11A 3ZZIA 4EVYA 2FXFA 1NE9A 3GY9A 4CS0B 2PSWA 1XE4A 4MI4A 1XF8A 1M4IA 2J8MA 4KVME 4U9YA 4YFJA 2R7HA 3JVNA 4OLLA 1R57A 2BEIA 3D8PA 2PC1A 4FD5A 3H4QA 4OAEA 4CAVA 4KOXA 4H89A 2AE6A 4K30A 1Z9UA 4NSQA 4NF1A 3CXQA 4JXRA 5KTAA 4NCZA 3MGDA 5IX3A 4U9ZA 1TIQA 3G3SA 4NXYA 2Q4YA 5H86A 3R9EA 2WPXA 4QBJA 4QVTA 2HQYA 3R1KA 4KVXA 4KUBA 2PDOA 3JUWA 4KOTA 4B5OA 3VWEA 3I9SA 3R96A 2GANA 1MJBA 2B5GA 2FL4A 3DSBA 2ZW5A 4MY0A 4PK2A 4RI1A 4H6UA 1KUXA 3W6XA 2D4PA 2PR1A 2BUEA 1MJAA 1Y9WA 2G3TA 2FE7A 1WK4A 3BLNA 5I0CA 2P6FA 1M4GA 2DXQA 5F47A 3DR8A 2J8NA 3C26A 1QSOA 2B3UA 2Q7BA 5HH1A 3F0AA 3LD2A 3D2PA 1I12A 2Q0YA 1YR0A 3LODA 1B6BA 1MJ9A 1UFHA 2Z10A 2OZUA 2ATRA 3TFYA 5EBVA 3FYNA 4MHDA 2CY2A 2VXKA 3S6GA 1KUVA 3FNCA 5F46A 4CAWA 3DR6A 4JLYA 1IYLA 3KKWA 5C82A 2FSRA 3W6SA 4UA3A 2PQ8A 1CM0A 3E0KA 3FXTA 4L89A 4Y49B 3NE7A 4B5PA 2KCWA 2PR8A 2FS5A 4X5KA 3GKRA 4AVAA 3ZJ0A 1YVKA 3F8KA 4FD4A 3QB8A 2RC4A 1WWZA 1XMTA 4F0YA 3SXOA 1LRZA 1PUAA 4KORA 2HUZA 3P2FA 1RXTA 5FVJA 4R9MA 4R3KA 1S60A 2GE3A 4AVBA 2Q04A 2Z0ZA 1S5KA 3IGRA 5JQ4A 4BMHA 2OZGA 2JDCA 1Q2CA 4CRZB 2Q4VA 4MY3A 1PU9A 1BO4A 5ISVA 2O28A 1S7NA 3DNSA 3V8IA 4R3LA 4M3SA 3P2HA 4KOVA 2X7BA 3TE4A 3CXPA 5DWMA 1P0HA 5E96A 4ONUA 1S7KA 4XPDC 3WR7A 4IUSA 1P4NA 4U5YA 3B8GA 1YVOA 3EXNA 4QUSA 5IB0A 4JXQA 3K9UA 4ORFA 5GCNA 4XNHC 2BL1A 5HMNA 2OH1A 1Q2DA 3FBUA 3BJ7A 3EFAA 5CNPA 3PP9A 1GHEA 2FIAA 2CNSA 1U6MA 2C27A 1NSLA 1YK3A 1YREA 5EC4A 5H84A 4KOSA 4E2AA 1Q2YA 4XPLA 4AG7A 3FRMA 3TO7A 3PZJA 1ON0A 2ZW6A 4KZTA 3SXNA 2B4DB 1IB1E 2P0WA 2Q44A 4M85A 5JPHA 2EUIA 2ZW7A 2VZZA 2JLMA 4MJ8A 4JD6A 1YGHA 2H5MA 2FT0A 2VI7A 4UWJA 4KUAA 2B4BA 1QSMA 4XNHB 1K4JA 4FD7A 4JJXA 4Y49C 4KLWA 3W91A 2B4DA 3TO6A 3TOAA 4CAXA 4CRYB 4HKFA 3QAHA 1IICA 4KOYA 5IV0A 4IF5A 1B87A 4E0AA 2JDDA 3FIXA 1QSNA 3TOBA 1KUYA 1YLEA 2D4OA 2FCKA 1XIXA 4ZBGA 4HNWB 1M44A 4MBUA 2ARHA 2VQYA 2HV2A 5KTCA 4DNCA 2B5GB 1S3ZA 3SHPA 4XPKA 3T9YA 3S6FA 1Y7RA 1L0CA 1RO5A 2I79A 4RS2A 3N7ZA 2Y0MA 2QECA 4JWPA 1J4JA 3IWGA 4R87A 2AJ6A 2R8VA 2R1IA 3S6HA 1QSRA 1S7FA 3VWDA 5J8CA 2QMLA 2WPWA 2R98A
chains in the Genus database with same CATH superfamily
1BLLE 4Z65A 4HNYB 3D2MA 3D68A 4CYNA 4F9UA 4F6AA 3R9GA 4I49A 5LYIA 2Q4ZA 4ZY2A 1LOKA 2BSWA 1FY7A 2REFA 4P4DA 4EMEA 3PBBA 4NGTA 4P4JA 4A39A 5C88A 3F5BA 1Y9KA 1F2OA 4O23A 1KZFA 2VBQA 1S7LA 2PJAA 3BJ8A 1Z8WA 4PSXA 2DF5A 2JEVA 3EY5A 3KGQA 4MCQA 4LX9A 1BAVA 2V77A 1Z8LA 5AGEA 3DGVA 1IY7A 3D66A 2WZNA 2AFWA 4CYPA 4KS9A 1YX0A 2CNTA 2Z3MA 3MRUA 3NFZA 5D8NA 4ZY0A 3IFEA 2PJ0A 2J8RA 1GYTA 1PCAA 2ZW4A 2B58A 1MK4A 2WYRA 4YRHA 3TX8A 4WWVA 2Z3OA 4NJQA 1ZG9A 2EVNA 2FIWA 3R9FA 2GLFA 2GLJA 5LYFA 1M1DA 1CPSA 1IGBA 4M6IA 4PV6A 5AG4A 1VGYA 2I00A 5F49A 4E8OA 2GREA 4OC0A 4C2YA 4KLVA 4HNXB 1QQ9A 1Z4EA 2VEZA 2ZOGA 3EO4A 3JRUA 4P4BA 1M4DA 1ELMP 3IIBA 2GIVA 3LMSA 1I21A 2B3VA 4JYWA 2G3AA 2PRBA 1QSTA 4OC3A 4J3GA 4A32A 8CPAA 2Z3NA 1Y7EA 2OR4A 1ARMA 1XEBA 2G0BA 4OC1A 3V7ZA 4OADA 3GYAA 4FWUA 4AG9A 3TO9A 4MFQA 4L8AA 4W9YA 1CP7A 5THWA 3L2NA 2AFSA 4LUAA 3KR5A 1IIDA 4GM5A 3CXSA 5HVGA 4XPDB 2IL4A 2ODFA 3VATA 2P6EA 3D7GA 2AFMA 3NH5A 3B3TA 3FB3A 4MFPA 1IYKA 1CPXA 2A4NA 2PJ1A 3R95A 4H6ZA 2VZYA 2BCOA 2CNMA 4BINA 2OZHA 2EK8A 2CF4A 4P10A 3K2KA 4QB9A 3TCVA 2QIRA 1XMBA 4RUHA 4MXUA 4KOWA 2REEA 5BWAB 1Z8XA 1VHSA 4YGOA 2PJ6A 4UCNA 4PPZA 4KVOE 4FD6A 3TTHA 3D3SA 4B13A 1N71A 2Z3KA 3KHZA 3RYOA 2NMTA 3EC4A 4R57A 2ZXVA 5F48A 5HVFA 3S6KA 4AB7A 3G8WA 5DWNA 3LACA 2F5IA 4R8FA 2O4HA 4NGRA 3FH4A 1TKHA 2CIJA 1EE3P 2EO8A 2K5TA 4ZYQA 3LWUA 4R6TA 2C6GA 3I3GA 1LAPA 1CJWA 1V0CA 3PB6X 2DPSA 1VIXA 3S9MA 1DE4C 2OU2A 5CBMA 4UWIA 1YQEA 4KOUA 5EMIA 2ZPAA 5LRJA 3GIUA 1VKCA 3PFOA 4P45A 3TT2A 2OB0A 3V38A 4AVCA 4C2XA 4II9A 3K9TA 3DDDA 4PK3A 4QC6A 4A31A 2DPTA 1OZPA 2PJ3A 1Z5RA 1BOBA 1Y0RA 3B3WA 3PB7X 3WABA 2WUUA 4GS4A 1Q7LA 1Z2LA 1NMTA 1SQHA 4NEXA 4UBRA 3KR4A 5J8FA 1Z4RA 4B5PB 3IWWA 1IU8A 3T90A 4PSWA 2P6GA 2RFHA 3OWCA 3UY5A 1I1DA 4FUUA 2V8DA 4KSIA 3PGPA 4CAEA 2Z11A 4MHPA 3ZZIA 4EVYA 2FXFA 1NE9A 4UF4A 4MFJA 2O53A 4UFWA 2XEGA 5JGFA 3GY9A 3RO0A 4CS0B 3GLJA 4X3RA 2YGWA 3WC5A 4C2ZA 3H8GA 2PSWA 1XE4A 2HC9A 4MI4A 4UCMA 7CPAA 1CP6A 4RN7A 1XF8A 1M4IA 2HB6A 4GXHA 2J8MA 3B7IA 4KVME 4U9YA 2YNCA 4OP4A 3D7FA 4YFJA 2R7HA 3JVNA 2BOAA 4MCRA 4R76A 4OLLA 1R57A 2NSMA 2BEIA 2PE3A 3D8PA 1XFOA 2PC1A 4FD5A 4NGPA 4M6HA 1CG2A 3SJGA 3H4QA 4OAEA 4UFXA 2PCUA 4CAVA 4KOXA 3IEHA 4H89A 2AE6A 4F9VA 4K30A 1QMUA 1YW4A 1Z9UA 2C6CA 4NSQA 4NF1A 4B10A 6CPAA 2ZEHA 3KZWA 3CXQA 4IAVA 4JXRA 5KTAA 4A37A 4NCZA 3MGDA 5IX3A 3SJFA 4U9ZA 4NJRA 4A95A 1TIQA 2PVVA 3G3SA 1X12A 4NXYA 1CX8A 2Q4YA 5H86A 4NGNA 3R9EA 5G21A 2WPXA 3H8EA 4QVTA 4QBJA 5JM6A 2HQYA 3R1KA 3PRTA 3A9LA 1FT7A 4KVXA 1XOVA 4KUBA 2PDOA 1TKJA 3JUWA 4KOTA 4UIAA 4B5OA 4ZY1A 3VWEA 4X2TA 3I9SA 3R96A 2GANA 2XEIA 1A2ZA 4MFZA 4AXVA 1MJBA 2B5GA 4MHYA 2FL4A 3DSBA 4F0XA 2ZW5A 1R3NA 3IU2A 2OOTA 4MY0A 5K8MA 4PK2A 4RI1A 4H6UA 4A33A 1KUXA 1CBXA 4MFLA 2J9AA 1ZLIA 3B3VA 2D4PA 3I1UA 2PR1A 3NH4A 3W6XA 1ZO0A 2BUEA 2CTCA 4PXBA 3S9LA 1TF9A 1HDUA 4NFRA 1MJAA 1Y9WA 2G3TA 3SJXA 2FE7A 5A27A 1IOIA 1WK4A 4Q36A 3WC6A 3BLNA 3IJ3A 5I0CA 2P6FA 4OC4A 4CGOA 4DUKA 2AFZA 4OIWA 1M4GA 1FNOA 1BPMA 2Z3LA 3CZXA 4CGNA 1TF8A 5J1QA 3CDXA 1M4LA 2DXQA 3KQZA 1ELLP 5F47A 3DR8A 3TC8A 3S9NA 2J8NA 2XEFA 5KTDA 4LQGA 1TXRA 3SJEA 1JQGA 3C26A 4P4EA 4MCSA 5F09A 1QSOA 2B3UA 1ZG7A 2Q7BA 5HH1A 2VL1A 5HVHA 4FAIA 3F0AA 3T8WA 2PJ8A 3LD2A 4M6GA 4IK2A 3D2PA 1I12A 2FVGA 3BXMA 3FEEA 2Q0YA 4FBEA 1YR0A 3LODA 5K8NA 1B6BA 1MJ9A 1UFHA 4UFVA 2Z10A 2OZUA 4B14A 2ATRA 3TFYA 5G20A 5EBVA 5K8OA 2GU2A 3FYNA 2PJ5A 4MHDA 3FJUA 2CY2A 2VXKA 4G1PA 2C1CA 3S6GA 1KUVA 2Q51A 3FNCA 4CPAA 5F46A 2JEWA 2BO9A 2ANPA 4HPSA 2GFQA 3BI1A 5LRGA 2AFUA 4OC5A 3PFEA 5HXDA 4DYOA 2QJ8A 4CAWA 3DR6A 2V8GA 4JLYA 1IYLA 2PVWA 4A30A 3KKWA 5C82A 2FSRA 3PB4X 1KWMA 3SI0A 1LCPA 3W6SA 5LYDA 4UA3A 4ONWA 1LFWA 2PQ8A 1CM0A 3GB0A 2V8VA 3PBEA 3E0KA 2CTBA 3FXTA 4OMEA 4L89A 4Y49B 3NE7A 2ZENA 2KCWA 2PR8A 4B5PA 2FS5A 4X5KA 3GKRA 3WC7A 4OKOA 4AVAA 3ZJ0A 4OC2A 1YVKA 3F8KA 4FD4A 2ZEPA 3B3CA 3QB8A 2RC4A 4H2KA 1WWZA 3KL9A 4YWYA 2NYQA 1VHEA 1XMTA 3B3SA 3HUVA 2G9DA 3KHXA 4F0YA 3SXOA 4PXEA 2PJ2A 4WJBA 2EBJA 1LRZA 1PUAA 4KORA 2HUZA 3IO1A 3P2FA 4NGSA 1RXTA 4NGMA 5FVJA 4R9MA 4R3KA 4UIBA 4C7HA 3KQXA 2CXAA 1AUGA 2WSAA 1S60A 2C6PA 2YNEA 5G1ZA 2GE3A 3ISZA 4AVBA 2Q04A 2Z0ZA 1S5KA 4A38A 4C68A 3IGRA 3IC1A 5CPAA 5JQ4A 3QAYA 1YLOA 3ISXA 1TKFA 4UEFA 4BMHA 2PJ9A 2OZGA 2JDCA 5AG7A 1OBRA 3BI0A 4PXCA 2ZELA 1Q2CA 4CRZB 2PJBA 2Q4VA 5G22A 4LQ6A 4MY3A 4EFDA 4CGLA 4K3NA 1PU9A 1BO4A 2AFOA 3HLPA 4MHNA 2EK9A 4KSFA 2O28A 5ISVA 4IHMA 1S7NA 3DNSA 3PB8X 3V8IA 4R3LA 4M3SA 2ZEEA 3P2HA 5ELYA 4B12A 1H8LA 4KOVA 2X7BA 4B6ZA 3TE4A 1F2PA 1BPNA 3CXPA 4ZI6A 1DTDA 1XBUA 2RB7A 5DWMA 1P0HA 2QVPA 5E96A 2AFXA 3FF3A 4JZ0A 4ONUA 1S7KA 4XPDC 3WR7A 4IUSA 1P4NA 3VARA 4U5YA 3B8GA 4R7MA 4TNUA 4UEZA 1YVOA 3EXNA 4QUSA 5IB0A 4JXQA 3K9UA 4ORFA 5GCNA 3JTKA 4XNHC 4Q7AA 2BL1A 2ZEFA 4A2ZA 5HMNA 3CPAA 2OH1A 1Q2DA 2JBKA 3FBUA 3KI9A 4OIDA 2PRQA 3BJ7A 3EFAA 3MN8A 5CNPA 4CGPA 4CGMA 3D4UA 3PP9A 1GHEA 2F7VA 2FIAA 2YNCC 4CYQA 2CNSA 1U6MA 2C27A 1NSLA 5JH9A 1YK3A 1YREA 1NSAA 5EC4A 1IOFA 3VH9A 5H84A 3D67A 3FEDA 4KOSA 4E2AA 1Q2YA 2Q7SA 2YNDA 3KASA 2I3CA 4XPLA 1JWQA 4AG7A 3FRMA 3TO7A 5LYLA 1PYTB 2JBJA 2ZOFA 3NA6A 1ON0A 2ZW6A 3PB9X 3PZJA 4MFKA 3RAMA 4KZTA 3RNZA 3SXNA 2B4DB 4YU9A 4PXDA 1Y0YA 4P4FA 3D7DA 1IB1E 2P0WA 1XRYA 1YW6A 2Q44A 4M85A 5K8PA 4A94A 4Q38A 5JPHA 1VHOA 2EUIA 2PJCA 3B2YA 2ZW7A 5IB9A 3GUXA 2VZZA 4TWEA 2JLMA 2IQ6A 4MJ8A 2PJ7A 3FVLA 4JD6A 2IJZA 4PQAA 1YGHA 5I4MA 3H8FA 2H5MA 2POKA 1Z8TA 5D29A 2FT0A 4NGQA 3RZAA 2VI7A 2IMOA 4KUAA 2B4BA 2Q43A 2ZEMA 1QSMA 4MCPA 4UEEA 4UWJA 4XNHB 1K4JA 4FD7A 4JJXA 4Y49C 4KSAA 2Z3PA 4KLWA 3W91A 2B4DA 4BD9A 1HDQA 2XEJA 2PIYA 5LRKA 3TO6A 4ZX8A 3TOAA 4CAXA 3PEIA 4ZX9A 4CRYB 5DS0A 4HKFA 3BHXA 4CAFA 3QAHA 1R43A 2ZEGA 4DJLA 1IICA 1HEEA 4KOYA 5IV0A 4IF5A 3CT9A 5AG5A 4ZGYB 3D7HA 3WT4A 1B87A 1AMPA 3FMCA 1LANA 4E0AA 2EWBA 2JDDA 1UWYA 1X10A 1QSNA 3FIXA 1ZLHA 3TOBA 1YMEA 1KUYA 1YLEA 2D4OA 2FCKA 1XIXA 4ZBGA 4HNWB 3N5FA 2QYVA 4X8IA 3CPXA 1M44A 2PJ4A 2ZEOA 3B35A 1ARLA 4P44A 4EWTA 1XJOA 4MMOA 4MBUA 1LAMA 2ARHA 2VQYA 2HV2A 5AG6A 4C7IA 4P4IA 5KTCA 4DNCA 2B5GB 1S3ZA 3SHPA 4XPKA 3T9YA 3S6FA 2PIZA 1Y7RA 3QNVA 1L0CA 1RO5A 1YSJA 2I79A 1F57A 3H5ZA 4RS2A 3N7ZA 3FX6A 4UCPA 2Y0MA 2QECA 2ZEDA 3DLJA 4JWPA 2DEAA 3IU1A 3SI2A 2ABZA 1J4JA 2F8HA 3IWGA 2V8HA 4MHZA 1RTQA 4P6YA 3FECA 1AYEA 2AJ6A 2R8VA 3NH8A 4R87A 3IWEA 4MRIA 3RBUA 4BBHA 2R1IA 5A28A 3S6HA 4CYOA 4B11A 1QSRA 3NE8A 1ZG8A 1S7FA 3SI1A 3VWDA 4F8ZA 5J8CA 2QMLA 2WPWA 2R98A
chains in the Genus database with same CATH topology
4HNYB 3D2MA 4CYNA 4F6AA 3R9GA 4I49A 2BSWA 1FY7A 2REFA 5C88A 3F5BA 1Y9KA 1KZFA 2VBQA 1S7LA 3BJ8A 4PSXA 2JEVA 3EY5A 4LX9A 5AGEA 4CYPA 4KS9A 1YX0A 2CNTA 2Z3MA 2J8RA 2ZW4A 2B58A 1MK4A 4YRHA 2Z3OA 2EVNA 2FIWA 3R9FA 1M1DA 4PV6A 5AG4A 2I00A 5F49A 4E8OA 4C2YA 4KLVA 4HNXB 1Z4EA 2VEZA 3EO4A 1M4DA 2GIVA 4A32A 1I21A 2B3VA 2G3AA 2PRBA 1QSTA 4J3GA 2Z3NA 1XEBA 2G0BA 4OADA 3GYAA 4AG9A 3TO9A 4MFQA 4L8AA 4LUAA 1IIDA 3CXSA 4XPDB 2IL4A 2P6EA 3FB3A 4MFPA 1IYKA 2A4NA 3R95A 4H6ZA 2VZYA 2CNMA 2OZHA 4QB9A 3TCVA 2QIRA 4KOWA 2REEA 5BWAB 4YGOA 1VHSA 4UCNA 4KVOE 4FD6A 3TTHA 3D3SA 4B13A 1N71A 2Z3KA 3RYOA 2NMTA 3EC4A 4R57A 2ZXVA 5F48A 3S6KA 4AB7A 3G8WA 5DWNA 2F5IA 2K5TA 3I3GA 1CJWA 1V0CA 2DPSA 2OU2A 4UWIA 4KOUA 2ZPAA 1VKCA 3TT2A 4AVCA 2OB0A 4C2XA 4II9A 4QC6A 3DDDA 4PK3A 4A31A 2DPTA 1OZPA 1BOBA 4GS4A 2WUUA 1NMTA 1SQHA 4NEXA 4UBRA 5J8FA 1Z4RA 4B5PB 3T90A 4PSWA 2P6GA 4CAEA 3OWCA 3UY5A 1I1DA 5KTDA 3PGPA 2Z11A 3ZZIA 4EVYA 2FXFA 1NE9A 4MFJA 4UFWA 3GY9A 4CS0B 2YGWA 4C2ZA 2PSWA 1XE4A 4MI4A 4UCMA 1XF8A 1M4IA 2J8MA 4KVME 4U9YA 2YNCA 4YFJA 2R7HA 3JVNA 4OLLA 1R57A 2BEIA 3D8PA 2PC1A 4FD5A 3H4QA 4OAEA 4UFXA 4CAVA 4KOXA 4H89A 2AE6A 4K30A 4B10A 1Z9UA 4NSQA 4NF1A 3CXQA 4JXRA 5KTAA 4NCZA 3MGDA 5IX3A 4U9ZA 4A95A 1TIQA 3G3SA 4NXYA 2Q4YA 5H86A 3R9EA 5G21A 2WPXA 4QBJA 4QVTA 2HQYA 3R1KA 3A9LA 4KVXA 4KUBA 2PDOA 3JUWA 4KOTA 4B5OA 3VWEA 3I9SA 3R96A 2GANA 4MFZA 1MJBA 2B5GA 4F0XA 2FL4A 3DSBA 2ZW5A 3IU2A 4MY0A 4PK2A 4RI1A 4H6UA 4A33A 1KUXA 4MFLA 3W6XA 2D4PA 2PR1A 1ZO0A 2BUEA 1MJAA 1Y9WA 2G3TA 2FE7A 5A27A 4Q36A 1WK4A 3BLNA 5I0CA 2P6FA 4CGOA 1M4GA 2Z3LA 4CGNA 2DXQA 5F47A 3DR8A 2J8NA 3C26A 1QSOA 2B3UA 2Q7BA 5HH1A 3F0AA 3LD2A 3D2PA 1I12A 2Q0YA 1YR0A 3LODA 1B6BA 1MJ9A 1UFHA 4UFVA 2Z10A 2OZUA 4B14A 2ATRA 3TFYA 5G20A 5EBVA 3FYNA 4MHDA 2CY2A 2VXKA 3S6GA 1KUVA 3FNCA 5F46A 4CAWA 3DR6A 4JLYA 1IYLA 4A30A 3KKWA 5C82A 2FSRA 3W6SA 4UA3A 2PQ8A 1CM0A 3E0KA 3FXTA 4L89A 4Y49B 3NE7A 4B5PA 2KCWA 2PR8A 2FS5A 4X5KA 3GKRA 4AVAA 3ZJ0A 1YVKA 3F8KA 4FD4A 3QB8A 2RC4A 1WWZA 1XMTA 4F0YA 3SXOA 1LRZA 1PUAA 4KORA 2HUZA 3P2FA 1RXTA 5FVJA 4R9MA 4R3KA 4C7HA 2CXAA 2WSAA 1S60A 2YNEA 5G1ZA 2GE3A 4AVBA 2Q04A 2Z0ZA 1S5KA 4C68A 3IGRA 5JQ4A 4BMHA 2OZGA 2JDCA 5AG7A 1Q2CA 4CRZB 2Q4VA 4MY3A 4CGLA 1PU9A 1BO4A 4KSFA 2O28A 5ISVA 1S7NA 3DNSA 3V8IA 4R3LA 4M3SA 3P2HA 4B12A 4KOVA 2X7BA 3TE4A 3CXPA 5DWMA 1P0HA 5E96A 4ONUA 1S7KA 4XPDC 3WR7A 4IUSA 1P4NA 4U5YA 3B8GA 1YVOA 3EXNA 4QUSA 5IB0A 4JXQA 3K9UA 4ORFA 5GCNA 3JTKA 4XNHC 2BL1A 5HMNA 4A2ZA 2OH1A 1Q2DA 3FBUA 3BJ7A 3EFAA 5CNPA 4CGPA 4CGMA 3PP9A 1GHEA 2FIAA 2YNCC 4CYQA 2CNSA 1U6MA 2C27A 1NSLA 1YK3A 1YREA 5EC4A 5H84A 4KOSA 4E2AA 1Q2YA 2YNDA 4XPLA 4AG7A 3FRMA 3TO7A 3PZJA 1ON0A 2ZW6A 4MFKA 4KZTA 3SXNA 2B4DB 1IB1E 2P0WA 2Q44A 4M85A 5JPHA 4Q38A 2EUIA 2ZW7A 2VZZA 2JLMA 4MJ8A 4JD6A 1YGHA 2H5MA 2FT0A 2VI7A 4UWJA 4KUAA 2B4BA 1QSMA 4XNHB 1K4JA 4FD7A 4JJXA 4Y49C 4KSAA 2Z3PA 4KLWA 3W91A 2B4DA 3TO6A 3TOAA 4CAXA 4CRYB 4HKFA 4CAFA 3QAHA 1IICA 4KOYA 5IV0A 4IF5A 5AG5A 4ZGYB 1B87A 4E0AA 2JDDA 3FIXA 1QSNA 3TOBA 1KUYA 1YLEA 2D4OA 2FCKA 1XIXA 4ZBGA 4HNWB 1M44A 4MBUA 2ARHA 2VQYA 2HV2A 5AG6A 4C7IA 5KTCA 4DNCA 2B5GB 1S3ZA 3SHPA 4XPKA 3T9YA 3S6FA 1Y7RA 1L0CA 1RO5A 2I79A 3H5ZA 4RS2A 3N7ZA 4UCPA 2Y0MA 2QECA 4JWPA 3IU1A 1J4JA 3IWGA 5G22A 4R87A 2AJ6A 2R8VA 4BBHA 5A28A 3IWEA 2R1IA 3S6HA 4CYOA 4B11A 1QSRA 1S7FA 3VWDA 5J8CA 2QMLA 2WPWA 2R98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNY B;  3D2M A;  4F6A A;  3R9G A;  4I49 A;  2BSW A;  1FY7 A;  2REF A;  5C88 A;  3F5B A;  1Y9K A;  1KZF A;  2VBQ A;  1S7L A;  3BJ8 A;  4PSX A;  2JEV A;  3EY5 A;  4LX9 A;  1YX0 A;  2CNT A;  2J8R A;  2ZW4 A;  2B58 A;  1MK4 A;  4YRH A;  2EVN A;  2FIW A;  3R9F A;  1M1D A;  4PV6 A;  2I00 A;  5F49 A;  4E8O A;  4KLV A;  4HNX B;  1Z4E A;  2VEZ A;  3EO4 A;  1M4D A;  2GIV A;  1I21 A;  2B3V A;  2G3A A;  2PRB A;  1QST A;  4J3G A;  1XEB A;  2G0B A;  4OAD A;  3GYA A;  4AG9 A;  3TO9 A;  4L8A A;  4LUA A;  1IID A;  3CXS A;  4XPD B;  2IL4 A;  2P6E A;  3FB3 A;  1IYK A;  2A4N A;  3R95 A;  4H6Z A;  2VZY A;  2CNM A;  2OZH A;  4QB9 A;  3TCV A;  2QIR A;  4KOW A;  2REE A;  4YGO A;  1VHS A;  4KVO E;  4FD6 A;  3TTH A;  3D3S A;  1N71 A;  3RYO A;  2NMT A;  3EC4 A;  4R57 A;  2ZXV A;  5F48 A;  3S6K A;  4AB7 A;  3G8W A;  5DWN A;  2F5I A;  2K5T A;  3I3G A;  1CJW A;  1V0C A;  2OU2 A;  4UWI A;  4KOU A;  2ZPA A;  1VKC A;  3TT2 A;  4AVC A;  2OB0 A;  4II9 A;  4QC6 A;  3DDD A;  4PK3 A;  1OZP A;  1BOB A;  4GS4 A;  1NMT A;  1SQH A;  4NEX A;  4UBR A;  5J8F A;  1Z4R A;  4B5P B;  3T90 A;  4PSW A;  2P6G A;  3OWC A;  3UY5 A;  1I1D A;  5KTD A;  3PGP A;  2Z11 A;  3ZZI A;  4EVY A;  2FXF A;  1NE9 A;  3GY9 A;  4CS0 B;  2PSW A;  1XE4 A;  4MI4 A;  1XF8 A;  1M4I A;  2J8M A;  4KVM E;  4U9Y A;  4YFJ A;  2R7H A;  3JVN A;  4OLL A;  1R57 A;  2BEI A;  3D8P A;  2PC1 A;  4FD5 A;  3H4Q A;  4OAE A;  4CAV A;  4KOX A;  4H89 A;  2AE6 A;  4K30 A;  1Z9U A;  4NSQ A;  4NF1 A;  3CXQ A;  4JXR A;  5KTA A;  4NCZ A;  3MGD A;  5IX3 A;  4U9Z A;  1TIQ A;  3G3S A;  4NXY A;  2Q4Y A;  5H86 A;  3R9E A;  2WPX A;  4QBJ A;  4QVT A;  2HQY A;  3R1K A;  4KVX A;  4KUB A;  2PDO A;  3JUW A;  4KOT A;  4B5O A;  3VWE A;  3I9S A;  3R96 A;  2GAN A;  1MJB A;  2B5G A;  2FL4 A;  3DSB A;  2ZW5 A;  4MY0 A;  4PK2 A;  4RI1 A;  4H6U A;  1KUX A;  3W6X A;  2D4P A;  2PR1 A;  2BUE A;  1MJA A;  1Y9W A;  2G3T A;  2FE7 A;  1WK4 A;  3BLN A;  5I0C A;  2P6F A;  1M4G A;  2DXQ A;  5F47 A;  3DR8 A;  2J8N A;  3C26 A;  1QSO A;  2B3U A;  2Q7B A;  5HH1 A;  3F0A A;  3LD2 A;  3D2P A;  1I12 A;  2Q0Y A;  1YR0 A;  3LOD A;  1B6B A;  1MJ9 A;  1UFH A;  2Z10 A;  2OZU A;  2ATR A;  3TFY A;  5EBV A;  3FYN A;  4MHD A;  2CY2 A;  2VXK A;  3S6G A;  1KUV A;  3FNC A;  5F46 A;  4CAW A;  3DR6 A;  4JLY A;  1IYL A;  3KKW A;  5C82 A;  2FSR A;  3W6S A;  4UA3 A;  2PQ8 A;  1CM0 A;  3E0K A;  3FXT A;  4L89 A;  4Y49 B;  3NE7 A;  4B5P A;  2KCW A;  2PR8 A;  2FS5 A;  4X5K A;  3GKR A;  4AVA A;  3ZJ0 A;  1YVK A;  3F8K A;  4FD4 A;  3QB8 A;  2RC4 A;  1WWZ A;  1XMT A;  4F0Y A;  3SXO A;  1LRZ A;  1PUA A;  4KOR A;  2HUZ A;  3P2F A;  1RXT A;  5FVJ A;  4R9M A;  4R3K A;  1S60 A;  2GE3 A;  4AVB A;  2Q04 A;  2Z0Z A;  1S5K A;  3IGR A;  5JQ4 A;  4BMH A;  2OZG A;  2JDC A;  1Q2C A;  4CRZ B;  2Q4V A;  4MY3 A;  1PU9 A;  1BO4 A;  5ISV A;  2O28 A;  1S7N A;  3DNS A;  3V8I A;  4R3L A;  4M3S A;  3P2H A;  4KOV A;  2X7B A;  3TE4 A;  3CXP A;  5DWM A;  1P0H A;  5E96 A;  4ONU A;  1S7K A;  4XPD C;  3WR7 A;  4IUS A;  1P4N A;  4U5Y A;  3B8G A;  1YVO A;  3EXN A;  4QUS A;  5IB0 A;  4JXQ A;  3K9U A;  4ORF A;  5GCN A;  4XNH C;  2BL1 A;  5HMN A;  2OH1 A;  1Q2D A;  3FBU A;  3BJ7 A;  3EFA A;  5CNP A;  3PP9 A;  1GHE A;  2FIA A;  2CNS A;  1U6M A;  2C27 A;  1NSL A;  1YK3 A;  1YRE A;  5EC4 A;  5H84 A;  4KOS A;  4E2A A;  1Q2Y A;  4XPL A;  4AG7 A;  3FRM A;  3TO7 A;  3PZJ A;  1ON0 A;  2ZW6 A;  4KZT A;  3SXN A;  2B4D B;  1IB1 E;  2P0W A;  2Q44 A;  4M85 A;  5JPH A;  2EUI A;  2ZW7 A;  2VZZ A;  2JLM A;  4MJ8 A;  4JD6 A;  1YGH A;  2H5M A;  2FT0 A;  2VI7 A;  4UWJ A;  4KUA A;  2B4B A;  1QSM A;  4XNH B;  1K4J A;  4FD7 A;  4JJX A;  4Y49 C;  4KLW A;  3W91 A;  2B4D A;  3TO6 A;  3TOA A;  4CAX A;  4CRY B;  4HKF A;  3QAH A;  1IIC A;  4KOY A;  5IV0 A;  4IF5 A;  1B87 A;  4E0A A;  2JDD A;  3FIX A;  1QSN A;  3TOB A;  1KUY A;  1YLE A;  2D4O A;  2FCK A;  1XIX A;  4ZBG A;  4HNW B;  1M44 A;  4MBU A;  2ARH A;  2VQY A;  2HV2 A;  5KTC A;  4DNC A;  2B5G B;  1S3Z A;  3SHP A;  4XPK A;  3T9Y A;  3S6F A;  1Y7R A;  1L0C A;  1RO5 A;  2I79 A;  4RS2 A;  3N7Z A;  2Y0M A;  2QEC A;  4JWP A;  1J4J A;  3IWG A;  4R87 A;  2AJ6 A;  2R8V A;  2R1I A;  3S6H A;  1QSR A;  1S7F A;  3VWD A;  5J8C A;  2QML A;  2WPW A;  2R98 A; 
#chains in the Genus database with same CATH topology
 1BLL E;  4Z65 A;  4HNY B;  3D2M A;  3D68 A;  4CYN A;  4F9U A;  4F6A A;  3R9G A;  4I49 A;  5LYI A;  2Q4Z A;  4ZY2 A;  1LOK A;  2BSW A;  1FY7 A;  2REF A;  4P4D A;  4EME A;  3PBB A;  4NGT A;  4P4J A;  4A39 A;  5C88 A;  3F5B A;  1Y9K A;  1F2O A;  4O23 A;  1KZF A;  2VBQ A;  1S7L A;  2PJA A;  3BJ8 A;  1Z8W A;  4PSX A;  2DF5 A;  2JEV A;  3EY5 A;  3KGQ A;  4MCQ A;  4LX9 A;  1BAV A;  2V77 A;  1Z8L A;  5AGE A;  3DGV A;  1IY7 A;  3D66 A;  2WZN A;  2AFW A;  4CYP A;  4KS9 A;  1YX0 A;  2CNT A;  2Z3M A;  3MRU A;  3NFZ A;  5D8N A;  4ZY0 A;  3IFE A;  2PJ0 A;  2J8R A;  1GYT A;  1PCA A;  2ZW4 A;  2B58 A;  1MK4 A;  2WYR A;  4YRH A;  3TX8 A;  4WWV A;  2Z3O A;  4NJQ A;  1ZG9 A;  2EVN A;  2FIW A;  3R9F A;  2GLF A;  2GLJ A;  5LYF A;  1M1D A;  1CPS A;  1IGB A;  4M6I A;  4PV6 A;  5AG4 A;  1VGY A;  2I00 A;  5F49 A;  4E8O A;  2GRE A;  4OC0 A;  4C2Y A;  4KLV A;  4HNX B;  1QQ9 A;  1Z4E A;  2VEZ A;  2ZOG A;  3EO4 A;  3JRU A;  4P4B A;  1M4D A;  1ELM P;  3IIB A;  2GIV A;  3LMS A;  1I21 A;  2B3V A;  4JYW A;  2G3A A;  2PRB A;  1QST A;  4OC3 A;  4J3G A;  4A32 A;  8CPA A;  2Z3N A;  1Y7E A;  2OR4 A;  1ARM A;  1XEB A;  2G0B A;  4OC1 A;  3V7Z A;  4OAD A;  3GYA A;  4FWU A;  4AG9 A;  3TO9 A;  4MFQ A;  4L8A A;  4W9Y A;  1CP7 A;  5THW A;  3L2N A;  2AFS A;  4LUA A;  3KR5 A;  1IID A;  4GM5 A;  3CXS A;  5HVG A;  4XPD B;  2IL4 A;  2ODF A;  3VAT A;  2P6E A;  3D7G A;  2AFM A;  3NH5 A;  3B3T A;  3FB3 A;  4MFP A;  1IYK A;  1CPX A;  2A4N A;  2PJ1 A;  3R95 A;  4H6Z A;  2VZY A;  2BCO A;  2CNM A;  4BIN A;  2OZH A;  2EK8 A;  2CF4 A;  4P10 A;  3K2K A;  4QB9 A;  3TCV A;  2QIR A;  1XMB A;  4RUH A;  4MXU A;  4KOW A;  2REE A;  5BWA B;  1Z8X A;  1VHS A;  4YGO A;  2PJ6 A;  4UCN A;  4PPZ A;  4KVO E;  4FD6 A;  3TTH A;  3D3S A;  4B13 A;  1N71 A;  2Z3K A;  3KHZ A;  3RYO A;  2NMT A;  3EC4 A;  4R57 A;  2ZXV A;  5F48 A;  5HVF A;  3S6K A;  4AB7 A;  3G8W A;  5DWN A;  3LAC A;  2F5I A;  4R8F A;  2O4H A;  4NGR A;  3FH4 A;  1TKH A;  2CIJ A;  1EE3 P;  2EO8 A;  2K5T A;  4ZYQ A;  3LWU A;  4R6T A;  2C6G A;  3I3G A;  1LAP A;  1CJW A;  1V0C A;  3PB6 X;  2DPS A;  1VIX A;  3S9M A;  1DE4 C;  2OU2 A;  5CBM A;  4UWI A;  1YQE A;  4KOU A;  5EMI A;  2ZPA A;  5LRJ A;  3GIU A;  1VKC A;  3PFO A;  4P45 A;  3TT2 A;  2OB0 A;  3V38 A;  4AVC A;  4C2X A;  4II9 A;  3K9T A;  3DDD A;  4PK3 A;  4QC6 A;  4A31 A;  2DPT A;  1OZP A;  2PJ3 A;  1Z5R A;  1BOB A;  1Y0R A;  3B3W A;  3PB7 X;  3WAB A;  2WUU A;  4GS4 A;  1Q7L A;  1Z2L A;  1NMT A;  1SQH A;  4NEX A;  4UBR A;  3KR4 A;  5J8F A;  1Z4R A;  4B5P B;  3IWW A;  1IU8 A;  3T90 A;  4PSW A;  2P6G A;  2RFH A;  3OWC A;  3UY5 A;  1I1D A;  4FUU A;  2V8D A;  4KSI A;  3PGP A;  4CAE A;  2Z11 A;  4MHP A;  3ZZI A;  4EVY A;  2FXF A;  1NE9 A;  4UF4 A;  4MFJ A;  2O53 A;  4UFW A;  2XEG A;  5JGF A;  3GY9 A;  3RO0 A;  4CS0 B;  3GLJ A;  4X3R A;  2YGW A;  3WC5 A;  4C2Z A;  3H8G A;  2PSW A;  1XE4 A;  2HC9 A;  4MI4 A;  4UCM A;  7CPA A;  1CP6 A;  4RN7 A;  1XF8 A;  1M4I A;  2HB6 A;  4GXH A;  2J8M A;  3B7I A;  4KVM E;  4U9Y A;  2YNC A;  4OP4 A;  3D7F A;  4YFJ A;  2R7H A;  3JVN A;  2BOA A;  4MCR A;  4R76 A;  4OLL A;  1R57 A;  2NSM A;  2BEI A;  2PE3 A;  3D8P A;  1XFO A;  2PC1 A;  4FD5 A;  4NGP A;  4M6H A;  1CG2 A;  3SJG A;  3H4Q A;  4OAE A;  4UFX A;  2PCU A;  4CAV A;  4KOX A;  3IEH A;  4H89 A;  2AE6 A;  4F9V A;  4K30 A;  1QMU A;  1YW4 A;  1Z9U A;  2C6C A;  4NSQ A;  4NF1 A;  4B10 A;  6CPA A;  2ZEH A;  3KZW A;  3CXQ A;  4IAV A;  4JXR A;  5KTA A;  4A37 A;  4NCZ A;  3MGD A;  5IX3 A;  3SJF A;  4U9Z A;  4NJR A;  4A95 A;  1TIQ A;  2PVV A;  3G3S A;  1X12 A;  4NXY A;  1CX8 A;  2Q4Y A;  5H86 A;  4NGN A;  3R9E A;  5G21 A;  2WPX A;  3H8E A;  4QVT A;  4QBJ A;  5JM6 A;  2HQY A;  3R1K A;  3PRT A;  3A9L A;  1FT7 A;  4KVX A;  1XOV A;  4KUB A;  2PDO A;  1TKJ A;  3JUW A;  4KOT A;  4UIA A;  4B5O A;  4ZY1 A;  3VWE A;  4X2T A;  3I9S A;  3R96 A;  2GAN A;  2XEI A;  1A2Z A;  4MFZ A;  4AXV A;  1MJB A;  2B5G A;  4MHY A;  2FL4 A;  3DSB A;  4F0X A;  2ZW5 A;  1R3N A;  3IU2 A;  2OOT A;  4MY0 A;  5K8M A;  4PK2 A;  4RI1 A;  4H6U A;  4A33 A;  1KUX A;  1CBX A;  4MFL A;  2J9A A;  1ZLI A;  3B3V A;  2D4P A;  3I1U A;  2PR1 A;  3NH4 A;  3W6X A;  1ZO0 A;  2BUE A;  2CTC A;  4PXB A;  3S9L A;  1TF9 A;  1HDU A;  4NFR A;  1MJA A;  1Y9W A;  2G3T A;  3SJX A;  2FE7 A;  5A27 A;  1IOI A;  1WK4 A;  4Q36 A;  3WC6 A;  3BLN A;  3IJ3 A;  5I0C A;  2P6F A;  4OC4 A;  4CGO A;  4DUK A;  2AFZ A;  4OIW A;  1M4G A;  1FNO A;  1BPM A;  2Z3L A;  3CZX A;  4CGN A;  1TF8 A;  5J1Q A;  3CDX A;  1M4L A;  2DXQ A;  3KQZ A;  1ELL P;  5F47 A;  3DR8 A;  3TC8 A;  3S9N A;  2J8N A;  2XEF A;  5KTD A;  4LQG A;  1TXR A;  3SJE A;  1JQG A;  3C26 A;  4P4E A;  4MCS A;  5F09 A;  1QSO A;  2B3U A;  1ZG7 A;  2Q7B A;  5HH1 A;  2VL1 A;  5HVH A;  4FAI A;  3F0A A;  3T8W A;  2PJ8 A;  3LD2 A;  4M6G A;  4IK2 A;  3D2P A;  1I12 A;  2FVG A;  3BXM A;  3FEE A;  2Q0Y A;  4FBE A;  1YR0 A;  3LOD A;  5K8N A;  1B6B A;  1MJ9 A;  1UFH A;  4UFV A;  2Z10 A;  2OZU A;  4B14 A;  2ATR A;  3TFY A;  5G20 A;  5EBV A;  5K8O A;  2GU2 A;  3FYN A;  2PJ5 A;  4MHD A;  3FJU A;  2CY2 A;  2VXK A;  4G1P A;  2C1C A;  3S6G A;  1KUV A;  2Q51 A;  3FNC A;  4CPA A;  5F46 A;  2JEW A;  2BO9 A;  2ANP A;  4HPS A;  2GFQ A;  3BI1 A;  5LRG A;  2AFU A;  4OC5 A;  3PFE A;  5HXD A;  4DYO A;  2QJ8 A;  4CAW A;  3DR6 A;  2V8G A;  4JLY A;  1IYL A;  2PVW A;  4A30 A;  3KKW A;  5C82 A;  2FSR A;  3PB4 X;  1KWM A;  3SI0 A;  1LCP A;  3W6S A;  5LYD A;  4UA3 A;  4ONW A;  1LFW A;  2PQ8 A;  1CM0 A;  3GB0 A;  2V8V A;  3PBE A;  3E0K A;  2CTB A;  3FXT A;  4OME A;  4L89 A;  4Y49 B;  3NE7 A;  2ZEN A;  2KCW A;  2PR8 A;  4B5P A;  2FS5 A;  4X5K A;  3GKR A;  3WC7 A;  4OKO A;  4AVA A;  3ZJ0 A;  4OC2 A;  1YVK A;  3F8K A;  4FD4 A;  2ZEP A;  3B3C A;  3QB8 A;  2RC4 A;  4H2K A;  1WWZ A;  3KL9 A;  4YWY A;  2NYQ A;  1VHE A;  1XMT A;  3B3S A;  3HUV A;  2G9D A;  3KHX A;  4F0Y A;  3SXO A;  4PXE A;  2PJ2 A;  4WJB A;  2EBJ A;  1LRZ A;  1PUA A;  4KOR A;  2HUZ A;  3IO1 A;  3P2F A;  4NGS A;  1RXT A;  4NGM A;  5FVJ A;  4R9M A;  4R3K A;  4UIB A;  4C7H A;  3KQX A;  2CXA A;  1AUG A;  2WSA A;  1S60 A;  2C6P A;  2YNE A;  5G1Z A;  2GE3 A;  3ISZ A;  4AVB A;  2Q04 A;  2Z0Z A;  1S5K A;  4A38 A;  4C68 A;  3IGR A;  3IC1 A;  5CPA A;  5JQ4 A;  3QAY A;  1YLO A;  3ISX A;  1TKF A;  4UEF A;  4BMH A;  2PJ9 A;  2OZG A;  2JDC A;  5AG7 A;  1OBR A;  3BI0 A;  4PXC A;  2ZEL A;  1Q2C A;  4CRZ B;  2PJB A;  2Q4V A;  5G22 A;  4LQ6 A;  4MY3 A;  4EFD A;  4CGL A;  4K3N A;  1PU9 A;  1BO4 A;  2AFO A;  3HLP A;  4MHN A;  2EK9 A;  4KSF A;  2O28 A;  5ISV A;  4IHM A;  1S7N A;  3DNS A;  3PB8 X;  3V8I A;  4R3L A;  4M3S A;  2ZEE A;  3P2H A;  5ELY A;  4B12 A;  1H8L A;  4KOV A;  2X7B A;  4B6Z A;  3TE4 A;  1F2P A;  1BPN A;  3CXP A;  4ZI6 A;  1DTD A;  1XBU A;  2RB7 A;  5DWM A;  1P0H A;  2QVP A;  5E96 A;  2AFX A;  3FF3 A;  4JZ0 A;  4ONU A;  1S7K A;  4XPD C;  3WR7 A;  4IUS A;  1P4N A;  3VAR A;  4U5Y A;  3B8G A;  4R7M A;  4TNU A;  4UEZ A;  1YVO A;  3EXN A;  4QUS A;  5IB0 A;  4JXQ A;  3K9U A;  4ORF A;  5GCN A;  3JTK A;  4XNH C;  4Q7A A;  2BL1 A;  2ZEF A;  4A2Z A;  5HMN A;  3CPA A;  2OH1 A;  1Q2D A;  2JBK A;  3FBU A;  3KI9 A;  4OID A;  2PRQ A;  3BJ7 A;  3EFA A;  3MN8 A;  5CNP A;  4CGP A;  4CGM A;  3D4U A;  3PP9 A;  1GHE A;  2F7V A;  2FIA A;  2YNC C;  4CYQ A;  2CNS A;  1U6M A;  2C27 A;  1NSL A;  5JH9 A;  1YK3 A;  1YRE A;  1NSA A;  5EC4 A;  1IOF A;  3VH9 A;  5H84 A;  3D67 A;  3FED A;  4KOS A;  4E2A A;  1Q2Y A;  2Q7S A;  2YND A;  3KAS A;  2I3C A;  4XPL A;  1JWQ A;  4AG7 A;  3FRM A;  3TO7 A;  5LYL A;  1PYT B;  2JBJ A;  2ZOF A;  3NA6 A;  1ON0 A;  2ZW6 A;  3PB9 X;  3PZJ A;  4MFK A;  3RAM A;  4KZT A;  3RNZ A;  3SXN A;  2B4D B;  4YU9 A;  4PXD A;  1Y0Y A;  4P4F A;  3D7D A;  1IB1 E;  2P0W A;  1XRY A;  1YW6 A;  2Q44 A;  4M85 A;  5K8P A;  4A94 A;  4Q38 A;  5JPH A;  1VHO A;  2EUI A;  2PJC A;  3B2Y A;  2ZW7 A;  5IB9 A;  3GUX A;  2VZZ A;  4TWE A;  2JLM A;  2IQ6 A;  4MJ8 A;  2PJ7 A;  3FVL A;  4JD6 A;  2IJZ A;  4PQA A;  1YGH A;  5I4M A;  3H8F A;  2H5M A;  2POK A;  1Z8T A;  5D29 A;  2FT0 A;  4NGQ A;  3RZA A;  2VI7 A;  2IMO A;  4KUA A;  2B4B A;  2Q43 A;  2ZEM A;  1QSM A;  4MCP A;  4UEE A;  4UWJ A;  4XNH B;  1K4J A;  4FD7 A;  4JJX A;  4Y49 C;  4KSA A;  2Z3P A;  4KLW A;  3W91 A;  2B4D A;  4BD9 A;  1HDQ A;  2XEJ A;  2PIY A;  5LRK A;  3TO6 A;  4ZX8 A;  3TOA A;  4CAX A;  3PEI A;  4ZX9 A;  4CRY B;  5DS0 A;  4HKF A;  3BHX A;  4CAF A;  3QAH A;  1R43 A;  2ZEG A;  4DJL A;  1IIC A;  1HEE A;  4KOY A;  5IV0 A;  4IF5 A;  3CT9 A;  5AG5 A;  4ZGY B;  3D7H A;  3WT4 A;  1B87 A;  1AMP A;  3FMC A;  1LAN A;  4E0A A;  2EWB A;  2JDD A;  1UWY A;  1X10 A;  1QSN A;  3FIX A;  1ZLH A;  3TOB A;  1YME A;  1KUY A;  1YLE A;  2D4O A;  2FCK A;  1XIX A;  4ZBG A;  4HNW B;  3N5F A;  2QYV A;  4X8I A;  3CPX A;  1M44 A;  2PJ4 A;  2ZEO A;  3B35 A;  1ARL A;  4P44 A;  4EWT A;  1XJO A;  4MMO A;  4MBU A;  1LAM A;  2ARH A;  2VQY A;  2HV2 A;  5AG6 A;  4C7I A;  4P4I A;  5KTC A;  4DNC A;  2B5G B;  1S3Z A;  3SHP A;  4XPK A;  3T9Y A;  3S6F A;  2PIZ A;  1Y7R A;  3QNV A;  1L0C A;  1RO5 A;  1YSJ A;  2I79 A;  1F57 A;  3H5Z A;  4RS2 A;  3N7Z A;  3FX6 A;  4UCP A;  2Y0M A;  2QEC A;  2ZED A;  3DLJ A;  4JWP A;  2DEA A;  3IU1 A;  3SI2 A;  2ABZ A;  1J4J A;  2F8H A;  3IWG A;  2V8H A;  4MHZ A;  1RTQ A;  4P6Y A;  3FEC A;  1AYE A;  2AJ6 A;  2R8V A;  3NH8 A;  4R87 A;  3IWE A;  4MRI A;  3RBU A;  4BBH A;  2R1I A;  5A28 A;  3S6H A;  4CYO A;  4B11 A;  1QSR A;  3NE8 A;  1ZG8 A;  1S7F A;  3SI1 A;  3VWD A;  4F8Z A;  5J8C A;  2QML A;  2WPW A;  2R98 A; 
#chains in the Genus database with same CATH homology
 4HNY B;  3D2M A;  4CYN A;  4F6A A;  3R9G A;  4I49 A;  2BSW A;  1FY7 A;  2REF A;  5C88 A;  3F5B A;  1Y9K A;  1KZF A;  2VBQ A;  1S7L A;  3BJ8 A;  4PSX A;  2JEV A;  3EY5 A;  4LX9 A;  5AGE A;  4CYP A;  4KS9 A;  1YX0 A;  2CNT A;  2Z3M A;  2J8R A;  2ZW4 A;  2B58 A;  1MK4 A;  4YRH A;  2Z3O A;  2EVN A;  2FIW A;  3R9F A;  1M1D A;  4PV6 A;  5AG4 A;  2I00 A;  5F49 A;  4E8O A;  4C2Y A;  4KLV A;  4HNX B;  1Z4E A;  2VEZ A;  3EO4 A;  1M4D A;  2GIV A;  4A32 A;  1I21 A;  2B3V A;  2G3A A;  2PRB A;  1QST A;  4J3G A;  2Z3N A;  1XEB A;  2G0B A;  4OAD A;  3GYA A;  4AG9 A;  3TO9 A;  4MFQ A;  4L8A A;  4LUA A;  1IID A;  3CXS A;  4XPD B;  2IL4 A;  2P6E A;  3FB3 A;  4MFP A;  1IYK A;  2A4N A;  3R95 A;  4H6Z A;  2VZY A;  2CNM A;  2OZH A;  4QB9 A;  3TCV A;  2QIR A;  4KOW A;  2REE A;  5BWA B;  4YGO A;  1VHS A;  4UCN A;  4KVO E;  4FD6 A;  3TTH A;  3D3S A;  4B13 A;  1N71 A;  2Z3K A;  3RYO A;  2NMT A;  3EC4 A;  4R57 A;  2ZXV A;  5F48 A;  3S6K A;  4AB7 A;  3G8W A;  5DWN A;  2F5I A;  2K5T A;  3I3G A;  1CJW A;  1V0C A;  2DPS A;  2OU2 A;  4UWI A;  4KOU A;  2ZPA A;  1VKC A;  3TT2 A;  4AVC A;  2OB0 A;  4C2X A;  4II9 A;  4QC6 A;  3DDD A;  4PK3 A;  4A31 A;  2DPT A;  1OZP A;  1BOB A;  4GS4 A;  2WUU A;  1NMT A;  1SQH A;  4NEX A;  4UBR A;  5J8F A;  1Z4R A;  4B5P B;  3T90 A;  4PSW A;  2P6G A;  4CAE A;  3OWC A;  3UY5 A;  1I1D A;  5KTD A;  3PGP A;  2Z11 A;  3ZZI A;  4EVY A;  2FXF A;  1NE9 A;  4MFJ A;  4UFW A;  3GY9 A;  4CS0 B;  2YGW A;  4C2Z A;  2PSW A;  1XE4 A;  4MI4 A;  4UCM A;  1XF8 A;  1M4I A;  2J8M A;  4KVM E;  4U9Y A;  2YNC A;  4YFJ A;  2R7H A;  3JVN A;  4OLL A;  1R57 A;  2BEI A;  3D8P A;  2PC1 A;  4FD5 A;  3H4Q A;  4OAE A;  4UFX A;  4CAV A;  4KOX A;  4H89 A;  2AE6 A;  4K30 A;  4B10 A;  1Z9U A;  4NSQ A;  4NF1 A;  3CXQ A;  4JXR A;  5KTA A;  4NCZ A;  3MGD A;  5IX3 A;  4U9Z A;  4A95 A;  1TIQ A;  3G3S A;  4NXY A;  2Q4Y A;  5H86 A;  3R9E A;  5G21 A;  2WPX A;  4QBJ A;  4QVT A;  2HQY A;  3R1K A;  3A9L A;  4KVX A;  4KUB A;  2PDO A;  3JUW A;  4KOT A;  4B5O A;  3VWE A;  3I9S A;  3R96 A;  2GAN A;  4MFZ A;  1MJB A;  2B5G A;  4F0X A;  2FL4 A;  3DSB A;  2ZW5 A;  3IU2 A;  4MY0 A;  4PK2 A;  4RI1 A;  4H6U A;  4A33 A;  1KUX A;  4MFL A;  3W6X A;  2D4P A;  2PR1 A;  1ZO0 A;  2BUE A;  1MJA A;  1Y9W A;  2G3T A;  2FE7 A;  5A27 A;  4Q36 A;  1WK4 A;  3BLN A;  5I0C A;  2P6F A;  4CGO A;  1M4G A;  2Z3L A;  4CGN A;  2DXQ A;  5F47 A;  3DR8 A;  2J8N A;  3C26 A;  1QSO A;  2B3U A;  2Q7B A;  5HH1 A;  3F0A A;  3LD2 A;  3D2P A;  1I12 A;  2Q0Y A;  1YR0 A;  3LOD A;  1B6B A;  1MJ9 A;  1UFH A;  4UFV A;  2Z10 A;  2OZU A;  4B14 A;  2ATR A;  3TFY A;  5G20 A;  5EBV A;  3FYN A;  4MHD A;  2CY2 A;  2VXK A;  3S6G A;  1KUV A;  3FNC A;  5F46 A;  4CAW A;  3DR6 A;  4JLY A;  1IYL A;  4A30 A;  3KKW A;  5C82 A;  2FSR A;  3W6S A;  4UA3 A;  2PQ8 A;  1CM0 A;  3E0K A;  3FXT A;  4L89 A;  4Y49 B;  3NE7 A;  4B5P A;  2KCW A;  2PR8 A;  2FS5 A;  4X5K A;  3GKR A;  4AVA A;  3ZJ0 A;  1YVK A;  3F8K A;  4FD4 A;  3QB8 A;  2RC4 A;  1WWZ A;  1XMT A;  4F0Y A;  3SXO A;  1LRZ A;  1PUA A;  4KOR A;  2HUZ A;  3P2F A;  1RXT A;  5FVJ A;  4R9M A;  4R3K A;  4C7H A;  2CXA A;  2WSA A;  1S60 A;  2YNE A;  5G1Z A;  2GE3 A;  4AVB A;  2Q04 A;  2Z0Z A;  1S5K A;  4C68 A;  3IGR A;  5JQ4 A;  4BMH A;  2OZG A;  2JDC A;  5AG7 A;  1Q2C A;  4CRZ B;  2Q4V A;  4MY3 A;  4CGL A;  1PU9 A;  1BO4 A;  4KSF A;  2O28 A;  5ISV A;  1S7N A;  3DNS A;  3V8I A;  4R3L A;  4M3S A;  3P2H A;  4B12 A;  4KOV A;  2X7B A;  3TE4 A;  3CXP A;  5DWM A;  1P0H A;  5E96 A;  4ONU A;  1S7K A;  4XPD C;  3WR7 A;  4IUS A;  1P4N A;  4U5Y A;  3B8G A;  1YVO A;  3EXN A;  4QUS A;  5IB0 A;  4JXQ A;  3K9U A;  4ORF A;  5GCN A;  3JTK A;  4XNH C;  2BL1 A;  5HMN A;  4A2Z A;  2OH1 A;  1Q2D A;  3FBU A;  3BJ7 A;  3EFA A;  5CNP A;  4CGP A;  4CGM A;  3PP9 A;  1GHE A;  2FIA A;  2YNC C;  4CYQ A;  2CNS A;  1U6M A;  2C27 A;  1NSL A;  1YK3 A;  1YRE A;  5EC4 A;  5H84 A;  4KOS A;  4E2A A;  1Q2Y A;  2YND A;  4XPL A;  4AG7 A;  3FRM A;  3TO7 A;  3PZJ A;  1ON0 A;  2ZW6 A;  4MFK A;  4KZT A;  3SXN A;  2B4D B;  1IB1 E;  2P0W A;  2Q44 A;  4M85 A;  5JPH A;  4Q38 A;  2EUI A;  2ZW7 A;  2VZZ A;  2JLM A;  4MJ8 A;  4JD6 A;  1YGH A;  2H5M A;  2FT0 A;  2VI7 A;  4UWJ A;  4KUA A;  2B4B A;  1QSM A;  4XNH B;  1K4J A;  4FD7 A;  4JJX A;  4Y49 C;  4KSA A;  2Z3P A;  4KLW A;  3W91 A;  2B4D A;  3TO6 A;  3TOA A;  4CAX A;  4CRY B;  4HKF A;  4CAF A;  3QAH A;  1IIC A;  4KOY A;  5IV0 A;  4IF5 A;  5AG5 A;  4ZGY B;  1B87 A;  4E0A A;  2JDD A;  3FIX A;  1QSN A;  3TOB A;  1KUY A;  1YLE A;  2D4O A;  2FCK A;  1XIX A;  4ZBG A;  4HNW B;  1M44 A;  4MBU A;  2ARH A;  2VQY A;  2HV2 A;  5AG6 A;  4C7I A;  5KTC A;  4DNC A;  2B5G B;  1S3Z A;  3SHP A;  4XPK A;  3T9Y A;  3S6F A;  1Y7R A;  1L0C A;  1RO5 A;  2I79 A;  3H5Z A;  4RS2 A;  3N7Z A;  4UCP A;  2Y0M A;  2QEC A;  4JWP A;  3IU1 A;  1J4J A;  3IWG A;  5G22 A;  4R87 A;  2AJ6 A;  2R8V A;  4BBH A;  5A28 A;  3IWE A;  2R1I A;  3S6H A;  4CYO A;  4B11 A;  1QSR A;  1S7F A;  3VWD A;  5J8C A;  2QML A;  2WPW A;  2R98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...