2JEVA

Crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
169
Chain Sequence
b'AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIAMINE ACETYLTRANSFERASE 1
publication title Mechanistic and Structural Analysis of Human Spermidine/Spermine N(1)-Acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jevA00
2F5IA 4PV6A 4KLVA 1R57A 2O28A 3TO7A 4MI4A 4IUSA 2R98A 1Y7RA 2P6GA 3S6HA 4F6AA 5C82A 2J8RA 4RS2A 1QSTA 3W6XA 4FD6A 4L89A 3TT2A 1N71A 2G3TA 1CM0A 2QMLA 4MY3A 5HMNA 4L8AA 3TOAA 2CY2A 4GS4A 2WPXA 1L0CA 2GANA 1P4NA 4AVBA 3QAHA 1YK3A 3D2MA 4NF1A 2A4NA 4FD7A 1S7KA 3EO4A 4QBJA 2B4BA 4KVOE 4XPLA 1YLEA 4YGOA 1PUAA 2OB0A 2VZYA 2FS5A 1IYLA 3JUWA 1MJBA 3IWGA 1BO4A 4BMHA 3NE7A 2JDCA 2RC4A 2FSRA 3G8WA 3ZJ0A 4JXRA 5E96A 4KUAA 4R3KA 3V8IA 2J8MA 5EBVA 2ZW7A 2BUEA 3FB3A 5F47A 4EVYA 2B3UA 3FIXA 3GY9A 1M4DA 2HQYA 4KOYA 4H6UA 1OZPA 4KOSA 5H86A 2JEVA 4HKFA 2GE3A 5F49A 3LD2A 2FE7A 4I49A 3TCVA 4K30A 1QSMA 3LODA 4ZBGA 1J4JA 1YGHA 1RO5A 2OU2A 2QECA 5J8FA 3EFAA 2D4OA 1YREA 2FCKA 2PRBA 2VQYA 4XPDB 1S5KA 4LUAA 4PK3A 3FBUA 2PDOA 3JVNA 3C26A 2JDDA 2FT0A 4KVXA 3IGRA 3R9GA 5HH1A 2OH1A 2I79A 5GCNA 1S7LA 3FYNA 2QIRA 4MHDA 1TIQA 1M4GA 1V0CA 1YVOA 1MK4A 2Z11A 3R1KA 2FIWA 4AG7A 4B5PA 1K4JA 1FY7A 1YVKA 2ARHA 4X5KA 1UFHA 1BOBA 2X7BA 2HV2A 1NSLA 2J8NA 4CRYB 2Q4YA 2BL1A 1S7NA 4KUBA 2AE6A 5KTCA 4FD4A 5IX3A 4NXYA 3CXSA 3FRMA 1MJAA 3TO9A 4QC6A 2Q4VA 2R7HA 3SHPA 2WPWA 2B5GA 2OZUA 4FD5A 4Y49C 4OLLA 3FNCA 3FXTA 2PQ8A 3S6GA 1KUVA 1M1DA 4PSXA 2HUZA 3DSBA 4IF5A 5JQ4A 1Y9WA 2R1IA 4KLWA 3DNSA 4F0YA 4MJ8A 2VXKA 3BJ7A 3DR6A 4AVCA 4OADA 4ONUA 3CXQA 2VEZA 1S3ZA 1WK4A 3SXNA 4JJXA 3W91A 3VWDA 4XNHC 4E8OA 4U9ZA 4R87A 4CAWA 1B87A 3T90A 3DDDA 1YX0A 4KZTA 4HNXB 4PK2A 1XIXA 2Y0MA 4KOWA 3S6KA 1U6MA 1Z9UA 1GHEA 4KVME 3MGDA 2Q44A 2P6FA 5F46A 1MJ9A 1KUXA 3D3SA 4PSWA 5C88A 1Y9KA 4M85A 3R95A 2ZPAA 2B58A 4JXQA 4QVTA 2P6EA 3BJ8A 3RYOA 2B4DB 1NMTA 4NEXA 1Z4RA 3D2PA 1IIDA 4U5YA 1I21A 2Z0ZA 3P2FA 3UY5A 1IICA 4DNCA 3OWCA 2NMTA 1I12A 4KORA 4QUSA 3ZZIA 4JLYA 2ZXVA 2OZHA 3W6SA 1RXTA 5IV0A 4KOVA 1QSRA 4UBRA 5DWMA 4LX9A 3F0AA 2REEA 4KOTA 3I9SA 5KTDA 3KKWA 2VI7A 3BLNA 4KOXA 4B5OA 1QSOA 2AJ6A 1WWZA 3I3GA 3CXPA 4H89A 2Q04A 3B8GA 2Q7BA 1M44A 1M4IA 3DR8A 4CAXA 4XPDC 2ZW6A 4OAEA 2FIAA 2R8VA 1XMTA 5EC4A 2OZGA 1PU9A 4E2AA 4UA3A 4Y49B 4HNYB 3H4QA 3TE4A 2Q0YA 4UWIA 3T9YA 5JPHA 3SXOA 4CAVA 1S7FA 2B4DA 1KUYA 2VBQA 3R9FA 4RI1A 1S60A 2P0WA 2PR8A 5J8CA 2FXFA 3PZJA 4CRZB 3PP9A 4UWJA 2PR1A 4HNWB 4XNHB 2H5MA 3TFYA 1B6BA 2DXQA 3GYAA 2PC1A 3F5BA 2CNTA 4KOUA 2K5TA 2C27A 2EUIA 3EXNA 3N7ZA 3S6FA 4YFJA 2PSWA 2CNSA 4R57A 1IYKA 5F48A 1KZFA 4E0AA 3TO6A 2FL4A 3G3SA 1VHSA 2G0BA 2KCWA 2G3AA 4XPKA 1LRZA 5KTAA 2BEIA 2JLMA 3EY5A 3TOBA 1QSNA 4AG9A 2I00A 4JWPA 3TTHA 2D4PA 3VWEA 1XE4A 4NSQA 3K9UA 1XEBA 4II9A 4AVAA 4B5PB 4JD6A 4U9YA 2VZZA 2REFA 3E0KA 5I0CA 4M3SA 1Q2YA 5CNPA 3QB8A 1Z4EA 3D8PA 4R3LA 5IB0A 1CJWA 3EC4A 2Z10A 1SQHA 4CS0B 2B3VA 4NCZA 2ATRA 1Q2DA 3PGPA 1YR0A 1P0HA 1Q2CA 2CNMA 4H6ZA 2EVNA 1NE9A 4QB9A 4AB7A 4R9MA 1VKCA 5H84A 1IB1E 2B5GB 2ZW4A 1I1DA 2BSWA 3GKRA 4YRHA 1XF8A 3F8KA 3R9EA 1ON0A 4MBUA 3WR7A 2IL4A 3P2HA 5DWNA 2ZW5A 3R96A 2GIVA 5FVJA 4J3GA 4ORFA 5ISVA 4MY0A
chains in the Genus database with same CATH superfamily
2F5IA 3KHZA 4PV6A 1HDUA 3D66A 2GFQA 4KLVA 1R57A 2O28A 3TO7A 2AFZA 4MI4A 3FVLA 5LRJA 4C7HA 4IUSA 1QMUA 2O4HA 2R98A 1Y7RA 1ZLHA 2P6GA 4ZY2A 3S6HA 1XRYA 2XEGA 1AYEA 4F6AA 1ZLIA 2AFOA 5G20A 5C82A 2J8RA 3GUXA 4RS2A 2V8DA 1QSTA 3DLJA 5LRKA 4A39A 3W6XA 2V8VA 4FD6A 4CAFA 4F8ZA 3WC7A 3PB9X 2PJAA 1IOFA 4A31A 4L89A 5D8NA 3TT2A 1N71A 1Z2LA 4Z65A 2G3TA 4PXCA 3B35A 1CM0A 2QMLA 5HVGA 4MY3A 5HMNA 3ISXA 3IIBA 2V8GA 4L8AA 3TOAA 2CY2A 4GS4A 3PRTA 2V77A 2WPXA 3S9NA 1L0CA 2GANA 4UIAA 1P4NA 1R43A 3QAHA 4M6GA 4AVBA 1EE3P 1YK3A 3D2MA 2EK9A 4NJQA 4NF1A 4M6IA 2AFSA 2A4NA 2XEIA 5A27A 3SJGA 3IC1A 4CYNA 4FD7A 1S7KA 1R3NA 3HUVA 3D7FA 3EO4A 4QBJA 4FBEA 2B4BA 1NSAA 2CF4A 4KVOE 4XPLA 1YLEA 4YGOA 4B6ZA 1YW4A 2G9DA 4YWYA 2OB0A 1PUAA 1VIXA 2EWBA 2VZYA 4MMOA 1ZG7A 2Z3LA 4MFKA 2FS5A 1IYLA 3JUWA 1MJBA 3IWGA 1BO4A 3IEHA 4BMHA 4CAEA 3N5FA 1DTDA 3NE7A 2JDCA 2RC4A 3A9LA 2FSRA 4MCQA 3PB8X 5G21A 3PBBA 3G8WA 3ZJ0A 3FJUA 2WZNA 4JXRA 5E96A 1CP7A 2GLJA 4KUAA 4MFLA 4R3KA 1LAMA 3V8IA 5CBMA 2J8MA 5EBVA 2ZW7A 5CPAA 2BUEA 3FB3A 4MFZA 2WSAA 1CG2A 2B3UA 5F47A 2Q4ZA 4EVYA 4F9VA 2Z3KA 3FIXA 3GY9A 1M4DA 2HQYA 4B11A 1F2PA 4KOYA 1M4LA 2YNCA 1JWQA 4H6UA 4IAVA 4JZ0A 4F0XA 5J1QA 1OZPA 2GREA 4G1PA 4KOSA 5H86A 5I4MA 2Z3OA 2JEVA 4HKFA 4A95A 2GE3A 4A30A 5F49A 3LD2A 2FE7A 3KQXA 4I49A 4K30A 4P4JA 3TCVA 1QSMA 2DEAA 3LODA 4ZBGA 1J4JA 1YGHA 2ZEDA 4C68A 1RO5A 3CDXA 5D29A 2OU2A 2QECA 2Q7SA 3FEDA 3FX6A 5J8FA 1LANA 4BD9A 2PVVA 5LYIA 3EFAA 2D4OA 1XBUA 3KR5A 1YREA 2FCKA 2PRBA 4ZY1A 2VQYA 4NGTA 2ZEGA 4A37A 5THWA 4ZX9A 1FT7A 2F8HA 4XPDB 2NYQA 4EWTA 1S5KA 2QVPA 5JGFA 3PB6X 4B12A 3DGVA 4LUAA 4Q36A 1LOKA 1XJOA 2PDOA 3FBUA 3JVNA 3KL9A 4MHNA 4MHYA 3C26A 4PK3A 4OP4A 2C6GA 2JDDA 2FT0A 4HPSA 4KVXA 3SJFA 4F9UA 3IGRA 1FNOA 4W9YA 4UEFA 1IY7A 4OC5A 5G22A 3R9GA 5HH1A 2OH1A 2I79A 4ZI6A 4Q7AA 5GCNA 1S7LA 1XOVA 4ZYQA 2PJ3A 3FYNA 2QIRA 4M6HA 3SJEA 4EMEA 3ISZA 4MHDA 2PVWA 4UCNA 1BLLE 4P44A 1TIQA 4FUUA 3SJXA 1M4GA 2Z3MA 1V0CA 1YVOA 1TF8A 1PYTB 3SI2A 3KZWA 1MK4A 4P4BA 3D7HA 3JTKA 4PQAA 4NGPA 2Z11A 3R1KA 3NH4A 2FIWA 4AG7A 4B5PA 5IB9A 1K4JA 1FY7A 4OC4A 1YVKA 2ZOGA 2RFHA 2OR4A 3B7IA 2ARHA 4X5KA 1UFHA 5LRGA 1BOBA 2X7BA 2HV2A 1NSLA 1Z5RA 3QNVA 4P6YA 2J8NA 4MCSA 1ZG8A 4NGNA 1RTQA 3S9MA 4ZY0A 4C7IA 5AG7A 1Q7LA 4CRYB 2Q4YA 2BL1A 1S7NA 4UIBA 5A28A 4KUBA 1AUGA 2ANPA 1HDQA 2AE6A 5KTCA 4KSFA 4FD4A 5IX3A 4MFPA 4NXYA 4UEEA 5AG4A 1ARLA 2PJ0A 3CXSA 1ZG9A 1IU8A 5HVFA 3FRMA 3B3CA 1BAVA 1DE4C 1MJAA 4GXHA 4IK2A 2Q4VA 2R7HA 4QC6A 3T8WA 3TO9A 1YQEA 3SHPA 4DUKA 5K8MA 4BBHA 2WPWA 5HXDA 2IQ6A 2B5GA 2OZUA 4FD5A 4Y49C 4OLLA 5AGEA 5DS0A 2DPTA 3FNCA 3FXTA 3NE8A 2PJBA 4MHPA 2PQ8A 3IO1A 3S6GA 5AG6A 1KUVA 4YU9A 3GIUA 5AG5A 3VARA 2EO8A 1M1DA 2PJ2A 4PSXA 3H8EA 2PIZA 2HUZA 3DSBA 4IF5A 3IU1A 5JQ4A 4P10A 1Y9WA 2YNEA 1Z8WA 2R1IA 4KLWA 3DNSA 2C6CA 4F0YA 4MJ8A 2VXKA 3BJ7A 4R8FA 4R76A 3DR6A 2O53A 3TX8A 4A33A 4FAIA 4AVCA 4OADA 4ONUA 1ELLP 1QQ9A 2VEZA 1S3ZA 1WK4A 3CXQA 4EFDA 3SXNA 4CYQA 1AMPA 5HVHA 4JJXA 2YNCC 6CPAA 3W91A 8CPAA 3VWDA 4B10A 4OC2A 4XNHC 4E8OA 4OIDA 4U9ZA 2EBJA 4R87A 3BI0A 4CAWA 4A32A 1B87A 3T90A 1IOIA 2AFXA 2PRQA 2QYVA 4CGMA 3DDDA 3K9TA 1YX0A 3H5ZA 4CGLA 4PXBA 4KZTA 1YSJA 4HNXB 1YLOA 4MHZA 4KSIA 2ABZA 4X8IA 4PK2A 2DF5A 1XIXA 2Y0MA 4KOWA 4C2YA 2J9AA 3S6KA 2GU2A 1U6MA 1Z9UA 1GHEA 4KVME 3MGDA 2Q44A 1TXRA 1Z8XA 3CT9A 4UCPA 2P6FA 4RUHA 1CP6A 5F46A 4C2XA 4P4EA 3WT4A 3IJ3A 1MJ9A 1PCAA 1KUXA 4WWVA 1TF9A 3B3VA 3D3SA 1TKJA 4PSWA 5C88A 4MCRA 1Y9KA 4M85A 4Q38A 4NJRA 3R95A 2ZPAA 2B58A 2Q43A 3FMCA 5BWAB 2FVGA 4JXQA 2JBKA 4OC0A 2PJ8A 3PB7X 1H8LA 4CGNA 2OOTA 4QVTA 2ZEPA 3PFOA 2P6EA 3BJ8A 2ZENA 3RYOA 2B4DB 1NMTA 4CPAA 2XEFA 4OC3A 3VATA 3WC5A 4NEXA 1Z4RA 3D2PA 1IIDA 4U5YA 1XMBA 2CIJA 3CPXA 4ZGYB 2Z3NA 1I21A 4KS9A 2Z0ZA 3FF3A 3P2FA 4WJBA 1IICA 3UY5A 1Y0RA 4DNCA 4X3RA 4A2ZA 1Z8LA 5JM6A 3OWCA 4C2ZA 3L2NA 1X12A 2NMTA 4OMEA 1I12A 4KORA 1Y0YA 4QUSA 2HB6A 2PJ4A 3ZZIA 1LCPA 3PFEA 4JLYA 2ZXVA 2OZHA 3S9LA 3W6SA 1RXTA 4UFXA 4GM5A 5IV0A 3V7ZA 5ELYA 2C1CA 1QSRA 2Z3PA 4KOVA 4LX9A 4UBRA 5DWMA 4DJLA 1LFWA 3F0AA 1Z8TA 2REEA 4OIWA 4KOTA 3I9SA 5KTDA 3KKWA 2VI7A 1YMEA 3WC6A 3BLNA 4KOXA 2QJ8A 4B5OA 3KHXA 1QSOA 2AJ6A 3BXMA 1WWZA 3HLPA 3I3GA 1CBXA 3CXPA 3SI0A 4H89A 5LYDA 2Q04A 2Q51A 4B14A 2WYRA 3B8GA 2Q7BA 2F7VA 1M44A 4MXUA 1M4IA 3DR8A 4PPZA 4CAXA 2XEJA 1TKHA 1HEEA 3MRUA 2DPSA 3KASA 4XPDC 2PJCA 2HC9A 2ZW6A 4OAEA 3RO0A 3RBUA 3QAYA 2FIAA 2R8VA 1XMTA 5EC4A 2PJ6A 2PE3A 2OZGA 4UFWA 1PU9A 4CYPA 4JYWA 4E2AA 1IGBA 3IU2A 4UA3A 2YGWA 4Y49B 4HNYB 3H4QA 3TE4A 1CPXA 2Q0YA 4H2KA 2ZEHA 3RNZA 4UWIA 3T9YA 5JPHA 3H8GA 2PJ1A 3SXOA 4CAVA 1S7FA 2B4DA 2RB7A 1KUYA 1ARMA 2VBQA 1YW6A 3R9FA 1A2ZA 3KI9A 4RI1A 1S60A 2POKA 2AFWA 2P0WA 4MCPA 3SI1A 3V38A 2PR8A 4NGSA 5J8CA 2FXFA 4UCMA 5K8NA 2VL1A 3PZJA 4CRZB 1OBRA 3PP9A 4UWJA 1TKFA 2PR1A 3LWUA 1F2OA 4HNWB 4XNHB 4A94A 3K2KA 3NH5A 4NGQA 2H5MA 3LACA 3TFYA 4LQ6A 1XFOA 1B6BA 2DXQA 4AXVA 5EMIA 3GYAA 1KWMA 2PC1A 3F5BA 1UWYA 3LMSA 2CNTA 4KOUA 3NA6A 1F57A 2K5TA 3D7GA 2ZEOA 2C27A 2EUIA 3EXNA 4RN7A 3N7ZA 3S6FA 3VH9A 1Y7EA 3TC8A 2PSWA 3FH4A 4YFJA 2CNSA 4R57A 2CTCA 1IYKA 2I3CA 3B3SA 3PEIA 2ZEFA 5F48A 1X10A 1CPSA 3B3WA 1KZFA 3B2YA 4E0AA 2C6PA 5JH9A 3CZXA 2BOAA 3TO6A 2FL4A 3G3SA 1VHSA 2G0BA 2KCWA 2G3AA 4XPKA 1LRZA 1CX8A 5KTAA 2BEIA 4P4DA 3NFZA 2JLMA 2PJ5A 1JQGA 3EY5A 3TOBA 1QSNA 2YNDA 3IFEA 4P4FA 4AG9A 4MFJA 2I00A 3BI1A 2NSMA 4PXEA 4JWPA 5G1ZA 4CGPA 4P4IA 3TTHA 2ZOFA 3NH8A 2D4PA 3VWEA 3BHXA 1XE4A 4NSQA 4B13A 3K9UA 1XEBA 4II9A 2JEWA 4OC1A 4BINA 1LAPA 4TNUA 3KQZA 4A38A 3IWWA 4AVAA 4B5PB 2EK8A 4JD6A 2IJZA 3FECA 4U9YA 2BO9A 2VZZA 4OKOA 3PBEA 2PJ7A 2REFA 2IMOA 3E0KA 4M3SA 4NFRA 5I0CA 1Q2YA 2BCOA 3GLJA 4P45A 4PXDA 5CNPA 4DYOA 5F09A 2CXAA 3QB8A 1Z4EA 1VHEA 3KGQA 3D8PA 4R3LA 5IB0A 1CJWA 3EC4A 2Z10A 1SQHA 4CS0B 5LYFA 2B3VA 4CGOA 2V8HA 3GB0A 3B3TA 4NCZA 2PIYA 4NGMA 2ATRA 1Q2DA 4ZX8A 3JRUA 5K8OA 3PGPA 1YR0A 4MFQA 4R6TA 1P0HA 1Q2CA 2CNMA 1GYTA 2EVNA 4H6ZA 3RAMA 4UFVA 1NE9A 2ZELA 3D68A 3D67A 4TWEA 5K8PA 4QB9A 4AB7A 2AFUA 4NGRA 1VGYA 1VKCA 4R9MA 4UEZA 4CYOA 5H84A 4ONWA 7CPAA 1IB1E 3CPAA 3PB4X 2B5GB 2ODFA 1ELMP 2ZW4A 4X2TA 3H8FA 1VHOA 5LYLA 1I1DA 2BSWA 2WUUA 3GKRA 2PJ9A 1XF8A 4O23A 4YRHA 3F8KA 3R9EA 1ON0A 3FEEA 3I1UA 2ZEEA 4MBUA 3WR7A 2IL4A 3P2HA 2CTBA 2GLFA 4IHMA 2ZW5A 3D4UA 4KSAA 5DWNA 3D7DA 1BPNA 1BPMA 3MN8A 4LQGA 2GIVA 4UF4A 3R96A 1ZO0A 5FVJA 4J3GA 2AFMA 4MRIA 2JBJA 4K3NA 2ZEMA 4FWUA 3WABA 3KR4A 2PCUA 3IWEA 4R7MA 4ORFA 5ISVA 4MY0A 3RZAA
chains in the Genus database with same CATH topology
2F5IA 4PV6A 4KLVA 1R57A 2O28A 3TO7A 4MI4A 4C7HA 4IUSA 2R98A 1Y7RA 2P6GA 3S6HA 4F6AA 5C82A 5G20A 2J8RA 4RS2A 1QSTA 3W6XA 4CAFA 4FD6A 4A31A 4L89A 3TT2A 1N71A 2G3TA 1CM0A 2QMLA 4MY3A 5HMNA 4L8AA 3TOAA 2CY2A 4GS4A 2WPXA 1L0CA 2GANA 1P4NA 4AVBA 3QAHA 1YK3A 3D2MA 4NF1A 2A4NA 5A27A 4CYNA 4FD7A 1S7KA 3EO4A 4QBJA 2B4BA 4KVOE 4XPLA 1YLEA 4YGOA 1PUAA 2OB0A 2VZYA 2Z3LA 4MFKA 2FS5A 1IYLA 3JUWA 1MJBA 3IWGA 1BO4A 4BMHA 4CAEA 3NE7A 2JDCA 2RC4A 3A9LA 2FSRA 5G21A 3G8WA 3ZJ0A 4JXRA 5E96A 4KUAA 4MFLA 4R3KA 3V8IA 2J8MA 5EBVA 2ZW7A 2BUEA 3FB3A 4MFZA 2WSAA 2B3UA 5F47A 4EVYA 2Z3KA 3FIXA 3GY9A 1M4DA 2HQYA 4B11A 4KOYA 2YNCA 4H6UA 4F0XA 1OZPA 4KOSA 5H86A 2Z3OA 2JEVA 4HKFA 4A95A 2GE3A 4A30A 5F49A 3LD2A 2FE7A 4I49A 3TCVA 4K30A 1QSMA 3LODA 4ZBGA 1J4JA 1YGHA 4C68A 1RO5A 2OU2A 2QECA 5J8FA 3EFAA 2D4OA 1YREA 2FCKA 2PRBA 2VQYA 4XPDB 1S5KA 4B12A 4LUAA 4Q36A 4PK3A 3FBUA 2PDOA 3JVNA 3C26A 2JDDA 2FT0A 4KVXA 3IGRA 5G22A 3R9GA 5HH1A 2OH1A 2I79A 5GCNA 1S7LA 3FYNA 2QIRA 4MHDA 4UCNA 1TIQA 1M4GA 2Z3MA 1V0CA 1YVOA 1MK4A 3JTKA 2Z11A 3R1KA 2FIWA 4AG7A 4B5PA 1K4JA 1FY7A 1YVKA 2ARHA 4X5KA 1UFHA 1BOBA 2X7BA 2HV2A 1NSLA 2J8NA 4C7IA 5AG7A 4CRYB 2Q4YA 2BL1A 1S7NA 5A28A 4KUBA 2AE6A 5KTCA 4KSFA 4FD4A 5IX3A 4MFPA 4NXYA 5AG4A 3CXSA 3FRMA 1MJAA 3TO9A 4QC6A 2Q4VA 2R7HA 3SHPA 4BBHA 2WPWA 2B5GA 2OZUA 4FD5A 4Y49C 4OLLA 5AGEA 2DPTA 3FNCA 3FXTA 2PQ8A 3S6GA 5AG6A 1KUVA 5AG5A 1M1DA 4PSXA 2HUZA 3DSBA 4IF5A 3IU1A 5JQ4A 1Y9WA 2YNEA 2R1IA 4KLWA 3DNSA 4F0YA 4MJ8A 2VXKA 3BJ7A 3DR6A 4A33A 4AVCA 4OADA 4ONUA 3CXQA 2VEZA 1S3ZA 1WK4A 3SXNA 4CYQA 4JJXA 2YNCC 3W91A 3VWDA 4B10A 4XNHC 4E8OA 4U9ZA 4R87A 4CAWA 4A32A 1B87A 3T90A 4CGMA 3DDDA 4CGLA 1YX0A 3H5ZA 4KZTA 4HNXB 4PK2A 1XIXA 2Y0MA 4KOWA 4C2YA 3S6KA 1U6MA 1Z9UA 1GHEA 4KVME 3MGDA 2Q44A 4UCPA 2P6FA 5F46A 4C2XA 1MJ9A 1KUXA 3D3SA 4PSWA 5C88A 1Y9KA 4M85A 4Q38A 3R95A 2ZPAA 2B58A 5BWAB 4JXQA 4CGNA 4QVTA 2P6EA 3BJ8A 3RYOA 2B4DB 1NMTA 4NEXA 1Z4RA 3D2PA 1IIDA 4U5YA 4ZGYB 2Z3NA 1I21A 4KS9A 2Z0ZA 3P2FA 3UY5A 1IICA 4DNCA 4A2ZA 3OWCA 4C2ZA 2NMTA 1I12A 4KORA 4QUSA 3ZZIA 4JLYA 2ZXVA 2OZHA 3W6SA 1RXTA 4UFXA 5IV0A 4KOVA 1QSRA 2Z3PA 4UBRA 4LX9A 5DWMA 3F0AA 2REEA 4KOTA 3I9SA 5KTDA 3KKWA 2VI7A 3BLNA 4KOXA 4B5OA 1QSOA 2AJ6A 1WWZA 3I3GA 3CXPA 4H89A 2Q04A 4B14A 3B8GA 2Q7BA 1M44A 1M4IA 3DR8A 4CAXA 2DPSA 4XPDC 2ZW6A 4OAEA 2FIAA 2R8VA 1XMTA 5EC4A 2OZGA 4UFWA 1PU9A 4CYPA 4E2AA 3IU2A 4UA3A 2YGWA 4Y49B 4HNYB 3H4QA 3TE4A 2Q0YA 4UWIA 3T9YA 5JPHA 3SXOA 4CAVA 1S7FA 2B4DA 1KUYA 2VBQA 3R9FA 4RI1A 1S60A 2P0WA 2PR8A 5J8CA 2FXFA 4UCMA 3PZJA 4CRZB 3PP9A 4UWJA 2PR1A 4HNWB 4XNHB 2H5MA 3TFYA 1B6BA 2DXQA 3GYAA 2PC1A 3F5BA 2CNTA 4KOUA 2K5TA 2C27A 2EUIA 3EXNA 3N7ZA 3S6FA 4YFJA 2PSWA 2CNSA 4R57A 1IYKA 5F48A 1KZFA 4E0AA 3TO6A 2FL4A 3G3SA 1VHSA 2G0BA 2KCWA 2G3AA 4XPKA 1LRZA 5KTAA 2BEIA 2JLMA 3EY5A 3TOBA 1QSNA 2YNDA 4AG9A 4MFJA 2I00A 4JWPA 5G1ZA 4CGPA 3TTHA 2D4PA 3VWEA 1XE4A 4NSQA 4B13A 3K9UA 1XEBA 4II9A 4AVAA 4B5PB 4JD6A 4U9YA 2VZZA 2REFA 3E0KA 5I0CA 4M3SA 1Q2YA 5CNPA 2CXAA 3QB8A 1Z4EA 3D8PA 4R3LA 5IB0A 1CJWA 3EC4A 2Z10A 1SQHA 4CS0B 2B3VA 4CGOA 4NCZA 2ATRA 1Q2DA 3PGPA 1YR0A 4MFQA 1P0HA 1Q2CA 2CNMA 4H6ZA 2EVNA 4UFVA 1NE9A 4QB9A 4AB7A 4R9MA 1VKCA 4CYOA 5H84A 1IB1E 2B5GB 2ZW4A 1I1DA 2BSWA 2WUUA 3GKRA 4YRHA 1XF8A 3F8KA 3R9EA 1ON0A 4MBUA 3WR7A 2IL4A 3P2HA 5DWNA 2ZW5A 4KSAA 3R96A 2GIVA 1ZO0A 5FVJA 4J3GA 3IWEA 4ORFA 5ISVA 4MY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5I A;  4PV6 A;  4KLV A;  1R57 A;  2O28 A;  3TO7 A;  4MI4 A;  4IUS A;  2R98 A;  1Y7R A;  2P6G A;  3S6H A;  4F6A A;  5C82 A;  2J8R A;  4RS2 A;  1QST A;  3W6X A;  4FD6 A;  4L89 A;  3TT2 A;  1N71 A;  2G3T A;  1CM0 A;  2QML A;  4MY3 A;  5HMN A;  4L8A A;  3TOA A;  2CY2 A;  4GS4 A;  2WPX A;  1L0C A;  2GAN A;  1P4N A;  4AVB A;  3QAH A;  1YK3 A;  3D2M A;  4NF1 A;  2A4N A;  4FD7 A;  1S7K A;  3EO4 A;  4QBJ A;  2B4B A;  4KVO E;  4XPL A;  1YLE A;  4YGO A;  1PUA A;  2OB0 A;  2VZY A;  2FS5 A;  1IYL A;  3JUW A;  1MJB A;  3IWG A;  1BO4 A;  4BMH A;  3NE7 A;  2JDC A;  2RC4 A;  2FSR A;  3G8W A;  3ZJ0 A;  4JXR A;  5E96 A;  4KUA A;  4R3K A;  3V8I A;  2J8M A;  5EBV A;  2ZW7 A;  2BUE A;  3FB3 A;  5F47 A;  4EVY A;  2B3U A;  3FIX A;  3GY9 A;  1M4D A;  2HQY A;  4KOY A;  4H6U A;  1OZP A;  4KOS A;  5H86 A;  2JEV A;  4HKF A;  2GE3 A;  5F49 A;  3LD2 A;  2FE7 A;  4I49 A;  3TCV A;  4K30 A;  1QSM A;  3LOD A;  4ZBG A;  1J4J A;  1YGH A;  1RO5 A;  2OU2 A;  2QEC A;  5J8F A;  3EFA A;  2D4O A;  1YRE A;  2FCK A;  2PRB A;  2VQY A;  4XPD B;  1S5K A;  4LUA A;  4PK3 A;  3FBU A;  2PDO A;  3JVN A;  3C26 A;  2JDD A;  2FT0 A;  4KVX A;  3IGR A;  3R9G A;  5HH1 A;  2OH1 A;  2I79 A;  5GCN A;  1S7L A;  3FYN A;  2QIR A;  4MHD A;  1TIQ A;  1M4G A;  1V0C A;  1YVO A;  1MK4 A;  2Z11 A;  3R1K A;  2FIW A;  4AG7 A;  4B5P A;  1K4J A;  1FY7 A;  1YVK A;  2ARH A;  4X5K A;  1UFH A;  1BOB A;  2X7B A;  2HV2 A;  1NSL A;  2J8N A;  4CRY B;  2Q4Y A;  2BL1 A;  1S7N A;  4KUB A;  2AE6 A;  5KTC A;  4FD4 A;  5IX3 A;  4NXY A;  3CXS A;  3FRM A;  1MJA A;  3TO9 A;  4QC6 A;  2Q4V A;  2R7H A;  3SHP A;  2WPW A;  2B5G A;  2OZU A;  4FD5 A;  4Y49 C;  4OLL A;  3FNC A;  3FXT A;  2PQ8 A;  3S6G A;  1KUV A;  1M1D A;  4PSX A;  2HUZ A;  3DSB A;  4IF5 A;  5JQ4 A;  1Y9W A;  2R1I A;  4KLW A;  3DNS A;  4F0Y A;  4MJ8 A;  2VXK A;  3BJ7 A;  3DR6 A;  4AVC A;  4OAD A;  4ONU A;  3CXQ A;  2VEZ A;  1S3Z A;  1WK4 A;  3SXN A;  4JJX A;  3W91 A;  3VWD A;  4XNH C;  4E8O A;  4U9Z A;  4R87 A;  4CAW A;  1B87 A;  3T90 A;  3DDD A;  1YX0 A;  4KZT A;  4HNX B;  4PK2 A;  1XIX A;  2Y0M A;  4KOW A;  3S6K A;  1U6M A;  1Z9U A;  1GHE A;  4KVM E;  3MGD A;  2Q44 A;  2P6F A;  5F46 A;  1MJ9 A;  1KUX A;  3D3S A;  4PSW A;  5C88 A;  1Y9K A;  4M85 A;  3R95 A;  2ZPA A;  2B58 A;  4JXQ A;  4QVT A;  2P6E A;  3BJ8 A;  3RYO A;  2B4D B;  1NMT A;  4NEX A;  1Z4R A;  3D2P A;  1IID A;  4U5Y A;  1I21 A;  2Z0Z A;  3P2F A;  3UY5 A;  1IIC A;  4DNC A;  3OWC A;  2NMT A;  1I12 A;  4KOR A;  4QUS A;  3ZZI A;  4JLY A;  2ZXV A;  2OZH A;  3W6S A;  1RXT A;  5IV0 A;  4KOV A;  1QSR A;  4UBR A;  5DWM A;  4LX9 A;  3F0A A;  2REE A;  4KOT A;  3I9S A;  5KTD A;  3KKW A;  2VI7 A;  3BLN A;  4KOX A;  4B5O A;  1QSO A;  2AJ6 A;  1WWZ A;  3I3G A;  3CXP A;  4H89 A;  2Q04 A;  3B8G A;  2Q7B A;  1M44 A;  1M4I A;  3DR8 A;  4CAX A;  4XPD C;  2ZW6 A;  4OAE A;  2FIA A;  2R8V A;  1XMT A;  5EC4 A;  2OZG A;  1PU9 A;  4E2A A;  4UA3 A;  4Y49 B;  4HNY B;  3H4Q A;  3TE4 A;  2Q0Y A;  4UWI A;  3T9Y A;  5JPH A;  3SXO A;  4CAV A;  1S7F A;  2B4D A;  1KUY A;  2VBQ A;  3R9F A;  4RI1 A;  1S60 A;  2P0W A;  2PR8 A;  5J8C A;  2FXF A;  3PZJ A;  4CRZ B;  3PP9 A;  4UWJ A;  2PR1 A;  4HNW B;  4XNH B;  2H5M A;  3TFY A;  1B6B A;  2DXQ A;  3GYA A;  2PC1 A;  3F5B A;  2CNT A;  4KOU A;  2K5T A;  2C27 A;  2EUI A;  3EXN A;  3N7Z A;  3S6F A;  4YFJ A;  2PSW A;  2CNS A;  4R57 A;  1IYK A;  5F48 A;  1KZF A;  4E0A A;  3TO6 A;  2FL4 A;  3G3S A;  1VHS A;  2G0B A;  2KCW A;  2G3A A;  4XPK A;  1LRZ A;  5KTA A;  2BEI A;  2JLM A;  3EY5 A;  3TOB A;  1QSN A;  4AG9 A;  2I00 A;  4JWP A;  3TTH A;  2D4P A;  3VWE A;  1XE4 A;  4NSQ A;  3K9U A;  1XEB A;  4II9 A;  4AVA A;  4B5P B;  4JD6 A;  4U9Y A;  2VZZ A;  2REF A;  3E0K A;  5I0C A;  4M3S A;  1Q2Y A;  5CNP A;  3QB8 A;  1Z4E A;  3D8P A;  4R3L A;  5IB0 A;  1CJW A;  3EC4 A;  2Z10 A;  1SQH A;  4CS0 B;  2B3V A;  4NCZ A;  2ATR A;  1Q2D A;  3PGP A;  1YR0 A;  1P0H A;  1Q2C A;  2CNM A;  4H6Z A;  2EVN A;  1NE9 A;  4QB9 A;  4AB7 A;  4R9M A;  1VKC A;  5H84 A;  1IB1 E;  2B5G B;  2ZW4 A;  1I1D A;  2BSW A;  3GKR A;  4YRH A;  1XF8 A;  3F8K A;  3R9E A;  1ON0 A;  4MBU A;  3WR7 A;  2IL4 A;  3P2H A;  5DWN A;  2ZW5 A;  3R96 A;  2GIV A;  5FVJ A;  4J3G A;  4ORF A;  5ISV A;  4MY0 A; 
#chains in the Genus database with same CATH topology
 2F5I A;  3KHZ A;  4PV6 A;  1HDU A;  3D66 A;  2GFQ A;  4KLV A;  1R57 A;  2O28 A;  3TO7 A;  2AFZ A;  4MI4 A;  3FVL A;  5LRJ A;  4C7H A;  4IUS A;  1QMU A;  2O4H A;  2R98 A;  1Y7R A;  1ZLH A;  2P6G A;  4ZY2 A;  3S6H A;  1XRY A;  2XEG A;  1AYE A;  4F6A A;  1ZLI A;  2AFO A;  5G20 A;  5C82 A;  2J8R A;  3GUX A;  4RS2 A;  2V8D A;  1QST A;  3DLJ A;  5LRK A;  4A39 A;  3W6X A;  2V8V A;  4FD6 A;  4CAF A;  4F8Z A;  3WC7 A;  3PB9 X;  2PJA A;  1IOF A;  4A31 A;  4L89 A;  5D8N A;  3TT2 A;  1N71 A;  1Z2L A;  4Z65 A;  2G3T A;  4PXC A;  3B35 A;  1CM0 A;  2QML A;  5HVG A;  4MY3 A;  5HMN A;  3ISX A;  3IIB A;  2V8G A;  4L8A A;  3TOA A;  2CY2 A;  4GS4 A;  3PRT A;  2V77 A;  2WPX A;  3S9N A;  1L0C A;  2GAN A;  4UIA A;  1P4N A;  1R43 A;  3QAH A;  4M6G A;  4AVB A;  1EE3 P;  1YK3 A;  3D2M A;  2EK9 A;  4NJQ A;  4NF1 A;  4M6I A;  2AFS A;  2A4N A;  2XEI A;  5A27 A;  3SJG A;  3IC1 A;  4CYN A;  4FD7 A;  1S7K A;  1R3N A;  3HUV A;  3D7F A;  3EO4 A;  4QBJ A;  4FBE A;  2B4B A;  1NSA A;  2CF4 A;  4KVO E;  4XPL A;  1YLE A;  4YGO A;  4B6Z A;  1YW4 A;  2G9D A;  4YWY A;  2OB0 A;  1PUA A;  1VIX A;  2EWB A;  2VZY A;  4MMO A;  1ZG7 A;  2Z3L A;  4MFK A;  2FS5 A;  1IYL A;  3JUW A;  1MJB A;  3IWG A;  1BO4 A;  3IEH A;  4BMH A;  4CAE A;  3N5F A;  1DTD A;  3NE7 A;  2JDC A;  2RC4 A;  3A9L A;  2FSR A;  4MCQ A;  3PB8 X;  5G21 A;  3PBB A;  3G8W A;  3ZJ0 A;  3FJU A;  2WZN A;  4JXR A;  5E96 A;  1CP7 A;  2GLJ A;  4KUA A;  4MFL A;  4R3K A;  1LAM A;  3V8I A;  5CBM A;  2J8M A;  5EBV A;  2ZW7 A;  5CPA A;  2BUE A;  3FB3 A;  4MFZ A;  2WSA A;  1CG2 A;  2B3U A;  5F47 A;  2Q4Z A;  4EVY A;  4F9V A;  2Z3K A;  3FIX A;  3GY9 A;  1M4D A;  2HQY A;  4B11 A;  1F2P A;  4KOY A;  1M4L A;  2YNC A;  1JWQ A;  4H6U A;  4IAV A;  4JZ0 A;  4F0X A;  5J1Q A;  1OZP A;  2GRE A;  4G1P A;  4KOS A;  5H86 A;  5I4M A;  2Z3O A;  2JEV A;  4HKF A;  4A95 A;  2GE3 A;  4A30 A;  5F49 A;  3LD2 A;  2FE7 A;  3KQX A;  4I49 A;  4K30 A;  4P4J A;  3TCV A;  1QSM A;  2DEA A;  3LOD A;  4ZBG A;  1J4J A;  1YGH A;  2ZED A;  4C68 A;  1RO5 A;  3CDX A;  5D29 A;  2OU2 A;  2QEC A;  2Q7S A;  3FED A;  3FX6 A;  5J8F A;  1LAN A;  4BD9 A;  2PVV A;  5LYI A;  3EFA A;  2D4O A;  1XBU A;  3KR5 A;  1YRE A;  2FCK A;  2PRB A;  4ZY1 A;  2VQY A;  4NGT A;  2ZEG A;  4A37 A;  5THW A;  4ZX9 A;  1FT7 A;  2F8H A;  4XPD B;  2NYQ A;  4EWT A;  1S5K A;  2QVP A;  5JGF A;  3PB6 X;  4B12 A;  3DGV A;  4LUA A;  4Q36 A;  1LOK A;  1XJO A;  2PDO A;  3FBU A;  3JVN A;  3KL9 A;  4MHN A;  4MHY A;  3C26 A;  4PK3 A;  4OP4 A;  2C6G A;  2JDD A;  2FT0 A;  4HPS A;  4KVX A;  3SJF A;  4F9U A;  3IGR A;  1FNO A;  4W9Y A;  4UEF A;  1IY7 A;  4OC5 A;  5G22 A;  3R9G A;  5HH1 A;  2OH1 A;  2I79 A;  4ZI6 A;  4Q7A A;  5GCN A;  1S7L A;  1XOV A;  4ZYQ A;  2PJ3 A;  3FYN A;  2QIR A;  4M6H A;  3SJE A;  4EME A;  3ISZ A;  4MHD A;  2PVW A;  4UCN A;  1BLL E;  4P44 A;  1TIQ A;  4FUU A;  3SJX A;  1M4G A;  2Z3M A;  1V0C A;  1YVO A;  1TF8 A;  1PYT B;  3SI2 A;  3KZW A;  1MK4 A;  4P4B A;  3D7H A;  3JTK A;  4PQA A;  4NGP A;  2Z11 A;  3R1K A;  3NH4 A;  2FIW A;  4AG7 A;  4B5P A;  5IB9 A;  1K4J A;  1FY7 A;  4OC4 A;  1YVK A;  2ZOG A;  2RFH A;  2OR4 A;  3B7I A;  2ARH A;  4X5K A;  1UFH A;  5LRG A;  1BOB A;  2X7B A;  2HV2 A;  1NSL A;  1Z5R A;  3QNV A;  4P6Y A;  2J8N A;  4MCS A;  1ZG8 A;  4NGN A;  1RTQ A;  3S9M A;  4ZY0 A;  4C7I A;  5AG7 A;  1Q7L A;  4CRY B;  2Q4Y A;  2BL1 A;  1S7N A;  4UIB A;  5A28 A;  4KUB A;  1AUG A;  2ANP A;  1HDQ A;  2AE6 A;  5KTC A;  4KSF A;  4FD4 A;  5IX3 A;  4MFP A;  4NXY A;  4UEE A;  5AG4 A;  1ARL A;  2PJ0 A;  3CXS A;  1ZG9 A;  1IU8 A;  5HVF A;  3FRM A;  3B3C A;  1BAV A;  1DE4 C;  1MJA A;  4GXH A;  4IK2 A;  2Q4V A;  2R7H A;  4QC6 A;  3T8W A;  3TO9 A;  1YQE A;  3SHP A;  4DUK A;  5K8M A;  4BBH A;  2WPW A;  5HXD A;  2IQ6 A;  2B5G A;  2OZU A;  4FD5 A;  4Y49 C;  4OLL A;  5AGE A;  5DS0 A;  2DPT A;  3FNC A;  3FXT A;  3NE8 A;  2PJB A;  4MHP A;  2PQ8 A;  3IO1 A;  3S6G A;  5AG6 A;  1KUV A;  4YU9 A;  3GIU A;  5AG5 A;  3VAR A;  2EO8 A;  1M1D A;  2PJ2 A;  4PSX A;  3H8E A;  2PIZ A;  2HUZ A;  3DSB A;  4IF5 A;  3IU1 A;  5JQ4 A;  4P10 A;  1Y9W A;  2YNE A;  1Z8W A;  2R1I A;  4KLW A;  3DNS A;  2C6C A;  4F0Y A;  4MJ8 A;  2VXK A;  3BJ7 A;  4R8F A;  4R76 A;  3DR6 A;  2O53 A;  3TX8 A;  4A33 A;  4FAI A;  4AVC A;  4OAD A;  4ONU A;  1ELL P;  1QQ9 A;  2VEZ A;  1S3Z A;  1WK4 A;  3CXQ A;  4EFD A;  3SXN A;  4CYQ A;  1AMP A;  5HVH A;  4JJX A;  2YNC C;  6CPA A;  3W91 A;  8CPA A;  3VWD A;  4B10 A;  4OC2 A;  4XNH C;  4E8O A;  4OID A;  4U9Z A;  2EBJ A;  4R87 A;  3BI0 A;  4CAW A;  4A32 A;  1B87 A;  3T90 A;  1IOI A;  2AFX A;  2PRQ A;  2QYV A;  4CGM A;  3DDD A;  3K9T A;  1YX0 A;  3H5Z A;  4CGL A;  4PXB A;  4KZT A;  1YSJ A;  4HNX B;  1YLO A;  4MHZ A;  4KSI A;  2ABZ A;  4X8I A;  4PK2 A;  2DF5 A;  1XIX A;  2Y0M A;  4KOW A;  4C2Y A;  2J9A A;  3S6K A;  2GU2 A;  1U6M A;  1Z9U A;  1GHE A;  4KVM E;  3MGD A;  2Q44 A;  1TXR A;  1Z8X A;  3CT9 A;  4UCP A;  2P6F A;  4RUH A;  1CP6 A;  5F46 A;  4C2X A;  4P4E A;  3WT4 A;  3IJ3 A;  1MJ9 A;  1PCA A;  1KUX A;  4WWV A;  1TF9 A;  3B3V A;  3D3S A;  1TKJ A;  4PSW A;  5C88 A;  4MCR A;  1Y9K A;  4M85 A;  4Q38 A;  4NJR A;  3R95 A;  2ZPA A;  2B58 A;  2Q43 A;  3FMC A;  5BWA B;  2FVG A;  4JXQ A;  2JBK A;  4OC0 A;  2PJ8 A;  3PB7 X;  1H8L A;  4CGN A;  2OOT A;  4QVT A;  2ZEP A;  3PFO A;  2P6E A;  3BJ8 A;  2ZEN A;  3RYO A;  2B4D B;  1NMT A;  4CPA A;  2XEF A;  4OC3 A;  3VAT A;  3WC5 A;  4NEX A;  1Z4R A;  3D2P A;  1IID A;  4U5Y A;  1XMB A;  2CIJ A;  3CPX A;  4ZGY B;  2Z3N A;  1I21 A;  4KS9 A;  2Z0Z A;  3FF3 A;  3P2F A;  4WJB A;  1IIC A;  3UY5 A;  1Y0R A;  4DNC A;  4X3R A;  4A2Z A;  1Z8L A;  5JM6 A;  3OWC A;  4C2Z A;  3L2N A;  1X12 A;  2NMT A;  4OME A;  1I12 A;  4KOR A;  1Y0Y A;  4QUS A;  2HB6 A;  2PJ4 A;  3ZZI A;  1LCP A;  3PFE A;  4JLY A;  2ZXV A;  2OZH A;  3S9L A;  3W6S A;  1RXT A;  4UFX A;  4GM5 A;  5IV0 A;  3V7Z A;  5ELY A;  2C1C A;  1QSR A;  2Z3P A;  4KOV A;  4LX9 A;  4UBR A;  5DWM A;  4DJL A;  1LFW A;  3F0A A;  1Z8T A;  2REE A;  4OIW A;  4KOT A;  3I9S A;  5KTD A;  3KKW A;  2VI7 A;  1YME A;  3WC6 A;  3BLN A;  4KOX A;  2QJ8 A;  4B5O A;  3KHX A;  1QSO A;  2AJ6 A;  3BXM A;  1WWZ A;  3HLP A;  3I3G A;  1CBX A;  3CXP A;  3SI0 A;  4H89 A;  5LYD A;  2Q04 A;  2Q51 A;  4B14 A;  2WYR A;  3B8G A;  2Q7B A;  2F7V A;  1M44 A;  4MXU A;  1M4I A;  3DR8 A;  4PPZ A;  4CAX A;  2XEJ A;  1TKH A;  1HEE A;  3MRU A;  2DPS A;  3KAS A;  4XPD C;  2PJC A;  2HC9 A;  2ZW6 A;  4OAE A;  3RO0 A;  3RBU A;  3QAY A;  2FIA A;  2R8V A;  1XMT A;  5EC4 A;  2PJ6 A;  2PE3 A;  2OZG A;  4UFW A;  1PU9 A;  4CYP A;  4JYW A;  4E2A A;  1IGB A;  3IU2 A;  4UA3 A;  2YGW A;  4Y49 B;  4HNY B;  3H4Q A;  3TE4 A;  1CPX A;  2Q0Y A;  4H2K A;  2ZEH A;  3RNZ A;  4UWI A;  3T9Y A;  5JPH A;  3H8G A;  2PJ1 A;  3SXO A;  4CAV A;  1S7F A;  2B4D A;  2RB7 A;  1KUY A;  1ARM A;  2VBQ A;  1YW6 A;  3R9F A;  1A2Z A;  3KI9 A;  4RI1 A;  1S60 A;  2POK A;  2AFW A;  2P0W A;  4MCP A;  3SI1 A;  3V38 A;  2PR8 A;  4NGS A;  5J8C A;  2FXF A;  4UCM A;  5K8N A;  2VL1 A;  3PZJ A;  4CRZ B;  1OBR A;  3PP9 A;  4UWJ A;  1TKF A;  2PR1 A;  3LWU A;  1F2O A;  4HNW B;  4XNH B;  4A94 A;  3K2K A;  3NH5 A;  4NGQ A;  2H5M A;  3LAC A;  3TFY A;  4LQ6 A;  1XFO A;  1B6B A;  2DXQ A;  4AXV A;  5EMI A;  3GYA A;  1KWM A;  2PC1 A;  3F5B A;  1UWY A;  3LMS A;  2CNT A;  4KOU A;  3NA6 A;  1F57 A;  2K5T A;  3D7G A;  2ZEO A;  2C27 A;  2EUI A;  3EXN A;  4RN7 A;  3N7Z A;  3S6F A;  3VH9 A;  1Y7E A;  3TC8 A;  2PSW A;  3FH4 A;  4YFJ A;  2CNS A;  4R57 A;  2CTC A;  1IYK A;  2I3C A;  3B3S A;  3PEI A;  2ZEF A;  5F48 A;  1X10 A;  1CPS A;  3B3W A;  1KZF A;  3B2Y A;  4E0A A;  2C6P A;  5JH9 A;  3CZX A;  2BOA A;  3TO6 A;  2FL4 A;  3G3S A;  1VHS A;  2G0B A;  2KCW A;  2G3A A;  4XPK A;  1LRZ A;  1CX8 A;  5KTA A;  2BEI A;  4P4D A;  3NFZ A;  2JLM A;  2PJ5 A;  1JQG A;  3EY5 A;  3TOB A;  1QSN A;  2YND A;  3IFE A;  4P4F A;  4AG9 A;  4MFJ A;  2I00 A;  3BI1 A;  2NSM A;  4PXE A;  4JWP A;  5G1Z A;  4CGP A;  4P4I A;  3TTH A;  2ZOF A;  3NH8 A;  2D4P A;  3VWE A;  3BHX A;  1XE4 A;  4NSQ A;  4B13 A;  3K9U A;  1XEB A;  4II9 A;  2JEW A;  4OC1 A;  4BIN A;  1LAP A;  4TNU A;  3KQZ A;  4A38 A;  3IWW A;  4AVA A;  4B5P B;  2EK8 A;  4JD6 A;  2IJZ A;  3FEC A;  4U9Y A;  2BO9 A;  2VZZ A;  4OKO A;  3PBE A;  2PJ7 A;  2REF A;  2IMO A;  3E0K A;  4M3S A;  4NFR A;  5I0C A;  1Q2Y A;  2BCO A;  3GLJ A;  4P45 A;  4PXD A;  5CNP A;  4DYO A;  5F09 A;  2CXA A;  3QB8 A;  1Z4E A;  1VHE A;  3KGQ A;  3D8P A;  4R3L A;  5IB0 A;  1CJW A;  3EC4 A;  2Z10 A;  1SQH A;  4CS0 B;  5LYF A;  2B3V A;  4CGO A;  2V8H A;  3GB0 A;  3B3T A;  4NCZ A;  2PIY A;  4NGM A;  2ATR A;  1Q2D A;  4ZX8 A;  3JRU A;  5K8O A;  3PGP A;  1YR0 A;  4MFQ A;  4R6T A;  1P0H A;  1Q2C A;  2CNM A;  1GYT A;  2EVN A;  4H6Z A;  3RAM A;  4UFV A;  1NE9 A;  2ZEL A;  3D68 A;  3D67 A;  4TWE A;  5K8P A;  4QB9 A;  4AB7 A;  2AFU A;  4NGR A;  1VGY A;  1VKC A;  4R9M A;  4UEZ A;  4CYO A;  5H84 A;  4ONW A;  7CPA A;  1IB1 E;  3CPA A;  3PB4 X;  2B5G B;  2ODF A;  1ELM P;  2ZW4 A;  4X2T A;  3H8F A;  1VHO A;  5LYL A;  1I1D A;  2BSW A;  2WUU A;  3GKR A;  2PJ9 A;  1XF8 A;  4O23 A;  4YRH A;  3F8K A;  3R9E A;  1ON0 A;  3FEE A;  3I1U A;  2ZEE A;  4MBU A;  3WR7 A;  2IL4 A;  3P2H A;  2CTB A;  2GLF A;  4IHM A;  2ZW5 A;  3D4U A;  4KSA A;  5DWN A;  3D7D A;  1BPN A;  1BPM A;  3MN8 A;  4LQG A;  2GIV A;  4UF4 A;  3R96 A;  1ZO0 A;  5FVJ A;  4J3G A;  2AFM A;  4MRI A;  2JBJ A;  4K3N A;  2ZEM A;  4FWU A;  3WAB A;  3KR4 A;  2PCU A;  3IWE A;  4R7M A;  4ORF A;  5ISV A;  4MY0 A;  3RZA A; 
#chains in the Genus database with same CATH homology
 2F5I A;  4PV6 A;  4KLV A;  1R57 A;  2O28 A;  3TO7 A;  4MI4 A;  4C7H A;  4IUS A;  2R98 A;  1Y7R A;  2P6G A;  3S6H A;  4F6A A;  5C82 A;  5G20 A;  2J8R A;  4RS2 A;  1QST A;  3W6X A;  4CAF A;  4FD6 A;  4A31 A;  4L89 A;  3TT2 A;  1N71 A;  2G3T A;  1CM0 A;  2QML A;  4MY3 A;  5HMN A;  4L8A A;  3TOA A;  2CY2 A;  4GS4 A;  2WPX A;  1L0C A;  2GAN A;  1P4N A;  4AVB A;  3QAH A;  1YK3 A;  3D2M A;  4NF1 A;  2A4N A;  5A27 A;  4CYN A;  4FD7 A;  1S7K A;  3EO4 A;  4QBJ A;  2B4B A;  4KVO E;  4XPL A;  1YLE A;  4YGO A;  1PUA A;  2OB0 A;  2VZY A;  2Z3L A;  4MFK A;  2FS5 A;  1IYL A;  3JUW A;  1MJB A;  3IWG A;  1BO4 A;  4BMH A;  4CAE A;  3NE7 A;  2JDC A;  2RC4 A;  3A9L A;  2FSR A;  5G21 A;  3G8W A;  3ZJ0 A;  4JXR A;  5E96 A;  4KUA A;  4MFL A;  4R3K A;  3V8I A;  2J8M A;  5EBV A;  2ZW7 A;  2BUE A;  3FB3 A;  4MFZ A;  2WSA A;  2B3U A;  5F47 A;  4EVY A;  2Z3K A;  3FIX A;  3GY9 A;  1M4D A;  2HQY A;  4B11 A;  4KOY A;  2YNC A;  4H6U A;  4F0X A;  1OZP A;  4KOS A;  5H86 A;  2Z3O A;  2JEV A;  4HKF A;  4A95 A;  2GE3 A;  4A30 A;  5F49 A;  3LD2 A;  2FE7 A;  4I49 A;  3TCV A;  4K30 A;  1QSM A;  3LOD A;  4ZBG A;  1J4J A;  1YGH A;  4C68 A;  1RO5 A;  2OU2 A;  2QEC A;  5J8F A;  3EFA A;  2D4O A;  1YRE A;  2FCK A;  2PRB A;  2VQY A;  4XPD B;  1S5K A;  4B12 A;  4LUA A;  4Q36 A;  4PK3 A;  3FBU A;  2PDO A;  3JVN A;  3C26 A;  2JDD A;  2FT0 A;  4KVX A;  3IGR A;  5G22 A;  3R9G A;  5HH1 A;  2OH1 A;  2I79 A;  5GCN A;  1S7L A;  3FYN A;  2QIR A;  4MHD A;  4UCN A;  1TIQ A;  1M4G A;  2Z3M A;  1V0C A;  1YVO A;  1MK4 A;  3JTK A;  2Z11 A;  3R1K A;  2FIW A;  4AG7 A;  4B5P A;  1K4J A;  1FY7 A;  1YVK A;  2ARH A;  4X5K A;  1UFH A;  1BOB A;  2X7B A;  2HV2 A;  1NSL A;  2J8N A;  4C7I A;  5AG7 A;  4CRY B;  2Q4Y A;  2BL1 A;  1S7N A;  5A28 A;  4KUB A;  2AE6 A;  5KTC A;  4KSF A;  4FD4 A;  5IX3 A;  4MFP A;  4NXY A;  5AG4 A;  3CXS A;  3FRM A;  1MJA A;  3TO9 A;  4QC6 A;  2Q4V A;  2R7H A;  3SHP A;  4BBH A;  2WPW A;  2B5G A;  2OZU A;  4FD5 A;  4Y49 C;  4OLL A;  5AGE A;  2DPT A;  3FNC A;  3FXT A;  2PQ8 A;  3S6G A;  5AG6 A;  1KUV A;  5AG5 A;  1M1D A;  4PSX A;  2HUZ A;  3DSB A;  4IF5 A;  3IU1 A;  5JQ4 A;  1Y9W A;  2YNE A;  2R1I A;  4KLW A;  3DNS A;  4F0Y A;  4MJ8 A;  2VXK A;  3BJ7 A;  3DR6 A;  4A33 A;  4AVC A;  4OAD A;  4ONU A;  3CXQ A;  2VEZ A;  1S3Z A;  1WK4 A;  3SXN A;  4CYQ A;  4JJX A;  2YNC C;  3W91 A;  3VWD A;  4B10 A;  4XNH C;  4E8O A;  4U9Z A;  4R87 A;  4CAW A;  4A32 A;  1B87 A;  3T90 A;  4CGM A;  3DDD A;  4CGL A;  1YX0 A;  3H5Z A;  4KZT A;  4HNX B;  4PK2 A;  1XIX A;  2Y0M A;  4KOW A;  4C2Y A;  3S6K A;  1U6M A;  1Z9U A;  1GHE A;  4KVM E;  3MGD A;  2Q44 A;  4UCP A;  2P6F A;  5F46 A;  4C2X A;  1MJ9 A;  1KUX A;  3D3S A;  4PSW A;  5C88 A;  1Y9K A;  4M85 A;  4Q38 A;  3R95 A;  2ZPA A;  2B58 A;  5BWA B;  4JXQ A;  4CGN A;  4QVT A;  2P6E A;  3BJ8 A;  3RYO A;  2B4D B;  1NMT A;  4NEX A;  1Z4R A;  3D2P A;  1IID A;  4U5Y A;  4ZGY B;  2Z3N A;  1I21 A;  4KS9 A;  2Z0Z A;  3P2F A;  3UY5 A;  1IIC A;  4DNC A;  4A2Z A;  3OWC A;  4C2Z A;  2NMT A;  1I12 A;  4KOR A;  4QUS A;  3ZZI A;  4JLY A;  2ZXV A;  2OZH A;  3W6S A;  1RXT A;  4UFX A;  5IV0 A;  4KOV A;  1QSR A;  2Z3P A;  4UBR A;  4LX9 A;  5DWM A;  3F0A A;  2REE A;  4KOT A;  3I9S A;  5KTD A;  3KKW A;  2VI7 A;  3BLN A;  4KOX A;  4B5O A;  1QSO A;  2AJ6 A;  1WWZ A;  3I3G A;  3CXP A;  4H89 A;  2Q04 A;  4B14 A;  3B8G A;  2Q7B A;  1M44 A;  1M4I A;  3DR8 A;  4CAX A;  2DPS A;  4XPD C;  2ZW6 A;  4OAE A;  2FIA A;  2R8V A;  1XMT A;  5EC4 A;  2OZG A;  4UFW A;  1PU9 A;  4CYP A;  4E2A A;  3IU2 A;  4UA3 A;  2YGW A;  4Y49 B;  4HNY B;  3H4Q A;  3TE4 A;  2Q0Y A;  4UWI A;  3T9Y A;  5JPH A;  3SXO A;  4CAV A;  1S7F A;  2B4D A;  1KUY A;  2VBQ A;  3R9F A;  4RI1 A;  1S60 A;  2P0W A;  2PR8 A;  5J8C A;  2FXF A;  4UCM A;  3PZJ A;  4CRZ B;  3PP9 A;  4UWJ A;  2PR1 A;  4HNW B;  4XNH B;  2H5M A;  3TFY A;  1B6B A;  2DXQ A;  3GYA A;  2PC1 A;  3F5B A;  2CNT A;  4KOU A;  2K5T A;  2C27 A;  2EUI A;  3EXN A;  3N7Z A;  3S6F A;  4YFJ A;  2PSW A;  2CNS A;  4R57 A;  1IYK A;  5F48 A;  1KZF A;  4E0A A;  3TO6 A;  2FL4 A;  3G3S A;  1VHS A;  2G0B A;  2KCW A;  2G3A A;  4XPK A;  1LRZ A;  5KTA A;  2BEI A;  2JLM A;  3EY5 A;  3TOB A;  1QSN A;  2YND A;  4AG9 A;  4MFJ A;  2I00 A;  4JWP A;  5G1Z A;  4CGP A;  3TTH A;  2D4P A;  3VWE A;  1XE4 A;  4NSQ A;  4B13 A;  3K9U A;  1XEB A;  4II9 A;  4AVA A;  4B5P B;  4JD6 A;  4U9Y A;  2VZZ A;  2REF A;  3E0K A;  5I0C A;  4M3S A;  1Q2Y A;  5CNP A;  2CXA A;  3QB8 A;  1Z4E A;  3D8P A;  4R3L A;  5IB0 A;  1CJW A;  3EC4 A;  2Z10 A;  1SQH A;  4CS0 B;  2B3V A;  4CGO A;  4NCZ A;  2ATR A;  1Q2D A;  3PGP A;  1YR0 A;  4MFQ A;  1P0H A;  1Q2C A;  2CNM A;  4H6Z A;  2EVN A;  4UFV A;  1NE9 A;  4QB9 A;  4AB7 A;  4R9M A;  1VKC A;  4CYO A;  5H84 A;  1IB1 E;  2B5G B;  2ZW4 A;  1I1D A;  2BSW A;  2WUU A;  3GKR A;  4YRH A;  1XF8 A;  3F8K A;  3R9E A;  1ON0 A;  4MBU A;  3WR7 A;  2IL4 A;  3P2H A;  5DWN A;  2ZW5 A;  4KSA A;  3R96 A;  2GIV A;  1ZO0 A;  5FVJ A;  4J3G A;  3IWE A;  4ORF A;  5ISV A;  4MY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...