2JEVA

Crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
169
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIAMINE ACETYLTRANSFERASE 1
publication title Mechanistic and Structural Analysis of Human Spermidine/Spermine N(1)-Acetyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jevA00
2WPWA 3I3GA 2G3AA 3WR7A 4KVXA 1Z4EA 2P6FA 2AE6A 2JDDA 4NCZA 5EC4A 1K4JA 4MJ8A 5KTDA 4KOVA 3TOBA 3FRMA 3GYAA 1MJBA 3QB8A 4UWIA 1N71A 1UFHA 4F6AA 2Z11A 3W91A 4ORFA 1YGHA 1CM0A 1M1DA 4MY0A 3BJ7A 1QSTA 2VEZA 2AJ6A 4OLLA 2G3TA 1KZFA 4MI4A 4E8OA 3P2FA 1XEBA 2EUIA 4MHDA 3D8PA 2FL4A 4RI1A 4AVCA 5JQ4A 4AVBA 4UA3A 5F49A 4OAEA 1IIDA 2I00A 5CNPA 4M85A 2P0WA 5JPHA 1IYKA 2B5GB 2HUZA 4LX9A 4KOTA 3PZJA 3FYNA 4CAWA 2PC1A 3ZJ0A 1XE4A 2OZUA 2PQ8A 4LUAA 5DWNA 4XPLA 4U9ZA 3IWGA 4I49A 2CNTA 3GKRA 3IGRA 1KUVA 1YVOA 3F8KA 3G3SA 3D2PA 3NE7A 2D4OA 4YRHA 2PDOA 2QIRA 2FSRA 4NXYA 4QB9A 2RC4A 4RS2A 2VZYA 1SQHA 5H86A 3W6XA 4R3LA 2NMTA 4L8AA 1ON0A 1B6BA 4HNXB 4HNWB 4QBJA 4PK2A 4Y49B 2OZGA 5I0CA 4J3GA 1QSMA 4PV6A 1J4JA 2VZZA 3R95A 3R1KA 2ZW4A 1PUAA 2R1IA 3OWCA 4NSQA 4AB7A 1IYLA 2ATRA 4II9A 4KVME 1CJWA 4CAXA 3FBUA 2HQYA 5EBVA 2EVNA 2BUEA 2VI7A 1M4GA 4KORA 3G8WA 2REEA 4MY3A 4YFJA 1WWZA 2CNMA 2PSWA 1Q2DA 3TT2A 2ZW6A 1TIQA 1Y9WA 2K5TA 4H6ZA 2ZPAA 1YVKA 3SXOA 5C88A 1IB1E 3W6SA 1YR0A 1WK4A 1YK3A 3C26A 2R7HA 4BMHA 2J8RA 3R9EA 1NMTA 1VKCA 1S5KA 2VXKA 4Y49C 1V0CA 5IB0A 5E96A 3PGPA 4XPDB 4KOUA 1P4NA 4JXRA 2GE3A 1S3ZA 2JLMA 5F48A 4CS0B 3I9SA 4FD7A 3EO4A 3V8IA 3N7ZA 2Q04A 2B3VA 2QMLA 2B4BA 3D2MA 1KUXA 4PSXA 3TOAA 2FT0A 2VQYA 4KZTA 4M3SA 2I79A 3DR6A 3DDDA 1MJ9A 2OU2A 4UBRA 5DWMA 3BLNA 4ONUA 2FXFA 2GANA 3UY5A 4KOYA 5HMNA 4QVTA 3SXNA 2D4PA 1S7FA 3ZZIA 4JWPA 4FD5A 2REFA 4JLYA 3TFYA 2OZHA 2FCKA 4KOXA 4NF1A 4XPDC 1U6MA 4IUSA 1BOBA 4R9MA 1NE9A 1YLEA 1YREA 4KVOE 4R57A 3GY9A 4CRZB 4JJXA 1Q2CA 2X7BA 3FIXA 4PK3A 4CAVA 5F46A 1M4IA 3DSBA 4R3KA 2B4DA 1Z9UA 2Z0ZA 4R87A 3LD2A 1VHSA 5KTAA 2H5MA 2PRBA 2WPXA 2B3UA 2J8NA 1QSOA 4FD6A 1P0HA 2VBQA 1OZPA 4E0AA 3T9YA 4JD6A 1S7NA 3R9GA 4QC6A 1NSLA 3P2HA 3S6FA 3KKWA 2G0BA 1MJAA 2F5IA 4KLWA 3CXSA 3FNCA 2FIWA 4EVYA 5HH1A 2J8MA 1XIXA 2A4NA 3S6HA 4CRYB 1LRZA 4HKFA 1Y7RA 3TO7A 2DXQA 3FB3A 3DR8A 4QUSA 4XPKA 3T90A 3BJ8A 3EFAA 1Q2YA 1I21A 1QSRA 1Z4RA 4JXQA 2P6EA 4ZBGA 1RXTA 2OB0A 3R96A 4AG9A 1L0CA 3TCVA 4KOSA 3F0AA 4AG7A 3S6GA 2B4DB 3PP9A 2Q7BA 1RO5A 5IV0A 2P6GA 1XMTA 1IICA 3JVNA 3DNSA 2HV2A 3H4QA 4X5KA 1B87A 3TO9A 2FS5A 3E0KA 4L89A 4E2AA 2Y0MA 4U9YA 2C27A 4IF5A 2PR1A 2QECA 3S6KA 3TE4A 1PU9A 2BL1A 3B8GA 4B5PA 2CNSA 4XNHB 3EC4A 1S7LA 3EXNA 3VWDA 2R98A 3D3SA 2ZW5A 1QSNA 4KUBA 4B5OA 3JUWA 5H84A 2O28A 1XF8A 4NEXA 3RYOA 5IX3A 5J8FA 1FY7A 3CXPA 1S7KA 5J8CA 2ZXVA 4F0YA 3LODA 3TO6A 3FXTA 4DNCA 4H6UA 4H89A 4PSWA 4AVAA 2Q44A 3MGDA 2FIAA 2R8VA 1M4DA 2CY2A 2OH1A 2ZW7A 2Q0YA 1M44A 2ARHA 4KUAA 3SHPA 3F5BA 4K30A 3TTHA 1MK4A 2PR8A 2Z10A 4MBUA 2FE7A 2IL4A 4OADA 4XNHC 2JDCA 4YGOA 2KCWA 2B58A 4UWJA 5ISVA 5C82A 4FD4A 2Q4YA 1GHEA 2B5GA 1I12A 1YX0A 4KLVA 3R9FA 4U5YA 4B5PB 5GCNA 1BO4A 1KUYA 4GS4A 2GIVA 2BSWA 3EY5A 1R57A 1I1DA 4KOWA 2Q4VA 5KTCA 3VWEA 1S60A 4HNYB 2JEVA 3CXQA 3K9UA 1Y9KA 2BEIA 3QAHA 5F47A 5FVJA
chains in the Genus database with same CATH superfamily
2WPWA 4CGLA 4MCSA 4X8IA 3I3GA 4CGNA 2G3AA 1XFOA 2XEGA 2J9AA 3WR7A 3JTKA 4KVXA 1Z4EA 2P6FA 2AE6A 2JDDA 3PB8X 4NCZA 5EC4A 1K4JA 1YQEA 2QYVA 4MJ8A 3HUVA 5KTDA 4BINA 3WT4A 4UCNA 4KOVA 2ZEPA 3TOBA 2PJ8A 3FRMA 4YU9A 2DF5A 3GYAA 1ZG9A 3H8GA 1UWYA 1MJBA 4OMEA 3QB8A 4UWIA 1N71A 1UFHA 4F6AA 2Z11A 3W91A 4ORFA 4NJQA 4UEFA 1YGHA 3BHXA 2V8VA 1CM0A 1M1DA 4MY0A 5LYDA 3BJ7A 1HEEA 1QSTA 2VEZA 2NSMA 1ELMP 2AJ6A 4OLLA 2G3TA 3IEHA 1KZFA 4LQ6A 3GIUA 4MI4A 4E8OA 4C68A 4NFRA 3P2FA 1XEBA 2EUIA 4MHDA 3WC5A 1NSAA 1Z8LA 3D8PA 1BAVA 2FL4A 4RI1A 4AVCA 1CPSA 4AVBA 5JQ4A 4UA3A 2C6CA 3D7FA 2VL1A 5F49A 4OAEA 3PFEA 4UF4A 4PXEA 2Z3LA 1FNOA 3S9MA 4NGTA 4PXBA 1IIDA 2I00A 5CNPA 4M85A 2P0WA 4MFZA 5JPHA 1IYKA 2B5GB 2IJZA 3PB4X 2HUZA 4LX9A 4UFVA 4KOTA 4A95A 8CPAA 3PZJA 3FYNA 3K9TA 2V8DA 2F8HA 3IO1A 2PC1A 3ZJ0A 1XE4A 2OZUA 2PQ8A 2WUUA 4LUAA 1XJOA 4B10A 5DWNA 2CF4A 2EO8A 2ZENA 2XEFA 4U9ZA 4XPLA 5D8NA 3VATA 4OKOA 4P10A 3IWGA 4UCPA 4I49A 2CNTA 4ZY0A 1KWMA 1AUGA 2BCOA 3GKRA 1Z5RA 4A30A 4MHNA 1A2ZA 1IOFA 1KUVA 1YVOA 3F8KA 2WYRA 3G3SA 2C6GA 3IGRA 4OIDA 3D2PA 3NE7A 5AGEA 3B3WA 1TKJA 2GFQA 2D4OA 4A2ZA 4YRHA 2PDOA 2QIRA 2FSRA 4NXYA 4QB9A 2HB6A 2RC4A 3QNVA 5HVHA 4RS2A 4UEEA 1XRYA 2VZYA 1SQHA 2Z3OA 4OC1A 2WZNA 5H86A 2C6PA 4FWUA 2ABZA 3PB6X 4OIWA 4R3LA 3W6XA 3CT9A 5G20A 4B13A 2NMTA 5G21A 1M4LA 3VH9A 2WSAA 3CPAA 1ON0A 4L8AA 1B6BA 4HNXB 4HNWB 1LAMA 2QVPA 4PK2A 4Y49B 2OZGA 4QBJA 2ZEEA 4X3RA 1QMUA 2JEWA 5DS0A 5I0CA 4J3GA 1QSMA 5LRKA 4PV6A 3LWUA 1IGBA 3IWEA 4NGMA 1J4JA 4CGMA 2VZZA 3R95A 3R1KA 2PVWA 2ZW4A 5AG6A 4EMEA 1FT7A 3WC7A 1PUAA 4WWVA 2R1IA 2I3CA 2ZELA 3OWCA 1IYLA 2PJ4A 2ATRA 4NSQA 4AB7A 3FEDA 2AFUA 1X10A 3DGVA 4KVME 1CJWA 4CAXA 4II9A 3FBUA 1XBUA 2HQYA 3FH4A 1DTDA 5EBVA 2POKA 2EVNA 4NGNA 2BUEA 2C1CA 2VI7A 1M4GA 4KORA 3G8WA 2PJBA 3IFEA 2REEA 2ZEHA 3FECA 3GUXA 4MFQA 4MY3A 4YFJA 1WWZA 2CNMA 3H8EA 2PSWA 1Q2DA 3TT2A 2ZW6A 2YGWA 2PJ9A 1TIQA 1Y9WA 4O23A 2K5TA 1Y0RA 2ZEMA 3WC6A 1IOIA 4H6ZA 2ZPAA 1YVKA 5F09A 3SXOA 3QAYA 4UIAA 4JYWA 2YNCC 5C88A 2Z3MA 1IB1E 2PJCA 3S9LA 4PXCA 4NJRA 2CIJA 4IHMA 1YR0A 1YW4A 2YNCA 3KL9A 1WK4A 3W6SA 1YLOA 2PJ2A 1YK3A 3C26A 2R7HA 2YNDA 1Z8XA 2DPSA 4BMHA 1GYTA 2J8RA 1Y0YA 3DLJA 4P4IA 3RBUA 4GXHA 3D4UA 3R9EA 1NMTA 2OR4A 1VKCA 1S5KA 3MN8A 2AFOA 4MHYA 1IY7A 2VXKA 4Y49C 1V0CA 5IB0A 5E96A 1ZG7A 2RFHA 3IU2A 3LMSA 3PGPA 4XPDB 4C2YA 2HC9A 3TC8A 3LACA 4KOUA 3RO0A 1P4NA 2XEJA 4JXRA 2GE3A 1S3ZA 1PYTB 1TF8A 2CTCA 2JLMA 5F48A 4CS0B 3I9SA 4FD7A 4F9VA 3EO4A 3B35A 4OP4A 3D67A 3V8IA 3N7ZA 2Q04A 2B3VA 4F8ZA 2NYQA 2QMLA 2B4BA 2V8HA 3D2MA 1KUXA 4NGSA 4PSXA 4OC5A 3TOAA 2GU2A 4ZY1A 2FT0A 2VQYA 4KZTA 4BBHA 4M3SA 4C7IA 2ZOFA 2I79A 3D68A 3DR6A 3KHZA 3FMCA 2AFMA 4Q36A 3DDDA 1MJ9A 4A39A 2OU2A 4R7MA 2GLJA 4UBRA 4ZY2A 3NH5A 5DWMA 4GM5A 2PRQA 3BLNA 3ISXA 4ZX9A 4ONUA 1ZLIA 2FXFA 4B6ZA 1CP7A 2GANA 3S9NA 1BPNA 4R76A 1CX8A 2CXAA 1VHEA 1LOKA 3UY5A 4KOYA 2EBJA 5HMNA 4QVTA 5G1ZA 2D4PA 3SXNA 1S7FA 5G22A 5AG4A 2ZOGA 4M6IA 3N5FA 3ZZIA 4B12A 5A27A 4CGOA 4JWPA 4OC3A 4YWYA 3PFOA 3SI0A 3KR5A 4FD5A 2REFA 4JLYA 3TFYA 2OZHA 3BXMA 2FCKA 4KOXA 4UIBA 4MCPA 5CPAA 4A37A 5JM6A 1YMEA 3SJFA 4NF1A 4R6TA 4AXVA 4XPDC 1U6MA 5K8PA 4IUSA 1BOBA 3H8FA 2Z3KA 4R9MA 1NE9A 1YLEA 1YREA 4KVOE 4R57A 3GY9A 5HVGA 3B2YA 4CRZB 1Q2CA 2X7BA 3FEEA 3FIXA 4JJXA 2ANPA 1QQ9A 1LANA 4MCQA 4PK3A 4X2TA 4CAVA 2ZEOA 2CTBA 5F46A 5JGFA 5J1QA 1M4IA 3DSBA 4R3KA 3D7GA 5BWAB 1AYEA 3I1UA 2PJAA 2O4HA 4BD9A 5ELYA 2PJ5A 5LYFA 3V38A 3NA6A 3NH8A 2B4DA 1Z9UA 2Z0ZA 1H8LA 1BPMA 2ZEFA 3PBEA 4P45A 1BLLE 4R87A 3FVLA 3LD2A 1VHSA 5KTAA 2H5MA 1VIXA 2PRBA 2WPXA 2AFSA 2B3UA 1QSOA 2J8NA 2ODFA 4FD6A 4NGPA 2OOTA 3RZAA 1P0HA 2VBQA 1HDQA 3FX6A 2AFZA 1OZPA 3IJ3A 3D7HA 4PXDA 3BI1A 4E0AA 3SJGA 3T9YA 1F57A 4JD6A 1S7NA 1PCAA 1ARMA 3R9GA 4QC6A 1NSLA 7CPAA 3MRUA 3P2HA 4P4JA 4PPZA 3S6FA 3KKWA 2G0BA 1MJAA 2F5IA 4CAEA 4B14A 5CBMA 4KLWA 3CXSA 4CAWA 4MFKA 1IU8A 3NH4A 6CPAA 3SI1A 4DYOA 4TWEA 3FNCA 1CG2A 1HDUA 3FF3A 3L2NA 2FIWA 4G1PA 5K8OA 3PEIA 2PJ0A 2G9DA 4EVYA 5HH1A 5JH9A 2PJ7A 3B3SA 3B7IA 2J8MA 1XIXA 2A4NA 3IWWA 4RN7A 3GLJA 3S6HA 3PB7X 3RNZA 2F7VA 4Q38A 1LRZA 4CRYB 4ONWA 4HKFA 1Y7RA 3TO7A 2DXQA 3D66A 3K2KA 3FB3A 3DR8A 5I4MA 2ZEDA 4QUSA 4XPKA 1LCPA 2PE3A 2FVGA 2EWBA 2EK9A 3HLPA 3T90A 3BJ8A 3EFAA 1Q2YA 3CZXA 1I21A 4A32A 5K8NA 1QSRA 3V7ZA 1Z4RA 4JXQA 4M6HA 1YW6A 2P6EA 2PCUA 4NGRA 4WJBA 3IC1A 4NGQA 1RXTA 4OC2A 4ZBGA 2PVVA 2OB0A 1Z8WA 3VARA 3R96A 4AG9A 4CYPA 4ZGYB 4DJLA 3NE8A 4P4FA 3KASA 4ZX8A 5LRGA 2Z3PA 1L0CA 5AG7A 3TCVA 2ZEGA 2AFXA 4KOSA 3WABA 2GREA 4P4EA 3KI9A 4P6YA 4B11A 3TX8A 4UCMA 5EMIA 3F0AA 4IK2A 4P4DA 4AG7A 1Y7EA 2IMOA 3S6GA 2B4DB 2Z3NA 3KHXA 3PP9A 4M6GA 3H5ZA 2Q7BA 3SJEA 1RO5A 5IV0A 3KGQA 2RB7A 1OBRA 2O53A 2BO9A 4MXUA 2P6GA 1XMTA 1IICA 3JVNA 3SI2A 1CP6A 3DNSA 4H2KA 2DPTA 2HV2A 3H4QA 4X5KA 4FAIA 4P4BA 1CBXA 3NFZA 1B87A 4P44A 2FS5A 3TO9A 3E0KA 4K3NA 4L89A 4E2AA 2Y0MA 4C2XA 1ELLP 4U9YA 4MFJA 1R3NA 4KS9A 3CPXA 2C27A 4IF5A 2PR1A 2QECA 3S6KA 5D29A 1AMPA 3TE4A 3B3CA 2BOAA 1PU9A 2BL1A 3B8GA 2Q4ZA 4IAVA 4B5PA 2EK8A 2CNSA 4XNHB 2JBKA 3EC4A 1S7LA 4MFPA 4ZI6A 3EXNA 3VWDA 2R98A 3D3SA 2ZW5A 5LRJA 2AFWA 4DUKA 1F2PA 4C7HA 2YNEA 4UFWA 1QSNA 4KUBA 3B3TA 1TXRA 4B5OA 3JUWA 4C2ZA 1VGYA 4JZ0A 4A94A 4F9UA 4TNUA 3PB9X 2O28A 5H84A 1XF8A 1VHOA 3PBBA 4NEXA 4W9YA 3RYOA 5IX3A 1TKFA 5J8FA 4EFDA 4CYQA 1FY7A 3T8WA 3CXPA 4UEZA 1S7KA 5J8CA 4A33A 3KQXA 2ZXVA 4F0YA 1XMBA 1ZLHA 1TKHA 3LODA 3TO6A 3FXTA 4DNCA 2Q43A 4H6UA 5LYIA 4Z65A 3GB0A 1LAPA 1TF9A 4MMOA 2Q7SA 4Q7AA 4H89A 1JQGA 2PIYA 2PJ3A 4PSWA 4AVAA 1ARLA 2Q44A 2PJ6A 3MGDA 4CYNA 4HPSA 2FIAA 2R8VA 5AG5A 1M4DA 4UFXA 3PRTA 4CYOA 4EWTA 4MHZA 2CY2A 2OH1A 4F0XA 3IU1A 2ZW7A 2Q0YA 1M44A 4MHPA 2ARHA 5THWA 1CPXA 4KUAA 4RUHA 3SHPA 3F5BA 4KSAA 3ISZA 4FBEA 1YSJA 4K30A 5HVFA 3TTHA 1LFWA 1MK4A 3KR4A 4MRIA 2PR8A 2Z10A 4MBUA 2FE7A 2IL4A 2XEIA 2IQ6A 4OADA 2QJ8A 4XNHC 4MFLA 4PQAA 2JDCA 4YGOA 5IB9A 2V8GA 3A9LA 1X12A 1Z2LA 1JWQA 2KCWA 2JBJA 2B58A 4UWJA 4ZYQA 5ISVA 5C82A 4FD4A 5HXDA 4MCRA 2Q4YA 1GHEA 1Q7LA 2B5GA 1RTQA 1I12A 3JRUA 4R8FA 4OC4A 4FUUA 4CAFA 1DE4C 1F2OA 1YX0A 4KLVA 1XOVA 3R9FA 3RAMA 4U5YA 1Z8TA 3D7DA 5A28A 1EE3P 2DEAA 4B5PB 3B3VA 1ZO0A 5GCNA 1BO4A 4OC0A 4A31A 4KSIA 1KUYA 3KQZA 4GS4A 2GIVA 2BSWA 3IIBA 3EY5A 4A38A 1R57A 5K8MA 1I1DA 1ZG8A 4KOWA 2PIZA 2Q4VA 5KTCA 2V77A 3KZWA 3VWEA 4CPAA 1S60A 4HNYB 2JEVA 3CXQA 3FJUA 4KSFA 3K9UA 4LQGA 1Y9KA 5LYLA 2GLFA 2BEIA 2Q51A 3CDXA 4CGPA 3QAHA 3SJXA 1R43A 3BI0A 5F47A 2PJ1A 5FVJA
chains in the Genus database with same CATH topology
2WPWA 4CGLA 3I3GA 4CGNA 2G3AA 3WR7A 3JTKA 4KVXA 1Z4EA 2P6FA 2AE6A 2JDDA 4NCZA 5EC4A 1K4JA 4MJ8A 5KTDA 4UCNA 4KOVA 3TOBA 3FRMA 3GYAA 1MJBA 3QB8A 4UWIA 1N71A 1UFHA 4F6AA 2Z11A 3W91A 4ORFA 1YGHA 1CM0A 1M1DA 4MY0A 3BJ7A 1QSTA 2VEZA 2AJ6A 4OLLA 2G3TA 1KZFA 4MI4A 4E8OA 4C68A 3P2FA 1XEBA 2EUIA 4MHDA 3D8PA 2FL4A 4RI1A 4AVCA 5JQ4A 4AVBA 4UA3A 5F49A 4OAEA 2Z3LA 1IIDA 2I00A 5CNPA 4M85A 2P0WA 4MFZA 5JPHA 1IYKA 2B5GB 2HUZA 4LX9A 4UFVA 4KOTA 4A95A 3PZJA 3FYNA 4CAWA 2PC1A 3ZJ0A 1XE4A 2OZUA 2PQ8A 2WUUA 4LUAA 4B10A 5DWNA 4XPLA 4U9ZA 3IWGA 4UCPA 4I49A 2CNTA 3GKRA 4A30A 3IGRA 1KUVA 1YVOA 3F8KA 3G3SA 3D2PA 3NE7A 5AGEA 2D4OA 4A2ZA 4YRHA 2PDOA 2QIRA 2FSRA 4NXYA 4QB9A 2RC4A 4RS2A 2VZYA 1SQHA 2Z3OA 5H86A 3W6XA 4R3LA 5G20A 4B13A 2NMTA 2WSAA 4L8AA 1ON0A 1B6BA 4HNXB 4HNWB 4QBJA 4PK2A 4Y49B 2OZGA 5I0CA 4J3GA 1QSMA 4PV6A 3IWEA 4CGMA 1J4JA 2VZZA 3R95A 3R1KA 2ZW4A 5AG6A 1PUAA 2R1IA 3OWCA 4NSQA 4AB7A 1IYLA 2ATRA 4II9A 4KVME 1CJWA 4CAXA 3FBUA 2HQYA 5EBVA 2EVNA 2BUEA 2VI7A 1M4GA 4KORA 3G8WA 2REEA 4MFQA 4MY3A 4YFJA 1WWZA 2CNMA 2PSWA 1Q2DA 3TT2A 2ZW6A 2YGWA 1TIQA 1Y9WA 2K5TA 4H6ZA 2ZPAA 1YVKA 3SXOA 2YNCC 5C88A 2Z3MA 1IB1E 3W6SA 1YR0A 2YNCA 1WK4A 1YK3A 3C26A 2R7HA 2YNDA 2DPSA 4BMHA 2J8RA 3R9EA 1NMTA 1VKCA 1S5KA 2VXKA 4Y49C 1V0CA 5IB0A 5E96A 3IU2A 3PGPA 4XPDB 4C2YA 4KOUA 1P4NA 4JXRA 2GE3A 1S3ZA 2JLMA 5F48A 4CS0B 3I9SA 4FD7A 3EO4A 3V8IA 3N7ZA 2Q04A 2B3VA 2QMLA 2B4BA 3D2MA 1KUXA 4PSXA 3TOAA 2FT0A 2VQYA 4KZTA 4BBHA 4M3SA 4C7IA 2I79A 3DR6A 4Q36A 3DDDA 1MJ9A 2OU2A 4UBRA 5DWMA 3BLNA 4ONUA 2FXFA 2GANA 2CXAA 3UY5A 4KOYA 5HMNA 4QVTA 5G1ZA 2D4PA 3SXNA 1S7FA 5G22A 5AG4A 3ZZIA 4B12A 5A27A 4CGOA 4JWPA 4FD5A 2REFA 4JLYA 3TFYA 2OZHA 2FCKA 4KOXA 4NF1A 4XPDC 1U6MA 4IUSA 1BOBA 4R9MA 2Z3KA 1NE9A 1YLEA 1YREA 4KVOE 4R57A 3GY9A 4CRZB 4JJXA 1Q2CA 2X7BA 3FIXA 4PK3A 4CAVA 5F46A 1M4IA 3DSBA 4R3KA 5BWAB 2B4DA 1Z9UA 2Z0ZA 4R87A 3LD2A 1VHSA 5KTAA 2H5MA 2PRBA 2WPXA 5G21A 2B3UA 2J8NA 1QSOA 4FD6A 1P0HA 2VBQA 1OZPA 4E0AA 3T9YA 4JD6A 1S7NA 3R9GA 4QC6A 1NSLA 3P2HA 3S6FA 3KKWA 2G0BA 1MJAA 2F5IA 4CAEA 4B14A 4KLWA 3CXSA 4MFKA 3FNCA 2FIWA 4EVYA 5HH1A 2J8MA 1XIXA 2A4NA 3S6HA 4Q38A 4CRYB 1LRZA 4HKFA 1Y7RA 3TO7A 2DXQA 3FB3A 3DR8A 4QUSA 4XPKA 3T90A 3BJ8A 3EFAA 1Q2YA 1I21A 4A32A 1QSRA 1Z4RA 4JXQA 2P6EA 4ZBGA 1RXTA 2OB0A 3R96A 4AG9A 4CYPA 4ZGYB 2Z3PA 1L0CA 5AG7A 3TCVA 4KOSA 4B11A 4UCMA 3F0AA 4AG7A 3S6GA 2B4DB 2Z3NA 3PP9A 3H5ZA 2Q7BA 1RO5A 5IV0A 2P6GA 1XMTA 1IICA 3JVNA 3DNSA 2DPTA 2HV2A 3H4QA 4X5KA 1B87A 3TO9A 2FS5A 3E0KA 4L89A 4E2AA 2Y0MA 4C2XA 4U9YA 4MFJA 4KS9A 2C27A 4IF5A 2PR1A 2QECA 3S6KA 3TE4A 1PU9A 2BL1A 3B8GA 4B5PA 2CNSA 4XNHB 3EC4A 1S7LA 4MFPA 3EXNA 3VWDA 2R98A 3D3SA 2ZW5A 4C7HA 2YNEA 4UFWA 1QSNA 4KUBA 4B5OA 3JUWA 4C2ZA 5H84A 2O28A 1XF8A 4NEXA 3RYOA 5IX3A 5J8FA 4CYQA 1FY7A 3CXPA 1S7KA 5J8CA 4A33A 2ZXVA 4F0YA 3LODA 3TO6A 3FXTA 4DNCA 4H6UA 4H89A 4PSWA 4AVAA 2Q44A 3MGDA 4CYNA 2FIAA 2R8VA 5AG5A 1M4DA 4UFXA 4CYOA 2CY2A 2OH1A 4F0XA 3IU1A 2ZW7A 2Q0YA 1M44A 2ARHA 4KUAA 3SHPA 3F5BA 4KSAA 4K30A 3TTHA 1MK4A 2PR8A 2Z10A 4MBUA 2FE7A 2IL4A 4OADA 4XNHC 4MFLA 2JDCA 4YGOA 3A9LA 2KCWA 2B58A 4UWJA 5ISVA 5C82A 4FD4A 2Q4YA 1GHEA 2B5GA 1I12A 4CAFA 1YX0A 4KLVA 3R9FA 4U5YA 5A28A 4B5PB 1ZO0A 5GCNA 1BO4A 4A31A 1KUYA 4GS4A 2GIVA 2BSWA 3EY5A 1R57A 1I1DA 4KOWA 2Q4VA 5KTCA 3VWEA 1S60A 4HNYB 2JEVA 3CXQA 4KSFA 3K9UA 1Y9KA 2BEIA 4CGPA 3QAHA 5F47A 5FVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPW A;  3I3G A;  2G3A A;  3WR7 A;  4KVX A;  1Z4E A;  2P6F A;  2AE6 A;  2JDD A;  4NCZ A;  5EC4 A;  1K4J A;  4MJ8 A;  5KTD A;  4KOV A;  3TOB A;  3FRM A;  3GYA A;  1MJB A;  3QB8 A;  4UWI A;  1N71 A;  1UFH A;  4F6A A;  2Z11 A;  3W91 A;  4ORF A;  1YGH A;  1CM0 A;  1M1D A;  4MY0 A;  3BJ7 A;  1QST A;  2VEZ A;  2AJ6 A;  4OLL A;  2G3T A;  1KZF A;  4MI4 A;  4E8O A;  3P2F A;  1XEB A;  2EUI A;  4MHD A;  3D8P A;  2FL4 A;  4RI1 A;  4AVC A;  5JQ4 A;  4AVB A;  4UA3 A;  5F49 A;  4OAE A;  1IID A;  2I00 A;  5CNP A;  4M85 A;  2P0W A;  5JPH A;  1IYK A;  2B5G B;  2HUZ A;  4LX9 A;  4KOT A;  3PZJ A;  3FYN A;  4CAW A;  2PC1 A;  3ZJ0 A;  1XE4 A;  2OZU A;  2PQ8 A;  4LUA A;  5DWN A;  4XPL A;  4U9Z A;  3IWG A;  4I49 A;  2CNT A;  3GKR A;  3IGR A;  1KUV A;  1YVO A;  3F8K A;  3G3S A;  3D2P A;  3NE7 A;  2D4O A;  4YRH A;  2PDO A;  2QIR A;  2FSR A;  4NXY A;  4QB9 A;  2RC4 A;  4RS2 A;  2VZY A;  1SQH A;  5H86 A;  3W6X A;  4R3L A;  2NMT A;  4L8A A;  1ON0 A;  1B6B A;  4HNX B;  4HNW B;  4QBJ A;  4PK2 A;  4Y49 B;  2OZG A;  5I0C A;  4J3G A;  1QSM A;  4PV6 A;  1J4J A;  2VZZ A;  3R95 A;  3R1K A;  2ZW4 A;  1PUA A;  2R1I A;  3OWC A;  4NSQ A;  4AB7 A;  1IYL A;  2ATR A;  4II9 A;  4KVM E;  1CJW A;  4CAX A;  3FBU A;  2HQY A;  5EBV A;  2EVN A;  2BUE A;  2VI7 A;  1M4G A;  4KOR A;  3G8W A;  2REE A;  4MY3 A;  4YFJ A;  1WWZ A;  2CNM A;  2PSW A;  1Q2D A;  3TT2 A;  2ZW6 A;  1TIQ A;  1Y9W A;  2K5T A;  4H6Z A;  2ZPA A;  1YVK A;  3SXO A;  5C88 A;  1IB1 E;  3W6S A;  1YR0 A;  1WK4 A;  1YK3 A;  3C26 A;  2R7H A;  4BMH A;  2J8R A;  3R9E A;  1NMT A;  1VKC A;  1S5K A;  2VXK A;  4Y49 C;  1V0C A;  5IB0 A;  5E96 A;  3PGP A;  4XPD B;  4KOU A;  1P4N A;  4JXR A;  2GE3 A;  1S3Z A;  2JLM A;  5F48 A;  4CS0 B;  3I9S A;  4FD7 A;  3EO4 A;  3V8I A;  3N7Z A;  2Q04 A;  2B3V A;  2QML A;  2B4B A;  3D2M A;  1KUX A;  4PSX A;  3TOA A;  2FT0 A;  2VQY A;  4KZT A;  4M3S A;  2I79 A;  3DR6 A;  3DDD A;  1MJ9 A;  2OU2 A;  4UBR A;  5DWM A;  3BLN A;  4ONU A;  2FXF A;  2GAN A;  3UY5 A;  4KOY A;  5HMN A;  4QVT A;  3SXN A;  2D4P A;  1S7F A;  3ZZI A;  4JWP A;  4FD5 A;  2REF A;  4JLY A;  3TFY A;  2OZH A;  2FCK A;  4KOX A;  4NF1 A;  4XPD C;  1U6M A;  4IUS A;  1BOB A;  4R9M A;  1NE9 A;  1YLE A;  1YRE A;  4KVO E;  4R57 A;  3GY9 A;  4CRZ B;  4JJX A;  1Q2C A;  2X7B A;  3FIX A;  4PK3 A;  4CAV A;  5F46 A;  1M4I A;  3DSB A;  4R3K A;  2B4D A;  1Z9U A;  2Z0Z A;  4R87 A;  3LD2 A;  1VHS A;  5KTA A;  2H5M A;  2PRB A;  2WPX A;  2B3U A;  2J8N A;  1QSO A;  4FD6 A;  1P0H A;  2VBQ A;  1OZP A;  4E0A A;  3T9Y A;  4JD6 A;  1S7N A;  3R9G A;  4QC6 A;  1NSL A;  3P2H A;  3S6F A;  3KKW A;  2G0B A;  1MJA A;  2F5I A;  4KLW A;  3CXS A;  3FNC A;  2FIW A;  4EVY A;  5HH1 A;  2J8M A;  1XIX A;  2A4N A;  3S6H A;  4CRY B;  1LRZ A;  4HKF A;  1Y7R A;  3TO7 A;  2DXQ A;  3FB3 A;  3DR8 A;  4QUS A;  4XPK A;  3T90 A;  3BJ8 A;  3EFA A;  1Q2Y A;  1I21 A;  1QSR A;  1Z4R A;  4JXQ A;  2P6E A;  4ZBG A;  1RXT A;  2OB0 A;  3R96 A;  4AG9 A;  1L0C A;  3TCV A;  4KOS A;  3F0A A;  4AG7 A;  3S6G A;  2B4D B;  3PP9 A;  2Q7B A;  1RO5 A;  5IV0 A;  2P6G A;  1XMT A;  1IIC A;  3JVN A;  3DNS A;  2HV2 A;  3H4Q A;  4X5K A;  1B87 A;  3TO9 A;  2FS5 A;  3E0K A;  4L89 A;  4E2A A;  2Y0M A;  4U9Y A;  2C27 A;  4IF5 A;  2PR1 A;  2QEC A;  3S6K A;  3TE4 A;  1PU9 A;  2BL1 A;  3B8G A;  4B5P A;  2CNS A;  4XNH B;  3EC4 A;  1S7L A;  3EXN A;  3VWD A;  2R98 A;  3D3S A;  2ZW5 A;  1QSN A;  4KUB A;  4B5O A;  3JUW A;  5H84 A;  2O28 A;  1XF8 A;  4NEX A;  3RYO A;  5IX3 A;  5J8F A;  1FY7 A;  3CXP A;  1S7K A;  5J8C A;  2ZXV A;  4F0Y A;  3LOD A;  3TO6 A;  3FXT A;  4DNC A;  4H6U A;  4H89 A;  4PSW A;  4AVA A;  2Q44 A;  3MGD A;  2FIA A;  2R8V A;  1M4D A;  2CY2 A;  2OH1 A;  2ZW7 A;  2Q0Y A;  1M44 A;  2ARH A;  4KUA A;  3SHP A;  3F5B A;  4K30 A;  3TTH A;  1MK4 A;  2PR8 A;  2Z10 A;  4MBU A;  2FE7 A;  2IL4 A;  4OAD A;  4XNH C;  2JDC A;  4YGO A;  2KCW A;  2B58 A;  4UWJ A;  5ISV A;  5C82 A;  4FD4 A;  2Q4Y A;  1GHE A;  2B5G A;  1I12 A;  1YX0 A;  4KLV A;  3R9F A;  4U5Y A;  4B5P B;  5GCN A;  1BO4 A;  1KUY A;  4GS4 A;  2GIV A;  2BSW A;  3EY5 A;  1R57 A;  1I1D A;  4KOW A;  2Q4V A;  5KTC A;  3VWE A;  1S60 A;  4HNY B;  2JEV A;  3CXQ A;  3K9U A;  1Y9K A;  2BEI A;  3QAH A;  5F47 A;  5FVJ A; 
#chains in the Genus database with same CATH topology
 2WPW A;  4CGL A;  4MCS A;  4X8I A;  3I3G A;  4CGN A;  2G3A A;  1XFO A;  2XEG A;  2J9A A;  3WR7 A;  3JTK A;  4KVX A;  1Z4E A;  2P6F A;  2AE6 A;  2JDD A;  3PB8 X;  4NCZ A;  5EC4 A;  1K4J A;  1YQE A;  2QYV A;  4MJ8 A;  3HUV A;  5KTD A;  4BIN A;  3WT4 A;  4UCN A;  4KOV A;  2ZEP A;  3TOB A;  2PJ8 A;  3FRM A;  4YU9 A;  2DF5 A;  3GYA A;  1ZG9 A;  3H8G A;  1UWY A;  1MJB A;  4OME A;  3QB8 A;  4UWI A;  1N71 A;  1UFH A;  4F6A A;  2Z11 A;  3W91 A;  4ORF A;  4NJQ A;  4UEF A;  1YGH A;  3BHX A;  2V8V A;  1CM0 A;  1M1D A;  4MY0 A;  5LYD A;  3BJ7 A;  1HEE A;  1QST A;  2VEZ A;  2NSM A;  1ELM P;  2AJ6 A;  4OLL A;  2G3T A;  3IEH A;  1KZF A;  4LQ6 A;  3GIU A;  4MI4 A;  4E8O A;  4C68 A;  4NFR A;  3P2F A;  1XEB A;  2EUI A;  4MHD A;  3WC5 A;  1NSA A;  1Z8L A;  3D8P A;  1BAV A;  2FL4 A;  4RI1 A;  4AVC A;  1CPS A;  4AVB A;  5JQ4 A;  4UA3 A;  2C6C A;  3D7F A;  2VL1 A;  5F49 A;  4OAE A;  3PFE A;  4UF4 A;  4PXE A;  2Z3L A;  1FNO A;  3S9M A;  4NGT A;  4PXB A;  1IID A;  2I00 A;  5CNP A;  4M85 A;  2P0W A;  4MFZ A;  5JPH A;  1IYK A;  2B5G B;  2IJZ A;  3PB4 X;  2HUZ A;  4LX9 A;  4UFV A;  4KOT A;  4A95 A;  8CPA A;  3PZJ A;  3FYN A;  3K9T A;  2V8D A;  2F8H A;  3IO1 A;  2PC1 A;  3ZJ0 A;  1XE4 A;  2OZU A;  2PQ8 A;  2WUU A;  4LUA A;  1XJO A;  4B10 A;  5DWN A;  2CF4 A;  2EO8 A;  2ZEN A;  2XEF A;  4U9Z A;  4XPL A;  5D8N A;  3VAT A;  4OKO A;  4P10 A;  3IWG A;  4UCP A;  4I49 A;  2CNT A;  4ZY0 A;  1KWM A;  1AUG A;  2BCO A;  3GKR A;  1Z5R A;  4A30 A;  4MHN A;  1A2Z A;  1IOF A;  1KUV A;  1YVO A;  3F8K A;  2WYR A;  3G3S A;  2C6G A;  3IGR A;  4OID A;  3D2P A;  3NE7 A;  5AGE A;  3B3W A;  1TKJ A;  2GFQ A;  2D4O A;  4A2Z A;  4YRH A;  2PDO A;  2QIR A;  2FSR A;  4NXY A;  4QB9 A;  2HB6 A;  2RC4 A;  3QNV A;  5HVH A;  4RS2 A;  4UEE A;  1XRY A;  2VZY A;  1SQH A;  2Z3O A;  4OC1 A;  2WZN A;  5H86 A;  2C6P A;  4FWU A;  2ABZ A;  3PB6 X;  4OIW A;  4R3L A;  3W6X A;  3CT9 A;  5G20 A;  4B13 A;  2NMT A;  5G21 A;  1M4L A;  3VH9 A;  2WSA A;  3CPA A;  1ON0 A;  4L8A A;  1B6B A;  4HNX B;  4HNW B;  1LAM A;  2QVP A;  4PK2 A;  4Y49 B;  2OZG A;  4QBJ A;  2ZEE A;  4X3R A;  1QMU A;  2JEW A;  5DS0 A;  5I0C A;  4J3G A;  1QSM A;  5LRK A;  4PV6 A;  3LWU A;  1IGB A;  3IWE A;  4NGM A;  1J4J A;  4CGM A;  2VZZ A;  3R95 A;  3R1K A;  2PVW A;  2ZW4 A;  5AG6 A;  4EME A;  1FT7 A;  3WC7 A;  1PUA A;  4WWV A;  2R1I A;  2I3C A;  2ZEL A;  3OWC A;  1IYL A;  2PJ4 A;  2ATR A;  4NSQ A;  4AB7 A;  3FED A;  2AFU A;  1X10 A;  3DGV A;  4KVM E;  1CJW A;  4CAX A;  4II9 A;  3FBU A;  1XBU A;  2HQY A;  3FH4 A;  1DTD A;  5EBV A;  2POK A;  2EVN A;  4NGN A;  2BUE A;  2C1C A;  2VI7 A;  1M4G A;  4KOR A;  3G8W A;  2PJB A;  3IFE A;  2REE A;  2ZEH A;  3FEC A;  3GUX A;  4MFQ A;  4MY3 A;  4YFJ A;  1WWZ A;  2CNM A;  3H8E A;  2PSW A;  1Q2D A;  3TT2 A;  2ZW6 A;  2YGW A;  2PJ9 A;  1TIQ A;  1Y9W A;  4O23 A;  2K5T A;  1Y0R A;  2ZEM A;  3WC6 A;  1IOI A;  4H6Z A;  2ZPA A;  1YVK A;  5F09 A;  3SXO A;  3QAY A;  4UIA A;  4JYW A;  2YNC C;  5C88 A;  2Z3M A;  1IB1 E;  2PJC A;  3S9L A;  4PXC A;  4NJR A;  2CIJ A;  4IHM A;  1YR0 A;  1YW4 A;  2YNC A;  3KL9 A;  1WK4 A;  3W6S A;  1YLO A;  2PJ2 A;  1YK3 A;  3C26 A;  2R7H A;  2YND A;  1Z8X A;  2DPS A;  4BMH A;  1GYT A;  2J8R A;  1Y0Y A;  3DLJ A;  4P4I A;  3RBU A;  4GXH A;  3D4U A;  3R9E A;  1NMT A;  2OR4 A;  1VKC A;  1S5K A;  3MN8 A;  2AFO A;  4MHY A;  1IY7 A;  2VXK A;  4Y49 C;  1V0C A;  5IB0 A;  5E96 A;  1ZG7 A;  2RFH A;  3IU2 A;  3LMS A;  3PGP A;  4XPD B;  4C2Y A;  2HC9 A;  3TC8 A;  3LAC A;  4KOU A;  3RO0 A;  1P4N A;  2XEJ A;  4JXR A;  2GE3 A;  1S3Z A;  1PYT B;  1TF8 A;  2CTC A;  2JLM A;  5F48 A;  4CS0 B;  3I9S A;  4FD7 A;  4F9V A;  3EO4 A;  3B35 A;  4OP4 A;  3D67 A;  3V8I A;  3N7Z A;  2Q04 A;  2B3V A;  4F8Z A;  2NYQ A;  2QML A;  2B4B A;  2V8H A;  3D2M A;  1KUX A;  4NGS A;  4PSX A;  4OC5 A;  3TOA A;  2GU2 A;  4ZY1 A;  2FT0 A;  2VQY A;  4KZT A;  4BBH A;  4M3S A;  4C7I A;  2ZOF A;  2I79 A;  3D68 A;  3DR6 A;  3KHZ A;  3FMC A;  2AFM A;  4Q36 A;  3DDD A;  1MJ9 A;  4A39 A;  2OU2 A;  4R7M A;  2GLJ A;  4UBR A;  4ZY2 A;  3NH5 A;  5DWM A;  4GM5 A;  2PRQ A;  3BLN A;  3ISX A;  4ZX9 A;  4ONU A;  1ZLI A;  2FXF A;  4B6Z A;  1CP7 A;  2GAN A;  3S9N A;  1BPN A;  4R76 A;  1CX8 A;  2CXA A;  1VHE A;  1LOK A;  3UY5 A;  4KOY A;  2EBJ A;  5HMN A;  4QVT A;  5G1Z A;  2D4P A;  3SXN A;  1S7F A;  5G22 A;  5AG4 A;  2ZOG A;  4M6I A;  3N5F A;  3ZZI A;  4B12 A;  5A27 A;  4CGO A;  4JWP A;  4OC3 A;  4YWY A;  3PFO A;  3SI0 A;  3KR5 A;  4FD5 A;  2REF A;  4JLY A;  3TFY A;  2OZH A;  3BXM A;  2FCK A;  4KOX A;  4UIB A;  4MCP A;  5CPA A;  4A37 A;  5JM6 A;  1YME A;  3SJF A;  4NF1 A;  4R6T A;  4AXV A;  4XPD C;  1U6M A;  5K8P A;  4IUS A;  1BOB A;  3H8F A;  2Z3K A;  4R9M A;  1NE9 A;  1YLE A;  1YRE A;  4KVO E;  4R57 A;  3GY9 A;  5HVG A;  3B2Y A;  4CRZ B;  1Q2C A;  2X7B A;  3FEE A;  3FIX A;  4JJX A;  2ANP A;  1QQ9 A;  1LAN A;  4MCQ A;  4PK3 A;  4X2T A;  4CAV A;  2ZEO A;  2CTB A;  5F46 A;  5JGF A;  5J1Q A;  1M4I A;  3DSB A;  4R3K A;  3D7G A;  5BWA B;  1AYE A;  3I1U A;  2PJA A;  2O4H A;  4BD9 A;  5ELY A;  2PJ5 A;  5LYF A;  3V38 A;  3NA6 A;  3NH8 A;  2B4D A;  1Z9U A;  2Z0Z A;  1H8L A;  1BPM A;  2ZEF A;  3PBE A;  4P45 A;  1BLL E;  4R87 A;  3FVL A;  3LD2 A;  1VHS A;  5KTA A;  2H5M A;  1VIX A;  2PRB A;  2WPX A;  2AFS A;  2B3U A;  1QSO A;  2J8N A;  2ODF A;  4FD6 A;  4NGP A;  2OOT A;  3RZA A;  1P0H A;  2VBQ A;  1HDQ A;  3FX6 A;  2AFZ A;  1OZP A;  3IJ3 A;  3D7H A;  4PXD A;  3BI1 A;  4E0A A;  3SJG A;  3T9Y A;  1F57 A;  4JD6 A;  1S7N A;  1PCA A;  1ARM A;  3R9G A;  4QC6 A;  1NSL A;  7CPA A;  3MRU A;  3P2H A;  4P4J A;  4PPZ A;  3S6F A;  3KKW A;  2G0B A;  1MJA A;  2F5I A;  4CAE A;  4B14 A;  5CBM A;  4KLW A;  3CXS A;  4CAW A;  4MFK A;  1IU8 A;  3NH4 A;  6CPA A;  3SI1 A;  4DYO A;  4TWE A;  3FNC A;  1CG2 A;  1HDU A;  3FF3 A;  3L2N A;  2FIW A;  4G1P A;  5K8O A;  3PEI A;  2PJ0 A;  2G9D A;  4EVY A;  5HH1 A;  5JH9 A;  2PJ7 A;  3B3S A;  3B7I A;  2J8M A;  1XIX A;  2A4N A;  3IWW A;  4RN7 A;  3GLJ A;  3S6H A;  3PB7 X;  3RNZ A;  2F7V A;  4Q38 A;  1LRZ A;  4CRY B;  4ONW A;  4HKF A;  1Y7R A;  3TO7 A;  2DXQ A;  3D66 A;  3K2K A;  3FB3 A;  3DR8 A;  5I4M A;  2ZED A;  4QUS A;  4XPK A;  1LCP A;  2PE3 A;  2FVG A;  2EWB A;  2EK9 A;  3HLP A;  3T90 A;  3BJ8 A;  3EFA A;  1Q2Y A;  3CZX A;  1I21 A;  4A32 A;  5K8N A;  1QSR A;  3V7Z A;  1Z4R A;  4JXQ A;  4M6H A;  1YW6 A;  2P6E A;  2PCU A;  4NGR A;  4WJB A;  3IC1 A;  4NGQ A;  1RXT A;  4OC2 A;  4ZBG A;  2PVV A;  2OB0 A;  1Z8W A;  3VAR A;  3R96 A;  4AG9 A;  4CYP A;  4ZGY B;  4DJL A;  3NE8 A;  4P4F A;  3KAS A;  4ZX8 A;  5LRG A;  2Z3P A;  1L0C A;  5AG7 A;  3TCV A;  2ZEG A;  2AFX A;  4KOS A;  3WAB A;  2GRE A;  4P4E A;  3KI9 A;  4P6Y A;  4B11 A;  3TX8 A;  4UCM A;  5EMI A;  3F0A A;  4IK2 A;  4P4D A;  4AG7 A;  1Y7E A;  2IMO A;  3S6G A;  2B4D B;  2Z3N A;  3KHX A;  3PP9 A;  4M6G A;  3H5Z A;  2Q7B A;  3SJE A;  1RO5 A;  5IV0 A;  3KGQ A;  2RB7 A;  1OBR A;  2O53 A;  2BO9 A;  4MXU A;  2P6G A;  1XMT A;  1IIC A;  3JVN A;  3SI2 A;  1CP6 A;  3DNS A;  4H2K A;  2DPT A;  2HV2 A;  3H4Q A;  4X5K A;  4FAI A;  4P4B A;  1CBX A;  3NFZ A;  1B87 A;  4P44 A;  2FS5 A;  3TO9 A;  3E0K A;  4K3N A;  4L89 A;  4E2A A;  2Y0M A;  4C2X A;  1ELL P;  4U9Y A;  4MFJ A;  1R3N A;  4KS9 A;  3CPX A;  2C27 A;  4IF5 A;  2PR1 A;  2QEC A;  3S6K A;  5D29 A;  1AMP A;  3TE4 A;  3B3C A;  2BOA A;  1PU9 A;  2BL1 A;  3B8G A;  2Q4Z A;  4IAV A;  4B5P A;  2EK8 A;  2CNS A;  4XNH B;  2JBK A;  3EC4 A;  1S7L A;  4MFP A;  4ZI6 A;  3EXN A;  3VWD A;  2R98 A;  3D3S A;  2ZW5 A;  5LRJ A;  2AFW A;  4DUK A;  1F2P A;  4C7H A;  2YNE A;  4UFW A;  1QSN A;  4KUB A;  3B3T A;  1TXR A;  4B5O A;  3JUW A;  4C2Z A;  1VGY A;  4JZ0 A;  4A94 A;  4F9U A;  4TNU A;  3PB9 X;  2O28 A;  5H84 A;  1XF8 A;  1VHO A;  3PBB A;  4NEX A;  4W9Y A;  3RYO A;  5IX3 A;  1TKF A;  5J8F A;  4EFD A;  4CYQ A;  1FY7 A;  3T8W A;  3CXP A;  4UEZ A;  1S7K A;  5J8C A;  4A33 A;  3KQX A;  2ZXV A;  4F0Y A;  1XMB A;  1ZLH A;  1TKH A;  3LOD A;  3TO6 A;  3FXT A;  4DNC A;  2Q43 A;  4H6U A;  5LYI A;  4Z65 A;  3GB0 A;  1LAP A;  1TF9 A;  4MMO A;  2Q7S A;  4Q7A A;  4H89 A;  1JQG A;  2PIY A;  2PJ3 A;  4PSW A;  4AVA A;  1ARL A;  2Q44 A;  2PJ6 A;  3MGD A;  4CYN A;  4HPS A;  2FIA A;  2R8V A;  5AG5 A;  1M4D A;  4UFX A;  3PRT A;  4CYO A;  4EWT A;  4MHZ A;  2CY2 A;  2OH1 A;  4F0X A;  3IU1 A;  2ZW7 A;  2Q0Y A;  1M44 A;  4MHP A;  2ARH A;  5THW A;  1CPX A;  4KUA A;  4RUH A;  3SHP A;  3F5B A;  4KSA A;  3ISZ A;  4FBE A;  1YSJ A;  4K30 A;  5HVF A;  3TTH A;  1LFW A;  1MK4 A;  3KR4 A;  4MRI A;  2PR8 A;  2Z10 A;  4MBU A;  2FE7 A;  2IL4 A;  2XEI A;  2IQ6 A;  4OAD A;  2QJ8 A;  4XNH C;  4MFL A;  4PQA A;  2JDC A;  4YGO A;  5IB9 A;  2V8G A;  3A9L A;  1X12 A;  1Z2L A;  1JWQ A;  2KCW A;  2JBJ A;  2B58 A;  4UWJ A;  4ZYQ A;  5ISV A;  5C82 A;  4FD4 A;  5HXD A;  4MCR A;  2Q4Y A;  1GHE A;  1Q7L A;  2B5G A;  1RTQ A;  1I12 A;  3JRU A;  4R8F A;  4OC4 A;  4FUU A;  4CAF A;  1DE4 C;  1F2O A;  1YX0 A;  4KLV A;  1XOV A;  3R9F A;  3RAM A;  4U5Y A;  1Z8T A;  3D7D A;  5A28 A;  1EE3 P;  2DEA A;  4B5P B;  3B3V A;  1ZO0 A;  5GCN A;  1BO4 A;  4OC0 A;  4A31 A;  4KSI A;  1KUY A;  3KQZ A;  4GS4 A;  2GIV A;  2BSW A;  3IIB A;  3EY5 A;  4A38 A;  1R57 A;  5K8M A;  1I1D A;  1ZG8 A;  4KOW A;  2PIZ A;  2Q4V A;  5KTC A;  2V77 A;  3KZW A;  3VWE A;  4CPA A;  1S60 A;  4HNY B;  2JEV A;  3CXQ A;  3FJU A;  4KSF A;  3K9U A;  4LQG A;  1Y9K A;  5LYL A;  2GLF A;  2BEI A;  2Q51 A;  3CDX A;  4CGP A;  3QAH A;  3SJX A;  1R43 A;  3BI0 A;  5F47 A;  2PJ1 A;  5FVJ A; 
#chains in the Genus database with same CATH homology
 2WPW A;  4CGL A;  3I3G A;  4CGN A;  2G3A A;  3WR7 A;  3JTK A;  4KVX A;  1Z4E A;  2P6F A;  2AE6 A;  2JDD A;  4NCZ A;  5EC4 A;  1K4J A;  4MJ8 A;  5KTD A;  4UCN A;  4KOV A;  3TOB A;  3FRM A;  3GYA A;  1MJB A;  3QB8 A;  4UWI A;  1N71 A;  1UFH A;  4F6A A;  2Z11 A;  3W91 A;  4ORF A;  1YGH A;  1CM0 A;  1M1D A;  4MY0 A;  3BJ7 A;  1QST A;  2VEZ A;  2AJ6 A;  4OLL A;  2G3T A;  1KZF A;  4MI4 A;  4E8O A;  4C68 A;  3P2F A;  1XEB A;  2EUI A;  4MHD A;  3D8P A;  2FL4 A;  4RI1 A;  4AVC A;  5JQ4 A;  4AVB A;  4UA3 A;  5F49 A;  4OAE A;  2Z3L A;  1IID A;  2I00 A;  5CNP A;  4M85 A;  2P0W A;  4MFZ A;  5JPH A;  1IYK A;  2B5G B;  2HUZ A;  4LX9 A;  4UFV A;  4KOT A;  4A95 A;  3PZJ A;  3FYN A;  4CAW A;  2PC1 A;  3ZJ0 A;  1XE4 A;  2OZU A;  2PQ8 A;  2WUU A;  4LUA A;  4B10 A;  5DWN A;  4XPL A;  4U9Z A;  3IWG A;  4UCP A;  4I49 A;  2CNT A;  3GKR A;  4A30 A;  3IGR A;  1KUV A;  1YVO A;  3F8K A;  3G3S A;  3D2P A;  3NE7 A;  5AGE A;  2D4O A;  4A2Z A;  4YRH A;  2PDO A;  2QIR A;  2FSR A;  4NXY A;  4QB9 A;  2RC4 A;  4RS2 A;  2VZY A;  1SQH A;  2Z3O A;  5H86 A;  3W6X A;  4R3L A;  5G20 A;  4B13 A;  2NMT A;  2WSA A;  4L8A A;  1ON0 A;  1B6B A;  4HNX B;  4HNW B;  4QBJ A;  4PK2 A;  4Y49 B;  2OZG A;  5I0C A;  4J3G A;  1QSM A;  4PV6 A;  3IWE A;  4CGM A;  1J4J A;  2VZZ A;  3R95 A;  3R1K A;  2ZW4 A;  5AG6 A;  1PUA A;  2R1I A;  3OWC A;  4NSQ A;  4AB7 A;  1IYL A;  2ATR A;  4II9 A;  4KVM E;  1CJW A;  4CAX A;  3FBU A;  2HQY A;  5EBV A;  2EVN A;  2BUE A;  2VI7 A;  1M4G A;  4KOR A;  3G8W A;  2REE A;  4MFQ A;  4MY3 A;  4YFJ A;  1WWZ A;  2CNM A;  2PSW A;  1Q2D A;  3TT2 A;  2ZW6 A;  2YGW A;  1TIQ A;  1Y9W A;  2K5T A;  4H6Z A;  2ZPA A;  1YVK A;  3SXO A;  2YNC C;  5C88 A;  2Z3M A;  1IB1 E;  3W6S A;  1YR0 A;  2YNC A;  1WK4 A;  1YK3 A;  3C26 A;  2R7H A;  2YND A;  2DPS A;  4BMH A;  2J8R A;  3R9E A;  1NMT A;  1VKC A;  1S5K A;  2VXK A;  4Y49 C;  1V0C A;  5IB0 A;  5E96 A;  3IU2 A;  3PGP A;  4XPD B;  4C2Y A;  4KOU A;  1P4N A;  4JXR A;  2GE3 A;  1S3Z A;  2JLM A;  5F48 A;  4CS0 B;  3I9S A;  4FD7 A;  3EO4 A;  3V8I A;  3N7Z A;  2Q04 A;  2B3V A;  2QML A;  2B4B A;  3D2M A;  1KUX A;  4PSX A;  3TOA A;  2FT0 A;  2VQY A;  4KZT A;  4BBH A;  4M3S A;  4C7I A;  2I79 A;  3DR6 A;  4Q36 A;  3DDD A;  1MJ9 A;  2OU2 A;  4UBR A;  5DWM A;  3BLN A;  4ONU A;  2FXF A;  2GAN A;  2CXA A;  3UY5 A;  4KOY A;  5HMN A;  4QVT A;  5G1Z A;  2D4P A;  3SXN A;  1S7F A;  5G22 A;  5AG4 A;  3ZZI A;  4B12 A;  5A27 A;  4CGO A;  4JWP A;  4FD5 A;  2REF A;  4JLY A;  3TFY A;  2OZH A;  2FCK A;  4KOX A;  4NF1 A;  4XPD C;  1U6M A;  4IUS A;  1BOB A;  4R9M A;  2Z3K A;  1NE9 A;  1YLE A;  1YRE A;  4KVO E;  4R57 A;  3GY9 A;  4CRZ B;  4JJX A;  1Q2C A;  2X7B A;  3FIX A;  4PK3 A;  4CAV A;  5F46 A;  1M4I A;  3DSB A;  4R3K A;  5BWA B;  2B4D A;  1Z9U A;  2Z0Z A;  4R87 A;  3LD2 A;  1VHS A;  5KTA A;  2H5M A;  2PRB A;  2WPX A;  5G21 A;  2B3U A;  2J8N A;  1QSO A;  4FD6 A;  1P0H A;  2VBQ A;  1OZP A;  4E0A A;  3T9Y A;  4JD6 A;  1S7N A;  3R9G A;  4QC6 A;  1NSL A;  3P2H A;  3S6F A;  3KKW A;  2G0B A;  1MJA A;  2F5I A;  4CAE A;  4B14 A;  4KLW A;  3CXS A;  4MFK A;  3FNC A;  2FIW A;  4EVY A;  5HH1 A;  2J8M A;  1XIX A;  2A4N A;  3S6H A;  4Q38 A;  4CRY B;  1LRZ A;  4HKF A;  1Y7R A;  3TO7 A;  2DXQ A;  3FB3 A;  3DR8 A;  4QUS A;  4XPK A;  3T90 A;  3BJ8 A;  3EFA A;  1Q2Y A;  1I21 A;  4A32 A;  1QSR A;  1Z4R A;  4JXQ A;  2P6E A;  4ZBG A;  1RXT A;  2OB0 A;  3R96 A;  4AG9 A;  4CYP A;  4ZGY B;  2Z3P A;  1L0C A;  5AG7 A;  3TCV A;  4KOS A;  4B11 A;  4UCM A;  3F0A A;  4AG7 A;  3S6G A;  2B4D B;  2Z3N A;  3PP9 A;  3H5Z A;  2Q7B A;  1RO5 A;  5IV0 A;  2P6G A;  1XMT A;  1IIC A;  3JVN A;  3DNS A;  2DPT A;  2HV2 A;  3H4Q A;  4X5K A;  1B87 A;  3TO9 A;  2FS5 A;  3E0K A;  4L89 A;  4E2A A;  2Y0M A;  4C2X A;  4U9Y A;  4MFJ A;  4KS9 A;  2C27 A;  4IF5 A;  2PR1 A;  2QEC A;  3S6K A;  3TE4 A;  1PU9 A;  2BL1 A;  3B8G A;  4B5P A;  2CNS A;  4XNH B;  3EC4 A;  1S7L A;  4MFP A;  3EXN A;  3VWD A;  2R98 A;  3D3S A;  2ZW5 A;  4C7H A;  2YNE A;  4UFW A;  1QSN A;  4KUB A;  4B5O A;  3JUW A;  4C2Z A;  5H84 A;  2O28 A;  1XF8 A;  4NEX A;  3RYO A;  5IX3 A;  5J8F A;  4CYQ A;  1FY7 A;  3CXP A;  1S7K A;  5J8C A;  4A33 A;  2ZXV A;  4F0Y A;  3LOD A;  3TO6 A;  3FXT A;  4DNC A;  4H6U A;  4H89 A;  4PSW A;  4AVA A;  2Q44 A;  3MGD A;  4CYN A;  2FIA A;  2R8V A;  5AG5 A;  1M4D A;  4UFX A;  4CYO A;  2CY2 A;  2OH1 A;  4F0X A;  3IU1 A;  2ZW7 A;  2Q0Y A;  1M44 A;  2ARH A;  4KUA A;  3SHP A;  3F5B A;  4KSA A;  4K30 A;  3TTH A;  1MK4 A;  2PR8 A;  2Z10 A;  4MBU A;  2FE7 A;  2IL4 A;  4OAD A;  4XNH C;  4MFL A;  2JDC A;  4YGO A;  3A9L A;  2KCW A;  2B58 A;  4UWJ A;  5ISV A;  5C82 A;  4FD4 A;  2Q4Y A;  1GHE A;  2B5G A;  1I12 A;  4CAF A;  1YX0 A;  4KLV A;  3R9F A;  4U5Y A;  5A28 A;  4B5P B;  1ZO0 A;  5GCN A;  1BO4 A;  4A31 A;  1KUY A;  4GS4 A;  2GIV A;  2BSW A;  3EY5 A;  1R57 A;  1I1D A;  4KOW A;  2Q4V A;  5KTC A;  3VWE A;  1S60 A;  4HNY B;  2JEV A;  3CXQ A;  4KSF A;  3K9U A;  1Y9K A;  2BEI A;  4CGP A;  3QAH A;  5F47 A;  5FVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...