4B12A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 23)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 118
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b12A00
4A31A 5G21A 4A33A 4UFVA 4CGNA 4UCNA 5AG4A 2WSAA 4C68A 4C7IA 3IWEA 3IU2A 4CGMA 3H5ZA 2YNDA 4UCMA 4CYPA 4B11A 2YNEA 4CYNA 2YNCA 4UFXA 4C2ZA 4B13A 4CGOA 5A27A 4B14A 4CAFA 4CAEA 4A32A 4C2XA 2WUUA 3JTKA 5AGEA 4CGPA 5AG5A 4B10A 5G22A 5AG7A 4B12A 4C2YA 2YNCC 4A2ZA 4CYOA 4A30A 4BBHA 4CGLA 4A95A 3IU1A 4UFWA 5A28A 4CYQA 4C7HA 4UCPA 5G20A 5AG6A 5G1ZA
chains in the Genus database with same CATH superfamily
1JWQA 4EVYA 4A94A 5C88A 3SJGA 4MBUA 2YNDA 3TTHA 4KLWA 4R9MA 2BL1A 3TOBA 2VXKA 1Q2DA 5E96A 3SI0A 3S9LA 1ARMA 4GS4A 1IY7A 2I00A 8CPAA 2Z3LA 2C27A 1I21A 1NSAA 3KR5A 5F47A 5IB0A 3H8GA 4NGPA 2ZPAA 3CPXA 2YGWA 3EY5A 3PB6X 1TF9A 2WPWA 2BOAA 3NE7A 1Y7EA 4MHPA 3G3SA 2J8NA 3B2YA 4CAXA 3KGQA 3D7DA 1KZFA 1LCPA 3FIXA 3PBEA 3IIBA 2GANA 5JM6A 4KOUA 1Z4RA 1WWZA 2VBQA 5HVGA 2OB0A 3SXOA 3B35A 2B5GA 3KZWA 4IHMA 3N7ZA 4OLLA 4O23A 1Q2YA 3D67A 4KOTA 5HH1A 4B14A 5K8NA 2FT0A 5KTDA 4KUBA 1M1DA 4CAVA 2Z3KA 4B5PB 4QC6A 2BUEA 2DF5A 5IB9A 4PPZA 2JBJA 4QUSA 2PIYA 3VH9A 5LYLA 2REFA 2Q04A 4NGRA 4UF4A 3IC1A 1N71A 2AFMA 3TO9A 2B5GB 2PJAA 4KS9A 4QVTA 2D4OA 4ZGYB 5IV0A 4BINA 2OR4A 3I9SA 3NFZA 4HNXB 2CTBA 4MFZA 4JJXA 5G1ZA 4ZY1A 1KWMA 4HNYB 3H8EA 1LAMA 4AG7A 3L2NA 2CNMA 4KVME 3PBBA 2V8VA 3DSBA 3BJ8A 2YNCA 4FD5A 4UFXA 4CGOA 3PP9A 4NSQA 1ZG9A 2DXQA 3HLPA 3R1KA 4UBRA 4QBJA 2PJ6A 3TE4A 3H8FA 2PJBA 2ZEFA 4M85A 2ZEOA 4MHDA 2YNCC 4A2ZA 1XE4A 1OBRA 3RNZA 4MJ8A 4NGTA 1LFWA 2Q7BA 5K8PA 5LYFA 2VQYA 2WPXA 4A38A 1LANA 1ELLP 4RUHA 2EO8A 1S5KA 2AFZA 4YWYA 5AG4A 4A31A 1XIXA 1BPMA 2B4BA 2DPTA 3EFAA 2NSMA 3WC6A 3F8KA 2ZEGA 1XJOA 3PEIA 4P44A 3DR6A 2ZOGA 2OZHA 4UCMA 1IYLA 2Q0YA 1J4JA 1TF8A 2GU2A 2P6FA 3CZXA 4NJQA 4UEEA 3JUWA 4CAFA 5KTAA 4NXYA 3K9TA 1HDUA 2ZEHA 4FUUA 4MCPA 2RB7A 1IIDA 4NF1A 4OADA 2OZGA 4R3LA 2CNSA 4NJRA 4FAIA 4IF5A 4OC3A 2BEIA 2C6PA 3TCVA 2PRQA 3MRUA 4H89A 2D4PA 1ZG8A 4YGOA 1Y0RA 2DEAA 1XFOA 2OOTA 4CYQA 3FX6A 3D3SA 5LYIA 3PGPA 4BD9A 4ZY2A 5A28A 5HXDA 1RXTA 3TC8A 1YW6A 4JLYA 4ONWA 4P45A 1UFHA 4UWIA 2HV2A 4KSIA 1Z2LA 4NGQA 1ELMP 1YSJA 3IWGA 3S6GA 2B58A 4F8ZA 3GKRA 3MN8A 5AG5A 2OH1A 1EE3P 3S6FA 3GYAA 4F9VA 5DS0A 1F57A 4CYOA 1KUXA 1ZLHA 3CXPA 3CT9A 1NSLA 2GFQA 1U6MA 2BSWA 2P6GA 3FVLA 4P4DA 3KHZA 4UIAA 3T8WA 1CP6A 3KQXA 4I49A 3B3CA 1X10A 1QSMA 3PFOA 2GIVA 2F7VA 1MJBA 1VIXA 3FF3A 4FD4A 3RBUA 3S6HA 4HNWB 2O53A 4K30A 4MFPA 1OZPA 4PK2A 3JVNA 5F09A 2AFUA 4MFJA 4UWJA 2ZEPA 1Z9UA 3D2PA 4R7MA 5ELYA 3R96A 2CY2A 4B12A 2B3UA 2ZOFA 4UIBA 2PR1A 1L0CA 4MHZA 2GREA 3DLJA 4KOYA 4KOVA 5I4MA 2PQ8A 4XPLA 1QSNA 3SI1A 5C82A 4NFRA 2CXAA 2JDCA 5JPHA 1PCAA 1XMBA 3IJ3A 4XNHB 3PB7X 4DYOA 1FNOA 2Q44A 2C6GA 4PSXA 5THWA 4PXBA 4UCNA 3ZZIA 4A33A 4B5PA 4MMOA 1S7NA 3D68A 2Z3NA 2G0BA 4P6YA 3GUXA 4KSFA 4OP4A 2IMOA 3OWCA 1YR0A 4A39A 4MHYA 4AVAA 3CPAA 1TIQA 3DR8A 1F2PA 2Q4YA 2IJZA 4P4IA 4NGNA 4X2TA 1MK4A 3B7IA 4X5KA 1H8LA 1QSRA 2PJ5A 4AG9A 3LACA 3TOAA 4CPAA 1Y9WA 2EK8A 2Z10A 2I79A 2J8MA 4KORA 1BLLE 2PJ3A 5CBMA 1XEBA 2Q43A 1GHEA 3FEEA 3B8GA 3R95A 1AUGA 4F0YA 1I1DA 4UFVA 3WC7A 2CIJA 4KVOE 2PJ8A 2VL1A 2ZEEA 2EVNA 1AMPA 4P4FA 4R87A 1IOFA 2QJ8A 4ZX9A 4KZTA 4B11A 3V8IA 2JEVA 3EXNA 5A27A 1DTDA 2Q7SA 3PB4X 5AGEA 1K4JA 4WWVA 1Z4EA 3DDDA 3K9UA 4MRIA 3BJ7A 2G3AA 3BI1A 3I3GA 4KLVA 3E0KA 4ONUA 4C2YA 1R3NA 2PJCA 5LRGA 3FRMA 2RFHA 2Q51A 3BHXA 3VARA 4Q38A 1PUAA 3C26A 3DGVA 3IU1A 3PFEA 4U9YA 3S9MA 5HMNA 3FJUA 2BCOA 3VWDA 3B3VA 3SHPA 2O28A 3RO0A 2I3CA 4PV6A 4R3KA 4ZBGA 3BXMA 1XMTA 3RYOA 1PYTB 2A4NA 1FT7A 4OC2A 3WC5A 2PJ9A 1BOBA 3JRUA 2R7HA 3KR4A 1YW4A 4MXUA 2ZEMA 4OKOA 4AB7A 3FECA 4OIWA 3WT4A 2PJ1A 2AJ6A 4P4EA 3IFEA 3D66A 4KOWA 1GYTA 2PVVA 3EC4A 3LMSA 2Z3OA 3KASA 2WUUA 1CX8A 3K2KA 3KL9A 3S6KA 2F8HA 4P4BA 4E0AA 4H6UA 1ZG7A 4Z65A 5AG7A 1VHOA 1IU8A 1CPXA 3FNCA 3LD2A 2J9AA 3D7FA 1S3ZA 2VZYA 3ISXA 4Q7AA 4LQGA 3SI2A 2C1CA 4DJLA 2XEIA 5EMIA 3HUVA 5CNPA 2V8GA 3BLNA 4G1PA 4UCPA 3I1UA 3CXQA 1P0HA 2ANPA 2C6CA 4R6TA 5DWMA 4MFQA 4NGSA 4LUAA 3T9YA 3P2FA 4HPSA 5J8CA 3B3SA 2WSAA 1YLEA 1SQHA 3SJXA 1Z8XA 2Z3MA 1RTQA 2Q4VA 4W9YA 2HC9A 1M4LA 4BMHA 1QMUA 1YLOA 2XEJA 3CXSA 1LAPA 3FEDA 2G9DA 2ODFA 5FVJA 3R9GA 1FY7A 1XBUA 1YVKA 5HVHA 4MFLA 2PR8A 2EK9A 3KI9A 3WABA 2AFWA 1CM0A 2R98A 4UA3A 4H2KA 5K8MA 4RN7A 1VGYA 3H4QA 3MGDA 4L89A 4XPDB 1QSOA 5GCNA 3ZJ0A 3EO4A 2V8HA 1KUVA 1S7LA 3IO1A 4P10A 4Y49C 1ARLA 1IICA 2B3VA 2PJ7A 2Y0MA 2PJ4A 4A95A 4XPKA 1S60A 3TO7A 2EUIA 5G20A 4GXHA 3TO6A 4JYWA 4Y49B 1CBXA 2P6EA 4IUSA 3NH5A 5AG6A 2PJ2A 5HVFA 2ATRA 3TT2A 3NH4A 4CS0B 1CJWA 4U5YA 1CP7A 2NYQA 2JDDA 4CYPA 4PXDA 3N5FA 4WJBA 2FXFA 2FIWA 1KUYA 2FIAA 4MCRA 3KKWA 4F0XA 5D8NA 1JQGA 2PC1A 2XEGA 4CAEA 4F9UA 4MFKA 3KHXA 4MHNA 5JH9A 2Q4ZA 4FBEA 3IWWA 2K5TA 2QVPA 4JD6A 4XNHC 2GLJA 1NMTA 3B3TA 2Z3PA 3NA6A 4A37A 4PSWA 4YRHA 2RC4A 2R8VA 4GM5A 5H86A 4PQAA 1P4NA 2FS5A 3BI0A 4DNCA 1IB1E 2POKA 3VATA 3A9LA 1YGHA 1TKHA 3GIUA 3B3WA 2FCKA 2VI7A 4OC0A 2FVGA 1VHSA 3PRTA 3F5BA 4R76A 5H84A 1ZLIA 4NGMA 2AFXA 4IK2A 3RAMA 1Y9KA 4M6HA 4YU9A 2FSRA 2KCWA 4ORFA 4FWUA 1MJ9A 1YX0A 5CPAA 2PVWA 1LRZA 4OC4A 4J3GA 3LWUA 4B10A 4CRZB 5JQ4A 3QNVA 4M6GA 1Z8WA 5F49A 4HKFA 3SJFA 2OZUA 3V38A 4B5OA 4E2AA 1Z5RA 2IL4A 3D4UA 3ISZA 3PB9X 1LOKA 1Q2CA 3PB8X 4R57A 5EBVA 2WZNA 1HEEA 2V8DA 3VWEA 4RS2A 4M6IA 1PU9A 5EC4A 5G21A 1RO5A 2PRBA 4IAVA 4ZY0A 4JXRA 5F46A 1CG2A 3F0AA 2AE6A 4AXVA 1YQEA 2YNEA 2Z0ZA 2EBJA 3NH8A 1BPNA 1S7KA 2PE3A 4TWEA 2ZELA 2PCUA 2GLFA 1M4IA 1XOVA 3KQZA 1ON0A 3W6XA 4A32A 4CGPA 3RZAA 4CRYB 2PSWA 2ZW6A 1I12A 2QECA 4EMEA 1YK3A 4RI1A 2IQ6A 2XEFA 3PZJA 4QB9A 1BAVA 1TXRA 4R8FA 2CTCA 2G3TA 3SJEA 4PK3A 1IOIA 7CPAA 3G8WA 1BO4A 1HDQA 1YVOA 1X12A 3LODA 4Q36A 4MY3A 4UFWA 4DUKA 2HQYA 3QAYA 3FYNA 4KOSA 4U9ZA 1Y7RA 5IX3A 1ZO0A 2HUZA 3W91A 4EWTA 1UWYA 1Z8TA 4KVXA 2J8RA 1QSTA 2PDOA 2QIRA 3CDXA 2ZXVA 4AVBA 4MCSA 5BWAB 3H5ZA 2PIZA 3R9FA 3GB0A 2ARHA 4K3NA 4LQ6A 5LRKA 4NCZA 5LRJA 4JWPA 4B13A 4MY0A 4NEXA 4C2XA 3NE8A 5F48A 1TKJA 2QYVA 4UEZA 1TKFA 1XRYA 1M4GA 3IEHA 4A30A 2FE7A 3TFYA 4BBHA 1R43A 4OC5A 4UEFA 3TX8A 3DNSA 4LX9A 2ZW7A 4TNUA 4ZI6A 1M44A 2AFSA 2WYRA 2VZZA 3D8PA 4P4JA 5I0CA 3GY9A 4EFDA 1VHEA 1YMEA 2NMTA 4CGNA 4JZ0A 3V7ZA 4ZX8A 3IWEA 2P0WA 2EWBA 4L8AA 3UY5A 1AYEA 1B6BA 1V0CA 3QB8A 5K8OA 4FD7A 2R1IA 3T90A 2PJ0A 3D7HA 2X7BA 1VKCA 2BO9A 3JTKA 2DPSA 2OU2A 4XPDC 4AVCA 1M4DA 2ZENA 5LYDA 4CAWA 1CPSA 3GLJA 3WR7A 5G22A 2ZW4A 2H5MA 2F5IA 4F6AA 1B87A 4KUAA 2ZW5A 1S7FA 4YFJA 1Y0YA 5KTCA 2FL4A 2JBKA 1A2ZA 4KOXA 4CGLA 4JXQA 1NE9A 2Z11A 2ABZA 2B4DA 2ZEDA 2AFOA 3D7GA 1Q7LA 2O4HA 4OAEA 3P2HA 3FXTA 1R57A 2CF4A 5D29A 4H6ZA 4KSAA 4ZYQA 3FH4A 5DWNA 4C68A 4C7IA 4CGMA 3IU2A 5JGFA 1DE4C 3QAHA 4II9A 4OC1A 4CYNA 3FBUA 4B6ZA 2JEWA 3IGRA 4MI4A 1XF8A 4C2ZA 2B4DB 1F2OA 1Z8LA 3D2MA 4E8OA 2V77A 4X8IA 4OMEA 1IGBA 2HB6A 2QMLA 4FD6A 3SXNA 3S9NA 3FMCA 5J8FA 1WK4A 5ISVA 1IYKA 5J1QA 2JLMA 4M3SA 1QQ9A 3FB3A 4PXEA 2REEA 4PXCA 3W6SA 4X3RA 1MJAA 4MCQA 3R9EA 2CNTA 2GE3A 2VEZA 4OIDA 4C7HA 6CPAA 1YREA
chains in the Genus database with same CATH topology
4EVYA 5C88A 4MBUA 2YNDA 3TTHA 4KLWA 4R9MA 2BL1A 3TOBA 2VXKA 1Q2DA 5E96A 4GS4A 2I00A 2Z3LA 2C27A 1I21A 5F47A 5IB0A 2ZPAA 2YGWA 3EY5A 2WPWA 3NE7A 3G3SA 2J8NA 4CAXA 1KZFA 3FIXA 2GANA 4KOUA 1Z4RA 1WWZA 2VBQA 2OB0A 3SXOA 2B5GA 3N7ZA 4OLLA 1Q2YA 4KOTA 5HH1A 4B14A 2FT0A 5KTDA 4KUBA 1M1DA 4CAVA 2Z3KA 4B5PB 4QC6A 2BUEA 4QUSA 2REFA 2Q04A 1N71A 3TO9A 2B5GB 4KS9A 4QVTA 2D4OA 4ZGYB 5IV0A 3I9SA 4HNXB 5G1ZA 4MFZA 4JJXA 4HNYB 4AG7A 2CNMA 4KVME 3DSBA 3BJ8A 2YNCA 4FD5A 4UFXA 4CGOA 3PP9A 4NSQA 2DXQA 3R1KA 4UBRA 4QBJA 3TE4A 4M85A 4MHDA 2YNCC 4A2ZA 1XE4A 4MJ8A 2Q7BA 2VQYA 2WPXA 1S5KA 5AG4A 4A31A 1XIXA 2B4BA 2DPTA 3EFAA 3F8KA 3DR6A 2OZHA 4UCMA 1IYLA 2Q0YA 1J4JA 2P6FA 3JUWA 4CAFA 5KTAA 4NXYA 1IIDA 4NF1A 4OADA 2OZGA 4R3LA 2CNSA 4IF5A 2BEIA 3TCVA 4H89A 2D4PA 4YGOA 4CYQA 3D3SA 3PGPA 5A28A 1RXTA 4JLYA 1UFHA 4UWIA 2HV2A 3IWGA 3S6GA 2B58A 3GKRA 5AG5A 2OH1A 3S6FA 3GYAA 4CYOA 1KUXA 3CXPA 1NSLA 1U6MA 2BSWA 2P6GA 4I49A 1QSMA 2GIVA 1MJBA 4FD4A 3S6HA 4HNWB 4K30A 4MFPA 1OZPA 4PK2A 3JVNA 4MFJA 4UWJA 1Z9UA 3D2PA 3R96A 2CY2A 4B12A 2B3UA 2PR1A 1L0CA 4KOYA 4KOVA 2PQ8A 4XPLA 1QSNA 5C82A 2CXAA 2JDCA 5JPHA 4XNHB 2Q44A 4PSXA 4A33A 4B5PA 4UCNA 3ZZIA 1S7NA 2Z3NA 2G0BA 4KSFA 3OWCA 1YR0A 4AVAA 1TIQA 3DR8A 2Q4YA 1MK4A 4X5KA 1QSRA 4AG9A 3TOAA 1Y9WA 2Z10A 2I79A 2J8MA 4KORA 1XEBA 1GHEA 3B8GA 3R95A 4F0YA 1I1DA 4UFVA 4KVOE 2EVNA 4R87A 4KZTA 4B11A 3V8IA 2JEVA 3EXNA 5A27A 5AGEA 1K4JA 1Z4EA 3DDDA 3K9UA 3BJ7A 2G3AA 3I3GA 4ONUA 4KLVA 3E0KA 4C2YA 3FRMA 4Q38A 1PUAA 3C26A 3IU1A 4U9YA 5HMNA 3VWDA 3SHPA 2O28A 4PV6A 4R3KA 4ZBGA 1XMTA 3RYOA 2A4NA 1BOBA 2R7HA 4AB7A 2AJ6A 4KOWA 3EC4A 2Z3OA 2WUUA 3S6KA 4E0AA 4H6UA 5AG7A 3FNCA 3LD2A 1S3ZA 2VZYA 5CNPA 3BLNA 4UCPA 5DWMA 4F6AA 3CXQA 1P0HA 4MFQA 3T9YA 4LUAA 5J8CA 3P2FA 2WSAA 1YLEA 1SQHA 2Z3MA 2Q4VA 4BMHA 5FVJA 3CXSA 3R9GA 1FY7A 1YVKA 4MFLA 2PR8A 1CM0A 2R98A 4UA3A 3MGDA 3H4QA 4L89A 4XPDB 5GCNA 1QSOA 3ZJ0A 3EO4A 1KUVA 1S7LA 4Y49C 2B3VA 1IICA 2Y0MA 4A95A 4XPKA 1S60A 3TO7A 2EUIA 5G20A 3TO6A 4Y49B 5AG6A 2P6EA 4IUSA 3TT2A 2ATRA 4CS0B 1CJWA 4U5YA 2JDDA 4CYPA 2FXFA 2FIWA 1KUYA 2FIAA 4F0XA 3KKWA 2PC1A 4CAEA 4MFKA 2K5TA 4JD6A 4XNHC 1NMTA 2Z3PA 4PSWA 4YRHA 2RC4A 2R8VA 5H86A 1P4NA 2FS5A 4DNCA 1IB1E 3A9LA 1YGHA 2FCKA 2VI7A 1VHSA 3F5BA 5H84A 1Y9KA 2FSRA 2KCWA 4ORFA 1MJ9A 1YX0A 5JQ4A 1LRZA 4B10A 4J3GA 4CRZB 5F49A 4HKFA 4B5OA 2OZUA 4E2AA 2IL4A 1Q2CA 5EBVA 4R57A 3VWEA 4RS2A 5EC4A 1PU9A 5G21A 1RO5A 2PRBA 4JXRA 5F46A 3F0AA 2AE6A 2YNEA 2Z0ZA 1S7KA 1M4IA 4A32A 3W6XA 1ON0A 4CGPA 4CRYB 2PSWA 2ZW6A 1I12A 2QECA 1YK3A 4RI1A 4QB9A 3PZJA 2G3TA 4PK3A 3G8WA 1BO4A 1YVOA 3LODA 4Q36A 4MY3A 4UFWA 2HQYA 4U9ZA 3FYNA 4KOSA 5IX3A 1Y7RA 1ZO0A 2HUZA 3W91A 4KVXA 2J8RA 1QSTA 2PDOA 2QIRA 2ZXVA 4AVBA 5BWAB 3H5ZA 3R9FA 2ARHA 4NCZA 4B13A 4JWPA 4MY0A 4NEXA 4C2XA 5F48A 1M4GA 4A30A 2FE7A 3TFYA 4BBHA 3DNSA 4LX9A 2ZW7A 1M44A 2VZZA 3D8PA 5I0CA 3GY9A 2NMTA 4CGNA 3IWEA 2P0WA 3UY5A 4L8AA 1B6BA 1V0CA 3QB8A 4FD7A 2R1IA 3T90A 2X7BA 1VKCA 3JTKA 2DPSA 2OU2A 4XPDC 4AVCA 1M4DA 4CAWA 3WR7A 5G22A 2ZW4A 2H5MA 2F5IA 1B87A 4KUAA 2ZW5A 1S7FA 4YFJA 5KTCA 2FL4A 4KOXA 4CGLA 4JXQA 1NE9A 2Z11A 2B4DA 4OAEA 3P2HA 3FXTA 1R57A 4H6ZA 4KSAA 5DWNA 4C68A 4C7IA 4CGMA 3IU2A 3QAHA 4II9A 4CYNA 3FBUA 3IGRA 4MI4A 1XF8A 4C2ZA 2B4DB 3D2MA 4E8OA 2QMLA 4FD6A 3SXNA 5J8FA 1WK4A 5ISVA 1IYKA 2JLMA 4M3SA 3FB3A 2REEA 3W6SA 1MJAA 3R9EA 2CNTA 2GE3A 2VEZA 4C7HA 1YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A31 A;  5G21 A;  4A33 A;  4UFV A;  4CGN A;  4UCN A;  5AG4 A;  2WSA A;  4C68 A;  4C7I A;  3IWE A;  3IU2 A;  4CGM A;  3H5Z A;  2YND A;  4UCM A;  4CYP A;  4B11 A;  2YNE A;  4CYN A;  2YNC A;  4UFX A;  4C2Z A;  4B13 A;  4CGO A;  5A27 A;  4B14 A;  4CAF A;  4CAE A;  4A32 A;  4C2X A;  2WUU A;  3JTK A;  5AGE A;  4CGP A;  5AG5 A;  4B10 A;  5G22 A;  5AG7 A;  4B12 A;  4C2Y A;  2YNC C;  4A2Z A;  4CYO A;  4A30 A;  4BBH A;  4CGL A;  4A95 A;  3IU1 A;  4UFW A;  5A28 A;  4CYQ A;  4C7H A;  4UCP A;  5G20 A;  5AG6 A;  5G1Z A; 
#chains in the Genus database with same CATH topology
 1JWQ A;  4EVY A;  4A94 A;  5C88 A;  3SJG A;  4MBU A;  2YND A;  3TTH A;  4KLW A;  4R9M A;  2BL1 A;  3TOB A;  2VXK A;  1Q2D A;  5E96 A;  3SI0 A;  3S9L A;  1ARM A;  4GS4 A;  1IY7 A;  2I00 A;  8CPA A;  2Z3L A;  2C27 A;  1I21 A;  1NSA A;  3KR5 A;  5F47 A;  5IB0 A;  3H8G A;  4NGP A;  2ZPA A;  3CPX A;  2YGW A;  3EY5 A;  3PB6 X;  1TF9 A;  2WPW A;  2BOA A;  3NE7 A;  1Y7E A;  4MHP A;  3G3S A;  2J8N A;  3B2Y A;  4CAX A;  3KGQ A;  3D7D A;  1KZF A;  1LCP A;  3FIX A;  3PBE A;  3IIB A;  2GAN A;  5JM6 A;  4KOU A;  1Z4R A;  1WWZ A;  2VBQ A;  5HVG A;  2OB0 A;  3SXO A;  3B35 A;  2B5G A;  3KZW A;  4IHM A;  3N7Z A;  4OLL A;  4O23 A;  1Q2Y A;  3D67 A;  4KOT A;  5HH1 A;  4B14 A;  5K8N A;  2FT0 A;  5KTD A;  4KUB A;  1M1D A;  4CAV A;  2Z3K A;  4B5P B;  4QC6 A;  2BUE A;  2DF5 A;  5IB9 A;  4PPZ A;  2JBJ A;  4QUS A;  2PIY A;  3VH9 A;  5LYL A;  2REF A;  2Q04 A;  4NGR A;  4UF4 A;  3IC1 A;  1N71 A;  2AFM A;  3TO9 A;  2B5G B;  2PJA A;  4KS9 A;  4QVT A;  2D4O A;  4ZGY B;  5IV0 A;  4BIN A;  2OR4 A;  3I9S A;  3NFZ A;  4HNX B;  2CTB A;  4MFZ A;  4JJX A;  5G1Z A;  4ZY1 A;  1KWM A;  4HNY B;  3H8E A;  1LAM A;  4AG7 A;  3L2N A;  2CNM A;  4KVM E;  3PBB A;  2V8V A;  3DSB A;  3BJ8 A;  2YNC A;  4FD5 A;  4UFX A;  4CGO A;  3PP9 A;  4NSQ A;  1ZG9 A;  2DXQ A;  3HLP A;  3R1K A;  4UBR A;  4QBJ A;  2PJ6 A;  3TE4 A;  3H8F A;  2PJB A;  2ZEF A;  4M85 A;  2ZEO A;  4MHD A;  2YNC C;  4A2Z A;  1XE4 A;  1OBR A;  3RNZ A;  4MJ8 A;  4NGT A;  1LFW A;  2Q7B A;  5K8P A;  5LYF A;  2VQY A;  2WPX A;  4A38 A;  1LAN A;  1ELL P;  4RUH A;  2EO8 A;  1S5K A;  2AFZ A;  4YWY A;  5AG4 A;  4A31 A;  1XIX A;  1BPM A;  2B4B A;  2DPT A;  3EFA A;  2NSM A;  3WC6 A;  3F8K A;  2ZEG A;  1XJO A;  3PEI A;  4P44 A;  3DR6 A;  2ZOG A;  2OZH A;  4UCM A;  1IYL A;  2Q0Y A;  1J4J A;  1TF8 A;  2GU2 A;  2P6F A;  3CZX A;  4NJQ A;  4UEE A;  3JUW A;  4CAF A;  5KTA A;  4NXY A;  3K9T A;  1HDU A;  2ZEH A;  4FUU A;  4MCP A;  2RB7 A;  1IID A;  4NF1 A;  4OAD A;  2OZG A;  4R3L A;  2CNS A;  4NJR A;  4FAI A;  4IF5 A;  4OC3 A;  2BEI A;  2C6P A;  3TCV A;  2PRQ A;  3MRU A;  4H89 A;  2D4P A;  1ZG8 A;  4YGO A;  1Y0R A;  2DEA A;  1XFO A;  2OOT A;  4CYQ A;  3FX6 A;  3D3S A;  5LYI A;  3PGP A;  4BD9 A;  4ZY2 A;  5A28 A;  5HXD A;  1RXT A;  3TC8 A;  1YW6 A;  4JLY A;  4ONW A;  4P45 A;  1UFH A;  4UWI A;  2HV2 A;  4KSI A;  1Z2L A;  4NGQ A;  1ELM P;  1YSJ A;  3IWG A;  3S6G A;  2B58 A;  4F8Z A;  3GKR A;  3MN8 A;  5AG5 A;  2OH1 A;  1EE3 P;  3S6F A;  3GYA A;  4F9V A;  5DS0 A;  1F57 A;  4CYO A;  1KUX A;  1ZLH A;  3CXP A;  3CT9 A;  1NSL A;  2GFQ A;  1U6M A;  2BSW A;  2P6G A;  3FVL A;  4P4D A;  3KHZ A;  4UIA A;  3T8W A;  1CP6 A;  3KQX A;  4I49 A;  3B3C A;  1X10 A;  1QSM A;  3PFO A;  2GIV A;  2F7V A;  1MJB A;  1VIX A;  3FF3 A;  4FD4 A;  3RBU A;  3S6H A;  4HNW B;  2O53 A;  4K30 A;  4MFP A;  1OZP A;  4PK2 A;  3JVN A;  5F09 A;  2AFU A;  4MFJ A;  4UWJ A;  2ZEP A;  1Z9U A;  3D2P A;  4R7M A;  5ELY A;  3R96 A;  2CY2 A;  4B12 A;  2B3U A;  2ZOF A;  4UIB A;  2PR1 A;  1L0C A;  4MHZ A;  2GRE A;  3DLJ A;  4KOY A;  4KOV A;  5I4M A;  2PQ8 A;  4XPL A;  1QSN A;  3SI1 A;  5C82 A;  4NFR A;  2CXA A;  2JDC A;  5JPH A;  1PCA A;  1XMB A;  3IJ3 A;  4XNH B;  3PB7 X;  4DYO A;  1FNO A;  2Q44 A;  2C6G A;  4PSX A;  5THW A;  4PXB A;  4UCN A;  3ZZI A;  4A33 A;  4B5P A;  4MMO A;  1S7N A;  3D68 A;  2Z3N A;  2G0B A;  4P6Y A;  3GUX A;  4KSF A;  4OP4 A;  2IMO A;  3OWC A;  1YR0 A;  4A39 A;  4MHY A;  4AVA A;  3CPA A;  1TIQ A;  3DR8 A;  1F2P A;  2Q4Y A;  2IJZ A;  4P4I A;  4NGN A;  4X2T A;  1MK4 A;  3B7I A;  4X5K A;  1H8L A;  1QSR A;  2PJ5 A;  4AG9 A;  3LAC A;  3TOA A;  4CPA A;  1Y9W A;  2EK8 A;  2Z10 A;  2I79 A;  2J8M A;  4KOR A;  1BLL E;  2PJ3 A;  5CBM A;  1XEB A;  2Q43 A;  1GHE A;  3FEE A;  3B8G A;  3R95 A;  1AUG A;  4F0Y A;  1I1D A;  4UFV A;  3WC7 A;  2CIJ A;  4KVO E;  2PJ8 A;  2VL1 A;  2ZEE A;  2EVN A;  1AMP A;  4P4F A;  4R87 A;  1IOF A;  2QJ8 A;  4ZX9 A;  4KZT A;  4B11 A;  3V8I A;  2JEV A;  3EXN A;  5A27 A;  1DTD A;  2Q7S A;  3PB4 X;  5AGE A;  1K4J A;  4WWV A;  1Z4E A;  3DDD A;  3K9U A;  4MRI A;  3BJ7 A;  2G3A A;  3BI1 A;  3I3G A;  4KLV A;  3E0K A;  4ONU A;  4C2Y A;  1R3N A;  2PJC A;  5LRG A;  3FRM A;  2RFH A;  2Q51 A;  3BHX A;  3VAR A;  4Q38 A;  1PUA A;  3C26 A;  3DGV A;  3IU1 A;  3PFE A;  4U9Y A;  3S9M A;  5HMN A;  3FJU A;  2BCO A;  3VWD A;  3B3V A;  3SHP A;  2O28 A;  3RO0 A;  2I3C A;  4PV6 A;  4R3K A;  4ZBG A;  3BXM A;  1XMT A;  3RYO A;  1PYT B;  2A4N A;  1FT7 A;  4OC2 A;  3WC5 A;  2PJ9 A;  1BOB A;  3JRU A;  2R7H A;  3KR4 A;  1YW4 A;  4MXU A;  2ZEM A;  4OKO A;  4AB7 A;  3FEC A;  4OIW A;  3WT4 A;  2PJ1 A;  2AJ6 A;  4P4E A;  3IFE A;  3D66 A;  4KOW A;  1GYT A;  2PVV A;  3EC4 A;  3LMS A;  2Z3O A;  3KAS A;  2WUU A;  1CX8 A;  3K2K A;  3KL9 A;  3S6K A;  2F8H A;  4P4B A;  4E0A A;  4H6U A;  1ZG7 A;  4Z65 A;  5AG7 A;  1VHO A;  1IU8 A;  1CPX A;  3FNC A;  3LD2 A;  2J9A A;  3D7F A;  1S3Z A;  2VZY A;  3ISX A;  4Q7A A;  4LQG A;  3SI2 A;  2C1C A;  4DJL A;  2XEI A;  5EMI A;  3HUV A;  5CNP A;  2V8G A;  3BLN A;  4G1P A;  4UCP A;  3I1U A;  3CXQ A;  1P0H A;  2ANP A;  2C6C A;  4R6T A;  5DWM A;  4MFQ A;  4NGS A;  4LUA A;  3T9Y A;  3P2F A;  4HPS A;  5J8C A;  3B3S A;  2WSA A;  1YLE A;  1SQH A;  3SJX A;  1Z8X A;  2Z3M A;  1RTQ A;  2Q4V A;  4W9Y A;  2HC9 A;  1M4L A;  4BMH A;  1QMU A;  1YLO A;  2XEJ A;  3CXS A;  1LAP A;  3FED A;  2G9D A;  2ODF A;  5FVJ A;  3R9G A;  1FY7 A;  1XBU A;  1YVK A;  5HVH A;  4MFL A;  2PR8 A;  2EK9 A;  3KI9 A;  3WAB A;  2AFW A;  1CM0 A;  2R98 A;  4UA3 A;  4H2K A;  5K8M A;  4RN7 A;  1VGY A;  3H4Q A;  3MGD A;  4L89 A;  4XPD B;  1QSO A;  5GCN A;  3ZJ0 A;  3EO4 A;  2V8H A;  1KUV A;  1S7L A;  3IO1 A;  4P10 A;  4Y49 C;  1ARL A;  1IIC A;  2B3V A;  2PJ7 A;  2Y0M A;  2PJ4 A;  4A95 A;  4XPK A;  1S60 A;  3TO7 A;  2EUI A;  5G20 A;  4GXH A;  3TO6 A;  4JYW A;  4Y49 B;  1CBX A;  2P6E A;  4IUS A;  3NH5 A;  5AG6 A;  2PJ2 A;  5HVF A;  2ATR A;  3TT2 A;  3NH4 A;  4CS0 B;  1CJW A;  4U5Y A;  1CP7 A;  2NYQ A;  2JDD A;  4CYP A;  4PXD A;  3N5F A;  4WJB A;  2FXF A;  2FIW A;  1KUY A;  2FIA A;  4MCR A;  3KKW A;  4F0X A;  5D8N A;  1JQG A;  2PC1 A;  2XEG A;  4CAE A;  4F9U A;  4MFK A;  3KHX A;  4MHN A;  5JH9 A;  2Q4Z A;  4FBE A;  3IWW A;  2K5T A;  2QVP A;  4JD6 A;  4XNH C;  2GLJ A;  1NMT A;  3B3T A;  2Z3P A;  3NA6 A;  4A37 A;  4PSW A;  4YRH A;  2RC4 A;  2R8V A;  4GM5 A;  5H86 A;  4PQA A;  1P4N A;  2FS5 A;  3BI0 A;  4DNC A;  1IB1 E;  2POK A;  3VAT A;  3A9L A;  1YGH A;  1TKH A;  3GIU A;  3B3W A;  2FCK A;  2VI7 A;  4OC0 A;  2FVG A;  1VHS A;  3PRT A;  3F5B A;  4R76 A;  5H84 A;  1ZLI A;  4NGM A;  2AFX A;  4IK2 A;  3RAM A;  1Y9K A;  4M6H A;  4YU9 A;  2FSR A;  2KCW A;  4ORF A;  4FWU A;  1MJ9 A;  1YX0 A;  5CPA A;  2PVW A;  1LRZ A;  4OC4 A;  4J3G A;  3LWU A;  4B10 A;  4CRZ B;  5JQ4 A;  3QNV A;  4M6G A;  1Z8W A;  5F49 A;  4HKF A;  3SJF A;  2OZU A;  3V38 A;  4B5O A;  4E2A A;  1Z5R A;  2IL4 A;  3D4U A;  3ISZ A;  3PB9 X;  1LOK A;  1Q2C A;  3PB8 X;  4R57 A;  5EBV A;  2WZN A;  1HEE A;  2V8D A;  3VWE A;  4RS2 A;  4M6I A;  1PU9 A;  5EC4 A;  5G21 A;  1RO5 A;  2PRB A;  4IAV A;  4ZY0 A;  4JXR A;  5F46 A;  1CG2 A;  3F0A A;  2AE6 A;  4AXV A;  1YQE A;  2YNE A;  2Z0Z A;  2EBJ A;  3NH8 A;  1BPN A;  1S7K A;  2PE3 A;  4TWE A;  2ZEL A;  2PCU A;  2GLF A;  1M4I A;  1XOV A;  3KQZ A;  1ON0 A;  3W6X A;  4A32 A;  4CGP A;  3RZA A;  4CRY B;  2PSW A;  2ZW6 A;  1I12 A;  2QEC A;  4EME A;  1YK3 A;  4RI1 A;  2IQ6 A;  2XEF A;  3PZJ A;  4QB9 A;  1BAV A;  1TXR A;  4R8F A;  2CTC A;  2G3T A;  3SJE A;  4PK3 A;  1IOI A;  7CPA A;  3G8W A;  1BO4 A;  1HDQ A;  1YVO A;  1X12 A;  3LOD A;  4Q36 A;  4MY3 A;  4UFW A;  4DUK A;  2HQY A;  3QAY A;  3FYN A;  4KOS A;  4U9Z A;  1Y7R A;  5IX3 A;  1ZO0 A;  2HUZ A;  3W91 A;  4EWT A;  1UWY A;  1Z8T A;  4KVX A;  2J8R A;  1QST A;  2PDO A;  2QIR A;  3CDX A;  2ZXV A;  4AVB A;  4MCS A;  5BWA B;  3H5Z A;  2PIZ A;  3R9F A;  3GB0 A;  2ARH A;  4K3N A;  4LQ6 A;  5LRK A;  4NCZ A;  5LRJ A;  4JWP A;  4B13 A;  4MY0 A;  4NEX A;  4C2X A;  3NE8 A;  5F48 A;  1TKJ A;  2QYV A;  4UEZ A;  1TKF A;  1XRY A;  1M4G A;  3IEH A;  4A30 A;  2FE7 A;  3TFY A;  4BBH A;  1R43 A;  4OC5 A;  4UEF A;  3TX8 A;  3DNS A;  4LX9 A;  2ZW7 A;  4TNU A;  4ZI6 A;  1M44 A;  2AFS A;  2WYR A;  2VZZ A;  3D8P A;  4P4J A;  5I0C A;  3GY9 A;  4EFD A;  1VHE A;  1YME A;  2NMT A;  4CGN A;  4JZ0 A;  3V7Z A;  4ZX8 A;  3IWE A;  2P0W A;  2EWB A;  4L8A A;  3UY5 A;  1AYE A;  1B6B A;  1V0C A;  3QB8 A;  5K8O A;  4FD7 A;  2R1I A;  3T90 A;  2PJ0 A;  3D7H A;  2X7B A;  1VKC A;  2BO9 A;  3JTK A;  2DPS A;  2OU2 A;  4XPD C;  4AVC A;  1M4D A;  2ZEN A;  5LYD A;  4CAW A;  1CPS A;  3GLJ A;  3WR7 A;  5G22 A;  2ZW4 A;  2H5M A;  2F5I A;  4F6A A;  1B87 A;  4KUA A;  2ZW5 A;  1S7F A;  4YFJ A;  1Y0Y A;  5KTC A;  2FL4 A;  2JBK A;  1A2Z A;  4KOX A;  4CGL A;  4JXQ A;  1NE9 A;  2Z11 A;  2ABZ A;  2B4D A;  2ZED A;  2AFO A;  3D7G A;  1Q7L A;  2O4H A;  4OAE A;  3P2H A;  3FXT A;  1R57 A;  2CF4 A;  5D29 A;  4H6Z A;  4KSA A;  4ZYQ A;  3FH4 A;  5DWN A;  4C68 A;  4C7I A;  4CGM A;  3IU2 A;  5JGF A;  1DE4 C;  3QAH A;  4II9 A;  4OC1 A;  4CYN A;  3FBU A;  4B6Z A;  2JEW A;  3IGR A;  4MI4 A;  1XF8 A;  4C2Z A;  2B4D B;  1F2O A;  1Z8L A;  3D2M A;  4E8O A;  2V77 A;  4X8I A;  4OME A;  1IGB A;  2HB6 A;  2QML A;  4FD6 A;  3SXN A;  3S9N A;  3FMC A;  5J8F A;  1WK4 A;  5ISV A;  1IYK A;  5J1Q A;  2JLM A;  4M3S A;  1QQ9 A;  3FB3 A;  4PXE A;  2REE A;  4PXC A;  3W6S A;  4X3R A;  1MJA A;  4MCQ A;  3R9E A;  2CNT A;  2GE3 A;  2VEZ A;  4OID A;  4C7H A;  6CPA A;  1YRE A; 
#chains in the Genus database with same CATH homology
 4EVY A;  5C88 A;  4MBU A;  2YND A;  3TTH A;  4KLW A;  4R9M A;  2BL1 A;  3TOB A;  2VXK A;  1Q2D A;  5E96 A;  4GS4 A;  2I00 A;  2Z3L A;  2C27 A;  1I21 A;  5F47 A;  5IB0 A;  2ZPA A;  2YGW A;  3EY5 A;  2WPW A;  3NE7 A;  3G3S A;  2J8N A;  4CAX A;  1KZF A;  3FIX A;  2GAN A;  4KOU A;  1Z4R A;  1WWZ A;  2VBQ A;  2OB0 A;  3SXO A;  2B5G A;  3N7Z A;  4OLL A;  1Q2Y A;  4KOT A;  5HH1 A;  4B14 A;  2FT0 A;  5KTD A;  4KUB A;  1M1D A;  4CAV A;  2Z3K A;  4B5P B;  4QC6 A;  2BUE A;  4QUS A;  2REF A;  2Q04 A;  1N71 A;  3TO9 A;  2B5G B;  4KS9 A;  4QVT A;  2D4O A;  4ZGY B;  5IV0 A;  3I9S A;  4HNX B;  5G1Z A;  4MFZ A;  4JJX A;  4HNY B;  4AG7 A;  2CNM A;  4KVM E;  3DSB A;  3BJ8 A;  2YNC A;  4FD5 A;  4UFX A;  4CGO A;  3PP9 A;  4NSQ A;  2DXQ A;  3R1K A;  4UBR A;  4QBJ A;  3TE4 A;  4M85 A;  4MHD A;  2YNC C;  4A2Z A;  1XE4 A;  4MJ8 A;  2Q7B A;  2VQY A;  2WPX A;  1S5K A;  5AG4 A;  4A31 A;  1XIX A;  2B4B A;  2DPT A;  3EFA A;  3F8K A;  3DR6 A;  2OZH A;  4UCM A;  1IYL A;  2Q0Y A;  1J4J A;  2P6F A;  3JUW A;  4CAF A;  5KTA A;  4NXY A;  1IID A;  4NF1 A;  4OAD A;  2OZG A;  4R3L A;  2CNS A;  4IF5 A;  2BEI A;  3TCV A;  4H89 A;  2D4P A;  4YGO A;  4CYQ A;  3D3S A;  3PGP A;  5A28 A;  1RXT A;  4JLY A;  1UFH A;  4UWI A;  2HV2 A;  3IWG A;  3S6G A;  2B58 A;  3GKR A;  5AG5 A;  2OH1 A;  3S6F A;  3GYA A;  4CYO A;  1KUX A;  3CXP A;  1NSL A;  1U6M A;  2BSW A;  2P6G A;  4I49 A;  1QSM A;  2GIV A;  1MJB A;  4FD4 A;  3S6H A;  4HNW B;  4K30 A;  4MFP A;  1OZP A;  4PK2 A;  3JVN A;  4MFJ A;  4UWJ A;  1Z9U A;  3D2P A;  3R96 A;  2CY2 A;  4B12 A;  2B3U A;  2PR1 A;  1L0C A;  4KOY A;  4KOV A;  2PQ8 A;  4XPL A;  1QSN A;  5C82 A;  2CXA A;  2JDC A;  5JPH A;  4XNH B;  2Q44 A;  4PSX A;  4A33 A;  4B5P A;  4UCN A;  3ZZI A;  1S7N A;  2Z3N A;  2G0B A;  4KSF A;  3OWC A;  1YR0 A;  4AVA A;  1TIQ A;  3DR8 A;  2Q4Y A;  1MK4 A;  4X5K A;  1QSR A;  4AG9 A;  3TOA A;  1Y9W A;  2Z10 A;  2I79 A;  2J8M A;  4KOR A;  1XEB A;  1GHE A;  3B8G A;  3R95 A;  4F0Y A;  1I1D A;  4UFV A;  4KVO E;  2EVN A;  4R87 A;  4KZT A;  4B11 A;  3V8I A;  2JEV A;  3EXN A;  5A27 A;  5AGE A;  1K4J A;  1Z4E A;  3DDD A;  3K9U A;  3BJ7 A;  2G3A A;  3I3G A;  4ONU A;  4KLV A;  3E0K A;  4C2Y A;  3FRM A;  4Q38 A;  1PUA A;  3C26 A;  3IU1 A;  4U9Y A;  5HMN A;  3VWD A;  3SHP A;  2O28 A;  4PV6 A;  4R3K A;  4ZBG A;  1XMT A;  3RYO A;  2A4N A;  1BOB A;  2R7H A;  4AB7 A;  2AJ6 A;  4KOW A;  3EC4 A;  2Z3O A;  2WUU A;  3S6K A;  4E0A A;  4H6U A;  5AG7 A;  3FNC A;  3LD2 A;  1S3Z A;  2VZY A;  5CNP A;  3BLN A;  4UCP A;  5DWM A;  4F6A A;  3CXQ A;  1P0H A;  4MFQ A;  3T9Y A;  4LUA A;  5J8C A;  3P2F A;  2WSA A;  1YLE A;  1SQH A;  2Z3M A;  2Q4V A;  4BMH A;  5FVJ A;  3CXS A;  3R9G A;  1FY7 A;  1YVK A;  4MFL A;  2PR8 A;  1CM0 A;  2R98 A;  4UA3 A;  3MGD A;  3H4Q A;  4L89 A;  4XPD B;  5GCN A;  1QSO A;  3ZJ0 A;  3EO4 A;  1KUV A;  1S7L A;  4Y49 C;  2B3V A;  1IIC A;  2Y0M A;  4A95 A;  4XPK A;  1S60 A;  3TO7 A;  2EUI A;  5G20 A;  3TO6 A;  4Y49 B;  5AG6 A;  2P6E A;  4IUS A;  3TT2 A;  2ATR A;  4CS0 B;  1CJW A;  4U5Y A;  2JDD A;  4CYP A;  2FXF A;  2FIW A;  1KUY A;  2FIA A;  4F0X A;  3KKW A;  2PC1 A;  4CAE A;  4MFK A;  2K5T A;  4JD6 A;  4XNH C;  1NMT A;  2Z3P A;  4PSW A;  4YRH A;  2RC4 A;  2R8V A;  5H86 A;  1P4N A;  2FS5 A;  4DNC A;  1IB1 E;  3A9L A;  1YGH A;  2FCK A;  2VI7 A;  1VHS A;  3F5B A;  5H84 A;  1Y9K A;  2FSR A;  2KCW A;  4ORF A;  1MJ9 A;  1YX0 A;  5JQ4 A;  1LRZ A;  4B10 A;  4J3G A;  4CRZ B;  5F49 A;  4HKF A;  4B5O A;  2OZU A;  4E2A A;  2IL4 A;  1Q2C A;  5EBV A;  4R57 A;  3VWE A;  4RS2 A;  5EC4 A;  1PU9 A;  5G21 A;  1RO5 A;  2PRB A;  4JXR A;  5F46 A;  3F0A A;  2AE6 A;  2YNE A;  2Z0Z A;  1S7K A;  1M4I A;  4A32 A;  3W6X A;  1ON0 A;  4CGP A;  4CRY B;  2PSW A;  2ZW6 A;  1I12 A;  2QEC A;  1YK3 A;  4RI1 A;  4QB9 A;  3PZJ A;  2G3T A;  4PK3 A;  3G8W A;  1BO4 A;  1YVO A;  3LOD A;  4Q36 A;  4MY3 A;  4UFW A;  2HQY A;  4U9Z A;  3FYN A;  4KOS A;  5IX3 A;  1Y7R A;  1ZO0 A;  2HUZ A;  3W91 A;  4KVX A;  2J8R A;  1QST A;  2PDO A;  2QIR A;  2ZXV A;  4AVB A;  5BWA B;  3H5Z A;  3R9F A;  2ARH A;  4NCZ A;  4B13 A;  4JWP A;  4MY0 A;  4NEX A;  4C2X A;  5F48 A;  1M4G A;  4A30 A;  2FE7 A;  3TFY A;  4BBH A;  3DNS A;  4LX9 A;  2ZW7 A;  1M44 A;  2VZZ A;  3D8P A;  5I0C A;  3GY9 A;  2NMT A;  4CGN A;  3IWE A;  2P0W A;  3UY5 A;  4L8A A;  1B6B A;  1V0C A;  3QB8 A;  4FD7 A;  2R1I A;  3T90 A;  2X7B A;  1VKC A;  3JTK A;  2DPS A;  2OU2 A;  4XPD C;  4AVC A;  1M4D A;  4CAW A;  3WR7 A;  5G22 A;  2ZW4 A;  2H5M A;  2F5I A;  1B87 A;  4KUA A;  2ZW5 A;  1S7F A;  4YFJ A;  5KTC A;  2FL4 A;  4KOX A;  4CGL A;  4JXQ A;  1NE9 A;  2Z11 A;  2B4D A;  4OAE A;  3P2H A;  3FXT A;  1R57 A;  4H6Z A;  4KSA A;  5DWN A;  4C68 A;  4C7I A;  4CGM A;  3IU2 A;  3QAH A;  4II9 A;  4CYN A;  3FBU A;  3IGR A;  4MI4 A;  1XF8 A;  4C2Z A;  2B4D B;  3D2M A;  4E8O A;  2QML A;  4FD6 A;  3SXN A;  5J8F A;  1WK4 A;  5ISV A;  1IYK A;  2JLM A;  4M3S A;  3FB3 A;  2REE A;  3W6S A;  1MJA A;  3R9E A;  2CNT A;  2GE3 A;  2VEZ A;  4C7H A;  1YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...