4B12A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 23)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 118
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b12A00
5A27A 5AGEA 5G21A 4CAEA 4C2ZA 4A31A 4A2ZA 5AG4A 3IU1A 2WUUA 4C2YA 4CGPA 5G20A 4CAFA 4B10A 5A28A 5G1ZA 2YNDA 4B13A 5AG7A 2YNCC 4CGLA 4CYOA 4C7HA 3IU2A 4UCMA 4UFXA 3H5ZA 2YNCA 4CYQA 4CYPA 5G22A 5AG6A 4UFVA 4CGMA 4CYNA 4A32A 4UCPA 4C2XA 4CGNA 4UCNA 2WSAA 4B12A 3IWEA 4A33A 4C7IA 2YNEA 4B11A 4BBHA 4A95A 4C68A 3JTKA 4CGOA 4A30A 5AG5A 4B14A 4UFWA
chains in the Genus database with same CATH superfamily
1PYTB 4R76A 3FXTA 5GCNA 3RBUA 3ISZA 1ZLIA 4A2ZA 4A31A 4X8IA 4YRHA 4R7MA 4F9VA 5A28A 4MHYA 4MHDA 4ZGYB 4ZI6A 1ARLA 4NGPA 2Q43A 2Z3NA 3IU2A 2QJ8A 4JWPA 4MHNA 4PXDA 4ORFA 1LAMA 4YGOA 1IU8A 2VBQA 4CAWA 3PEIA 1LAPA 3FVLA 3WC5A 2WPWA 2I79A 4U9YA 3VATA 1JQGA 5H86A 7CPAA 2C6PA 1NMTA 3T9YA 4YU9A 4A38A 1S7NA 1IY7A 4MRIA 2ODFA 5K8NA 1NSLA 2AFXA 2OH1A 2AFUA 4MCSA 4WJBA 5G22A 5E96A 1ZO0A 5AGEA 3FNCA 2B58A 4PXBA 4MCRA 4NGNA 1H8LA 1XFOA 4ZX9A 2PR1A 4CAFA 1ZG8A 2IL4A 1YX0A 2ZENA 6CPAA 1NE9A 1QSTA 1CJWA 4CYQA 2HC9A 4H2KA 4CYPA 4P44A 5JM6A 4A37A 4CYNA 2PJCA 3DNSA 4PK2A 3SI2A 4Z65A 3PGPA 4H6UA 2X7BA 4UCNA 1KUVA 4IAVA 4J3GA 4NEXA 1IYLA 4MFLA 2AFZA 1OBRA 2GFQA 2PJ2A 4ZX8A 1NSAA 2CNTA 3KQZA 1CM0A 3KQXA 1Y0YA 2CXAA 3GYAA 2ZOGA 3RO0A 3D7HA 1Z9UA 4MCQA 2Q4YA 3W91A 4R8FA 1WWZA 3V7ZA 3IU1A 2V77A 5DWNA 2XEJA 4CGPA 5G20A 2D4OA 2VI7A 1YR0A 2K5TA 3FBUA 3NE8A 4GM5A 3LMSA 1BLLE 2BOAA 1XEBA 2I3CA 2YNCA 3R9EA 1IB1E 2V8DA 2FCKA 2JLMA 4UFVA 5F49A 2FXFA 4FUUA 5KTAA 1CP7A 1YQEA 4FD6A 2WSAA 2FVGA 1XMTA 1VIXA 3FYNA 3LODA 3NFZA 4A95A 1ON0A 5THWA 2EO8A 2REEA 4KOTA 3I9SA 3SJFA 1Q7LA 2EK9A 2Z0ZA 2BSWA 1VGYA 4NGRA 4DJLA 2DF5A 2ZEEA 1B6BA 3RNZA 4HNYB 2R1IA 2D4PA 4B10A 3KASA 2HQYA 1Z5RA 5KTCA 2Z3PA 1ZG7A 4KLVA 1Y0RA 4JXQA 1MJAA 4P4EA 4ZBGA 4M6HA 2NMTA 1HDUA 1VHEA 3NH8A 3UY5A 1ELLP 2PJ0A 2G9DA 1M44A 4OP4A 1S3ZA 1S7FA 1TKHA 3KGQA 4FBEA 1Z4EA 5K8PA 1X12A 2PJ8A 3IJ3A 3B3SA 4JXRA 2Q7BA 1A2ZA 4DUKA 4KOWA 3FEEA 5CNPA 1ARMA 3D68A 4MXUA 1BPNA 1PU9A 1TKFA 1CPSA 3PP9A 2G3TA 3PB4X 1YMEA 2V8VA 4OKOA 3DR6A 2G3AA 3DSBA 3CZXA 2ZXVA 1MK4A 4LQ6A 1V0CA 2JBJA 4UFXA 4C7HA 4QUSA 4TWEA 4CGMA 1F2OA 3NH5A 4MFPA 4PXCA 1YREA 3R95A 2GLJA 3NE7A 3FMCA 1TIQA 3GLJA 3T8WA 4A33A 3GIUA 2A4NA 1QSRA 4KUAA 4CGOA 2FL4A 1TKJA 4MY3A 3BI1A 4UBRA 4CAEA 4KOSA 1Y9WA 4KOVA 3WABA 4F8ZA 2ZELA 2V8HA 4JZ0A 2J9AA 4FD4A 2B3UA 1K4JA 2OZUA 4U9ZA 2O4HA 5HH1A 5IB9A 4KOUA 5J8CA 1I21A 3KL9A 1S7LA 4K30A 4Q36A 1YVKA 4KLWA 2AFOA 2OZGA 4MFJA 4MFQA 2AFWA 3PRTA 4MHPA 2KCWA 3QAHA 4UWJA 4AVBA 3F8KA 1QSMA 4M3SA 4PSWA 4X2TA 3IWWA 2GLFA 1YGHA 1XMBA 3BXMA 2EVNA 3B3WA 5C82A 5HXDA 2R98A 1N71A 3IWEA 3S9NA 2DEAA 3CXQA 2EBJA 3PFEA 3D4UA 4O23A 3LACA 1JWQA 3FX6A 3F0AA 4MFKA 2YGWA 3D2MA 2DPTA 4AG9A 1TF8A 2R8VA 4LX9A 4M6IA 4A39A 3D66A 3FEDA 3JRUA 1R57A 4H89A 2B4BA 2B4DB 3R9GA 1Q2CA 1L0CA 2JDCA 4ZYQA 2ZEFA 2PR8A 3D7GA 4CRYB 2PJ1A 2PVVA 3S6HA 1S7KA 2VZZA 4B13A 4CGLA 4X3RA 4RUHA 1CX8A 5F09A 3H5ZA 4UEFA 3CXPA 4KSIA 4UEEA 3KHXA 4UA3A 4F9UA 5HMNA 4B5PA 4MBUA 1IOIA 1OZPA 3H8EA 4CGNA 2PJ7A 4B12A 5KTDA 3D2PA 4FWUA 4KVOE 3H8GA 4OC4A 1ELMP 4E0AA 3TO6A 1XOVA 2Q04A 3PZJA 4AVAA 4P4BA 3TX8A 4ZY1A 1LCPA 2PQ8A 2Z11A 4JLYA 5LRGA 5J1QA 3EFAA 3D67A 4RS2A 4HKFA 4P4IA 2PC1A 8CPAA 1VHSA 1LOKA 2EWBA 2FSRA 2PSWA 2ZPAA 3HLPA 3B2YA 4B5OA 5G1ZA 3SXOA 2YNCC 3SXNA 1Q2DA 3N7ZA 4OC1A 1BOBA 3PFOA 1J4JA 2POKA 3I1UA 1UFHA 1KUYA 1Y7RA 4A32A 2PJAA 1QQ9A 4K3NA 3TO7A 3WC6A 2P0WA 4M6GA 1TXRA 2CIJA 2PJBA 3TFYA 1YK3A 5LYLA 1HEEA 5EC4A 2YNEA 4OC3A 5FVJA 4LQGA 3SHPA 2BL1A 2NSMA 1U6MA 3RAMA 4EFDA 2JEVA 3MGDA 3CPXA 2O28A 4NSQA 3IO1A 4A94A 4OIWA 3ISXA 4P45A 4YWYA 4QC6A 4KS9A 4RN7A 1M4LA 2VL1A 5D29A 4CS0B 3GKRA 3D3SA 4FD5A 4NCZA 4OC2A 1FNOA 4R87A 2ATRA 3CT9A 5J8FA 4P4FA 1Y7EA 1AMPA 5DWMA 2YNDA 2JEWA 3CDXA 4KOXA 2ZW5A 4XPDB 4HNXB 3A9LA 1BPMA 2PRQA 3P2HA 3S9MA 1M4DA 4R3LA 2VXKA 3G8WA 4KOYA 3DR8A 3NA6A 4UEZA 1PUAA 3FRMA 3CPAA 3B7IA 2HV2A 1Z8XA 3P2FA 4XNHB 3TTHA 3V38A 4CPAA 4BD9A 1Z2LA 1XJOA 4Y49B 5K8MA 1B87A 3B3TA 2P6FA 2GU2A 4F6AA 4F0XA 1IICA 5LYDA 3IIBA 3E0KA 4HNWB 1GYTA 1M4IA 1LANA 2C1CA 2PRBA 1RXTA 4P4JA 3BI0A 4OMEA 4UIBA 3TC8A 3FJUA 3K9UA 1X10A 3TCVA 5EMIA 4NJRA 4BMHA 4F0YA 1PCAA 2Q51A 2PIZA 3K2KA 3PB7X 2XEGA 2OB0A 4JYWA 3TO9A 5I4MA 4PXEA 1DTDA 2BEIA 3FECA 3K9TA 3VH9A 2QYVA 2H5MA 1QSNA 4IK2A 3BJ8A 4HPSA 4XPKA 3WR7A 2OR4A 5ISVA 2IJZA 3KKWA 5K8OA 2CNMA 3EC4A 1LFWA 3F5BA 4H6ZA 3RYOA 2EK8A 4KORA 3B3CA 2VQYA 4UF4A 3KI9A 2PJ3A 3PBEA 3TOAA 4CAXA 2FE7A 2ZEMA 2DPSA 2XEIA 4A30A 4ZY0A 1VHOA 2PE3A 2Z3LA 4OC0A 4CRZB 2ZW7A 2QIRA 4NGSA 1XF8A 4P4DA 5G21A 2QECA 3G3SA 3S9LA 3WT4A 1CPXA 2C27A 2PDOA 4ONUA 1HDQA 1TF9A 4R57A 3BLNA 3IFEA 3SJEA 2ZEPA 5AG7A 5C88A 1F57A 3JVNA 3BJ7A 4MHZA 4Q38A 4JD6A 4I49A 4L8AA 4UCPA 5JGFA 4EVYA 2C6CA 1Z8WA 1Z8LA 1KWMA 3D7DA 1XRYA 4UIAA 2IMOA 1VKCA 2JBKA 2ZEDA 3C26A 5JH9A 3PB6X 4KVME 4B14A 3FH4A 4ONWA 2B5GB 3HUVA 2BUEA 2QVPA 2GANA 2Z3KA 4IUSA 4MI4A 4E8OA 3S6KA 4YFJA 2WZNA 4PQAA 3IC1A 3JUWA 5LYIA 3FIXA 4DYOA 5CPAA 1WK4A 2OU2A 4W9YA 3N5FA 2J8MA 5HVGA 2ZEOA 4IHMA 4R3KA 4PPZA 5AG6A 4XPLA 1R43A 1QSOA 2Y0MA 4OAEA 4X5KA 3B35A 2PJ5A 2ZW4A 4C2XA 5JPHA 1XE4A 2O53A 2AJ6A 3EO4A 3KR5A 4OLLA 4B11A 4BBHA 4C68A 3VWDA 2BCOA 4AB7A 3BHXA 5IV0A 3PB8X 1BAVA 2PCUA 5AG5A 5F48A 2PJ4A 4NGQA 4QBJA 5AG4A 3SJGA 1IOFA 2Q4VA 4PV6A 4KVXA 4BINA 5A27A 3WC7A 2BO9A 1I1DA 1F2PA 2CY2A 1SQHA 4C2ZA 1Z8TA 3GB0A 2CTBA 3LD2A 4WWVA 4C2YA 1I12A 3V8IA 1ZLHA 2C6GA 4NJQA 3MN8A 3S6FA 1EE3P 3I3GA 4MFZA 4IF5A 2JDDA 5F47A 2R7HA 2PJ6A 1IGBA 2GREA 1YW6A 2ZEHA 1KUXA 3VARA 1YVOA 4EMEA 5I0CA 3QNVA 2ANPA 3LWUA 4LUAA 4AG7A 1KZFA 4DNCA 5IX3A 3PB9X 2Q4ZA 1CBXA 2RC4A 2ZEGA 4P10A 2REFA 4PK3A 4II9A 4P6YA 4ZY2A 3DGVA 2FS5A 4R9MA 3SJXA 5LRKA 1GHEA 4TNUA 1RTQA 1Q2YA 3TE4A 2B5GA 3QAYA 2F7VA 2WPXA 1M4GA 2PIYA 2FIAA 2RFHA 4M85A 2IQ6A 2WUUA 2B4DA 4RI1A 2F5IA 4MCPA 4UWIA 3TT2A 4AXVA 2F8HA 2HUZA 1P0HA 2GE3A 3VWEA 1R3NA 1YW4A 4KUBA 4R6TA 4MJ8A 4CAVA 5IB0A 3FB3A 4KSFA 2PJ9A 5BWAB 2VEZA 3T90A 2Z10A 4B6ZA 3OWCA 1AYEA 2ZW6A 3ZZIA 2Z3MA 3W6SA 1XBUA 2NYQA 3JTKA 5ELYA 2FIWA 4NGTA 2EUIA 4FAIA 5H84A 4KSAA 2Q7SA 3GY9A 1LRZA 2V8GA 2CF4A 2ZOFA 1IIDA 1XIXA 1ZG9A 2J8RA 2P6GA 3DDDA 2ARHA 1CG2A 3SI1A 1Z4RA 1MJ9A 5JQ4A 2WYRA 3S6GA 2PVWA 3NH4A 3W6XA 5HVHA 3KHZA 1RO5A 5HVFA 1MJBA 4CYOA 2ABZA 4UCMA 2DXQA 4PSXA 3FF3A 3R96A 2B3VA 3PBBA 2AE6A 2FT0A 4FD7A 1Y9KA 4KZTA 4E2AA 2J8NA 1YSJA 5D8NA 3R9FA 1UWYA 4MY0A 1QMUA 5LRJA 5CBMA 3ZJ0A 1DE4C 1P4NA 2XEFA 4G1PA 4Q7AA 1M1DA 1FT7A 2CNSA 3L2NA 4JJXA 4U5YA 2P6EA 5F46A 2VZYA 2I00A 4MMOA 3GUXA 4UFWA 1YLEA 3EY5A 4NGMA 5LYFA 4AVCA 2Q44A 4NF1A 2CTCA 4OIDA 4GXHA 3SI0A 4QVTA 4QB9A 1YLOA 2Z3OA 3EXNA 3H8FA 4XPDC 4NXYA 3KZWA 2OOTA 2HB6A 3RZAA 1S60A 3R1KA 2OZHA 3B3VA 2RB7A 3IEHA 3KR4A 2QMLA 3MRUA 4GS4A 3H4QA 4B5PB 1CP6A 1S5KA 5DS0A 1AUGA 4NFRA 3D7FA 4XNHC 2GIVA 3CXSA 1BO4A 4OADA 3IWGA 3D8PA 4C7IA 4Y49C 2AFSA 5EBVA 3TOBA 4EWTA 2G0BA 2Q0YA 3DLJA 1FY7A 2AFMA 3B8GA 3IGRA 4OC5A 1IYKA 3QB8A 4L89A
chains in the Genus database with same CATH topology
3FXTA 5GCNA 4A31A 4A2ZA 4YRHA 5A28A 4MHDA 4ZGYB 2Z3NA 3IU2A 4JWPA 4ORFA 4YGOA 4CAWA 2VBQA 2WPWA 2I79A 4U9YA 5H86A 1NMTA 3T9YA 1S7NA 1NSLA 2OH1A 5G22A 5E96A 1ZO0A 5AGEA 3FNCA 2B58A 2PR1A 4CAFA 2IL4A 1YX0A 1NE9A 1QSTA 1CJWA 4CYQA 4CYPA 4CYNA 3DNSA 4PK2A 3PGPA 4H6UA 2X7BA 4UCNA 1KUVA 4J3GA 4NEXA 1IYLA 4MFLA 2CNTA 1CM0A 2CXAA 3GYAA 3W91A 1Z9UA 2Q4YA 1WWZA 3IU1A 5DWNA 4CGPA 5G20A 2D4OA 2VI7A 1YR0A 2K5TA 3FBUA 1XEBA 2YNCA 3R9EA 1IB1E 2FCKA 2JLMA 4UFVA 5F49A 2FXFA 5KTAA 4FD6A 2WSAA 1XMTA 3FYNA 3LODA 4A95A 1ON0A 2REEA 4KOTA 3I9SA 2Z0ZA 2BSWA 1B6BA 4HNYB 2R1IA 2D4PA 4B10A 2HQYA 5KTCA 2Z3PA 4KLVA 4JXQA 1MJAA 4ZBGA 2NMTA 3UY5A 1M44A 1S3ZA 1S7FA 1Z4EA 4JXRA 2Q7BA 4KOWA 5CNPA 1PU9A 3PP9A 2G3TA 3DR6A 2G3AA 3DSBA 2ZXVA 1MK4A 1V0CA 4C7HA 4UFXA 4QUSA 4CGMA 4MFPA 1YREA 3R95A 3NE7A 1TIQA 4A33A 2A4NA 1QSRA 4KUAA 4CGOA 2FL4A 4MY3A 4UBRA 4CAEA 4KOSA 1Y9WA 4KOVA 4FD4A 2B3UA 1K4JA 2OZUA 4U9ZA 5HH1A 4KOUA 5J8CA 1I21A 1S7LA 4K30A 4Q36A 1YVKA 4KLWA 2OZGA 4MFJA 4MFQA 2KCWA 3QAHA 4UWJA 4AVBA 3F8KA 1QSMA 4M3SA 4PSWA 1YGHA 2EVNA 5C82A 2R98A 1N71A 3IWEA 3CXQA 3F0AA 4MFKA 2YGWA 3D2MA 2DPTA 4AG9A 2R8VA 4LX9A 1R57A 4H89A 2B4BA 2B4DB 3R9GA 1Q2CA 1L0CA 2JDCA 2PR8A 4CRYB 3S6HA 1S7KA 2VZZA 4B13A 4CGLA 3H5ZA 3CXPA 4UA3A 5HMNA 4B5PA 4MBUA 1OZPA 4CGNA 5KTDA 4B12A 3D2PA 4KVOE 4E0AA 3TO6A 2Q04A 3PZJA 4AVAA 2PQ8A 2Z11A 4JLYA 3EFAA 4RS2A 4HKFA 2PC1A 1VHSA 4B5OA 2FSRA 2PSWA 2ZPAA 5G1ZA 3SXOA 2YNCC 3SXNA 1Q2DA 3N7ZA 1BOBA 1J4JA 1UFHA 1KUYA 1Y7RA 4A32A 3TO7A 2P0WA 3TFYA 1YK3A 5EC4A 2YNEA 5FVJA 3SHPA 2BL1A 1U6MA 2JEVA 3MGDA 2O28A 4NSQA 4QC6A 4KS9A 4CS0B 3GKRA 3D3SA 4FD5A 4NCZA 4R87A 5J8FA 2ATRA 5DWMA 2YNDA 4KOXA 4XPDB 2ZW5A 4HNXB 3A9LA 3P2HA 1M4DA 4R3LA 2VXKA 3G8WA 4KOYA 3DR8A 1PUAA 3FRMA 4XNHB 2HV2A 3P2FA 3TTHA 4Y49B 1B87A 4F6AA 2P6FA 4F0XA 1IICA 3E0KA 4HNWB 1M4IA 2PRBA 1RXTA 3K9UA 3TCVA 4BMHA 4F0YA 3TO9A 2OB0A 2BEIA 2H5MA 1QSNA 3BJ8A 4XPKA 3WR7A 5ISVA 3KKWA 2CNMA 3EC4A 3F5BA 4H6ZA 3RYOA 4KORA 2VQYA 3TOAA 4CAXA 2FE7A 2DPSA 4A30A 2Z3LA 4CRZB 2ZW7A 2QIRA 1XF8A 5G21A 2QECA 3G3SA 2C27A 2PDOA 4ONUA 4R57A 3BLNA 5AG7A 5C88A 3JVNA 3BJ7A 4Q38A 4JD6A 4I49A 4L8AA 4UCPA 4EVYA 1VKCA 3C26A 4KVME 4B14A 2B5GB 2BUEA 2GANA 2Z3KA 4IUSA 4MI4A 4E8OA 3S6KA 4YFJA 3JUWA 3FIXA 1WK4A 2OU2A 2J8MA 4R3KA 5AG6A 4XPLA 1QSOA 2Y0MA 4OAEA 4X5KA 4C2XA 2ZW4A 5JPHA 1XE4A 2AJ6A 3EO4A 4OLLA 4B11A 4BBHA 4C68A 3VWDA 4AB7A 5IV0A 5AG5A 5F48A 4QBJA 5AG4A 2Q4VA 4PV6A 4KVXA 5A27A 1I1DA 4C2ZA 2CY2A 1SQHA 3LD2A 4C2YA 1I12A 3V8IA 3S6FA 3I3GA 4MFZA 4IF5A 2JDDA 5F47A 2R7HA 1KUXA 1YVOA 5I0CA 4LUAA 4AG7A 1KZFA 4DNCA 5IX3A 2RC4A 2REFA 4PK3A 4II9A 2FS5A 4R9MA 1GHEA 1Q2YA 3TE4A 2B5GA 2WPXA 1M4GA 2FIAA 4M85A 4RI1A 2WUUA 2B4DA 4UWIA 2F5IA 3TT2A 2HUZA 1P0HA 2GE3A 3VWEA 4KUBA 4MJ8A 4CAVA 5IB0A 3FB3A 4KSFA 5BWAB 2VEZA 3T90A 2Z10A 3OWCA 2ZW6A 3ZZIA 2Z3MA 3W6SA 3JTKA 2FIWA 2EUIA 5H84A 4KSAA 3GY9A 1LRZA 3DDDA 1IIDA 1XIXA 2J8RA 2P6GA 2ARHA 1Z4RA 1MJ9A 5JQ4A 3S6GA 3W6XA 1RO5A 1MJBA 4CYOA 4UCMA 2DXQA 4PSXA 3R96A 2B3VA 2AE6A 2FT0A 4FD7A 1Y9KA 4KZTA 4E2AA 2J8NA 3R9FA 4MY0A 3ZJ0A 1P4NA 1M1DA 2CNSA 4JJXA 4U5YA 2P6EA 5F46A 2VZYA 2I00A 4UFWA 1YLEA 3EY5A 4AVCA 2Q44A 4NF1A 4QVTA 4QB9A 2Z3OA 3EXNA 4XPDC 4NXYA 1S60A 3R1KA 2OZHA 4GS4A 2QMLA 4B5PB 3H4QA 1S5KA 4XNHC 2GIVA 3CXSA 1BO4A 4OADA 3IWGA 3D8PA 4C7IA 4Y49C 5EBVA 3TOBA 2G0BA 2Q0YA 1FY7A 3B8GA 3IGRA 1IYKA 3QB8A 4L89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A27 A;  5AGE A;  5G21 A;  4CAE A;  4C2Z A;  4A31 A;  4A2Z A;  5AG4 A;  3IU1 A;  2WUU A;  4C2Y A;  4CGP A;  5G20 A;  4CAF A;  4B10 A;  5A28 A;  5G1Z A;  2YND A;  4B13 A;  5AG7 A;  2YNC C;  4CGL A;  4CYO A;  4C7H A;  3IU2 A;  4UCM A;  4UFX A;  3H5Z A;  2YNC A;  4CYQ A;  4CYP A;  5G22 A;  5AG6 A;  4UFV A;  4CGM A;  4CYN A;  4A32 A;  4UCP A;  4C2X A;  4CGN A;  4UCN A;  2WSA A;  4B12 A;  3IWE A;  4A33 A;  4C7I A;  2YNE A;  4B11 A;  4BBH A;  4A95 A;  4C68 A;  3JTK A;  4CGO A;  4A30 A;  5AG5 A;  4B14 A;  4UFW A; 
#chains in the Genus database with same CATH topology
 1PYT B;  4R76 A;  3FXT A;  5GCN A;  3RBU A;  3ISZ A;  1ZLI A;  4A2Z A;  4A31 A;  4X8I A;  4YRH A;  4R7M A;  4F9V A;  5A28 A;  4MHY A;  4MHD A;  4ZGY B;  4ZI6 A;  1ARL A;  4NGP A;  2Q43 A;  2Z3N A;  3IU2 A;  2QJ8 A;  4JWP A;  4MHN A;  4PXD A;  4ORF A;  1LAM A;  4YGO A;  1IU8 A;  2VBQ A;  4CAW A;  3PEI A;  1LAP A;  3FVL A;  3WC5 A;  2WPW A;  2I79 A;  4U9Y A;  3VAT A;  1JQG A;  5H86 A;  7CPA A;  2C6P A;  1NMT A;  3T9Y A;  4YU9 A;  4A38 A;  1S7N A;  1IY7 A;  4MRI A;  2ODF A;  5K8N A;  1NSL A;  2AFX A;  2OH1 A;  2AFU A;  4MCS A;  4WJB A;  5G22 A;  5E96 A;  1ZO0 A;  5AGE A;  3FNC A;  2B58 A;  4PXB A;  4MCR A;  4NGN A;  1H8L A;  1XFO A;  4ZX9 A;  2PR1 A;  4CAF A;  1ZG8 A;  2IL4 A;  1YX0 A;  2ZEN A;  6CPA A;  1NE9 A;  1QST A;  1CJW A;  4CYQ A;  2HC9 A;  4H2K A;  4CYP A;  4P44 A;  5JM6 A;  4A37 A;  4CYN A;  2PJC A;  3DNS A;  4PK2 A;  3SI2 A;  4Z65 A;  3PGP A;  4H6U A;  2X7B A;  4UCN A;  1KUV A;  4IAV A;  4J3G A;  4NEX A;  1IYL A;  4MFL A;  2AFZ A;  1OBR A;  2GFQ A;  2PJ2 A;  4ZX8 A;  1NSA A;  2CNT A;  3KQZ A;  1CM0 A;  3KQX A;  1Y0Y A;  2CXA A;  3GYA A;  2ZOG A;  3RO0 A;  3D7H A;  1Z9U A;  4MCQ A;  2Q4Y A;  3W91 A;  4R8F A;  1WWZ A;  3V7Z A;  3IU1 A;  2V77 A;  5DWN A;  2XEJ A;  4CGP A;  5G20 A;  2D4O A;  2VI7 A;  1YR0 A;  2K5T A;  3FBU A;  3NE8 A;  4GM5 A;  3LMS A;  1BLL E;  2BOA A;  1XEB A;  2I3C A;  2YNC A;  3R9E A;  1IB1 E;  2V8D A;  2FCK A;  2JLM A;  4UFV A;  5F49 A;  2FXF A;  4FUU A;  5KTA A;  1CP7 A;  1YQE A;  4FD6 A;  2WSA A;  2FVG A;  1XMT A;  1VIX A;  3FYN A;  3LOD A;  3NFZ A;  4A95 A;  1ON0 A;  5THW A;  2EO8 A;  2REE A;  4KOT A;  3I9S A;  3SJF A;  1Q7L A;  2EK9 A;  2Z0Z A;  2BSW A;  1VGY A;  4NGR A;  4DJL A;  2DF5 A;  2ZEE A;  1B6B A;  3RNZ A;  4HNY B;  2R1I A;  2D4P A;  4B10 A;  3KAS A;  2HQY A;  1Z5R A;  5KTC A;  2Z3P A;  1ZG7 A;  4KLV A;  1Y0R A;  4JXQ A;  1MJA A;  4P4E A;  4ZBG A;  4M6H A;  2NMT A;  1HDU A;  1VHE A;  3NH8 A;  3UY5 A;  1ELL P;  2PJ0 A;  2G9D A;  1M44 A;  4OP4 A;  1S3Z A;  1S7F A;  1TKH A;  3KGQ A;  4FBE A;  1Z4E A;  5K8P A;  1X12 A;  2PJ8 A;  3IJ3 A;  3B3S A;  4JXR A;  2Q7B A;  1A2Z A;  4DUK A;  4KOW A;  3FEE A;  5CNP A;  1ARM A;  3D68 A;  4MXU A;  1BPN A;  1PU9 A;  1TKF A;  1CPS A;  3PP9 A;  2G3T A;  3PB4 X;  1YME A;  2V8V A;  4OKO A;  3DR6 A;  2G3A A;  3DSB A;  3CZX A;  2ZXV A;  1MK4 A;  4LQ6 A;  1V0C A;  2JBJ A;  4UFX A;  4C7H A;  4QUS A;  4TWE A;  4CGM A;  1F2O A;  3NH5 A;  4MFP A;  4PXC A;  1YRE A;  3R95 A;  2GLJ A;  3NE7 A;  3FMC A;  1TIQ A;  3GLJ A;  3T8W A;  4A33 A;  3GIU A;  2A4N A;  1QSR A;  4KUA A;  4CGO A;  2FL4 A;  1TKJ A;  4MY3 A;  3BI1 A;  4UBR A;  4CAE A;  4KOS A;  1Y9W A;  4KOV A;  3WAB A;  4F8Z A;  2ZEL A;  2V8H A;  4JZ0 A;  2J9A A;  4FD4 A;  2B3U A;  1K4J A;  2OZU A;  4U9Z A;  2O4H A;  5HH1 A;  5IB9 A;  4KOU A;  5J8C A;  1I21 A;  3KL9 A;  1S7L A;  4K30 A;  4Q36 A;  1YVK A;  4KLW A;  2AFO A;  2OZG A;  4MFJ A;  4MFQ A;  2AFW A;  3PRT A;  4MHP A;  2KCW A;  3QAH A;  4UWJ A;  4AVB A;  3F8K A;  1QSM A;  4M3S A;  4PSW A;  4X2T A;  3IWW A;  2GLF A;  1YGH A;  1XMB A;  3BXM A;  2EVN A;  3B3W A;  5C82 A;  5HXD A;  2R98 A;  1N71 A;  3IWE A;  3S9N A;  2DEA A;  3CXQ A;  2EBJ A;  3PFE A;  3D4U A;  4O23 A;  3LAC A;  1JWQ A;  3FX6 A;  3F0A A;  4MFK A;  2YGW A;  3D2M A;  2DPT A;  4AG9 A;  1TF8 A;  2R8V A;  4LX9 A;  4M6I A;  4A39 A;  3D66 A;  3FED A;  3JRU A;  1R57 A;  4H89 A;  2B4B A;  2B4D B;  3R9G A;  1Q2C A;  1L0C A;  2JDC A;  4ZYQ A;  2ZEF A;  2PR8 A;  3D7G A;  4CRY B;  2PJ1 A;  2PVV A;  3S6H A;  1S7K A;  2VZZ A;  4B13 A;  4CGL A;  4X3R A;  4RUH A;  1CX8 A;  5F09 A;  3H5Z A;  4UEF A;  3CXP A;  4KSI A;  4UEE A;  3KHX A;  4UA3 A;  4F9U A;  5HMN A;  4B5P A;  4MBU A;  1IOI A;  1OZP A;  3H8E A;  4CGN A;  2PJ7 A;  4B12 A;  5KTD A;  3D2P A;  4FWU A;  4KVO E;  3H8G A;  4OC4 A;  1ELM P;  4E0A A;  3TO6 A;  1XOV A;  2Q04 A;  3PZJ A;  4AVA A;  4P4B A;  3TX8 A;  4ZY1 A;  1LCP A;  2PQ8 A;  2Z11 A;  4JLY A;  5LRG A;  5J1Q A;  3EFA A;  3D67 A;  4RS2 A;  4HKF A;  4P4I A;  2PC1 A;  8CPA A;  1VHS A;  1LOK A;  2EWB A;  2FSR A;  2PSW A;  2ZPA A;  3HLP A;  3B2Y A;  4B5O A;  5G1Z A;  3SXO A;  2YNC C;  3SXN A;  1Q2D A;  3N7Z A;  4OC1 A;  1BOB A;  3PFO A;  1J4J A;  2POK A;  3I1U A;  1UFH A;  1KUY A;  1Y7R A;  4A32 A;  2PJA A;  1QQ9 A;  4K3N A;  3TO7 A;  3WC6 A;  2P0W A;  4M6G A;  1TXR A;  2CIJ A;  2PJB A;  3TFY A;  1YK3 A;  5LYL A;  1HEE A;  5EC4 A;  2YNE A;  4OC3 A;  5FVJ A;  4LQG A;  3SHP A;  2BL1 A;  2NSM A;  1U6M A;  3RAM A;  4EFD A;  2JEV A;  3MGD A;  3CPX A;  2O28 A;  4NSQ A;  3IO1 A;  4A94 A;  4OIW A;  3ISX A;  4P45 A;  4YWY A;  4QC6 A;  4KS9 A;  4RN7 A;  1M4L A;  2VL1 A;  5D29 A;  4CS0 B;  3GKR A;  3D3S A;  4FD5 A;  4NCZ A;  4OC2 A;  1FNO A;  4R87 A;  2ATR A;  3CT9 A;  5J8F A;  4P4F A;  1Y7E A;  1AMP A;  5DWM A;  2YND A;  2JEW A;  3CDX A;  4KOX A;  2ZW5 A;  4XPD B;  4HNX B;  3A9L A;  1BPM A;  2PRQ A;  3P2H A;  3S9M A;  1M4D A;  4R3L A;  2VXK A;  3G8W A;  4KOY A;  3DR8 A;  3NA6 A;  4UEZ A;  1PUA A;  3FRM A;  3CPA A;  3B7I A;  2HV2 A;  1Z8X A;  3P2F A;  4XNH B;  3TTH A;  3V38 A;  4CPA A;  4BD9 A;  1Z2L A;  1XJO A;  4Y49 B;  5K8M A;  1B87 A;  3B3T A;  2P6F A;  2GU2 A;  4F6A A;  4F0X A;  1IIC A;  5LYD A;  3IIB A;  3E0K A;  4HNW B;  1GYT A;  1M4I A;  1LAN A;  2C1C A;  2PRB A;  1RXT A;  4P4J A;  3BI0 A;  4OME A;  4UIB A;  3TC8 A;  3FJU A;  3K9U A;  1X10 A;  3TCV A;  5EMI A;  4NJR A;  4BMH A;  4F0Y A;  1PCA A;  2Q51 A;  2PIZ A;  3K2K A;  3PB7 X;  2XEG A;  2OB0 A;  4JYW A;  3TO9 A;  5I4M A;  4PXE A;  1DTD A;  2BEI A;  3FEC A;  3K9T A;  3VH9 A;  2QYV A;  2H5M A;  1QSN A;  4IK2 A;  3BJ8 A;  4HPS A;  4XPK A;  3WR7 A;  2OR4 A;  5ISV A;  2IJZ A;  3KKW A;  5K8O A;  2CNM A;  3EC4 A;  1LFW A;  3F5B A;  4H6Z A;  3RYO A;  2EK8 A;  4KOR A;  3B3C A;  2VQY A;  4UF4 A;  3KI9 A;  2PJ3 A;  3PBE A;  3TOA A;  4CAX A;  2FE7 A;  2ZEM A;  2DPS A;  2XEI A;  4A30 A;  4ZY0 A;  1VHO A;  2PE3 A;  2Z3L A;  4OC0 A;  4CRZ B;  2ZW7 A;  2QIR A;  4NGS A;  1XF8 A;  4P4D A;  5G21 A;  2QEC A;  3G3S A;  3S9L A;  3WT4 A;  1CPX A;  2C27 A;  2PDO A;  4ONU A;  1HDQ A;  1TF9 A;  4R57 A;  3BLN A;  3IFE A;  3SJE A;  2ZEP A;  5AG7 A;  5C88 A;  1F57 A;  3JVN A;  3BJ7 A;  4MHZ A;  4Q38 A;  4JD6 A;  4I49 A;  4L8A A;  4UCP A;  5JGF A;  4EVY A;  2C6C A;  1Z8W A;  1Z8L A;  1KWM A;  3D7D A;  1XRY A;  4UIA A;  2IMO A;  1VKC A;  2JBK A;  2ZED A;  3C26 A;  5JH9 A;  3PB6 X;  4KVM E;  4B14 A;  3FH4 A;  4ONW A;  2B5G B;  3HUV A;  2BUE A;  2QVP A;  2GAN A;  2Z3K A;  4IUS A;  4MI4 A;  4E8O A;  3S6K A;  4YFJ A;  2WZN A;  4PQA A;  3IC1 A;  3JUW A;  5LYI A;  3FIX A;  4DYO A;  5CPA A;  1WK4 A;  2OU2 A;  4W9Y A;  3N5F A;  2J8M A;  5HVG A;  2ZEO A;  4IHM A;  4R3K A;  4PPZ A;  5AG6 A;  4XPL A;  1R43 A;  1QSO A;  2Y0M A;  4OAE A;  4X5K A;  3B35 A;  2PJ5 A;  2ZW4 A;  4C2X A;  5JPH A;  1XE4 A;  2O53 A;  2AJ6 A;  3EO4 A;  3KR5 A;  4OLL A;  4B11 A;  4BBH A;  4C68 A;  3VWD A;  2BCO A;  4AB7 A;  3BHX A;  5IV0 A;  3PB8 X;  1BAV A;  2PCU A;  5AG5 A;  5F48 A;  2PJ4 A;  4NGQ A;  4QBJ A;  5AG4 A;  3SJG A;  1IOF A;  2Q4V A;  4PV6 A;  4KVX A;  4BIN A;  5A27 A;  3WC7 A;  2BO9 A;  1I1D A;  1F2P A;  2CY2 A;  1SQH A;  4C2Z A;  1Z8T A;  3GB0 A;  2CTB A;  3LD2 A;  4WWV A;  4C2Y A;  1I12 A;  3V8I A;  1ZLH A;  2C6G A;  4NJQ A;  3MN8 A;  3S6F A;  1EE3 P;  3I3G A;  4MFZ A;  4IF5 A;  2JDD A;  5F47 A;  2R7H A;  2PJ6 A;  1IGB A;  2GRE A;  1YW6 A;  2ZEH A;  1KUX A;  3VAR A;  1YVO A;  4EME A;  5I0C A;  3QNV A;  2ANP A;  3LWU A;  4LUA A;  4AG7 A;  1KZF A;  4DNC A;  5IX3 A;  3PB9 X;  2Q4Z A;  1CBX A;  2RC4 A;  2ZEG A;  4P10 A;  2REF A;  4PK3 A;  4II9 A;  4P6Y A;  4ZY2 A;  3DGV A;  2FS5 A;  4R9M A;  3SJX A;  5LRK A;  1GHE A;  4TNU A;  1RTQ A;  1Q2Y A;  3TE4 A;  2B5G A;  3QAY A;  2F7V A;  2WPX A;  1M4G A;  2PIY A;  2FIA A;  2RFH A;  4M85 A;  2IQ6 A;  2WUU A;  2B4D A;  4RI1 A;  2F5I A;  4MCP A;  4UWI A;  3TT2 A;  4AXV A;  2F8H A;  2HUZ A;  1P0H A;  2GE3 A;  3VWE A;  1R3N A;  1YW4 A;  4KUB A;  4R6T A;  4MJ8 A;  4CAV A;  5IB0 A;  3FB3 A;  4KSF A;  2PJ9 A;  5BWA B;  2VEZ A;  3T90 A;  2Z10 A;  4B6Z A;  3OWC A;  1AYE A;  2ZW6 A;  3ZZI A;  2Z3M A;  3W6S A;  1XBU A;  2NYQ A;  3JTK A;  5ELY A;  2FIW A;  4NGT A;  2EUI A;  4FAI A;  5H84 A;  4KSA A;  2Q7S A;  3GY9 A;  1LRZ A;  2V8G A;  2CF4 A;  2ZOF A;  1IID A;  1XIX A;  1ZG9 A;  2J8R A;  2P6G A;  3DDD A;  2ARH A;  1CG2 A;  3SI1 A;  1Z4R A;  1MJ9 A;  5JQ4 A;  2WYR A;  3S6G A;  2PVW A;  3NH4 A;  3W6X A;  5HVH A;  3KHZ A;  1RO5 A;  5HVF A;  1MJB A;  4CYO A;  2ABZ A;  4UCM A;  2DXQ A;  4PSX A;  3FF3 A;  3R96 A;  2B3V A;  3PBB A;  2AE6 A;  2FT0 A;  4FD7 A;  1Y9K A;  4KZT A;  4E2A A;  2J8N A;  1YSJ A;  5D8N A;  3R9F A;  1UWY A;  4MY0 A;  1QMU A;  5LRJ A;  5CBM A;  3ZJ0 A;  1DE4 C;  1P4N A;  2XEF A;  4G1P A;  4Q7A A;  1M1D A;  1FT7 A;  2CNS A;  3L2N A;  4JJX A;  4U5Y A;  2P6E A;  5F46 A;  2VZY A;  2I00 A;  4MMO A;  3GUX A;  4UFW A;  1YLE A;  3EY5 A;  4NGM A;  5LYF A;  4AVC A;  2Q44 A;  4NF1 A;  2CTC A;  4OID A;  4GXH A;  3SI0 A;  4QVT A;  4QB9 A;  1YLO A;  2Z3O A;  3EXN A;  3H8F A;  4XPD C;  4NXY A;  3KZW A;  2OOT A;  2HB6 A;  3RZA A;  1S60 A;  3R1K A;  2OZH A;  3B3V A;  2RB7 A;  3IEH A;  3KR4 A;  2QML A;  3MRU A;  4GS4 A;  3H4Q A;  4B5P B;  1CP6 A;  1S5K A;  5DS0 A;  1AUG A;  4NFR A;  3D7F A;  4XNH C;  2GIV A;  3CXS A;  1BO4 A;  4OAD A;  3IWG A;  3D8P A;  4C7I A;  4Y49 C;  2AFS A;  5EBV A;  3TOB A;  4EWT A;  2G0B A;  2Q0Y A;  3DLJ A;  1FY7 A;  2AFM A;  3B8G A;  3IGR A;  4OC5 A;  1IYK A;  3QB8 A;  4L89 A; 
#chains in the Genus database with same CATH homology
 3FXT A;  5GCN A;  4A31 A;  4A2Z A;  4YRH A;  5A28 A;  4MHD A;  4ZGY B;  2Z3N A;  3IU2 A;  4JWP A;  4ORF A;  4YGO A;  4CAW A;  2VBQ A;  2WPW A;  2I79 A;  4U9Y A;  5H86 A;  1NMT A;  3T9Y A;  1S7N A;  1NSL A;  2OH1 A;  5G22 A;  5E96 A;  1ZO0 A;  5AGE A;  3FNC A;  2B58 A;  2PR1 A;  4CAF A;  2IL4 A;  1YX0 A;  1NE9 A;  1QST A;  1CJW A;  4CYQ A;  4CYP A;  4CYN A;  3DNS A;  4PK2 A;  3PGP A;  4H6U A;  2X7B A;  4UCN A;  1KUV A;  4J3G A;  4NEX A;  1IYL A;  4MFL A;  2CNT A;  1CM0 A;  2CXA A;  3GYA A;  3W91 A;  1Z9U A;  2Q4Y A;  1WWZ A;  3IU1 A;  5DWN A;  4CGP A;  5G20 A;  2D4O A;  2VI7 A;  1YR0 A;  2K5T A;  3FBU A;  1XEB A;  2YNC A;  3R9E A;  1IB1 E;  2FCK A;  2JLM A;  4UFV A;  5F49 A;  2FXF A;  5KTA A;  4FD6 A;  2WSA A;  1XMT A;  3FYN A;  3LOD A;  4A95 A;  1ON0 A;  2REE A;  4KOT A;  3I9S A;  2Z0Z A;  2BSW A;  1B6B A;  4HNY B;  2R1I A;  2D4P A;  4B10 A;  2HQY A;  5KTC A;  2Z3P A;  4KLV A;  4JXQ A;  1MJA A;  4ZBG A;  2NMT A;  3UY5 A;  1M44 A;  1S3Z A;  1S7F A;  1Z4E A;  4JXR A;  2Q7B A;  4KOW A;  5CNP A;  1PU9 A;  3PP9 A;  2G3T A;  3DR6 A;  2G3A A;  3DSB A;  2ZXV A;  1MK4 A;  1V0C A;  4C7H A;  4UFX A;  4QUS A;  4CGM A;  4MFP A;  1YRE A;  3R95 A;  3NE7 A;  1TIQ A;  4A33 A;  2A4N A;  1QSR A;  4KUA A;  4CGO A;  2FL4 A;  4MY3 A;  4UBR A;  4CAE A;  4KOS A;  1Y9W A;  4KOV A;  4FD4 A;  2B3U A;  1K4J A;  2OZU A;  4U9Z A;  5HH1 A;  4KOU A;  5J8C A;  1I21 A;  1S7L A;  4K30 A;  4Q36 A;  1YVK A;  4KLW A;  2OZG A;  4MFJ A;  4MFQ A;  2KCW A;  3QAH A;  4UWJ A;  4AVB A;  3F8K A;  1QSM A;  4M3S A;  4PSW A;  1YGH A;  2EVN A;  5C82 A;  2R98 A;  1N71 A;  3IWE A;  3CXQ A;  3F0A A;  4MFK A;  2YGW A;  3D2M A;  2DPT A;  4AG9 A;  2R8V A;  4LX9 A;  1R57 A;  4H89 A;  2B4B A;  2B4D B;  3R9G A;  1Q2C A;  1L0C A;  2JDC A;  2PR8 A;  4CRY B;  3S6H A;  1S7K A;  2VZZ A;  4B13 A;  4CGL A;  3H5Z A;  3CXP A;  4UA3 A;  5HMN A;  4B5P A;  4MBU A;  1OZP A;  4CGN A;  5KTD A;  4B12 A;  3D2P A;  4KVO E;  4E0A A;  3TO6 A;  2Q04 A;  3PZJ A;  4AVA A;  2PQ8 A;  2Z11 A;  4JLY A;  3EFA A;  4RS2 A;  4HKF A;  2PC1 A;  1VHS A;  4B5O A;  2FSR A;  2PSW A;  2ZPA A;  5G1Z A;  3SXO A;  2YNC C;  3SXN A;  1Q2D A;  3N7Z A;  1BOB A;  1J4J A;  1UFH A;  1KUY A;  1Y7R A;  4A32 A;  3TO7 A;  2P0W A;  3TFY A;  1YK3 A;  5EC4 A;  2YNE A;  5FVJ A;  3SHP A;  2BL1 A;  1U6M A;  2JEV A;  3MGD A;  2O28 A;  4NSQ A;  4QC6 A;  4KS9 A;  4CS0 B;  3GKR A;  3D3S A;  4FD5 A;  4NCZ A;  4R87 A;  5J8F A;  2ATR A;  5DWM A;  2YND A;  4KOX A;  4XPD B;  2ZW5 A;  4HNX B;  3A9L A;  3P2H A;  1M4D A;  4R3L A;  2VXK A;  3G8W A;  4KOY A;  3DR8 A;  1PUA A;  3FRM A;  4XNH B;  2HV2 A;  3P2F A;  3TTH A;  4Y49 B;  1B87 A;  4F6A A;  2P6F A;  4F0X A;  1IIC A;  3E0K A;  4HNW B;  1M4I A;  2PRB A;  1RXT A;  3K9U A;  3TCV A;  4BMH A;  4F0Y A;  3TO9 A;  2OB0 A;  2BEI A;  2H5M A;  1QSN A;  3BJ8 A;  4XPK A;  3WR7 A;  5ISV A;  3KKW A;  2CNM A;  3EC4 A;  3F5B A;  4H6Z A;  3RYO A;  4KOR A;  2VQY A;  3TOA A;  4CAX A;  2FE7 A;  2DPS A;  4A30 A;  2Z3L A;  4CRZ B;  2ZW7 A;  2QIR A;  1XF8 A;  5G21 A;  2QEC A;  3G3S A;  2C27 A;  2PDO A;  4ONU A;  4R57 A;  3BLN A;  5AG7 A;  5C88 A;  3JVN A;  3BJ7 A;  4Q38 A;  4JD6 A;  4I49 A;  4L8A A;  4UCP A;  4EVY A;  1VKC A;  3C26 A;  4KVM E;  4B14 A;  2B5G B;  2BUE A;  2GAN A;  2Z3K A;  4IUS A;  4MI4 A;  4E8O A;  3S6K A;  4YFJ A;  3JUW A;  3FIX A;  1WK4 A;  2OU2 A;  2J8M A;  4R3K A;  5AG6 A;  4XPL A;  1QSO A;  2Y0M A;  4OAE A;  4X5K A;  4C2X A;  2ZW4 A;  5JPH A;  1XE4 A;  2AJ6 A;  3EO4 A;  4OLL A;  4B11 A;  4BBH A;  4C68 A;  3VWD A;  4AB7 A;  5IV0 A;  5AG5 A;  5F48 A;  4QBJ A;  5AG4 A;  2Q4V A;  4PV6 A;  4KVX A;  5A27 A;  1I1D A;  4C2Z A;  2CY2 A;  1SQH A;  3LD2 A;  4C2Y A;  1I12 A;  3V8I A;  3S6F A;  3I3G A;  4MFZ A;  4IF5 A;  2JDD A;  5F47 A;  2R7H A;  1KUX A;  1YVO A;  5I0C A;  4LUA A;  4AG7 A;  1KZF A;  4DNC A;  5IX3 A;  2RC4 A;  2REF A;  4PK3 A;  4II9 A;  2FS5 A;  4R9M A;  1GHE A;  1Q2Y A;  3TE4 A;  2B5G A;  2WPX A;  1M4G A;  2FIA A;  4M85 A;  4RI1 A;  2WUU A;  2B4D A;  4UWI A;  2F5I A;  3TT2 A;  2HUZ A;  1P0H A;  2GE3 A;  3VWE A;  4KUB A;  4MJ8 A;  4CAV A;  5IB0 A;  3FB3 A;  4KSF A;  5BWA B;  2VEZ A;  3T90 A;  2Z10 A;  3OWC A;  2ZW6 A;  3ZZI A;  2Z3M A;  3W6S A;  3JTK A;  2FIW A;  2EUI A;  5H84 A;  4KSA A;  3GY9 A;  1LRZ A;  3DDD A;  1IID A;  1XIX A;  2J8R A;  2P6G A;  2ARH A;  1Z4R A;  1MJ9 A;  5JQ4 A;  3S6G A;  3W6X A;  1RO5 A;  1MJB A;  4CYO A;  4UCM A;  2DXQ A;  4PSX A;  3R96 A;  2B3V A;  2AE6 A;  2FT0 A;  4FD7 A;  1Y9K A;  4KZT A;  4E2A A;  2J8N A;  3R9F A;  4MY0 A;  3ZJ0 A;  1P4N A;  1M1D A;  2CNS A;  4JJX A;  4U5Y A;  2P6E A;  5F46 A;  2VZY A;  2I00 A;  4UFW A;  1YLE A;  3EY5 A;  4AVC A;  2Q44 A;  4NF1 A;  4QVT A;  4QB9 A;  2Z3O A;  3EXN A;  4XPD C;  4NXY A;  1S60 A;  3R1K A;  2OZH A;  4GS4 A;  2QML A;  4B5P B;  3H4Q A;  1S5K A;  4XNH C;  2GIV A;  3CXS A;  1BO4 A;  4OAD A;  3IWG A;  3D8P A;  4C7I A;  4Y49 C;  5EBV A;  3TOB A;  2G0B A;  2Q0Y A;  1FY7 A;  3B8G A;  3IGR A;  1IYK A;  3QB8 A;  4L89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...