4CGOA

Leishmania major n-myristoyltransferase in complex with a thienopyrimidine inhibitor
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgoA00
4CGLA 4CYNA 5G21A 4C7HA 4A32A 5AG6A 2YNCC 4B10A 5G20A 4UFXA 4A33A 4CAEA 4C7IA 5A28A 2YNCA 5G22A 4C2YA 4A95A 2YNDA 4UCMA 4CGOA 2WUUA 2WSAA 4CYOA 4UCNA 4C68A 4B14A 5AG5A 4C2XA 3IU2A 5G1ZA 4B11A 5AG7A 4CGNA 3IWEA 2YNEA 4CYPA 3JTKA 4UFVA 4CYQA 4A30A 5A27A 5AG4A 4UFWA 3H5ZA 5AGEA 4B13A 4CGMA 4C2ZA 4A31A 4UCPA 4B12A 4CGPA 4CAFA 4A2ZA 4BBHA 3IU1A
chains in the Genus database with same CATH superfamily
3NH8A 2HQYA 4EWTA 2QYVA 2ZOFA 2XEIA 3PBBA 3LWUA 3D66A 3V8IA 3VWDA 2ZEEA 4KOXA 4Y49B 2BL1A 2CTBA 4HKFA 4E0AA 1TIQA 3FXTA 1UFHA 4R6TA 2GANA 5H86A 2BSWA 2FSRA 3R9GA 3EY5A 2VZYA 4F9VA 2HV2A 1LCPA 4II9A 1XBUA 3B8GA 2B5GB 5JQ4A 2O4HA 2J8RA 1TF9A 3CXPA 4YFJA 4NGNA 1KUYA 1J4JA 2V8HA 2FIWA 2G3TA 2B5GA 2GE3A 4CPAA 4L8AA 2GU2A 4AG9A 3S9MA 2PJ8A 2EO8A 4KLVA 2EBJA 4RN7A 4UA3A 3DR6A 1F2PA 2ZOGA 3K2KA 4NGRA 1A2ZA 3FJUA 5LYFA 3RYOA 3TC8A 1DTDA 2ABZA 4M6GA 2BUEA 4J3GA 3PB6X 1RO5A 2PJ2A 3T9YA 3CXSA 4R87A 2D4OA 2X7BA 2Z3OA 2ZEFA 2QMLA 3I3GA 5F46A 2F7VA 4WJBA 2V8DA 4OC3A 2CNSA 3H8FA 1MJ9A 1YK3A 4R3KA 5HH1A 2ZEMA 3LMSA 4PSXA 2B3VA 4MFZA 3W6XA 4RI1A 4MCPA 4ONWA 1I21A 1CP7A 2VL1A 4ORFA 1UWYA 1IY7A 1CPXA 2OR4A 4HNWB 4KZTA 2POKA 4KOSA 4XNHB 3N7ZA 1XIXA 2FVGA 4M6HA 2Z10A 4CGPA 4UWIA 3ISXA 3SJGA 1YLOA 3FMCA 4X8IA 1HDQA 2PIYA 1BAVA 2RB7A 5CPAA 4BINA 2C6CA 3KHZA 2OZHA 4NXYA 4B5OA 4NJQA 2HC9A 1WWZA 1XE4A 2Z3NA 3ISZA 4F0XA 5C82A 4EMEA 1NE9A 1XJOA 4O23A 2PJBA 4FAIA 4KVXA 4K30A 1IYKA 5DWMA 3RO0A 2FL4A 1QMUA 1YX0A 1CX8A 3FVLA 4AB7A 3W6SA 1IOFA 4KLWA 1XEBA 4ZY1A 3D2MA 3R1KA 4P4JA 2WZNA 1YMEA 5IB0A 5J8FA 2ANPA 5HVGA 3BI1A 4CAFA 4PV6A 3IU1A 2Z3PA 3RZAA 1IOIA 3SJFA 4JWPA 5AG6A 3TO6A 4A37A 2PR8A 1IIDA 1BOBA 3FIXA 4U9YA 2CIJA 5FVJA 4UFXA 3F5BA 2FCKA 3FYNA 4KVME 1U6MA 3H4QA 3SI1A 2QECA 1QSMA 3IWWA 2P0WA 4YWYA 3A9LA 2AE6A 2ATRA 1FT7A 4UEEA 4GXHA 2R8VA 2Q4ZA 3WC7A 4OC0A 3FF3A 1Z5RA 1AYEA 1Y0RA 3VWEA 5H84A 3PB4X 3B3VA 2Z3MA 2DXQA 2VXKA 2PJ1A 4IK2A 4UCPA 4FD4A 4H6ZA 1FNOA 3EC4A 4LX9A 4XPDB 3WABA 3RNZA 1MJBA 1ARMA 5G21A 3B3SA 2FIAA 4B5PB 2VZZA 2EK9A 4Z65A 3JUWA 1Z4RA 3BJ7A 2NMTA 3KHXA 3DDDA 3DLJA 4B5PA 4BD9A 2YNCA 5G22A 4MCQA 2PJ3A 4A95A 5K8PA 1VHSA 2IQ6A 3B3CA 5IB9A 4R7MA 5JPHA 2B4DB 4UF4A 3LD2A 3PBEA 4UCNA 5C88A 5EC4A 5AG7A 2RFHA 1QQ9A 1XFOA 1H8LA 2ODFA 3QAYA 3JTKA 2R1IA 2P6GA 3PB8X 1VKCA 4XNHC 2H5MA 3FECA 4HPSA 1XMBA 4TNUA 4X5KA 3GIUA 2PRBA 4KOTA 1OBRA 4DNCA 4CGLA 5LRKA 3CPAA 4P6YA 4G1PA 4MFJA 8CPAA 5BWAB 2PJ9A 1S3ZA 4OLLA 3UY5A 3PEIA 1IGBA 1Q7LA 4CAEA 4PXDA 3S6FA 2NYQA 1CBXA 2WPWA 3EXNA 1CPSA 2Q7SA 4OKOA 4Q7AA 1LAMA 1RXTA 2AFZA 2PVWA 4PXCA 1KWMA 2ZEHA 1MK4A 3H8GA 2WSAA 3FH4A 4KSFA 1YSJA 4MRIA 1R57A 3TCVA 3FB3A 1ZG9A 3EO4A 1CG2A 4HNXB 1M4GA 4B11A 4MJ8A 1GYTA 2V8GA 2C1CA 4KORA 4UIBA 2I00A 5J8CA 1AUGA 2JEVA 2VI7A 3KKWA 3KQZA 2DPSA 2J8MA 5GCNA 4NGSA 3H5ZA 4YU9A 2JDDA 2NSMA 4MCRA 5D8NA 1M1DA 1I1DA 4NGQA 1Y7RA 1LAPA 2PJ6A 4MBUA 3SXOA 1ZO0A 4NF1A 2OOTA 5JH9A 2EK8A 3TO9A 4PPZA 4KSIA 1EE3P 3DNSA 3H8EA 3PB7X 2C27A 4A33A 4OIDA 3V38A 1JQGA 2ZPAA 3CXQA 1YGHA 3PB9X 3RAMA 3G8WA 1S60A 1Y0YA 1Z4EA 4KVOE 2WUUA 4OC1A 1YVOA 4LQ6A 4B14A 2C6GA 5D29A 2PR1A 1BO4A 3NH5A 2BO9A 2PIZA 4H2KA 2CXAA 4QUSA 4OC5A 2IJZA 3FNCA 5J1QA 2EUIA 3F8KA 4ZGYB 5LRGA 5F09A 4CYQA 2OB0A 4A30A 3BI0A 2GLFA 3IWGA 3NFZA 1CJWA 2R98A 4MFQA 4MHZA 4B6ZA 2P6FA 3B7IA 4XPDC 4A2ZA 1R43A 2F5IA 2JLMA 4MHPA 3WT4A 4P44A 3SI2A 2ZEOA 1PU9A 1TKHA 2JBJA 1K4JA 2CF4A 3R95A 2RC4A 1YW4A 2IMOA 2ZW5A 5G20A 1Y9WA 4OC4A 1IICA 2Q4VA 3KL9A 2PJ4A 5I0CA 4E8OA 2VEZA 4KOVA 4X3RA 1B87A 1S7FA 2PSWA 4L89A 1N71A 4MY3A 2PCUA 5LYLA 4OADA 2CNTA 2HB6A 3IU2A 5LYIA 1HEEA 5E96A 4CS0B 4UEZA 2OZGA 1F2OA 4CYPA 3KQXA 4C68A 2AFOA 4AVBA 1IB1E 1DE4C 4NCZA 1Q2DA 2AFUA 4CRYB 2EVNA 7CPAA 1NMTA 4HNYB 1TKFA 4PK3A 2AFSA 3SJXA 3OWCA 4A39A 2XEJA 1BLLE 3SHPA 4Y49C 3SI0A 3I1UA 4A94A 1YR0A 2PDOA 4P10A 3GB0A 3PGPA 4MHDA 4RS2A 3P2FA 3CZXA 3B3TA 4Q38A 2Q51A 3D68A 4R3LA 4OP4A 1QSNA 3ZJ0A 2YNEA 1Z9UA 4IAVA 3PFEA 3S9LA 2Z0ZA 3CT9A 1SQHA 2Q0YA 5CBMA 1KUVA 4M6IA 4DYOA 4DUKA 5ELYA 4I49A 1CP6A 4R8FA 2OZUA 1M4IA 3WC5A 4F9UA 3PP9A 3VH9A 1LOKA 3NA6A 3KGQA 2GREA 3RBUA 4UBRA 4OAEA 3P2HA 2Q7BA 5A28A 2REFA 1Z8XA 2O28A 5EMIA 1M4LA 1TKJA 1S7NA 4UCMA 2GFQA 1Q2YA 3D3SA 4U9ZA 1XF8A 1HDUA 1XOVA 3B3WA 4PSWA 4WWVA 4CAVA 1PUAA 3D8PA 1ELLP 2IL4A 1ZG8A 3S6GA 1YLEA 4QC6A 3V7ZA 2ZEGA 1AMPA 4MFKA 1PCAA 4AXVA 3JRUA 2PQ8A 2WPXA 3D2PA 4AVCA 5K8MA 2JEWA 3B35A 2ZW4A 4UFWA 4B13A 1OZPA 1ZLHA 3I9SA 4CGMA 5I4MA 3PZJA 4BMHA 1V0CA 4PQAA 4OMEA 1VGYA 1S7KA 1JWQA 3TX8A 1IYLA 1Z2LA 1QSOA 3NE8A 4XPLA 1ELMP 2B4BA 4TWEA 3SXNA 2XEGA 2JBKA 4A32A 1XMTA 3MN8A 2PVVA 4MY0A 4ZYQA 4B10A 4ZX9A 1IU8A 1VHOA 3JVNA 1R3NA 2YNDA 3IC1A 3IEHA 4MHYA 4F0YA 4CAWA 2Q43A 4LUAA 4KS9A 4QBJA 4FD6A 3QB8A 2AFMA 5HXDA 3R96A 4H6UA 2ZW6A 3E0KA 3GY9A 3BHXA 1M4DA 2PJ7A 5AG4A 2Z3LA 2FE7A 5IX3A 4MI4A 4KOUA 2G0BA 4EVYA 4Q36A 4NSQA 4K3NA 4BBHA 1BPMA 3S9NA 1YREA 2DPTA 1F57A 3GKRA 2WYRA 2PRQA 1B6BA 2Q04A 3BJ8A 2J9AA 3IO1A 4PXBA 1QSTA 2EWBA 3TO7A 2PC1A 2ZW7A 3TOBA 4R57A 1Z8TA 3IFEA 4U5YA 4EFDA 3D7FA 3B2YA 4X2TA 5IV0A 2B58A 3D67A 1NSAA 4IHMA 4YGOA 2PJCA 2FT0A 3DSBA 3FEDA 4CYOA 3FRMA 4FWUA 1NSLA 4F8ZA 4KOWA 2AFWA 4QB9A 5AG5A 5G1ZA 3HLPA 2Q4YA 3K9TA 3MRUA 4MFPA 5KTCA 4AVAA 2DF5A 4ZI6A 2I79A 4H89A 3GYAA 1VIXA 4OC2A 4P4DA 3TTHA 2Q44A 5EBVA 5AGEA 5DS0A 2QVPA 2P6EA 4C2ZA 4P4BA 4P4IA 5CNPA 1YQEA 1Y9KA 1GHEA 4NJRA 3DGVA 3W91A 3VATA 2PE3A 5F49A 2YNCC 4P4FA 5JM6A 1LFWA 1ZLIA 2D4PA 3MGDA 3KASA 4FD7A 4GS4A 1M44A 4JLYA 4W9YA 4C2YA 3CDXA 2K5TA 4UIAA 4MHNA 3ZZIA 2VQYA 2C6PA 4CGOA 2Z3KA 2VBQA 4KUAA 1PYTB 2QJ8A 3N5FA 4IUSA 3NE7A 1Z8LA 2OH1A 5THWA 3FBUA 3KR5A 2Y0MA 2O53A 3EFAA 4IF5A 4NFRA 1QSRA 4JZ0A 4C2XA 3TE4A 4DJLA 3FEEA 3TT2A 3NH4A 2V77A 3QAHA 2F8HA 3QNVA 3KI9A 1BPNA 2J8NA 2XEFA 2CTCA 4MCSA 4CYNA 3D4UA 3LODA 1I12A 2Z11A 1S5KA 4JXRA 4PK2A 5KTDA 1KZFA 2V8VA 3PRTA 3TFYA 2OU2A 2ZELA 4P45A 4FUUA 2PJ0A 3GLJA 2B3UA 3KZWA 2BEIA 5F47A 5F48A 4CAXA 4JD6A 1LRZA 4KSAA 1Z8WA 5LRJA 4ZX8A 4XPKA 5ISVA 4GM5A 1TXRA 1WK4A 3IGRA 3CPXA 4ZBGA 4R9MA 2JDCA 2ZENA 1KUXA 1XRYA 4MMOA 2CNMA 2FXFA 3R9EA 4CRZB 4AG7A 5K8NA 4B12A 3WC6A 1ARLA 3GUXA 5JGFA 4F6AA 4UEFA 3D7GA 4M85A 4ONUA 4OIWA 1ON0A 3FX6A 4E2AA 2DEAA 4NGMA 2I3CA 4A38A 1Q2CA 1ZG7A 2BCOA 1LANA 2REEA 3TOAA 3S6HA 5HVHA 3C26A 4MXUA 2ZEDA 3BXMA 3KR4A 4NGTA 2GLJA 4NGPA 2HUZA 2G9DA 1MJAA 4ZY2A 3HUVA 5LYDA 3F0AA 4JJXA 1Y7EA 1P0HA 1YW6A 4JXQA 5A27A 3LACA 3IJ3A 2PJAA 3PFOA 3VARA 1P4NA 4YRHA 1YVKA 3DR8A 4R76A 5HMNA 3R9FA 3WR7A 4RUHA 1RTQA 4KOYA 4KUBA 4C7HA 2AJ6A 2R7HA 4FBEA 2BOAA 2G3AA 2QIRA 3G3SA 3L2NA 2FS5A 4C7IA 3S6KA 3SJEA 4QVTA 2CY2A 2AFXA 4P4EA 5HVFA 1X12A 1S7LA 1X10A 4MFLA 4LQGA 4ZY0A 6CPAA 4UWJA 4M3SA 3T90A 3D7DA 3D7HA 2A4NA 4JYWA 1TF8A 2GIVA 2ZEPA 2ARHA 2B4DA 4CGNA 1CM0A 3IWEA 1FY7A 3K9UA 2YGWA 4UFVA 3T8WA 4FD5A 5DWNA 4NEXA 2ZXVA 2PJ5A 1VHEA 5KTAA 1L0CA 5K8OA 4A31A 3BLNA 2KCWA 3IIBA 4PXEA
chains in the Genus database with same CATH topology
2HQYA 3V8IA 3VWDA 4KOXA 4Y49B 2BL1A 4HKFA 4E0AA 1TIQA 3FXTA 1UFHA 2GANA 5H86A 2BSWA 2FSRA 3R9GA 3EY5A 2VZYA 2HV2A 4II9A 3B8GA 2B5GB 5JQ4A 2J8RA 3CXPA 4YFJA 1KUYA 1J4JA 2FIWA 2G3TA 2B5GA 2GE3A 4L8AA 4AG9A 4KLVA 4UA3A 3DR6A 3RYOA 2BUEA 4J3GA 1RO5A 3T9YA 3CXSA 4R87A 2D4OA 2X7BA 2Z3OA 2QMLA 3I3GA 5F46A 2CNSA 1MJ9A 1YK3A 4R3KA 5HH1A 4PSXA 2B3VA 4MFZA 3W6XA 4RI1A 1I21A 4ORFA 4HNWB 4KZTA 4KOSA 4XNHB 3N7ZA 1XIXA 2Z10A 4CGPA 4UWIA 2OZHA 4NXYA 4B5OA 2Z3NA 1WWZA 1XE4A 4F0XA 5C82A 1NE9A 4KVXA 4K30A 1IYKA 5DWMA 2FL4A 1YX0A 4AB7A 3W6SA 4KLWA 1XEBA 3D2MA 3R1KA 5IB0A 5J8FA 4CAFA 4PV6A 3IU1A 2Z3PA 4JWPA 5AG6A 3TO6A 2PR8A 3FIXA 1IIDA 1BOBA 4U9YA 5FVJA 4UFXA 3F5BA 2FCKA 3FYNA 4KVME 1U6MA 3H4QA 2QECA 1QSMA 2P0WA 3A9LA 2AE6A 2ATRA 2R8VA 3VWEA 5H84A 2Z3MA 2DXQA 2VXKA 4UCPA 4FD4A 4H6ZA 3EC4A 4LX9A 4XPDB 1MJBA 5G21A 2FIAA 4B5PB 2VZZA 3JUWA 1Z4RA 3BJ7A 2NMTA 3DDDA 4B5PA 2YNCA 5G22A 4A95A 1VHSA 5JPHA 2B4DB 4UCNA 3LD2A 5C88A 5EC4A 5AG7A 3JTKA 2R1IA 2P6GA 1VKCA 4XNHC 2H5MA 4X5KA 2PRBA 4KOTA 4DNCA 4CGLA 4MFJA 5BWAB 3UY5A 1S3ZA 4OLLA 4CAEA 3S6FA 2WPWA 3EXNA 1RXTA 1MK4A 2WSAA 4KSFA 1R57A 3TCVA 3FB3A 3EO4A 4HNXB 1M4GA 4B11A 4MJ8A 4KORA 2I00A 5J8CA 2JEVA 2VI7A 3KKWA 5GCNA 2DPSA 2J8MA 3H5ZA 2JDDA 1M1DA 1I1DA 1Y7RA 3SXOA 4MBUA 1ZO0A 4NF1A 3TO9A 3DNSA 2C27A 4A33A 2ZPAA 3CXQA 1YGHA 3G8WA 1S60A 1Z4EA 4KVOE 2WUUA 1YVOA 4B14A 2PR1A 1BO4A 2CXAA 4QUSA 3FNCA 2EUIA 3F8KA 4ZGYB 4CYQA 2OB0A 4A30A 3IWGA 1CJWA 2R98A 4MFQA 2P6FA 4XPDC 4A2ZA 2F5IA 2JLMA 1PU9A 1K4JA 3R95A 2RC4A 2ZW5A 5G20A 1Y9WA 1IICA 2Q4VA 5I0CA 4E8OA 2VEZA 4KOVA 1B87A 1S7FA 2PSWA 4L89A 1N71A 4MY3A 4OADA 2CNTA 3IU2A 4CS0B 5E96A 2OZGA 4CYPA 4C68A 4AVBA 1IB1E 4CRYB 4NCZA 1Q2DA 2EVNA 1NMTA 4HNYB 4PK3A 3OWCA 3SHPA 4Y49C 1YR0A 2PDOA 4RS2A 3PGPA 4MHDA 3P2FA 4Q38A 4R3LA 1QSNA 3ZJ0A 2YNEA 1Z9UA 2Z0ZA 1SQHA 2Q0YA 1KUVA 4I49A 2OZUA 1M4IA 3PP9A 4UBRA 4OAEA 3P2HA 2Q7BA 5A28A 2REFA 2O28A 1S7NA 4UCMA 1Q2YA 3D3SA 4U9ZA 1XF8A 4PSWA 4CAVA 1PUAA 3D8PA 2IL4A 3S6GA 1YLEA 4QC6A 4MFKA 2PQ8A 2WPXA 3D2PA 4AVCA 2ZW4A 4UFWA 4B13A 1OZPA 4CGMA 3I9SA 3PZJA 4BMHA 1V0CA 1S7KA 1IYLA 1QSOA 4XPLA 2B4BA 3SXNA 4A32A 1XMTA 4MY0A 4B10A 3JVNA 2YNDA 4F0YA 4CAWA 4LUAA 4KS9A 4QBJA 4FD6A 3QB8A 3R96A 4H6UA 2ZW6A 3E0KA 3GY9A 1M4DA 5AG4A 5IX3A 2Z3LA 2FE7A 4MI4A 4KOUA 2G0BA 4EVYA 4Q36A 4NSQA 4BBHA 1YREA 2DPTA 3GKRA 1B6BA 2Q04A 3BJ8A 1QSTA 3TO7A 2PC1A 2ZW7A 3TOBA 4R57A 4U5YA 5IV0A 2B58A 4YGOA 3DSBA 2FT0A 4CYOA 3FRMA 1NSLA 4KOWA 5AG5A 4QB9A 5G1ZA 2Q4YA 4MFPA 5KTCA 4AVAA 2I79A 4H89A 3GYAA 3TTHA 2Q44A 5EBVA 5AGEA 4C2ZA 2P6EA 5CNPA 1Y9KA 1GHEA 3W91A 5F49A 2YNCC 2D4PA 3MGDA 4FD7A 4GS4A 4JLYA 1M44A 4C2YA 2K5TA 3ZZIA 2VQYA 4CGOA 2Z3KA 2VBQA 4KUAA 4IUSA 3NE7A 2OH1A 3FBUA 4C2XA 2Y0MA 3EFAA 4IF5A 3TE4A 1QSRA 3TT2A 3QAHA 2J8NA 4CYNA 3LODA 1I12A 2Z11A 1S5KA 4JXRA 4PK2A 5KTDA 1KZFA 3TFYA 2OU2A 2B3UA 2BEIA 5F47A 5F48A 4CAXA 4JD6A 1LRZA 4KSAA 4XPKA 5ISVA 1WK4A 3IGRA 4ZBGA 4R9MA 2JDCA 4CRZB 1KUXA 3R9EA 2CNMA 2FXFA 4AG7A 4B12A 4F6AA 4M85A 4ONUA 1ON0A 4E2AA 1Q2CA 2REEA 3TOAA 3S6HA 3C26A 2HUZA 1MJAA 3F0AA 4JJXA 4JXQA 1P0HA 5A27A 1P4NA 4YRHA 1YVKA 3DR8A 5HMNA 3R9FA 3WR7A 4KOYA 4KUBA 4C7HA 2AJ6A 2R7HA 2G3AA 2QIRA 3G3SA 2FS5A 4C7IA 3S6KA 4QVTA 2CY2A 4MFLA 1S7LA 4UWJA 4M3SA 3T90A 2A4NA 2GIVA 2ARHA 2B4DA 4CGNA 1CM0A 3IWEA 1FY7A 3K9UA 2YGWA 4UFVA 4FD5A 5DWNA 4NEXA 2ZXVA 5KTAA 1L0CA 4A31A 3BLNA 2KCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGL A;  4CYN A;  5G21 A;  4C7H A;  4A32 A;  5AG6 A;  2YNC C;  4B10 A;  5G20 A;  4UFX A;  4A33 A;  4CAE A;  4C7I A;  5A28 A;  2YNC A;  5G22 A;  4C2Y A;  4A95 A;  2YND A;  4UCM A;  4CGO A;  2WUU A;  2WSA A;  4CYO A;  4UCN A;  4C68 A;  4B14 A;  5AG5 A;  4C2X A;  3IU2 A;  5G1Z A;  4B11 A;  5AG7 A;  4CGN A;  3IWE A;  2YNE A;  4CYP A;  3JTK A;  4UFV A;  4CYQ A;  4A30 A;  5A27 A;  5AG4 A;  4UFW A;  3H5Z A;  5AGE A;  4B13 A;  4CGM A;  4C2Z A;  4A31 A;  4UCP A;  4B12 A;  4CGP A;  4CAF A;  4A2Z A;  4BBH A;  3IU1 A; 
#chains in the Genus database with same CATH topology
 3NH8 A;  2HQY A;  4EWT A;  2QYV A;  2ZOF A;  2XEI A;  3PBB A;  3LWU A;  3D66 A;  3V8I A;  3VWD A;  2ZEE A;  4KOX A;  4Y49 B;  2BL1 A;  2CTB A;  4HKF A;  4E0A A;  1TIQ A;  3FXT A;  1UFH A;  4R6T A;  2GAN A;  5H86 A;  2BSW A;  2FSR A;  3R9G A;  3EY5 A;  2VZY A;  4F9V A;  2HV2 A;  1LCP A;  4II9 A;  1XBU A;  3B8G A;  2B5G B;  5JQ4 A;  2O4H A;  2J8R A;  1TF9 A;  3CXP A;  4YFJ A;  4NGN A;  1KUY A;  1J4J A;  2V8H A;  2FIW A;  2G3T A;  2B5G A;  2GE3 A;  4CPA A;  4L8A A;  2GU2 A;  4AG9 A;  3S9M A;  2PJ8 A;  2EO8 A;  4KLV A;  2EBJ A;  4RN7 A;  4UA3 A;  3DR6 A;  1F2P A;  2ZOG A;  3K2K A;  4NGR A;  1A2Z A;  3FJU A;  5LYF A;  3RYO A;  3TC8 A;  1DTD A;  2ABZ A;  4M6G A;  2BUE A;  4J3G A;  3PB6 X;  1RO5 A;  2PJ2 A;  3T9Y A;  3CXS A;  4R87 A;  2D4O A;  2X7B A;  2Z3O A;  2ZEF A;  2QML A;  3I3G A;  5F46 A;  2F7V A;  4WJB A;  2V8D A;  4OC3 A;  2CNS A;  3H8F A;  1MJ9 A;  1YK3 A;  4R3K A;  5HH1 A;  2ZEM A;  3LMS A;  4PSX A;  2B3V A;  4MFZ A;  3W6X A;  4RI1 A;  4MCP A;  4ONW A;  1I21 A;  1CP7 A;  2VL1 A;  4ORF A;  1UWY A;  1IY7 A;  1CPX A;  2OR4 A;  4HNW B;  4KZT A;  2POK A;  4KOS A;  4XNH B;  3N7Z A;  1XIX A;  2FVG A;  4M6H A;  2Z10 A;  4CGP A;  4UWI A;  3ISX A;  3SJG A;  1YLO A;  3FMC A;  4X8I A;  1HDQ A;  2PIY A;  1BAV A;  2RB7 A;  5CPA A;  4BIN A;  2C6C A;  3KHZ A;  2OZH A;  4NXY A;  4B5O A;  4NJQ A;  2HC9 A;  1WWZ A;  1XE4 A;  2Z3N A;  3ISZ A;  4F0X A;  5C82 A;  4EME A;  1NE9 A;  1XJO A;  4O23 A;  2PJB A;  4FAI A;  4KVX A;  4K30 A;  1IYK A;  5DWM A;  3RO0 A;  2FL4 A;  1QMU A;  1YX0 A;  1CX8 A;  3FVL A;  4AB7 A;  3W6S A;  1IOF A;  4KLW A;  1XEB A;  4ZY1 A;  3D2M A;  3R1K A;  4P4J A;  2WZN A;  1YME A;  5IB0 A;  5J8F A;  2ANP A;  5HVG A;  3BI1 A;  4CAF A;  4PV6 A;  3IU1 A;  2Z3P A;  3RZA A;  1IOI A;  3SJF A;  4JWP A;  5AG6 A;  3TO6 A;  4A37 A;  2PR8 A;  1IID A;  1BOB A;  3FIX A;  4U9Y A;  2CIJ A;  5FVJ A;  4UFX A;  3F5B A;  2FCK A;  3FYN A;  4KVM E;  1U6M A;  3H4Q A;  3SI1 A;  2QEC A;  1QSM A;  3IWW A;  2P0W A;  4YWY A;  3A9L A;  2AE6 A;  2ATR A;  1FT7 A;  4UEE A;  4GXH A;  2R8V A;  2Q4Z A;  3WC7 A;  4OC0 A;  3FF3 A;  1Z5R A;  1AYE A;  1Y0R A;  3VWE A;  5H84 A;  3PB4 X;  3B3V A;  2Z3M A;  2DXQ A;  2VXK A;  2PJ1 A;  4IK2 A;  4UCP A;  4FD4 A;  4H6Z A;  1FNO A;  3EC4 A;  4LX9 A;  4XPD B;  3WAB A;  3RNZ A;  1MJB A;  1ARM A;  5G21 A;  3B3S A;  2FIA A;  4B5P B;  2VZZ A;  2EK9 A;  4Z65 A;  3JUW A;  1Z4R A;  3BJ7 A;  2NMT A;  3KHX A;  3DDD A;  3DLJ A;  4B5P A;  4BD9 A;  2YNC A;  5G22 A;  4MCQ A;  2PJ3 A;  4A95 A;  5K8P A;  1VHS A;  2IQ6 A;  3B3C A;  5IB9 A;  4R7M A;  5JPH A;  2B4D B;  4UF4 A;  3LD2 A;  3PBE A;  4UCN A;  5C88 A;  5EC4 A;  5AG7 A;  2RFH A;  1QQ9 A;  1XFO A;  1H8L A;  2ODF A;  3QAY A;  3JTK A;  2R1I A;  2P6G A;  3PB8 X;  1VKC A;  4XNH C;  2H5M A;  3FEC A;  4HPS A;  1XMB A;  4TNU A;  4X5K A;  3GIU A;  2PRB A;  4KOT A;  1OBR A;  4DNC A;  4CGL A;  5LRK A;  3CPA A;  4P6Y A;  4G1P A;  4MFJ A;  8CPA A;  5BWA B;  2PJ9 A;  1S3Z A;  4OLL A;  3UY5 A;  3PEI A;  1IGB A;  1Q7L A;  4CAE A;  4PXD A;  3S6F A;  2NYQ A;  1CBX A;  2WPW A;  3EXN A;  1CPS A;  2Q7S A;  4OKO A;  4Q7A A;  1LAM A;  1RXT A;  2AFZ A;  2PVW A;  4PXC A;  1KWM A;  2ZEH A;  1MK4 A;  3H8G A;  2WSA A;  3FH4 A;  4KSF A;  1YSJ A;  4MRI A;  1R57 A;  3TCV A;  3FB3 A;  1ZG9 A;  3EO4 A;  1CG2 A;  4HNX B;  1M4G A;  4B11 A;  4MJ8 A;  1GYT A;  2V8G A;  2C1C A;  4KOR A;  4UIB A;  2I00 A;  5J8C A;  1AUG A;  2JEV A;  2VI7 A;  3KKW A;  3KQZ A;  2DPS A;  2J8M A;  5GCN A;  4NGS A;  3H5Z A;  4YU9 A;  2JDD A;  2NSM A;  4MCR A;  5D8N A;  1M1D A;  1I1D A;  4NGQ A;  1Y7R A;  1LAP A;  2PJ6 A;  4MBU A;  3SXO A;  1ZO0 A;  4NF1 A;  2OOT A;  5JH9 A;  2EK8 A;  3TO9 A;  4PPZ A;  4KSI A;  1EE3 P;  3DNS A;  3H8E A;  3PB7 X;  2C27 A;  4A33 A;  4OID A;  3V38 A;  1JQG A;  2ZPA A;  3CXQ A;  1YGH A;  3PB9 X;  3RAM A;  3G8W A;  1S60 A;  1Y0Y A;  1Z4E A;  4KVO E;  2WUU A;  4OC1 A;  1YVO A;  4LQ6 A;  4B14 A;  2C6G A;  5D29 A;  2PR1 A;  1BO4 A;  3NH5 A;  2BO9 A;  2PIZ A;  4H2K A;  2CXA A;  4QUS A;  4OC5 A;  2IJZ A;  3FNC A;  5J1Q A;  2EUI A;  3F8K A;  4ZGY B;  5LRG A;  5F09 A;  4CYQ A;  2OB0 A;  4A30 A;  3BI0 A;  2GLF A;  3IWG A;  3NFZ A;  1CJW A;  2R98 A;  4MFQ A;  4MHZ A;  4B6Z A;  2P6F A;  3B7I A;  4XPD C;  4A2Z A;  1R43 A;  2F5I A;  2JLM A;  4MHP A;  3WT4 A;  4P44 A;  3SI2 A;  2ZEO A;  1PU9 A;  1TKH A;  2JBJ A;  1K4J A;  2CF4 A;  3R95 A;  2RC4 A;  1YW4 A;  2IMO A;  2ZW5 A;  5G20 A;  1Y9W A;  4OC4 A;  1IIC A;  2Q4V A;  3KL9 A;  2PJ4 A;  5I0C A;  4E8O A;  2VEZ A;  4KOV A;  4X3R A;  1B87 A;  1S7F A;  2PSW A;  4L89 A;  1N71 A;  4MY3 A;  2PCU A;  5LYL A;  4OAD A;  2CNT A;  2HB6 A;  3IU2 A;  5LYI A;  1HEE A;  5E96 A;  4CS0 B;  4UEZ A;  2OZG A;  1F2O A;  4CYP A;  3KQX A;  4C68 A;  2AFO A;  4AVB A;  1IB1 E;  1DE4 C;  4NCZ A;  1Q2D A;  2AFU A;  4CRY B;  2EVN A;  7CPA A;  1NMT A;  4HNY B;  1TKF A;  4PK3 A;  2AFS A;  3SJX A;  3OWC A;  4A39 A;  2XEJ A;  1BLL E;  3SHP A;  4Y49 C;  3SI0 A;  3I1U A;  4A94 A;  1YR0 A;  2PDO A;  4P10 A;  3GB0 A;  3PGP A;  4MHD A;  4RS2 A;  3P2F A;  3CZX A;  3B3T A;  4Q38 A;  2Q51 A;  3D68 A;  4R3L A;  4OP4 A;  1QSN A;  3ZJ0 A;  2YNE A;  1Z9U A;  4IAV A;  3PFE A;  3S9L A;  2Z0Z A;  3CT9 A;  1SQH A;  2Q0Y A;  5CBM A;  1KUV A;  4M6I A;  4DYO A;  4DUK A;  5ELY A;  4I49 A;  1CP6 A;  4R8F A;  2OZU A;  1M4I A;  3WC5 A;  4F9U A;  3PP9 A;  3VH9 A;  1LOK A;  3NA6 A;  3KGQ A;  2GRE A;  3RBU A;  4UBR A;  4OAE A;  3P2H A;  2Q7B A;  5A28 A;  2REF A;  1Z8X A;  2O28 A;  5EMI A;  1M4L A;  1TKJ A;  1S7N A;  4UCM A;  2GFQ A;  1Q2Y A;  3D3S A;  4U9Z A;  1XF8 A;  1HDU A;  1XOV A;  3B3W A;  4PSW A;  4WWV A;  4CAV A;  1PUA A;  3D8P A;  1ELL P;  2IL4 A;  1ZG8 A;  3S6G A;  1YLE A;  4QC6 A;  3V7Z A;  2ZEG A;  1AMP A;  4MFK A;  1PCA A;  4AXV A;  3JRU A;  2PQ8 A;  2WPX A;  3D2P A;  4AVC A;  5K8M A;  2JEW A;  3B35 A;  2ZW4 A;  4UFW A;  4B13 A;  1OZP A;  1ZLH A;  3I9S A;  4CGM A;  5I4M A;  3PZJ A;  4BMH A;  1V0C A;  4PQA A;  4OME A;  1VGY A;  1S7K A;  1JWQ A;  3TX8 A;  1IYL A;  1Z2L A;  1QSO A;  3NE8 A;  4XPL A;  1ELM P;  2B4B A;  4TWE A;  3SXN A;  2XEG A;  2JBK A;  4A32 A;  1XMT A;  3MN8 A;  2PVV A;  4MY0 A;  4ZYQ A;  4B10 A;  4ZX9 A;  1IU8 A;  1VHO A;  3JVN A;  1R3N A;  2YND A;  3IC1 A;  3IEH A;  4MHY A;  4F0Y A;  4CAW A;  2Q43 A;  4LUA A;  4KS9 A;  4QBJ A;  4FD6 A;  3QB8 A;  2AFM A;  5HXD A;  3R96 A;  4H6U A;  2ZW6 A;  3E0K A;  3GY9 A;  3BHX A;  1M4D A;  2PJ7 A;  5AG4 A;  2Z3L A;  2FE7 A;  5IX3 A;  4MI4 A;  4KOU A;  2G0B A;  4EVY A;  4Q36 A;  4NSQ A;  4K3N A;  4BBH A;  1BPM A;  3S9N A;  1YRE A;  2DPT A;  1F57 A;  3GKR A;  2WYR A;  2PRQ A;  1B6B A;  2Q04 A;  3BJ8 A;  2J9A A;  3IO1 A;  4PXB A;  1QST A;  2EWB A;  3TO7 A;  2PC1 A;  2ZW7 A;  3TOB A;  4R57 A;  1Z8T A;  3IFE A;  4U5Y A;  4EFD A;  3D7F A;  3B2Y A;  4X2T A;  5IV0 A;  2B58 A;  3D67 A;  1NSA A;  4IHM A;  4YGO A;  2PJC A;  2FT0 A;  3DSB A;  3FED A;  4CYO A;  3FRM A;  4FWU A;  1NSL A;  4F8Z A;  4KOW A;  2AFW A;  4QB9 A;  5AG5 A;  5G1Z A;  3HLP A;  2Q4Y A;  3K9T A;  3MRU A;  4MFP A;  5KTC A;  4AVA A;  2DF5 A;  4ZI6 A;  2I79 A;  4H89 A;  3GYA A;  1VIX A;  4OC2 A;  4P4D A;  3TTH A;  2Q44 A;  5EBV A;  5AGE A;  5DS0 A;  2QVP A;  2P6E A;  4C2Z A;  4P4B A;  4P4I A;  5CNP A;  1YQE A;  1Y9K A;  1GHE A;  4NJR A;  3DGV A;  3W91 A;  3VAT A;  2PE3 A;  5F49 A;  2YNC C;  4P4F A;  5JM6 A;  1LFW A;  1ZLI A;  2D4P A;  3MGD A;  3KAS A;  4FD7 A;  4GS4 A;  1M44 A;  4JLY A;  4W9Y A;  4C2Y A;  3CDX A;  2K5T A;  4UIA A;  4MHN A;  3ZZI A;  2VQY A;  2C6P A;  4CGO A;  2Z3K A;  2VBQ A;  4KUA A;  1PYT B;  2QJ8 A;  3N5F A;  4IUS A;  3NE7 A;  1Z8L A;  2OH1 A;  5THW A;  3FBU A;  3KR5 A;  2Y0M A;  2O53 A;  3EFA A;  4IF5 A;  4NFR A;  1QSR A;  4JZ0 A;  4C2X A;  3TE4 A;  4DJL A;  3FEE A;  3TT2 A;  3NH4 A;  2V77 A;  3QAH A;  2F8H A;  3QNV A;  3KI9 A;  1BPN A;  2J8N A;  2XEF A;  2CTC A;  4MCS A;  4CYN A;  3D4U A;  3LOD A;  1I12 A;  2Z11 A;  1S5K A;  4JXR A;  4PK2 A;  5KTD A;  1KZF A;  2V8V A;  3PRT A;  3TFY A;  2OU2 A;  2ZEL A;  4P45 A;  4FUU A;  2PJ0 A;  3GLJ A;  2B3U A;  3KZW A;  2BEI A;  5F47 A;  5F48 A;  4CAX A;  4JD6 A;  1LRZ A;  4KSA A;  1Z8W A;  5LRJ A;  4ZX8 A;  4XPK A;  5ISV A;  4GM5 A;  1TXR A;  1WK4 A;  3IGR A;  3CPX A;  4ZBG A;  4R9M A;  2JDC A;  2ZEN A;  1KUX A;  1XRY A;  4MMO A;  2CNM A;  2FXF A;  3R9E A;  4CRZ B;  4AG7 A;  5K8N A;  4B12 A;  3WC6 A;  1ARL A;  3GUX A;  5JGF A;  4F6A A;  4UEF A;  3D7G A;  4M85 A;  4ONU A;  4OIW A;  1ON0 A;  3FX6 A;  4E2A A;  2DEA A;  4NGM A;  2I3C A;  4A38 A;  1Q2C A;  1ZG7 A;  2BCO A;  1LAN A;  2REE A;  3TOA A;  3S6H A;  5HVH A;  3C26 A;  4MXU A;  2ZED A;  3BXM A;  3KR4 A;  4NGT A;  2GLJ A;  4NGP A;  2HUZ A;  2G9D A;  1MJA A;  4ZY2 A;  3HUV A;  5LYD A;  3F0A A;  4JJX A;  1Y7E A;  1P0H A;  1YW6 A;  4JXQ A;  5A27 A;  3LAC A;  3IJ3 A;  2PJA A;  3PFO A;  3VAR A;  1P4N A;  4YRH A;  1YVK A;  3DR8 A;  4R76 A;  5HMN A;  3R9F A;  3WR7 A;  4RUH A;  1RTQ A;  4KOY A;  4KUB A;  4C7H A;  2AJ6 A;  2R7H A;  4FBE A;  2BOA A;  2G3A A;  2QIR A;  3G3S A;  3L2N A;  2FS5 A;  4C7I A;  3S6K A;  3SJE A;  4QVT A;  2CY2 A;  2AFX A;  4P4E A;  5HVF A;  1X12 A;  1S7L A;  1X10 A;  4MFL A;  4LQG A;  4ZY0 A;  6CPA A;  4UWJ A;  4M3S A;  3T90 A;  3D7D A;  3D7H A;  2A4N A;  4JYW A;  1TF8 A;  2GIV A;  2ZEP A;  2ARH A;  2B4D A;  4CGN A;  1CM0 A;  3IWE A;  1FY7 A;  3K9U A;  2YGW A;  4UFV A;  3T8W A;  4FD5 A;  5DWN A;  4NEX A;  2ZXV A;  2PJ5 A;  1VHE A;  5KTA A;  1L0C A;  5K8O A;  4A31 A;  3BLN A;  2KCW A;  3IIB A;  4PXE A; 
#chains in the Genus database with same CATH homology
 2HQY A;  3V8I A;  3VWD A;  4KOX A;  4Y49 B;  2BL1 A;  4HKF A;  4E0A A;  1TIQ A;  3FXT A;  1UFH A;  2GAN A;  5H86 A;  2BSW A;  2FSR A;  3R9G A;  3EY5 A;  2VZY A;  2HV2 A;  4II9 A;  3B8G A;  2B5G B;  5JQ4 A;  2J8R A;  3CXP A;  4YFJ A;  1KUY A;  1J4J A;  2FIW A;  2G3T A;  2B5G A;  2GE3 A;  4L8A A;  4AG9 A;  4KLV A;  4UA3 A;  3DR6 A;  3RYO A;  2BUE A;  4J3G A;  1RO5 A;  3T9Y A;  3CXS A;  4R87 A;  2D4O A;  2X7B A;  2Z3O A;  2QML A;  3I3G A;  5F46 A;  2CNS A;  1MJ9 A;  1YK3 A;  4R3K A;  5HH1 A;  4PSX A;  2B3V A;  4MFZ A;  3W6X A;  4RI1 A;  1I21 A;  4ORF A;  4HNW B;  4KZT A;  4KOS A;  4XNH B;  3N7Z A;  1XIX A;  2Z10 A;  4CGP A;  4UWI A;  2OZH A;  4NXY A;  4B5O A;  2Z3N A;  1WWZ A;  1XE4 A;  4F0X A;  5C82 A;  1NE9 A;  4KVX A;  4K30 A;  1IYK A;  5DWM A;  2FL4 A;  1YX0 A;  4AB7 A;  3W6S A;  4KLW A;  1XEB A;  3D2M A;  3R1K A;  5IB0 A;  5J8F A;  4CAF A;  4PV6 A;  3IU1 A;  2Z3P A;  4JWP A;  5AG6 A;  3TO6 A;  2PR8 A;  3FIX A;  1IID A;  1BOB A;  4U9Y A;  5FVJ A;  4UFX A;  3F5B A;  2FCK A;  3FYN A;  4KVM E;  1U6M A;  3H4Q A;  2QEC A;  1QSM A;  2P0W A;  3A9L A;  2AE6 A;  2ATR A;  2R8V A;  3VWE A;  5H84 A;  2Z3M A;  2DXQ A;  2VXK A;  4UCP A;  4FD4 A;  4H6Z A;  3EC4 A;  4LX9 A;  4XPD B;  1MJB A;  5G21 A;  2FIA A;  4B5P B;  2VZZ A;  3JUW A;  1Z4R A;  3BJ7 A;  2NMT A;  3DDD A;  4B5P A;  2YNC A;  5G22 A;  4A95 A;  1VHS A;  5JPH A;  2B4D B;  4UCN A;  3LD2 A;  5C88 A;  5EC4 A;  5AG7 A;  3JTK A;  2R1I A;  2P6G A;  1VKC A;  4XNH C;  2H5M A;  4X5K A;  2PRB A;  4KOT A;  4DNC A;  4CGL A;  4MFJ A;  5BWA B;  3UY5 A;  1S3Z A;  4OLL A;  4CAE A;  3S6F A;  2WPW A;  3EXN A;  1RXT A;  1MK4 A;  2WSA A;  4KSF A;  1R57 A;  3TCV A;  3FB3 A;  3EO4 A;  4HNX B;  1M4G A;  4B11 A;  4MJ8 A;  4KOR A;  2I00 A;  5J8C A;  2JEV A;  2VI7 A;  3KKW A;  5GCN A;  2DPS A;  2J8M A;  3H5Z A;  2JDD A;  1M1D A;  1I1D A;  1Y7R A;  3SXO A;  4MBU A;  1ZO0 A;  4NF1 A;  3TO9 A;  3DNS A;  2C27 A;  4A33 A;  2ZPA A;  3CXQ A;  1YGH A;  3G8W A;  1S60 A;  1Z4E A;  4KVO E;  2WUU A;  1YVO A;  4B14 A;  2PR1 A;  1BO4 A;  2CXA A;  4QUS A;  3FNC A;  2EUI A;  3F8K A;  4ZGY B;  4CYQ A;  2OB0 A;  4A30 A;  3IWG A;  1CJW A;  2R98 A;  4MFQ A;  2P6F A;  4XPD C;  4A2Z A;  2F5I A;  2JLM A;  1PU9 A;  1K4J A;  3R95 A;  2RC4 A;  2ZW5 A;  5G20 A;  1Y9W A;  1IIC A;  2Q4V A;  5I0C A;  4E8O A;  2VEZ A;  4KOV A;  1B87 A;  1S7F A;  2PSW A;  4L89 A;  1N71 A;  4MY3 A;  4OAD A;  2CNT A;  3IU2 A;  4CS0 B;  5E96 A;  2OZG A;  4CYP A;  4C68 A;  4AVB A;  1IB1 E;  4CRY B;  4NCZ A;  1Q2D A;  2EVN A;  1NMT A;  4HNY B;  4PK3 A;  3OWC A;  3SHP A;  4Y49 C;  1YR0 A;  2PDO A;  4RS2 A;  3PGP A;  4MHD A;  3P2F A;  4Q38 A;  4R3L A;  1QSN A;  3ZJ0 A;  2YNE A;  1Z9U A;  2Z0Z A;  1SQH A;  2Q0Y A;  1KUV A;  4I49 A;  2OZU A;  1M4I A;  3PP9 A;  4UBR A;  4OAE A;  3P2H A;  2Q7B A;  5A28 A;  2REF A;  2O28 A;  1S7N A;  4UCM A;  1Q2Y A;  3D3S A;  4U9Z A;  1XF8 A;  4PSW A;  4CAV A;  1PUA A;  3D8P A;  2IL4 A;  3S6G A;  1YLE A;  4QC6 A;  4MFK A;  2PQ8 A;  2WPX A;  3D2P A;  4AVC A;  2ZW4 A;  4UFW A;  4B13 A;  1OZP A;  4CGM A;  3I9S A;  3PZJ A;  4BMH A;  1V0C A;  1S7K A;  1IYL A;  1QSO A;  4XPL A;  2B4B A;  3SXN A;  4A32 A;  1XMT A;  4MY0 A;  4B10 A;  3JVN A;  2YND A;  4F0Y A;  4CAW A;  4LUA A;  4KS9 A;  4QBJ A;  4FD6 A;  3QB8 A;  3R96 A;  4H6U A;  2ZW6 A;  3E0K A;  3GY9 A;  1M4D A;  5AG4 A;  5IX3 A;  2Z3L A;  2FE7 A;  4MI4 A;  4KOU A;  2G0B A;  4EVY A;  4Q36 A;  4NSQ A;  4BBH A;  1YRE A;  2DPT A;  3GKR A;  1B6B A;  2Q04 A;  3BJ8 A;  1QST A;  3TO7 A;  2PC1 A;  2ZW7 A;  3TOB A;  4R57 A;  4U5Y A;  5IV0 A;  2B58 A;  4YGO A;  3DSB A;  2FT0 A;  4CYO A;  3FRM A;  1NSL A;  4KOW A;  5AG5 A;  4QB9 A;  5G1Z A;  2Q4Y A;  4MFP A;  5KTC A;  4AVA A;  2I79 A;  4H89 A;  3GYA A;  3TTH A;  2Q44 A;  5EBV A;  5AGE A;  4C2Z A;  2P6E A;  5CNP A;  1Y9K A;  1GHE A;  3W91 A;  5F49 A;  2YNC C;  2D4P A;  3MGD A;  4FD7 A;  4GS4 A;  4JLY A;  1M44 A;  4C2Y A;  2K5T A;  3ZZI A;  2VQY A;  4CGO A;  2Z3K A;  2VBQ A;  4KUA A;  4IUS A;  3NE7 A;  2OH1 A;  3FBU A;  4C2X A;  2Y0M A;  3EFA A;  4IF5 A;  3TE4 A;  1QSR A;  3TT2 A;  3QAH A;  2J8N A;  4CYN A;  3LOD A;  1I12 A;  2Z11 A;  1S5K A;  4JXR A;  4PK2 A;  5KTD A;  1KZF A;  3TFY A;  2OU2 A;  2B3U A;  2BEI A;  5F47 A;  5F48 A;  4CAX A;  4JD6 A;  1LRZ A;  4KSA A;  4XPK A;  5ISV A;  1WK4 A;  3IGR A;  4ZBG A;  4R9M A;  2JDC A;  4CRZ B;  1KUX A;  3R9E A;  2CNM A;  2FXF A;  4AG7 A;  4B12 A;  4F6A A;  4M85 A;  4ONU A;  1ON0 A;  4E2A A;  1Q2C A;  2REE A;  3TOA A;  3S6H A;  3C26 A;  2HUZ A;  1MJA A;  3F0A A;  4JJX A;  4JXQ A;  1P0H A;  5A27 A;  1P4N A;  4YRH A;  1YVK A;  3DR8 A;  5HMN A;  3R9F A;  3WR7 A;  4KOY A;  4KUB A;  4C7H A;  2AJ6 A;  2R7H A;  2G3A A;  2QIR A;  3G3S A;  2FS5 A;  4C7I A;  3S6K A;  4QVT A;  2CY2 A;  4MFL A;  1S7L A;  4UWJ A;  4M3S A;  3T90 A;  2A4N A;  2GIV A;  2ARH A;  2B4D A;  4CGN A;  1CM0 A;  3IWE A;  1FY7 A;  3K9U A;  2YGW A;  4UFV A;  4FD5 A;  5DWN A;  4NEX A;  2ZXV A;  5KTA A;  1L0C A;  4A31 A;  3BLN A;  2KCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...