4CGOA

Leishmania major n-myristoyltransferase in complex with a thienopyrimidine inhibitor
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgoA00
2YNEA 3IU1A 4CGPA 4CYQA 4B11A 4C68A 4A30A 2WSAA 4B13A 5AGEA 5G22A 5AG5A 4UFVA 4A95A 4CGMA 2YNCA 4UCNA 4B12A 2YNCC 4CAFA 2YNDA 5A28A 3IWEA 4CYOA 4UFWA 4A31A 4C7IA 3H5ZA 4B10A 4UCPA 2WUUA 4CYPA 4C2YA 4BBHA 5AG4A 4UCMA 4C2ZA 4C2XA 4C7HA 5G21A 4A33A 5AG6A 4A2ZA 4CGOA 5G1ZA 4CGNA 4CYNA 5A27A 4B14A 5G20A 5AG7A 4CAEA 3IU2A 4A32A 4CGLA 3JTKA 4UFXA
chains in the Genus database with same CATH superfamily
2DPSA 2DPTA 5E96A 1BPMA 3SXNA 3IO1A 2J9AA 2ZELA 3DDDA 4MY3A 1KUXA 1TF8A 5G22A 3SHPA 4CRZB 3B35A 1Z4RA 1K4JA 2PRBA 2JDDA 4ZX8A 3D2PA 4B12A 2OOTA 4CAFA 1WWZA 4CYOA 3WC6A 3WABA 1FY7A 2C6GA 2IJZA 1PCAA 2KCWA 2WPWA 4KZTA 3FEDA 2JBJA 1S5KA 1F2OA 2PJCA 4ONUA 1XRYA 1TIQA 3LMSA 4MHNA 4TWEA 5JH9A 2HC9A 4K30A 4QVTA 2Z3LA 1XE4A 3CXPA 3PB6X 4NF1A 1BPNA 3I3GA 3PFEA 4ZX9A 4CGPA 2IQ6A 2PJ5A 3QB8A 4KSFA 4Q7AA 4J3GA 3CZXA 3FJUA 3S6KA 1LFWA 5C88A 4XNHB 3CPXA 2R98A 4A94A 2IL4A 4IAVA 3B3TA 1UWYA 2ODFA 3VWEA 3WC5A 3TX8A 3V7ZA 2CNTA 2Z10A 3FXTA 3D8PA 4KORA 4EWTA 4P4EA 5JGFA 3BHXA 1XBUA 2VEZA 1IYKA 1YGHA 3FECA 4F9UA 3CPAA 4I49A 3DSBA 4JZ0A 5ISVA 1ZLHA 4X5KA 2VBQA 2QMLA 3CXSA 3CT9A 3TFYA 4OC3A 3TO9A 1H8LA 4CAEA 3B7IA 2BEIA 2BOAA 4UFXA 4DJLA 4P44A 2B58A 4B11A 2QECA 1QQ9A 3GLJA 2DF5A 4MCSA 2PJ3A 4P4JA 4KOWA 3TOAA 2PJ4A 2REEA 5AG5A 2J8NA 1B6BA 5J1QA 2CY2A 4NCZA 4MHPA 3GKRA 5EMIA 3R9EA 4P4IA 3MN8A 4X2TA 3H8FA 4E8OA 1S7NA 1S3ZA 2XEJA 3D7FA 1A2ZA 3IGRA 4NGTA 4M6IA 2B5GA 4GXHA 1ZG9A 3KL9A 4A32A 2V8VA 4CGLA 1VHSA 3NA6A 4H6UA 5IV0A 1Z8WA 4KOVA 1CJWA 4F9VA 1DTDA 1BO4A 4Y49C 4AXVA 3KR5A 4B5PA 4KOTA 1YR0A 3D2MA 3PZJA 1CP7A 1Y9KA 1PUAA 2AE6A 2WYRA 1JWQA 2YNCC 5LYIA 5GCNA 1KUVA 2BCOA 2PJ6A 1IYLA 2QVPA 2CNMA 5HVFA 4CS0B 1V0CA 4MFPA 1PYTB 2K5TA 1LCPA 3FIXA 1YW4A 2OR4A 4PQAA 3WT4A 5KTDA 4KS9A 4NXYA 4PSWA 4OMEA 5G21A 3S6FA 2V8HA 3TE4A 1BLLE 1JQGA 1XOVA 1Z5RA 2FSRA 1VHOA 2ZEEA 1FNOA 2ZW5A 3B2YA 5F46A 1QSTA 4Q38A 3SI1A 1NMTA 2ANPA 3G3SA 3ZZIA 2NMTA 2AFMA 2VQYA 4LQGA 4UIAA 4ZY0A 1HDQA 1OZPA 5HVHA 4FD7A 2C6CA 1ELMP 3KASA 4JJXA 1XIXA 2YNCA 3FRMA 2A4NA 1Q2YA 2YNDA 2B3VA 4UEFA 1TKHA 2GIVA 2HUZA 4R9MA 2OZUA 3W6XA 4KVOE 1Z2LA 2O4HA 3K9UA 3WC7A 4L89A 5HXDA 4HKFA 3S9LA 4BBHA 4CAWA 2G0BA 2HB6A 1AYEA 2PJBA 3KZWA 4DYOA 2JEWA 2EK9A 4M85A 5JQ4A 5LRKA 4A2ZA 5G1ZA 4B5OA 2CXAA 4B14A 4R6TA 3IU2A 5F09A 4MFLA 1M4IA 4PXDA 4FUUA 3S9MA 3SJXA 4CYQA 1M4LA 2JDCA 4B13A 2BO9A 5AGEA 2VI7A 4NJQA 4ZBGA 3FBUA 1MJAA 4OADA 3HUVA 3KI9A 3KHXA 5IB9A 5IX3A 1MJ9A 4Y49B 2ZEHA 1RXTA 3PB7X 3NH4A 3E0KA 1LAPA 5C82A 1QSNA 4AVCA 5J8FA 5LRJA 1CBXA 1ZLIA 4OC0A 2PIYA 1MK4A 2P6FA 4JXRA 2P6GA 2PJ7A 4F6AA 2EO8A 4UCMA 1M4GA 1Q7LA 4PXBA 1NSAA 1KWMA 1YLOA 4M3SA 2C1CA 1ELLP 1HDUA 4F0XA 4Z65A 2BUEA 3MRUA 5K8OA 3LODA 4YWYA 4QUSA 2Q4YA 1CX8A 4KUAA 2YNEA 3KGQA 4C68A 5I0CA 4JLYA 4KLWA 3IC1A 4GS4A 3D67A 3H8EA 5F49A 1Q2CA 3K2KA 4KVXA 2GFQA 2POKA 4UFVA 4JYWA 4FWUA 2B4DB 2VXKA 2OZGA 4RS2A 3CXQA 1ON0A 3D4UA 2PQ8A 3B3SA 4II9A 5LYFA 3T90A 4EMEA 3ISXA 1IGBA 4U9ZA 4M6GA 1XFOA 1I12A 4RN7A 4MMOA 3FVLA 4C2XA 1I1DA 4PXEA 3T9YA 4E2AA 4A38A 2ZW6A 4Q36A 2FE7A 3PRTA 1SQHA 2FIAA 4R57A 4ZY1A 1HEEA 4MHDA 4R3LA 5LRGA 1X10A 3BJ8A 1BAVA 2CTCA 1Z8TA 2QJ8A 3LD2A 4RI1A 4UA3A 3BI0A 3D3SA 4XPDC 5CNPA 5CBMA 2PR8A 2V77A 2G3TA 1GYTA 2HV2A 3RO0A 4H89A 4R8FA 1Y7EA 3TT2A 3V8IA 1YREA 1AUGA 1I21A 1YQEA 2BSWA 4MCPA 4LUAA 3DNSA 3CDXA 4OIDA 4OIWA 5DS0A 3FEEA 3TO7A 5DWMA 4NSQA 1CM0A 2F7VA 4FAIA 3F8KA 2P6EA 2DEAA 4TNUA 2XEFA 1Q2DA 3FH4A 1M4DA 1IOFA 3IWWA 1X12A 2CIJA 4H6ZA 4KOXA 5DWNA 3RAMA 1LAMA 3DR8A 4IF5A 1YSJA 4AVAA 5D29A 4A33A 4NJRA 2VZZA 1NSLA 5K8MA 1VGYA 1GHEA 2AFSA 2FCKA 4KUBA 2ZEMA 4ZY2A 3SI2A 4KSIA 2EWBA 5BWAB 4MHZA 4QBJA 3EFAA 1VHEA 3D7DA 1B87A 4K3NA 4FD4A 4L8AA 3QAHA 1CPSA 2F8HA 4FD5A 1R43A 1S7FA 3B8GA 2X7BA 1TXRA 1IY7A 2PCUA 2Q4VA 4R76A 1RO5A 2ZENA 1QMUA 3IEHA 3SJGA 1S7LA 1P0HA 2PVVA 5THWA 4B6ZA 2EBJA 2JBKA 5H86A 1QSOA 4UEEA 1U6MA 1Y7RA 5FVJA 4KOYA 1YLEA 5JM6A 2O53A 4ORFA 3W91A 2V8DA 4GM5A 4FBEA 3SXOA 2PJ0A 3A9LA 4DUKA 2Z3MA 3PBBA 5HMNA 1XF8A 2BL1A 3RYOA 1KUYA 4F8ZA 2D4PA 4AG7A 2ZEPA 3GB0A 4NGPA 4P45A 3D66A 4U9YA 4P6YA 1YMEA 1OBRA 1Y9WA 3JRUA 3JTKA 3ISZA 3V38A 5KTCA 3PB9X 2PDOA 1XMBA 4A30A 1CG2A 2C6PA 4NGNA 5IB0A 2IMOA 5KTAA 4ZYQA 3EC4A 4NGRA 2EUIA 2OU2A 2V8GA 3TO6A 1YVOA 4NEXA 2PVWA 4E0AA 4MJ8A 1YX0A 2OZHA 3P2FA 4ZGYB 2Z3NA 4NGMA 4MFQA 2RB7A 2Q4ZA 4UF4A 3IJ3A 4QC6A 4XPKA 4KSAA 2PSWA 2ZOFA 4MI4A 5F48A 1F57A 1LANA 2PJ8A 4A39A 4CYNA 7CPAA 3BLNA 3UY5A 1XMTA 3WR7A 2ZW4A 2B4DA 3D7HA 1LOKA 1IIDA 3T8WA 2G9DA 2Z3OA 2Y0MA 2GU2A 8CPAA 1IU8A 2Q43A 3R9FA 4R87A 1NE9A 2Z3KA 3IWEA 2OH1A 3B3VA 1VKCA 4UFWA 2JEVA 4P4BA 3NE8A 1AMPA 3BI1A 3H5ZA 2ZEDA 4CRYB 2D4OA 2F5IA 3I1UA 5K8NA 3PGPA 4EVYA 3FF3A 2AFWA 3PB8X 3QAYA 4JXQA 3JVNA 4P4FA 1S7KA 2Q0YA 3TC8A 2HQYA 5K8PA 4UWJA 3EY5A 1ARLA 4HPSA 1MJBA 2FIWA 2WSAA 2PJ1A 2ZXVA 3QNVA 3TCVA 4MY0A 2B4BA 2I00A 4X8IA 3IWGA 4MFZA 4OC4A 2R1IA 3GYAA 2ZW7A 4P4DA 4OC5A 2Z3PA 2YGWA 4FD6A 3FYNA 4HNYB 4LX9A 2PC1A 5CPAA 2O28A 2I3CA 2ZEFA 4PXCA 3C26A 1FT7A 4OC1A 2ATRA 1XJOA 4UCPA 3NE7A 2Q44A 2CF4A 2AFZA 4HNXB 4C2YA 4RUHA 2Z0ZA 1M1DA 4MCRA 4CYPA 2EK8A 3GIUA 1EE3P 4UIBA 4C7HA 1VIXA 3D7GA 3F5BA 3B3CA 3N7ZA 4ONWA 4CGNA 3R96A 2I79A 1XEBA 4MFJA 3IFEA 2EVNA 3G8WA 3FB3A 3H4QA 3LWUA 3TOBA 1IB1E 4WJBA 4YFJA 3GY9A 1CP6A 3N5FA 3NH8A 1IICA 4MXUA 1J4JA 3HLPA 3OWCA 1YVKA 2XEIA 2GLFA 3NH5A 4MCQA 4OLLA 4IK2A 3IIBA 3FNCA 3SI0A 5LYLA 4UBRA 2Q04A 2P0WA 1ZG8A 3RBUA 2WUUA 1PU9A 1YW6A 2RFHA 4UEZA 3D68A 3JUWA 4YRHA 2PR1A 5AG6A 4CGOA 3P2HA 5H84A 2B3UA 2REFA 3DLJA 1BOBA 4XPLA 4DNCA 3K9TA 4R7MA 3I9SA 4IHMA 3EXNA 2Q7BA 2FVGA 4F0YA 2QIRA 4R3KA 2PRQA 4HNWB 3KKWA 4U5YA 4NGQA 3PP9A 4LQ6A 1F2PA 3BJ7A 3H8GA 4BD9A 1ARMA 2Q7SA 2ZEGA 4UCNA 1ZO0A 5EBVA 6CPAA 3DR6A 2PJ9A 2CNSA 3VATA 3S6HA 3SJEA 2C27A 2GANA 3R9GA 2FXFA 5JPHA 4AVBA 4JD6A 4CPAA 2PIZA 4PSXA 4PV6A 2AFOA 3KR4A 1R3NA 2GLJA 3PB4X 4H2KA 3VWDA 4CAVA 3R95A 5A27A 1WK4A 3BXMA 2H5MA 2ABZA 1M44A 2AJ6A 2R7HA 3F0AA 3GUXA 4NFRA 4PK3A 5AG7A 5G20A 4EFDA 5LYDA 4ZI6A 3S9NA 2NYQA 3PBEA 3SJFA 1IOIA 1RTQA 2GE3A 3MGDA 4UWIA 4YU9A 4QB9A 2JLMA 2G3AA 2RC4A 4AG9A 1R57A 2AFXA 4IUSA 3ZJ0A 1Z8XA 2ARHA 2ZPAA 4PPZA 5A28A 4CGMA 1N71A 2VZYA 3R1KA 4XPDB 5HH1A 5J8CA 1KZFA 1TKJA 1YK3A 2DXQA 3FX6A 4KLVA 4MFKA 4A31A 1Y0RA 5D8NA 4B10A 1S60A 3KQXA 2PE3A 3L2NA 2R8VA 4OP4A 1TF9A 2FL4A 4O23A 4YGOA 4G1PA 5F47A 4OKOA 1QSRA 3B3WA 4BMHA 3FMCA 4PK2A 2ZEOA 2Z11A 3VARA 4W9YA 1ZG7A 2FT0A 4OAEA 3KHZA 4XNHC 2AFUA 2GREA 2FS5A 3IU1A 4CAXA 1Z4EA 1Z8LA 2PJ2A 3S6GA 2B5GB 4JWPA 4NGSA 3VH9A 5HVGA 5EC4A 4MHYA 4KOUA 4M6HA 3TTHA 2XEGA 2WPXA 1DE4C 3RZAA 4A95A 3RNZA 5I4MA 4MBUA 4AB7A 2NSMA 3NFZA 1Z9UA 4B5PB 1L0CA 2OB0A 4C7IA 2QYVA 1LRZA 3EO4A 1CPXA 2ZOGA 4X3RA 1P4NA 1QSMA 1TKFA 3KQZA 3PFOA 5ELYA 3W6SA 3LACA 4BINA 5AG4A 4WWVA 4C2ZA 2J8MA 2Q51A 2CTBA 2J8RA 3PEIA 4KVME 4P10A 3DGVA 4MRIA 1Y0YA 4OC2A 4KOSA 4A37A 2PJAA 2WZNA 2VL1A 1UFHA
chains in the Genus database with same CATH topology
2DPSA 2DPTA 5E96A 3SXNA 3DDDA 4MY3A 1KUXA 5G22A 3SHPA 4CRZB 1Z4RA 1K4JA 2PRBA 2JDDA 3D2PA 4B12A 4CAFA 1WWZA 4CYOA 1FY7A 2WPWA 2KCWA 4KZTA 1S5KA 4ONUA 1TIQA 4K30A 4QVTA 2Z3LA 1XE4A 3CXPA 4NF1A 3I3GA 4CGPA 3QB8A 4KSFA 4J3GA 3S6KA 5C88A 4XNHB 2R98A 2IL4A 3VWEA 2CNTA 2Z10A 3FXTA 3D8PA 4KORA 2VEZA 1IYKA 1YGHA 4I49A 3DSBA 5ISVA 4X5KA 2VBQA 2QMLA 3CXSA 3TFYA 3TO9A 4CAEA 2BEIA 4UFXA 2B58A 4B11A 2QECA 4KOWA 3TOAA 2REEA 5AG5A 2J8NA 1B6BA 2CY2A 4NCZA 3GKRA 3R9EA 4E8OA 1S7NA 1S3ZA 3IGRA 2B5GA 4A32A 5IV0A 4CGLA 1VHSA 4H6UA 4KOVA 1CJWA 1BO4A 4Y49C 4B5PA 4KOTA 1YR0A 3D2MA 3PZJA 1Y9KA 1PUAA 2AE6A 2YNCC 5GCNA 1KUVA 1IYLA 4CS0B 2CNMA 1V0CA 4MFPA 2K5TA 3FIXA 5KTDA 4KS9A 4NXYA 4PSWA 5G21A 3S6FA 3TE4A 2FSRA 2ZW5A 5F46A 1QSTA 4Q38A 3G3SA 1NMTA 3ZZIA 2NMTA 2VQYA 1OZPA 4FD7A 4JJXA 1XIXA 2YNCA 3FRMA 2A4NA 1Q2YA 2YNDA 2B3VA 2GIVA 2HUZA 4R9MA 2OZUA 3W6XA 4KVOE 3K9UA 4L89A 4HKFA 4BBHA 4CAWA 2G0BA 4M85A 5JQ4A 4A2ZA 5G1ZA 4B5OA 2CXAA 4B14A 3IU2A 4MFLA 1M4IA 4CYQA 4B13A 2JDCA 5AGEA 2VI7A 4ZBGA 3FBUA 1MJAA 4OADA 5IX3A 1MJ9A 4Y49B 1RXTA 3E0KA 5C82A 5J8FA 1QSNA 4AVCA 1MK4A 2P6FA 4JXRA 2P6GA 4F6AA 4UCMA 1M4GA 4M3SA 4F0XA 2BUEA 3LODA 4QUSA 2Q4YA 4KUAA 2YNEA 4C68A 5I0CA 4JLYA 4KLWA 4GS4A 5F49A 1Q2CA 4KVXA 4UFVA 2B4DB 2VXKA 2OZGA 4RS2A 3CXQA 1ON0A 2PQ8A 4II9A 3T90A 4U9ZA 1I12A 4C2XA 1I1DA 4E2AA 3T9YA 2ZW6A 4Q36A 2FE7A 1SQHA 2FIAA 4R57A 4MHDA 4R3LA 3LD2A 3BJ8A 4UA3A 4RI1A 4XPDC 3D3SA 5CNPA 2PR8A 2G3TA 2HV2A 4H89A 3TT2A 3V8IA 1YREA 1I21A 2BSWA 4LUAA 3DNSA 3TO7A 5DWMA 4NSQA 1CM0A 3F8KA 2P6EA 4KOXA 1Q2DA 4CYPA 1M4DA 4H6ZA 5DWNA 3DR8A 4IF5A 4AVAA 4A33A 2VZZA 1NSLA 1GHEA 4KUBA 2FCKA 5BWAB 4QBJA 3EFAA 1B87A 4FD4A 4L8AA 3QAHA 4FD5A 1S7FA 3B8GA 2X7BA 2Q4VA 1RO5A 4CGMA 1S7LA 1P0HA 5H86A 1QSOA 1U6MA 1Y7RA 5FVJA 4KOYA 1YLEA 4ORFA 3W91A 3SXOA 3A9LA 2Z3MA 5HMNA 1XF8A 2BL1A 3RYOA 1KUYA 2D4PA 4AG7A 4U9YA 1Y9WA 3JTKA 5KTCA 2PDOA 4A30A 5IB0A 5KTAA 3EC4A 2EUIA 2OU2A 3TO6A 1YVOA 4NEXA 4E0AA 4MJ8A 1YX0A 2OZHA 3P2FA 4ZGYB 2Z3NA 4MFQA 4QC6A 4XPKA 5F48A 4KSAA 2PSWA 4MI4A 4CYNA 3BLNA 3UY5A 1XMTA 3WR7A 2ZW4A 2B4DA 1IIDA 2Z3OA 2Y0MA 3R9FA 4R87A 1NE9A 2Z3KA 3IWEA 2OH1A 1VKCA 4UFWA 2JEVA 3H5ZA 4CRYB 2D4OA 2F5IA 3PGPA 4EVYA 4JXQA 3JVNA 1S7KA 2Q0YA 2HQYA 4UWJA 3EY5A 1MJBA 2FIWA 2WSAA 2ZXVA 3TCVA 4MY0A 2B4BA 2I00A 3IWGA 4MFZA 2R1IA 3GYAA 2ZW7A 2Z3PA 2YGWA 3FYNA 4HNYB 4LX9A 2PC1A 2O28A 3C26A 2ATRA 4UCPA 3NE7A 2Q44A 4HNXB 4C2YA 2Z0ZA 1M1DA 4C7HA 3F5BA 3N7ZA 4CGNA 3R96A 2I79A 1XEBA 4MFJA 2EVNA 3G8WA 3FB3A 3H4QA 3TOBA 1IB1E 4YFJA 3GY9A 1IICA 1J4JA 3OWCA 1YVKA 4OLLA 3FNCA 4UBRA 2Q04A 2P0WA 2WUUA 1PU9A 3JUWA 4YRHA 2PR1A 5AG6A 4CGOA 3P2HA 5H84A 2B3UA 2REFA 4XPLA 1BOBA 4DNCA 3I9SA 2Q7BA 3EXNA 4F0YA 2QIRA 4R3KA 4HNWB 3KKWA 4U5YA 3PP9A 3BJ7A 4UCNA 1ZO0A 5EBVA 3DR6A 2CNSA 3S6HA 2C27A 2GANA 3R9GA 2FXFA 5JPHA 4AVBA 4JD6A 4PSXA 4PV6A 3VWDA 4CAVA 3R95A 5A27A 1WK4A 2H5MA 3F0AA 1M44A 2AJ6A 2R7HA 4PK3A 5AG7A 5G20A 2GE3A 3MGDA 4UWIA 4QB9A 2JLMA 2G3AA 2RC4A 4AG9A 1R57A 4IUSA 3ZJ0A 2ARHA 2ZPAA 5A28A 1N71A 2VZYA 3R1KA 4XPDB 5HH1A 5J8CA 1KZFA 1YK3A 2DXQA 4MFKA 4KLVA 4A31A 4B10A 1S60A 2R8VA 2FL4A 5F47A 4YGOA 1QSRA 4BMHA 4PK2A 2Z11A 2FT0A 4XNHC 4OAEA 2FS5A 3IU1A 4CAXA 1Z4EA 3S6GA 2B5GB 4JWPA 5EC4A 4KOUA 3TTHA 2WPXA 4A95A 4MBUA 4AB7A 4B5PB 1Z9UA 1L0CA 2OB0A 4C7IA 1LRZA 3EO4A 1P4NA 1QSMA 3W6SA 5AG4A 4C2ZA 2J8MA 2J8RA 4KVME 4KOSA 4FD6A 1UFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNE A;  3IU1 A;  4CGP A;  4CYQ A;  4B11 A;  4C68 A;  4A30 A;  2WSA A;  4B13 A;  5AGE A;  5G22 A;  5AG5 A;  4UFV A;  4A95 A;  4CGM A;  2YNC A;  4UCN A;  4B12 A;  2YNC C;  4CAF A;  2YND A;  5A28 A;  3IWE A;  4CYO A;  4UFW A;  4A31 A;  4C7I A;  3H5Z A;  4B10 A;  4UCP A;  2WUU A;  4CYP A;  4C2Y A;  4BBH A;  5AG4 A;  4UCM A;  4C2Z A;  4C2X A;  4C7H A;  5G21 A;  4A33 A;  5AG6 A;  4A2Z A;  4CGO A;  5G1Z A;  4CGN A;  4CYN A;  5A27 A;  4B14 A;  5G20 A;  5AG7 A;  4CAE A;  3IU2 A;  4A32 A;  4CGL A;  3JTK A;  4UFX A; 
#chains in the Genus database with same CATH topology
 2DPS A;  2DPT A;  5E96 A;  1BPM A;  3SXN A;  3IO1 A;  2J9A A;  2ZEL A;  3DDD A;  4MY3 A;  1KUX A;  1TF8 A;  5G22 A;  3SHP A;  4CRZ B;  3B35 A;  1Z4R A;  1K4J A;  2PRB A;  2JDD A;  4ZX8 A;  3D2P A;  4B12 A;  2OOT A;  4CAF A;  1WWZ A;  4CYO A;  3WC6 A;  3WAB A;  1FY7 A;  2C6G A;  2IJZ A;  1PCA A;  2KCW A;  2WPW A;  4KZT A;  3FED A;  2JBJ A;  1S5K A;  1F2O A;  2PJC A;  4ONU A;  1XRY A;  1TIQ A;  3LMS A;  4MHN A;  4TWE A;  5JH9 A;  2HC9 A;  4K30 A;  4QVT A;  2Z3L A;  1XE4 A;  3CXP A;  3PB6 X;  4NF1 A;  1BPN A;  3I3G A;  3PFE A;  4ZX9 A;  4CGP A;  2IQ6 A;  2PJ5 A;  3QB8 A;  4KSF A;  4Q7A A;  4J3G A;  3CZX A;  3FJU A;  3S6K A;  1LFW A;  5C88 A;  4XNH B;  3CPX A;  2R98 A;  4A94 A;  2IL4 A;  4IAV A;  3B3T A;  1UWY A;  2ODF A;  3VWE A;  3WC5 A;  3TX8 A;  3V7Z A;  2CNT A;  2Z10 A;  3FXT A;  3D8P A;  4KOR A;  4EWT A;  4P4E A;  5JGF A;  3BHX A;  1XBU A;  2VEZ A;  1IYK A;  1YGH A;  3FEC A;  4F9U A;  3CPA A;  4I49 A;  3DSB A;  4JZ0 A;  5ISV A;  1ZLH A;  4X5K A;  2VBQ A;  2QML A;  3CXS A;  3CT9 A;  3TFY A;  4OC3 A;  3TO9 A;  1H8L A;  4CAE A;  3B7I A;  2BEI A;  2BOA A;  4UFX A;  4DJL A;  4P44 A;  2B58 A;  4B11 A;  2QEC A;  1QQ9 A;  3GLJ A;  2DF5 A;  4MCS A;  2PJ3 A;  4P4J A;  4KOW A;  3TOA A;  2PJ4 A;  2REE A;  5AG5 A;  2J8N A;  1B6B A;  5J1Q A;  2CY2 A;  4NCZ A;  4MHP A;  3GKR A;  5EMI A;  3R9E A;  4P4I A;  3MN8 A;  4X2T A;  3H8F A;  4E8O A;  1S7N A;  1S3Z A;  2XEJ A;  3D7F A;  1A2Z A;  3IGR A;  4NGT A;  4M6I A;  2B5G A;  4GXH A;  1ZG9 A;  3KL9 A;  4A32 A;  2V8V A;  4CGL A;  1VHS A;  3NA6 A;  4H6U A;  5IV0 A;  1Z8W A;  4KOV A;  1CJW A;  4F9V A;  1DTD A;  1BO4 A;  4Y49 C;  4AXV A;  3KR5 A;  4B5P A;  4KOT A;  1YR0 A;  3D2M A;  3PZJ A;  1CP7 A;  1Y9K A;  1PUA A;  2AE6 A;  2WYR A;  1JWQ A;  2YNC C;  5LYI A;  5GCN A;  1KUV A;  2BCO A;  2PJ6 A;  1IYL A;  2QVP A;  2CNM A;  5HVF A;  4CS0 B;  1V0C A;  4MFP A;  1PYT B;  2K5T A;  1LCP A;  3FIX A;  1YW4 A;  2OR4 A;  4PQA A;  3WT4 A;  5KTD A;  4KS9 A;  4NXY A;  4PSW A;  4OME A;  5G21 A;  3S6F A;  2V8H A;  3TE4 A;  1BLL E;  1JQG A;  1XOV A;  1Z5R A;  2FSR A;  1VHO A;  2ZEE A;  1FNO A;  2ZW5 A;  3B2Y A;  5F46 A;  1QST A;  4Q38 A;  3SI1 A;  1NMT A;  2ANP A;  3G3S A;  3ZZI A;  2NMT A;  2AFM A;  2VQY A;  4LQG A;  4UIA A;  4ZY0 A;  1HDQ A;  1OZP A;  5HVH A;  4FD7 A;  2C6C A;  1ELM P;  3KAS A;  4JJX A;  1XIX A;  2YNC A;  3FRM A;  2A4N A;  1Q2Y A;  2YND A;  2B3V A;  4UEF A;  1TKH A;  2GIV A;  2HUZ A;  4R9M A;  2OZU A;  3W6X A;  4KVO E;  1Z2L A;  2O4H A;  3K9U A;  3WC7 A;  4L89 A;  5HXD A;  4HKF A;  3S9L A;  4BBH A;  4CAW A;  2G0B A;  2HB6 A;  1AYE A;  2PJB A;  3KZW A;  4DYO A;  2JEW A;  2EK9 A;  4M85 A;  5JQ4 A;  5LRK A;  4A2Z A;  5G1Z A;  4B5O A;  2CXA A;  4B14 A;  4R6T A;  3IU2 A;  5F09 A;  4MFL A;  1M4I A;  4PXD A;  4FUU A;  3S9M A;  3SJX A;  4CYQ A;  1M4L A;  2JDC A;  4B13 A;  2BO9 A;  5AGE A;  2VI7 A;  4NJQ A;  4ZBG A;  3FBU A;  1MJA A;  4OAD A;  3HUV A;  3KI9 A;  3KHX A;  5IB9 A;  5IX3 A;  1MJ9 A;  4Y49 B;  2ZEH A;  1RXT A;  3PB7 X;  3NH4 A;  3E0K A;  1LAP A;  5C82 A;  1QSN A;  4AVC A;  5J8F A;  5LRJ A;  1CBX A;  1ZLI A;  4OC0 A;  2PIY A;  1MK4 A;  2P6F A;  4JXR A;  2P6G A;  2PJ7 A;  4F6A A;  2EO8 A;  4UCM A;  1M4G A;  1Q7L A;  4PXB A;  1NSA A;  1KWM A;  1YLO A;  4M3S A;  2C1C A;  1ELL P;  1HDU A;  4F0X A;  4Z65 A;  2BUE A;  3MRU A;  5K8O A;  3LOD A;  4YWY A;  4QUS A;  2Q4Y A;  1CX8 A;  4KUA A;  2YNE A;  3KGQ A;  4C68 A;  5I0C A;  4JLY A;  4KLW A;  3IC1 A;  4GS4 A;  3D67 A;  3H8E A;  5F49 A;  1Q2C A;  3K2K A;  4KVX A;  2GFQ A;  2POK A;  4UFV A;  4JYW A;  4FWU A;  2B4D B;  2VXK A;  2OZG A;  4RS2 A;  3CXQ A;  1ON0 A;  3D4U A;  2PQ8 A;  3B3S A;  4II9 A;  5LYF A;  3T90 A;  4EME A;  3ISX A;  1IGB A;  4U9Z A;  4M6G A;  1XFO A;  1I12 A;  4RN7 A;  4MMO A;  3FVL A;  4C2X A;  1I1D A;  4PXE A;  3T9Y A;  4E2A A;  4A38 A;  2ZW6 A;  4Q36 A;  2FE7 A;  3PRT A;  1SQH A;  2FIA A;  4R57 A;  4ZY1 A;  1HEE A;  4MHD A;  4R3L A;  5LRG A;  1X10 A;  3BJ8 A;  1BAV A;  2CTC A;  1Z8T A;  2QJ8 A;  3LD2 A;  4RI1 A;  4UA3 A;  3BI0 A;  3D3S A;  4XPD C;  5CNP A;  5CBM A;  2PR8 A;  2V77 A;  2G3T A;  1GYT A;  2HV2 A;  3RO0 A;  4H89 A;  4R8F A;  1Y7E A;  3TT2 A;  3V8I A;  1YRE A;  1AUG A;  1I21 A;  1YQE A;  2BSW A;  4MCP A;  4LUA A;  3DNS A;  3CDX A;  4OID A;  4OIW A;  5DS0 A;  3FEE A;  3TO7 A;  5DWM A;  4NSQ A;  1CM0 A;  2F7V A;  4FAI A;  3F8K A;  2P6E A;  2DEA A;  4TNU A;  2XEF A;  1Q2D A;  3FH4 A;  1M4D A;  1IOF A;  3IWW A;  1X12 A;  2CIJ A;  4H6Z A;  4KOX A;  5DWN A;  3RAM A;  1LAM A;  3DR8 A;  4IF5 A;  1YSJ A;  4AVA A;  5D29 A;  4A33 A;  4NJR A;  2VZZ A;  1NSL A;  5K8M A;  1VGY A;  1GHE A;  2AFS A;  2FCK A;  4KUB A;  2ZEM A;  4ZY2 A;  3SI2 A;  4KSI A;  2EWB A;  5BWA B;  4MHZ A;  4QBJ A;  3EFA A;  1VHE A;  3D7D A;  1B87 A;  4K3N A;  4FD4 A;  4L8A A;  3QAH A;  1CPS A;  2F8H A;  4FD5 A;  1R43 A;  1S7F A;  3B8G A;  2X7B A;  1TXR A;  1IY7 A;  2PCU A;  2Q4V A;  4R76 A;  1RO5 A;  2ZEN A;  1QMU A;  3IEH A;  3SJG A;  1S7L A;  1P0H A;  2PVV A;  5THW A;  4B6Z A;  2EBJ A;  2JBK A;  5H86 A;  1QSO A;  4UEE A;  1U6M A;  1Y7R A;  5FVJ A;  4KOY A;  1YLE A;  5JM6 A;  2O53 A;  4ORF A;  3W91 A;  2V8D A;  4GM5 A;  4FBE A;  3SXO A;  2PJ0 A;  3A9L A;  4DUK A;  2Z3M A;  3PBB A;  5HMN A;  1XF8 A;  2BL1 A;  3RYO A;  1KUY A;  4F8Z A;  2D4P A;  4AG7 A;  2ZEP A;  3GB0 A;  4NGP A;  4P45 A;  3D66 A;  4U9Y A;  4P6Y A;  1YME A;  1OBR A;  1Y9W A;  3JRU A;  3JTK A;  3ISZ A;  3V38 A;  5KTC A;  3PB9 X;  2PDO A;  1XMB A;  4A30 A;  1CG2 A;  2C6P A;  4NGN A;  5IB0 A;  2IMO A;  5KTA A;  4ZYQ A;  3EC4 A;  4NGR A;  2EUI A;  2OU2 A;  2V8G A;  3TO6 A;  1YVO A;  4NEX A;  2PVW A;  4E0A A;  4MJ8 A;  1YX0 A;  2OZH A;  3P2F A;  4ZGY B;  2Z3N A;  4NGM A;  4MFQ A;  2RB7 A;  2Q4Z A;  4UF4 A;  3IJ3 A;  4QC6 A;  4XPK A;  4KSA A;  2PSW A;  2ZOF A;  4MI4 A;  5F48 A;  1F57 A;  1LAN A;  2PJ8 A;  4A39 A;  4CYN A;  7CPA A;  3BLN A;  3UY5 A;  1XMT A;  3WR7 A;  2ZW4 A;  2B4D A;  3D7H A;  1LOK A;  1IID A;  3T8W A;  2G9D A;  2Z3O A;  2Y0M A;  2GU2 A;  8CPA A;  1IU8 A;  2Q43 A;  3R9F A;  4R87 A;  1NE9 A;  2Z3K A;  3IWE A;  2OH1 A;  3B3V A;  1VKC A;  4UFW A;  2JEV A;  4P4B A;  3NE8 A;  1AMP A;  3BI1 A;  3H5Z A;  2ZED A;  4CRY B;  2D4O A;  2F5I A;  3I1U A;  5K8N A;  3PGP A;  4EVY A;  3FF3 A;  2AFW A;  3PB8 X;  3QAY A;  4JXQ A;  3JVN A;  4P4F A;  1S7K A;  2Q0Y A;  3TC8 A;  2HQY A;  5K8P A;  4UWJ A;  3EY5 A;  1ARL A;  4HPS A;  1MJB A;  2FIW A;  2WSA A;  2PJ1 A;  2ZXV A;  3QNV A;  3TCV A;  4MY0 A;  2B4B A;  2I00 A;  4X8I A;  3IWG A;  4MFZ A;  4OC4 A;  2R1I A;  3GYA A;  2ZW7 A;  4P4D A;  4OC5 A;  2Z3P A;  2YGW A;  4FD6 A;  3FYN A;  4HNY B;  4LX9 A;  2PC1 A;  5CPA A;  2O28 A;  2I3C A;  2ZEF A;  4PXC A;  3C26 A;  1FT7 A;  4OC1 A;  2ATR A;  1XJO A;  4UCP A;  3NE7 A;  2Q44 A;  2CF4 A;  2AFZ A;  4HNX B;  4C2Y A;  4RUH A;  2Z0Z A;  1M1D A;  4MCR A;  4CYP A;  2EK8 A;  3GIU A;  1EE3 P;  4UIB A;  4C7H A;  1VIX A;  3D7G A;  3F5B A;  3B3C A;  3N7Z A;  4ONW A;  4CGN A;  3R96 A;  2I79 A;  1XEB A;  4MFJ A;  3IFE A;  2EVN A;  3G8W A;  3FB3 A;  3H4Q A;  3LWU A;  3TOB A;  1IB1 E;  4WJB A;  4YFJ A;  3GY9 A;  1CP6 A;  3N5F A;  3NH8 A;  1IIC A;  4MXU A;  1J4J A;  3HLP A;  3OWC A;  1YVK A;  2XEI A;  2GLF A;  3NH5 A;  4MCQ A;  4OLL A;  4IK2 A;  3IIB A;  3FNC A;  3SI0 A;  5LYL A;  4UBR A;  2Q04 A;  2P0W A;  1ZG8 A;  3RBU A;  2WUU A;  1PU9 A;  1YW6 A;  2RFH A;  4UEZ A;  3D68 A;  3JUW A;  4YRH A;  2PR1 A;  5AG6 A;  4CGO A;  3P2H A;  5H84 A;  2B3U A;  2REF A;  3DLJ A;  1BOB A;  4XPL A;  4DNC A;  3K9T A;  4R7M A;  3I9S A;  4IHM A;  3EXN A;  2Q7B A;  2FVG A;  4F0Y A;  2QIR A;  4R3K A;  2PRQ A;  4HNW B;  3KKW A;  4U5Y A;  4NGQ A;  3PP9 A;  4LQ6 A;  1F2P A;  3BJ7 A;  3H8G A;  4BD9 A;  1ARM A;  2Q7S A;  2ZEG A;  4UCN A;  1ZO0 A;  5EBV A;  6CPA A;  3DR6 A;  2PJ9 A;  2CNS A;  3VAT A;  3S6H A;  3SJE A;  2C27 A;  2GAN A;  3R9G A;  2FXF A;  5JPH A;  4AVB A;  4JD6 A;  4CPA A;  2PIZ A;  4PSX A;  4PV6 A;  2AFO A;  3KR4 A;  1R3N A;  2GLJ A;  3PB4 X;  4H2K A;  3VWD A;  4CAV A;  3R95 A;  5A27 A;  1WK4 A;  3BXM A;  2H5M A;  2ABZ A;  1M44 A;  2AJ6 A;  2R7H A;  3F0A A;  3GUX A;  4NFR A;  4PK3 A;  5AG7 A;  5G20 A;  4EFD A;  5LYD A;  4ZI6 A;  3S9N A;  2NYQ A;  3PBE A;  3SJF A;  1IOI A;  1RTQ A;  2GE3 A;  3MGD A;  4UWI A;  4YU9 A;  4QB9 A;  2JLM A;  2G3A A;  2RC4 A;  4AG9 A;  1R57 A;  2AFX A;  4IUS A;  3ZJ0 A;  1Z8X A;  2ARH A;  2ZPA A;  4PPZ A;  5A28 A;  4CGM A;  1N71 A;  2VZY A;  3R1K A;  4XPD B;  5HH1 A;  5J8C A;  1KZF A;  1TKJ A;  1YK3 A;  2DXQ A;  3FX6 A;  4KLV A;  4MFK A;  4A31 A;  1Y0R A;  5D8N A;  4B10 A;  1S60 A;  3KQX A;  2PE3 A;  3L2N A;  2R8V A;  4OP4 A;  1TF9 A;  2FL4 A;  4O23 A;  4YGO A;  4G1P A;  5F47 A;  4OKO A;  1QSR A;  3B3W A;  4BMH A;  3FMC A;  4PK2 A;  2ZEO A;  2Z11 A;  3VAR A;  4W9Y A;  1ZG7 A;  2FT0 A;  4OAE A;  3KHZ A;  4XNH C;  2AFU A;  2GRE A;  2FS5 A;  3IU1 A;  4CAX A;  1Z4E A;  1Z8L A;  2PJ2 A;  3S6G A;  2B5G B;  4JWP A;  4NGS A;  3VH9 A;  5HVG A;  5EC4 A;  4MHY A;  4KOU A;  4M6H A;  3TTH A;  2XEG A;  2WPX A;  1DE4 C;  3RZA A;  4A95 A;  3RNZ A;  5I4M A;  4MBU A;  4AB7 A;  2NSM A;  3NFZ A;  1Z9U A;  4B5P B;  1L0C A;  2OB0 A;  4C7I A;  2QYV A;  1LRZ A;  3EO4 A;  1CPX A;  2ZOG A;  4X3R A;  1P4N A;  1QSM A;  1TKF A;  3KQZ A;  3PFO A;  5ELY A;  3W6S A;  3LAC A;  4BIN A;  5AG4 A;  4WWV A;  4C2Z A;  2J8M A;  2Q51 A;  2CTB A;  2J8R A;  3PEI A;  4KVM E;  4P10 A;  3DGV A;  4MRI A;  1Y0Y A;  4OC2 A;  4KOS A;  4A37 A;  2PJA A;  2WZN A;  2VL1 A;  1UFH A; 
#chains in the Genus database with same CATH homology
 2DPS A;  2DPT A;  5E96 A;  3SXN A;  3DDD A;  4MY3 A;  1KUX A;  5G22 A;  3SHP A;  4CRZ B;  1Z4R A;  1K4J A;  2PRB A;  2JDD A;  3D2P A;  4B12 A;  4CAF A;  1WWZ A;  4CYO A;  1FY7 A;  2WPW A;  2KCW A;  4KZT A;  1S5K A;  4ONU A;  1TIQ A;  4K30 A;  4QVT A;  2Z3L A;  1XE4 A;  3CXP A;  4NF1 A;  3I3G A;  4CGP A;  3QB8 A;  4KSF A;  4J3G A;  3S6K A;  5C88 A;  4XNH B;  2R98 A;  2IL4 A;  3VWE A;  2CNT A;  2Z10 A;  3FXT A;  3D8P A;  4KOR A;  2VEZ A;  1IYK A;  1YGH A;  4I49 A;  3DSB A;  5ISV A;  4X5K A;  2VBQ A;  2QML A;  3CXS A;  3TFY A;  3TO9 A;  4CAE A;  2BEI A;  4UFX A;  2B58 A;  4B11 A;  2QEC A;  4KOW A;  3TOA A;  2REE A;  5AG5 A;  2J8N A;  1B6B A;  2CY2 A;  4NCZ A;  3GKR A;  3R9E A;  4E8O A;  1S7N A;  1S3Z A;  3IGR A;  2B5G A;  4A32 A;  5IV0 A;  4CGL A;  1VHS A;  4H6U A;  4KOV A;  1CJW A;  1BO4 A;  4Y49 C;  4B5P A;  4KOT A;  1YR0 A;  3D2M A;  3PZJ A;  1Y9K A;  1PUA A;  2AE6 A;  2YNC C;  5GCN A;  1KUV A;  1IYL A;  4CS0 B;  2CNM A;  1V0C A;  4MFP A;  2K5T A;  3FIX A;  5KTD A;  4KS9 A;  4NXY A;  4PSW A;  5G21 A;  3S6F A;  3TE4 A;  2FSR A;  2ZW5 A;  5F46 A;  1QST A;  4Q38 A;  3G3S A;  1NMT A;  3ZZI A;  2NMT A;  2VQY A;  1OZP A;  4FD7 A;  4JJX A;  1XIX A;  2YNC A;  3FRM A;  2A4N A;  1Q2Y A;  2YND A;  2B3V A;  2GIV A;  2HUZ A;  4R9M A;  2OZU A;  3W6X A;  4KVO E;  3K9U A;  4L89 A;  4HKF A;  4BBH A;  4CAW A;  2G0B A;  4M85 A;  5JQ4 A;  4A2Z A;  5G1Z A;  4B5O A;  2CXA A;  4B14 A;  3IU2 A;  4MFL A;  1M4I A;  4CYQ A;  4B13 A;  2JDC A;  5AGE A;  2VI7 A;  4ZBG A;  3FBU A;  1MJA A;  4OAD A;  5IX3 A;  1MJ9 A;  4Y49 B;  1RXT A;  3E0K A;  5C82 A;  5J8F A;  1QSN A;  4AVC A;  1MK4 A;  2P6F A;  4JXR A;  2P6G A;  4F6A A;  4UCM A;  1M4G A;  4M3S A;  4F0X A;  2BUE A;  3LOD A;  4QUS A;  2Q4Y A;  4KUA A;  2YNE A;  4C68 A;  5I0C A;  4JLY A;  4KLW A;  4GS4 A;  5F49 A;  1Q2C A;  4KVX A;  4UFV A;  2B4D B;  2VXK A;  2OZG A;  4RS2 A;  3CXQ A;  1ON0 A;  2PQ8 A;  4II9 A;  3T90 A;  4U9Z A;  1I12 A;  4C2X A;  1I1D A;  4E2A A;  3T9Y A;  2ZW6 A;  4Q36 A;  2FE7 A;  1SQH A;  2FIA A;  4R57 A;  4MHD A;  4R3L A;  3LD2 A;  3BJ8 A;  4UA3 A;  4RI1 A;  4XPD C;  3D3S A;  5CNP A;  2PR8 A;  2G3T A;  2HV2 A;  4H89 A;  3TT2 A;  3V8I A;  1YRE A;  1I21 A;  2BSW A;  4LUA A;  3DNS A;  3TO7 A;  5DWM A;  4NSQ A;  1CM0 A;  3F8K A;  2P6E A;  4KOX A;  1Q2D A;  4CYP A;  1M4D A;  4H6Z A;  5DWN A;  3DR8 A;  4IF5 A;  4AVA A;  4A33 A;  2VZZ A;  1NSL A;  1GHE A;  4KUB A;  2FCK A;  5BWA B;  4QBJ A;  3EFA A;  1B87 A;  4FD4 A;  4L8A A;  3QAH A;  4FD5 A;  1S7F A;  3B8G A;  2X7B A;  2Q4V A;  1RO5 A;  4CGM A;  1S7L A;  1P0H A;  5H86 A;  1QSO A;  1U6M A;  1Y7R A;  5FVJ A;  4KOY A;  1YLE A;  4ORF A;  3W91 A;  3SXO A;  3A9L A;  2Z3M A;  5HMN A;  1XF8 A;  2BL1 A;  3RYO A;  1KUY A;  2D4P A;  4AG7 A;  4U9Y A;  1Y9W A;  3JTK A;  5KTC A;  2PDO A;  4A30 A;  5IB0 A;  5KTA A;  3EC4 A;  2EUI A;  2OU2 A;  3TO6 A;  1YVO A;  4NEX A;  4E0A A;  4MJ8 A;  1YX0 A;  2OZH A;  3P2F A;  4ZGY B;  2Z3N A;  4MFQ A;  4QC6 A;  4XPK A;  5F48 A;  4KSA A;  2PSW A;  4MI4 A;  4CYN A;  3BLN A;  3UY5 A;  1XMT A;  3WR7 A;  2ZW4 A;  2B4D A;  1IID A;  2Z3O A;  2Y0M A;  3R9F A;  4R87 A;  1NE9 A;  2Z3K A;  3IWE A;  2OH1 A;  1VKC A;  4UFW A;  2JEV A;  3H5Z A;  4CRY B;  2D4O A;  2F5I A;  3PGP A;  4EVY A;  4JXQ A;  3JVN A;  1S7K A;  2Q0Y A;  2HQY A;  4UWJ A;  3EY5 A;  1MJB A;  2FIW A;  2WSA A;  2ZXV A;  3TCV A;  4MY0 A;  2B4B A;  2I00 A;  3IWG A;  4MFZ A;  2R1I A;  3GYA A;  2ZW7 A;  2Z3P A;  2YGW A;  3FYN A;  4HNY B;  4LX9 A;  2PC1 A;  2O28 A;  3C26 A;  2ATR A;  4UCP A;  3NE7 A;  2Q44 A;  4HNX B;  4C2Y A;  2Z0Z A;  1M1D A;  4C7H A;  3F5B A;  3N7Z A;  4CGN A;  3R96 A;  2I79 A;  1XEB A;  4MFJ A;  2EVN A;  3G8W A;  3FB3 A;  3H4Q A;  3TOB A;  1IB1 E;  4YFJ A;  3GY9 A;  1IIC A;  1J4J A;  3OWC A;  1YVK A;  4OLL A;  3FNC A;  4UBR A;  2Q04 A;  2P0W A;  2WUU A;  1PU9 A;  3JUW A;  4YRH A;  2PR1 A;  5AG6 A;  4CGO A;  3P2H A;  5H84 A;  2B3U A;  2REF A;  4XPL A;  1BOB A;  4DNC A;  3I9S A;  2Q7B A;  3EXN A;  4F0Y A;  2QIR A;  4R3K A;  4HNW B;  3KKW A;  4U5Y A;  3PP9 A;  3BJ7 A;  4UCN A;  1ZO0 A;  5EBV A;  3DR6 A;  2CNS A;  3S6H A;  2C27 A;  2GAN A;  3R9G A;  2FXF A;  5JPH A;  4AVB A;  4JD6 A;  4PSX A;  4PV6 A;  3VWD A;  4CAV A;  3R95 A;  5A27 A;  1WK4 A;  2H5M A;  3F0A A;  1M44 A;  2AJ6 A;  2R7H A;  4PK3 A;  5AG7 A;  5G20 A;  2GE3 A;  3MGD A;  4UWI A;  4QB9 A;  2JLM A;  2G3A A;  2RC4 A;  4AG9 A;  1R57 A;  4IUS A;  3ZJ0 A;  2ARH A;  2ZPA A;  5A28 A;  1N71 A;  2VZY A;  3R1K A;  4XPD B;  5HH1 A;  5J8C A;  1KZF A;  1YK3 A;  2DXQ A;  4MFK A;  4KLV A;  4A31 A;  4B10 A;  1S60 A;  2R8V A;  2FL4 A;  5F47 A;  4YGO A;  1QSR A;  4BMH A;  4PK2 A;  2Z11 A;  2FT0 A;  4XNH C;  4OAE A;  2FS5 A;  3IU1 A;  4CAX A;  1Z4E A;  3S6G A;  2B5G B;  4JWP A;  5EC4 A;  4KOU A;  3TTH A;  2WPX A;  4A95 A;  4MBU A;  4AB7 A;  4B5P B;  1Z9U A;  1L0C A;  2OB0 A;  4C7I A;  1LRZ A;  3EO4 A;  1P4N A;  1QSM A;  3W6S A;  5AG4 A;  4C2Z A;  2J8M A;  2J8R A;  4KVM E;  4KOS A;  4FD6 A;  1UFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...