4CGOA

Leishmania major n-myristoyltransferase in complex with a thienopyrimidine inhibitor
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgoA00
2WSAA 5AG5A 4A32A 4CGPA 4UFXA 4B14A 4CGLA 4C2YA 5A28A 5AGEA 4B12A 3IU1A 5G20A 4CYOA 5AG4A 2YNCA 5G1ZA 5G21A 5AG6A 4C68A 4A33A 4CGMA 4A2ZA 2YNDA 5G22A 4CYNA 4CYPA 4B10A 4CGOA 5AG7A 3IU2A 4CAFA 3H5ZA 2YNCC 4CYQA 5A27A 2YNEA 4C7HA 4A30A 4UFVA 4A95A 3JTKA 4CAEA 4UFWA 4BBHA 4C2XA 4C2ZA 4UCPA 4UCNA 4C7IA 3IWEA 4B13A 4A31A 4CGNA 4B11A 4UCMA 2WUUA
chains in the Genus database with same CATH superfamily
4A32A 4KVME 1QSTA 2VBQA 4HNYB 3ZJ0A 1Z4RA 1Y0RA 1S7KA 3PFOA 2C6CA 3WABA 2IJZA 2NSMA 4YWYA 4YGOA 4X8IA 4WWVA 2Z3PA 2J9AA 1FT7A 1F2OA 1IIDA 1OBRA 2YGWA 4A95A 3RYOA 1XE4A 2WPXA 4NF1A 4MXUA 4Q7AA 4LX9A 4NXYA 6CPAA 2CNTA 2B4DA 2O53A 4KOXA 3QNVA 4NSQA 3S6HA 1XIXA 3CZXA 4BD9A 4DJLA 3TE4A 4JXRA 3WC6A 4X2TA 5F48A 1U6MA 2GLJA 1VHEA 2G3AA 2CTCA 2PJ9A 3B3TA 2VEZA 3GLJA 2PE3A 4GS4A 2B3UA 3SI0A 2REEA 2PDOA 3CXSA 3LWUA 3WC7A 1S7FA 3CPAA 3KKWA 3KQXA 4DNCA 5E96A 2R1IA 1UWYA 5F46A 4W9YA 4I49A 2YNDA 3GKRA 3K9UA 1DE4C 1QSNA 1CX8A 1YLOA 1MK4A 4MHNA 2Z11A 1ELLP 2FIWA 4KOWA 2POKA 3MGDA 1BPNA 1XF8A 2PSWA 2X7BA 1RXTA 3R1KA 4NGRA 3BJ7A 3PB9X 4C2XA 3TCVA 2PJ6A 1VIXA 4UEZA 2GANA 4CRZB 4ZY2A 2IQ6A 4UIAA 1CPSA 2C1CA 2EBJA 1YK3A 4QVTA 5H84A 2Q4VA 4CS0B 3IIBA 1X12A 5K8PA 1YLEA 4B5PB 4P45A 1CM0A 2C27A 4OIWA 3BI0A 3FX6A 2O4HA 2B3VA 5IX3A 4FUUA 5HH1A 5C88A 4FWUA 1TIQA 4PSXA 4EMEA 4M6HA 2FVGA 2YNEA 4A30A 2ZW5A 4MJ8A 5IB9A 3VARA 1V0CA 4CAXA 3SI1A 3IWWA 4XNHB 4PV6A 4C7IA 2VI7A 4RI1A 1QQ9A 3EXNA 3BHXA 5JH9A 2AE6A 3FH4A 4ONWA 2BOAA 3KZWA 1XRYA 3H4QA 3R96A 1Q2DA 1ZG9A 1IGBA 2GU2A 2PJCA 4OP4A 2GE3A 2PJ8A 2IMOA 2ZEHA 4OC2A 4AVAA 2HC9A 5JQ4A 2QJ8A 1HEEA 2Q44A 4K3NA 4QB9A 4FAIA 3QAYA 5KTCA 2JDCA 4GM5A 4A33A 3MRUA 2Z3NA 2PCUA 4L89A 1IYLA 1NMTA 3I3GA 5LRKA 4WJBA 2AFWA 4FD6A 1M44A 4GXHA 4KVOE 4UBRA 2AFXA 2OZUA 2PR1A 2XEGA 4NEXA 1VGYA 3NFZA 3RO0A 2Q4YA 2ZEOA 2ATRA 4UCPA 4B5PA 1CG2A 2K5TA 3HLPA 3R9FA 3NH8A 4JWPA 1J4JA 2BUEA 3TO7A 2AFMA 4A31A 4FBEA 2WPWA 5EC4A 1XBUA 1YVKA 2Q7BA 1Y9WA 1XOVA 3K2KA 4U9ZA 3CXQA 4LQ6A 1IICA 2ZEDA 4B12A 5HXDA 1RTQA 3DR6A 2FXFA 2ZOGA 3FNCA 4OC4A 2NYQA 3ZZIA 2O28A 1A2ZA 1ARMA 2Q7SA 4YFJA 2P6FA 2QYVA 2AFUA 4CYPA 4NGTA 4CGOA 1N71A 1VKCA 1OZPA 1BLLE 1WK4A 2ZW4A 3G3SA 4XNHC 4AVBA 3D4UA 1TKHA 4UFWA 1Z8WA 2ZELA 5CBMA 2AFSA 4F9UA 2EWBA 4OC0A 3SHPA 3IEHA 3F8KA 4B13A 1KUYA 1F57A 1Z9UA 5F09A 3IWGA 1Y7RA 2QMLA 1PYTB 1Z8LA 2I3CA 4UCMA 4XPDB 5CNPA 2AFZA 4ZX8A 4A38A 1KZFA 1KUVA 3TX8A 4R6TA 4U9YA 4UFXA 3SXNA 2OB0A 4YU9A 3S9NA 1ELMP 2PRBA 3TO9A 3V7ZA 4MFJA 3V8IA 4R9MA 3JUWA 1M1DA 3KGQA 2H5MA 2Q43A 4OC3A 4Z65A 1M4GA 1MJBA 1P4NA 1AMPA 1S5KA 3D67A 2Q4ZA 2RFHA 3PB4X 4KLVA 4KOYA 1VHOA 4OADA 5IB0A 1Z2LA 1Z8TA 2FE7A 5A27A 3TT2A 5K8NA 4P4FA 4Y49C 3S6GA 4LQGA 1VHSA 1AUGA 1Y0YA 4CAEA 1RO5A 4P6YA 2JLMA 3PFEA 5THWA 2JBJA 5HMNA 3UY5A 5K8OA 3PB6X 4R76A 4X3RA 3SJXA 1LOKA 4JYWA 3GY9A 5LYLA 4MFKA 2REFA 2GFQA 4AG7A 1YR0A 2GIVA 3B2YA 1Z8XA 4KSFA 5AG5A 4UEFA 1Y7EA 4M85A 2CIJA 3PBBA 1QSMA 5DWNA 2V8HA 2VZZA 5LRGA 3CDXA 3LD2A 5G21A 2PQ8A 2NMTA 1PUAA 4TNUA 4YRHA 2V8VA 3GYAA 1S3ZA 3D3SA 5DWMA 3R95A 4M6IA 4F0YA 2GLFA 3PP9A 1S60A 4CYQA 3FVLA 1GHEA 5ELYA 4R57A 3NH4A 4NGSA 3LODA 2Q04A 4XPDC 3S6FA 2ZEEA 2R7HA 4ZYQA 1K4JA 1PCAA 2Z3OA 4UF4A 4R87A 1ON0A 4AXVA 1Y9KA 1SQHA 2F5IA 4DYOA 1NSAA 4MFZA 5A28A 3GIUA 5AGEA 4F9VA 5K8MA 2R8VA 4KOTA 4Q36A 4PSWA 3RZAA 4MFLA 1NSLA 3A9LA 2QIRA 4M3SA 4JJXA 2ZEFA 3F0AA 3EO4A 4HPSA 4OKOA 4R8FA 4CAWA 4ZGYB 4RS2A 2EVNA 3N5FA 5FVJA 4AG9A 5G22A 5EMIA 3DLJA 5LYDA 5KTDA 1Z5RA 2ZXVA 1TKFA 3KR5A 4P4IA 4UA3A 4UEEA 1YMEA 3T9YA 5LYIA 2ZW6A 4R7MA 2WZNA 4X5KA 2Z3KA 1LFWA 3VATA 2DPTA 5GCNA 3D7GA 3HUVA 3KI9A 4IHMA 4KUAA 4AB7A 4PXDA 3RAMA 4KZTA 1B6BA 3BXMA 4H89A 4C2YA 5BWAB 2ARHA 4NGNA 4CYOA 2DEAA 1LANA 3S6KA 2YNCA 4MCQA 1MJAA 2PJAA 2ZEMA 3I9SA 1YVOA 1ZG8A 2CTBA 2ZPAA 2PR8A 4UIBA 2ABZA 2CXAA 4C68A 1MJ9A 4U5YA 2OR4A 2D4PA 2VXKA 2PVVA 2BO9A 3NH5A 2YNCC 3B3WA 2BSWA 5JPHA 4QBJA 2JEVA 1AYEA 2P6GA 3F5BA 4ZBGA 2J8RA 4BBHA 4C2ZA 3EC4A 4E2AA 3KL9A 3IWEA 4Y49B 2EO8A 2B4BA 2ZW7A 4KOVA 4MMOA 4P4DA 1PU9A 4PXCA 3D7HA 4MFQA 3IC1A 3G8WA 4Q38A 2EK8A 4KSAA 1QMUA 2B58A 2XEJA 3IU1A 4NFRA 3SJFA 1ZLHA 2ZOFA 4PK3A 1CJWA 4JLYA 3VWEA 1YQEA 3B7IA 1Q2YA 4IF5A 4ZI6A 5C82A 4A2ZA 1IOFA 1QSRA 4O23A 2HV2A 2HB6A 2PIZA 2VQYA 2Z10A 3IU2A 3H5ZA 3KR4A 4EWTA 5LYFA 3T8WA 4P4EA 3JTKA 3TC8A 4KLWA 2Q51A 2V77A 3TO6A 8CPAA 4RN7A 2JDDA 2ODFA 2QECA 2DF5A 1UFHA 3PZJA 3PB7X 5D29A 1NE9A 2J8NA 2EUIA 3TTHA 3TFYA 1LCPA 2PJ2A 3LACA 3NE7A 3FEEA 4OC5A 2CY2A 5HVHA 2C6PA 2Z0ZA 1CPXA 2ZEPA 4FD7A 3D7FA 3H8GA 4KSIA 3RNZA 2CF4A 4CPAA 1XMBA 2J8MA 4G1PA 1KUXA 4MY0A 5AG4A 3FEDA 4NGPA 1IB1E 3D8PA 1BOBA 4MHYA 4H6UA 4QUSA 5JGFA 3QAHA 5EBVA 4NJRA 1DTDA 5J1QA 1TXRA 4CAFA 5J8FA 2HQYA 2Z3MA 3L2NA 3NA6A 4IUSA 4C7HA 2AFOA 2R98A 3CPXA 2VZYA 1ARLA 1FNOA 5HVFA 4OIDA 4ZX9A 4CGNA 4P4BA 3S9LA 4MI4A 4MY3A 4MCRA 1IY7A 2WUUA 4E8OA 4A94A 4CGPA 3KASA 3DDDA 3PRTA 2G3TA 1YW4A 3FF3A 4CGLA 1YX0A 1XMTA 1ZG7A 3WT4A 1TKJA 4OLLA 2HUZA 2JBKA 4KORA 2XEFA 2WYRA 3R9GA 1P0HA 1BAVA 2A4NA 4A37A 4M6GA 1I21A 4PPZA 4PQAA 4CYNA 1H8LA 4BINA 4EFDA 2BEIA 2OU2A 1CBXA 5IV0A 3B3CA 1HDQA 3KQZA 3TOAA 3W6XA 1I1DA 1Q7LA 4OAEA 3P2FA 4UFVA 3T90A 3I1UA 3B35A 4ONUA 1IU8A 2FSRA 3DNSA 2F7VA 1JQGA 2PC1A 2ZENA 3FBUA 1LAPA 4PXEA 4MHZA 4E0AA 4ZY0A 3IGRA 2G0BA 1R3NA 3D7DA 1R57A 4B6ZA 2B5GB 2WSAA 3DGVA 3VWDA 2EK9A 2QVPA 4B14A 2V8GA 4JXQA 5DS0A 3PGPA 3SXOA 4DUKA 5ISVA 4MCPA 2BCOA 5G1ZA 2OH1A 2GREA 4KUBA 4MFPA 2PJ1A 4FD5A 4NJQA 4CRYB 5I0CA 2JEWA 1XJOA 2PVWA 4B10A 4HNXB 1CP6A 3FB3A 5J8CA 2D4OA 2I00A 1WWZA 1LRZA 3QB8A 3DSBA 4F0XA 3D2MA 4TWEA 4AVCA 2PRQA 3P2HA 4QC6A 3V38A 2PJ7A 4EVYA 1YGHA 4ZY1A 3D66A 4II9A 7CPAA 4P44A 4F6AA 3FMCA 5HVGA 4CAVA 3W91A 1FY7A 1L0CA 4KOUA 4B11A 1S7LA 2CNSA 2PJ0A 5LRJA 5I4MA 4MHPA 1XEBA 3CXPA 3MN8A 3B3SA 2FS5A 2ANPA 2P6EA 2B5GA 3PEIA 3WC5A 3IJ3A 3BJ8A 3GUXA 2FCKA 3IFEA 4H2KA 4OC1A 3WR7A 4H6ZA 3PBEA 1HDUA 4KVXA 3TOBA 5KTAA 2C6GA 4B5OA 1M4DA 3SJEA 4KS9A 4JZ0A 2IL4A 2FIAA 2BL1A 4HKFA 1Q2CA 4BMHA 3C26A 1BPMA 3SI2A 4P10A 3D68A 2DXQA 3FXTA 2FL4A 1QSOA 1B87A 1TF8A 1EE3P 3DR8A 1R43A 2PJ5A 3FYNA 4MRIA 2FT0A 4R3KA 1S7NA 1YREA 2F8HA 3JRUA 4XPKA 5G20A 1IOIA 1ZLIA 3EFAA 3W6SA 3FIXA 1M4IA 4UWJA 2V8DA 2VL1A 1F2PA 2G9DA 1XFOA 3IO1A 3R9EA 3S9MA 2RB7A 4A39A 3ISXA 5F49A 1X10A 2PJ3A 2RC4A 5JM6A 1YW6A 1JWQA 4IK2A 3H8EA 2PJ4A 4NGMA 3B8GA 1BO4A 4ORFA 4R3LA 5D8NA 2CNMA 2AJ6A 4MCSA 4PXBA 3RBUA 1CP7A 1ZO0A 3H8FA 2P0WA 4FD4A 4LUAA 3GB0A 4RUHA 3N7ZA 3EY5A 3FRMA 1IYKA 4K30A 4KOSA 5F47A 1KWMA 3SJGA 2DPSA 4IAVA 3K9TA 1YSJA 4HNWB 4NCZA 4OMEA 3VH9A 2PJBA 2PIYA 3NE8A 1LAMA 3FJUA 3CT9A 3JVNA 3FECA 4L8AA 2B4DB 4XPLA 3ISZA 3BI1A 3B3VA 4F8ZA 5AG6A 2Y0MA 1GYTA 3OWCA 2OZHA 3E0KA 3KHXA 3KHZA 3PB8X 2I79A 4PK2A 4CGMA 2OOTA 1TF9A 5AG7A 4MHDA 2Q0YA 4NGQA 4P4JA 5CPAA 2KCWA 4MBUA 3BLNA 3D2PA 4UWIA 4UCNA 1Z4EA 2ZEGA 4J3GA 1I12A 2OZGA 1M4LA 2Z3LA 4JD6A 2XEIA 3LMSA 5H86A
chains in the Genus database with same CATH topology
4A32A 4KVME 1QSTA 2VBQA 4HNYB 3ZJ0A 1Z4RA 1S7KA 4YGOA 2Z3PA 1IIDA 2YGWA 4A95A 3RYOA 1XE4A 2WPXA 4NF1A 4LX9A 4NXYA 2CNTA 2B4DA 4KOXA 4NSQA 3S6HA 1XIXA 3TE4A 4JXRA 5F48A 1U6MA 2G3AA 2VEZA 4GS4A 2B3UA 2REEA 2PDOA 3CXSA 1S7FA 3KKWA 4DNCA 5E96A 2R1IA 5F46A 4I49A 2YNDA 3GKRA 3K9UA 1QSNA 1MK4A 2Z11A 2FIWA 4KOWA 3MGDA 1XF8A 2PSWA 2X7BA 1RXTA 3R1KA 3BJ7A 4C2XA 3TCVA 2GANA 4CRZB 1YK3A 4QVTA 5H84A 2Q4VA 4CS0B 1YLEA 4B5PB 1CM0A 2C27A 2B3VA 5IX3A 5HH1A 5C88A 1TIQA 4PSXA 2YNEA 4A30A 2ZW5A 4MJ8A 1V0CA 4CAXA 4XNHB 4PV6A 4C7IA 2VI7A 4RI1A 3EXNA 2AE6A 3H4QA 3R96A 1Q2DA 2GE3A 4AVAA 5JQ4A 4QB9A 2Q44A 5KTCA 2JDCA 4A33A 2Z3NA 4L89A 1IYLA 1NMTA 3I3GA 4FD6A 1M44A 4UBRA 4KVOE 2OZUA 2PR1A 4NEXA 4B5PA 2Q4YA 2ATRA 4UCPA 2K5TA 3R9FA 4JWPA 1J4JA 2BUEA 3TO7A 4A31A 2WPWA 5EC4A 1YVKA 2Q7BA 1Y9WA 4U9ZA 3CXQA 4B12A 1IICA 3DR6A 2FXFA 3FNCA 3ZZIA 2O28A 4YFJA 2P6FA 4CYPA 4CGOA 1N71A 1VKCA 1OZPA 1WK4A 2ZW4A 3G3SA 4XNHC 4AVBA 4UFWA 3SHPA 4B13A 3F8KA 1KUYA 1Z9UA 3IWGA 1Y7RA 2QMLA 4XPDB 4UCMA 5CNPA 4B11A 1KZFA 1KUVA 4UFXA 4U9YA 3SXNA 2OB0A 3TO9A 2PRBA 4MFJA 3V8IA 4R9MA 3JUWA 1M1DA 2H5MA 1M4GA 1MJBA 1P4NA 1S5KA 5IB0A 4KLVA 4KOYA 4OADA 2FE7A 5A27A 3TT2A 4Y49C 3S6GA 1VHSA 4CAEA 1RO5A 2JLMA 5HMNA 3UY5A 3GY9A 4MFKA 2REFA 4AG7A 1YR0A 2GIVA 4KSFA 5AG5A 4M85A 1QSMA 5DWNA 2VZZA 3LD2A 5G21A 2PQ8A 2NMTA 1PUAA 4YRHA 3GYAA 1S3ZA 3D3SA 5DWMA 3R95A 4F0YA 3PP9A 1S60A 4CYQA 1GHEA 4R57A 3LODA 2Q04A 4XPDC 3S6FA 2R7HA 1K4JA 2Z3OA 4R87A 1ON0A 1Y9KA 1SQHA 2F5IA 4MFZA 5A28A 5AGEA 2R8VA 4KOTA 4Q36A 4PSWA 4MFLA 1NSLA 3A9LA 2QIRA 4M3SA 4JJXA 3F0AA 3EO4A 4ZGYB 4CAWA 4RS2A 2EVNA 5FVJA 4AG9A 5G22A 5KTDA 2ZXVA 4UA3A 3T9YA 2ZW6A 4X5KA 2Z3KA 2DPTA 5GCNA 4KUAA 4AB7A 4KZTA 1B6BA 4H89A 4C2YA 5BWAB 2ARHA 4CYOA 3S6KA 2YNCA 1MJAA 3I9SA 1YVOA 2ZPAA 2PR8A 2CXAA 4C68A 1MJ9A 4U5YA 2D4PA 2VXKA 2YNCC 2BSWA 5JPHA 4QBJA 2JEVA 3F5BA 2P6GA 4ZBGA 2J8RA 4BBHA 4C2ZA 3EC4A 4E2AA 3IWEA 4Y49B 2B4BA 2ZW7A 4KOVA 1PU9A 4MFQA 3G8WA 4Q38A 4KSAA 2B58A 3IU1A 4PK3A 1CJWA 4JLYA 3VWEA 5C82A 1Q2YA 4IF5A 4A2ZA 1QSRA 2HV2A 2VQYA 2Z10A 3IU2A 3H5ZA 3JTKA 4KLWA 3TO6A 2JDDA 2QECA 3PZJA 1UFHA 3TTHA 3TFYA 1NE9A 2J8NA 2EUIA 3NE7A 2CY2A 4FD7A 2Z0ZA 2J8MA 1KUXA 4MY0A 5AG4A 1IB1E 3D8PA 1BOBA 4H6UA 4QUSA 3QAHA 5EBVA 4CAFA 5J8FA 2HQYA 2Z3MA 4C7HA 4IUSA 2R98A 2VZYA 4CGNA 4MI4A 4MY3A 2WUUA 4E8OA 4CGPA 3DDDA 4CGLA 2G3TA 1YX0A 1XMTA 4OLLA 2HUZA 4KORA 3R9GA 1P0HA 2A4NA 1I21A 4CYNA 2BEIA 2OU2A 5IV0A 3TOAA 3W6XA 1I1DA 4OAEA 4UFVA 3P2FA 3T90A 4ONUA 2FSRA 3DNSA 2PC1A 3FBUA 4E0AA 3IGRA 2G0BA 1R57A 2B5GB 2WSAA 3VWDA 4B14A 4JXQA 3PGPA 3SXOA 5ISVA 5G1ZA 2OH1A 4KUBA 4MFPA 4FD5A 4CRYB 5I0CA 4B10A 4HNXB 3FB3A 5J8CA 2D4OA 2I00A 1WWZA 1LRZA 3QB8A 3DSBA 4F0XA 3D2MA 3P2HA 4QC6A 4EVYA 1YGHA 4II9A 4F6AA 4CAVA 3W91A 1FY7A 1L0CA 4KOUA 1S7LA 2CNSA 1XEBA 3CXPA 2FS5A 2P6EA 2B5GA 3BJ8A 2FCKA 3WR7A 4H6ZA 3TOBA 4KVXA 5KTAA 4B5OA 1M4DA 4KS9A 2IL4A 2FIAA 2BL1A 4HKFA 1Q2CA 4BMHA 3C26A 3FXTA 2DXQA 1QSOA 2FL4A 1B87A 3DR8A 4AVCA 3FYNA 2FT0A 4R3KA 1S7NA 1YREA 4XPKA 5G20A 3EFAA 3W6SA 3FIXA 1M4IA 4UWJA 3R9EA 5F49A 2RC4A 3B8GA 1BO4A 4ORFA 4R3LA 2CNMA 2AJ6A 1ZO0A 2P0WA 4FD4A 4LUAA 3N7ZA 3EY5A 3FRMA 1IYKA 4K30A 4KOSA 5F47A 2DPSA 4HNWB 4NCZA 3JVNA 4L8AA 4XPLA 2B4DB 5AG6A 2Y0MA 3OWCA 2OZHA 3E0KA 4CGMA 2I79A 4PK2A 5AG7A 4MHDA 2Q0YA 2KCWA 4MBUA 3BLNA 3D2PA 4UWIA 4UCNA 1Z4EA 4J3GA 4JD6A 1I12A 2OZGA 2Z3LA 5H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSA A;  5AG5 A;  4A32 A;  4CGP A;  4UFX A;  4B14 A;  4CGL A;  4C2Y A;  5A28 A;  5AGE A;  4B12 A;  3IU1 A;  5G20 A;  4CYO A;  5AG4 A;  2YNC A;  5G1Z A;  5G21 A;  5AG6 A;  4C68 A;  4A33 A;  4CGM A;  4A2Z A;  2YND A;  5G22 A;  4CYN A;  4CYP A;  4B10 A;  4CGO A;  5AG7 A;  3IU2 A;  4CAF A;  3H5Z A;  2YNC C;  4CYQ A;  5A27 A;  2YNE A;  4C7H A;  4A30 A;  4UFV A;  4A95 A;  3JTK A;  4CAE A;  4UFW A;  4BBH A;  4C2X A;  4C2Z A;  4UCP A;  4UCN A;  4C7I A;  3IWE A;  4B13 A;  4A31 A;  4CGN A;  4B11 A;  4UCM A;  2WUU A; 
#chains in the Genus database with same CATH topology
 4A32 A;  4KVM E;  1QST A;  2VBQ A;  4HNY B;  3ZJ0 A;  1Z4R A;  1Y0R A;  1S7K A;  3PFO A;  2C6C A;  3WAB A;  2IJZ A;  2NSM A;  4YWY A;  4YGO A;  4X8I A;  4WWV A;  2Z3P A;  2J9A A;  1FT7 A;  1F2O A;  1IID A;  1OBR A;  2YGW A;  4A95 A;  3RYO A;  1XE4 A;  2WPX A;  4NF1 A;  4MXU A;  4Q7A A;  4LX9 A;  4NXY A;  6CPA A;  2CNT A;  2B4D A;  2O53 A;  4KOX A;  3QNV A;  4NSQ A;  3S6H A;  1XIX A;  3CZX A;  4BD9 A;  4DJL A;  3TE4 A;  4JXR A;  3WC6 A;  4X2T A;  5F48 A;  1U6M A;  2GLJ A;  1VHE A;  2G3A A;  2CTC A;  2PJ9 A;  3B3T A;  2VEZ A;  3GLJ A;  2PE3 A;  4GS4 A;  2B3U A;  3SI0 A;  2REE A;  2PDO A;  3CXS A;  3LWU A;  3WC7 A;  1S7F A;  3CPA A;  3KKW A;  3KQX A;  4DNC A;  5E96 A;  2R1I A;  1UWY A;  5F46 A;  4W9Y A;  4I49 A;  2YND A;  3GKR A;  3K9U A;  1DE4 C;  1QSN A;  1CX8 A;  1YLO A;  1MK4 A;  4MHN A;  2Z11 A;  1ELL P;  2FIW A;  4KOW A;  2POK A;  3MGD A;  1BPN A;  1XF8 A;  2PSW A;  2X7B A;  1RXT A;  3R1K A;  4NGR A;  3BJ7 A;  3PB9 X;  4C2X A;  3TCV A;  2PJ6 A;  1VIX A;  4UEZ A;  2GAN A;  4CRZ B;  4ZY2 A;  2IQ6 A;  4UIA A;  1CPS A;  2C1C A;  2EBJ A;  1YK3 A;  4QVT A;  5H84 A;  2Q4V A;  4CS0 B;  3IIB A;  1X12 A;  5K8P A;  1YLE A;  4B5P B;  4P45 A;  1CM0 A;  2C27 A;  4OIW A;  3BI0 A;  3FX6 A;  2O4H A;  2B3V A;  5IX3 A;  4FUU A;  5HH1 A;  5C88 A;  4FWU A;  1TIQ A;  4PSX A;  4EME A;  4M6H A;  2FVG A;  2YNE A;  4A30 A;  2ZW5 A;  4MJ8 A;  5IB9 A;  3VAR A;  1V0C A;  4CAX A;  3SI1 A;  3IWW A;  4XNH B;  4PV6 A;  4C7I A;  2VI7 A;  4RI1 A;  1QQ9 A;  3EXN A;  3BHX A;  5JH9 A;  2AE6 A;  3FH4 A;  4ONW A;  2BOA A;  3KZW A;  1XRY A;  3H4Q A;  3R96 A;  1Q2D A;  1ZG9 A;  1IGB A;  2GU2 A;  2PJC A;  4OP4 A;  2GE3 A;  2PJ8 A;  2IMO A;  2ZEH A;  4OC2 A;  4AVA A;  2HC9 A;  5JQ4 A;  2QJ8 A;  1HEE A;  2Q44 A;  4K3N A;  4QB9 A;  4FAI A;  3QAY A;  5KTC A;  2JDC A;  4GM5 A;  4A33 A;  3MRU A;  2Z3N A;  2PCU A;  4L89 A;  1IYL A;  1NMT A;  3I3G A;  5LRK A;  4WJB A;  2AFW A;  4FD6 A;  1M44 A;  4GXH A;  4KVO E;  4UBR A;  2AFX A;  2OZU A;  2PR1 A;  2XEG A;  4NEX A;  1VGY A;  3NFZ A;  3RO0 A;  2Q4Y A;  2ZEO A;  2ATR A;  4UCP A;  4B5P A;  1CG2 A;  2K5T A;  3HLP A;  3R9F A;  3NH8 A;  4JWP A;  1J4J A;  2BUE A;  3TO7 A;  2AFM A;  4A31 A;  4FBE A;  2WPW A;  5EC4 A;  1XBU A;  1YVK A;  2Q7B A;  1Y9W A;  1XOV A;  3K2K A;  4U9Z A;  3CXQ A;  4LQ6 A;  1IIC A;  2ZED A;  4B12 A;  5HXD A;  1RTQ A;  3DR6 A;  2FXF A;  2ZOG A;  3FNC A;  4OC4 A;  2NYQ A;  3ZZI A;  2O28 A;  1A2Z A;  1ARM A;  2Q7S A;  4YFJ A;  2P6F A;  2QYV A;  2AFU A;  4CYP A;  4NGT A;  4CGO A;  1N71 A;  1VKC A;  1OZP A;  1BLL E;  1WK4 A;  2ZW4 A;  3G3S A;  4XNH C;  4AVB A;  3D4U A;  1TKH A;  4UFW A;  1Z8W A;  2ZEL A;  5CBM A;  2AFS A;  4F9U A;  2EWB A;  4OC0 A;  3SHP A;  3IEH A;  3F8K A;  4B13 A;  1KUY A;  1F57 A;  1Z9U A;  5F09 A;  3IWG A;  1Y7R A;  2QML A;  1PYT B;  1Z8L A;  2I3C A;  4UCM A;  4XPD B;  5CNP A;  2AFZ A;  4ZX8 A;  4A38 A;  1KZF A;  1KUV A;  3TX8 A;  4R6T A;  4U9Y A;  4UFX A;  3SXN A;  2OB0 A;  4YU9 A;  3S9N A;  1ELM P;  2PRB A;  3TO9 A;  3V7Z A;  4MFJ A;  3V8I A;  4R9M A;  3JUW A;  1M1D A;  3KGQ A;  2H5M A;  2Q43 A;  4OC3 A;  4Z65 A;  1M4G A;  1MJB A;  1P4N A;  1AMP A;  1S5K A;  3D67 A;  2Q4Z A;  2RFH A;  3PB4 X;  4KLV A;  4KOY A;  1VHO A;  4OAD A;  5IB0 A;  1Z2L A;  1Z8T A;  2FE7 A;  5A27 A;  3TT2 A;  5K8N A;  4P4F A;  4Y49 C;  3S6G A;  4LQG A;  1VHS A;  1AUG A;  1Y0Y A;  4CAE A;  1RO5 A;  4P6Y A;  2JLM A;  3PFE A;  5THW A;  2JBJ A;  5HMN A;  3UY5 A;  5K8O A;  3PB6 X;  4R76 A;  4X3R A;  3SJX A;  1LOK A;  4JYW A;  3GY9 A;  5LYL A;  4MFK A;  2REF A;  2GFQ A;  4AG7 A;  1YR0 A;  2GIV A;  3B2Y A;  1Z8X A;  4KSF A;  5AG5 A;  4UEF A;  1Y7E A;  4M85 A;  2CIJ A;  3PBB A;  1QSM A;  5DWN A;  2V8H A;  2VZZ A;  5LRG A;  3CDX A;  3LD2 A;  5G21 A;  2PQ8 A;  2NMT A;  1PUA A;  4TNU A;  4YRH A;  2V8V A;  3GYA A;  1S3Z A;  3D3S A;  5DWM A;  3R95 A;  4M6I A;  4F0Y A;  2GLF A;  3PP9 A;  1S60 A;  4CYQ A;  3FVL A;  1GHE A;  5ELY A;  4R57 A;  3NH4 A;  4NGS A;  3LOD A;  2Q04 A;  4XPD C;  3S6F A;  2ZEE A;  2R7H A;  4ZYQ A;  1K4J A;  1PCA A;  2Z3O A;  4UF4 A;  4R87 A;  1ON0 A;  4AXV A;  1Y9K A;  1SQH A;  2F5I A;  4DYO A;  1NSA A;  4MFZ A;  5A28 A;  3GIU A;  5AGE A;  4F9V A;  5K8M A;  2R8V A;  4KOT A;  4Q36 A;  4PSW A;  3RZA A;  4MFL A;  1NSL A;  3A9L A;  2QIR A;  4M3S A;  4JJX A;  2ZEF A;  3F0A A;  3EO4 A;  4HPS A;  4OKO A;  4R8F A;  4CAW A;  4ZGY B;  4RS2 A;  2EVN A;  3N5F A;  5FVJ A;  4AG9 A;  5G22 A;  5EMI A;  3DLJ A;  5LYD A;  5KTD A;  1Z5R A;  2ZXV A;  1TKF A;  3KR5 A;  4P4I A;  4UA3 A;  4UEE A;  1YME A;  3T9Y A;  5LYI A;  2ZW6 A;  4R7M A;  2WZN A;  4X5K A;  2Z3K A;  1LFW A;  3VAT A;  2DPT A;  5GCN A;  3D7G A;  3HUV A;  3KI9 A;  4IHM A;  4KUA A;  4AB7 A;  4PXD A;  3RAM A;  4KZT A;  1B6B A;  3BXM A;  4H89 A;  4C2Y A;  5BWA B;  2ARH A;  4NGN A;  4CYO A;  2DEA A;  1LAN A;  3S6K A;  2YNC A;  4MCQ A;  1MJA A;  2PJA A;  2ZEM A;  3I9S A;  1YVO A;  1ZG8 A;  2CTB A;  2ZPA A;  2PR8 A;  4UIB A;  2ABZ A;  2CXA A;  4C68 A;  1MJ9 A;  4U5Y A;  2OR4 A;  2D4P A;  2VXK A;  2PVV A;  2BO9 A;  3NH5 A;  2YNC C;  3B3W A;  2BSW A;  5JPH A;  4QBJ A;  2JEV A;  1AYE A;  2P6G A;  3F5B A;  4ZBG A;  2J8R A;  4BBH A;  4C2Z A;  3EC4 A;  4E2A A;  3KL9 A;  3IWE A;  4Y49 B;  2EO8 A;  2B4B A;  2ZW7 A;  4KOV A;  4MMO A;  4P4D A;  1PU9 A;  4PXC A;  3D7H A;  4MFQ A;  3IC1 A;  3G8W A;  4Q38 A;  2EK8 A;  4KSA A;  1QMU A;  2B58 A;  2XEJ A;  3IU1 A;  4NFR A;  3SJF A;  1ZLH A;  2ZOF A;  4PK3 A;  1CJW A;  4JLY A;  3VWE A;  1YQE A;  3B7I A;  1Q2Y A;  4IF5 A;  4ZI6 A;  5C82 A;  4A2Z A;  1IOF A;  1QSR A;  4O23 A;  2HV2 A;  2HB6 A;  2PIZ A;  2VQY A;  2Z10 A;  3IU2 A;  3H5Z A;  3KR4 A;  4EWT A;  5LYF A;  3T8W A;  4P4E A;  3JTK A;  3TC8 A;  4KLW A;  2Q51 A;  2V77 A;  3TO6 A;  8CPA A;  4RN7 A;  2JDD A;  2ODF A;  2QEC A;  2DF5 A;  1UFH A;  3PZJ A;  3PB7 X;  5D29 A;  1NE9 A;  2J8N A;  2EUI A;  3TTH A;  3TFY A;  1LCP A;  2PJ2 A;  3LAC A;  3NE7 A;  3FEE A;  4OC5 A;  2CY2 A;  5HVH A;  2C6P A;  2Z0Z A;  1CPX A;  2ZEP A;  4FD7 A;  3D7F A;  3H8G A;  4KSI A;  3RNZ A;  2CF4 A;  4CPA A;  1XMB A;  2J8M A;  4G1P A;  1KUX A;  4MY0 A;  5AG4 A;  3FED A;  4NGP A;  1IB1 E;  3D8P A;  1BOB A;  4MHY A;  4H6U A;  4QUS A;  5JGF A;  3QAH A;  5EBV A;  4NJR A;  1DTD A;  5J1Q A;  1TXR A;  4CAF A;  5J8F A;  2HQY A;  2Z3M A;  3L2N A;  3NA6 A;  4IUS A;  4C7H A;  2AFO A;  2R98 A;  3CPX A;  2VZY A;  1ARL A;  1FNO A;  5HVF A;  4OID A;  4ZX9 A;  4CGN A;  4P4B A;  3S9L A;  4MI4 A;  4MY3 A;  4MCR A;  1IY7 A;  2WUU A;  4E8O A;  4A94 A;  4CGP A;  3KAS A;  3DDD A;  3PRT A;  2G3T A;  1YW4 A;  3FF3 A;  4CGL A;  1YX0 A;  1XMT A;  1ZG7 A;  3WT4 A;  1TKJ A;  4OLL A;  2HUZ A;  2JBK A;  4KOR A;  2XEF A;  2WYR A;  3R9G A;  1P0H A;  1BAV A;  2A4N A;  4A37 A;  4M6G A;  1I21 A;  4PPZ A;  4PQA A;  4CYN A;  1H8L A;  4BIN A;  4EFD A;  2BEI A;  2OU2 A;  1CBX A;  5IV0 A;  3B3C A;  1HDQ A;  3KQZ A;  3TOA A;  3W6X A;  1I1D A;  1Q7L A;  4OAE A;  3P2F A;  4UFV A;  3T90 A;  3I1U A;  3B35 A;  4ONU A;  1IU8 A;  2FSR A;  3DNS A;  2F7V A;  1JQG A;  2PC1 A;  2ZEN A;  3FBU A;  1LAP A;  4PXE A;  4MHZ A;  4E0A A;  4ZY0 A;  3IGR A;  2G0B A;  1R3N A;  3D7D A;  1R57 A;  4B6Z A;  2B5G B;  2WSA A;  3DGV A;  3VWD A;  2EK9 A;  2QVP A;  4B14 A;  2V8G A;  4JXQ A;  5DS0 A;  3PGP A;  3SXO A;  4DUK A;  5ISV A;  4MCP A;  2BCO A;  5G1Z A;  2OH1 A;  2GRE A;  4KUB A;  4MFP A;  2PJ1 A;  4FD5 A;  4NJQ A;  4CRY B;  5I0C A;  2JEW A;  1XJO A;  2PVW A;  4B10 A;  4HNX B;  1CP6 A;  3FB3 A;  5J8C A;  2D4O A;  2I00 A;  1WWZ A;  1LRZ A;  3QB8 A;  3DSB A;  4F0X A;  3D2M A;  4TWE A;  4AVC A;  2PRQ A;  3P2H A;  4QC6 A;  3V38 A;  2PJ7 A;  4EVY A;  1YGH A;  4ZY1 A;  3D66 A;  4II9 A;  7CPA A;  4P44 A;  4F6A A;  3FMC A;  5HVG A;  4CAV A;  3W91 A;  1FY7 A;  1L0C A;  4KOU A;  4B11 A;  1S7L A;  2CNS A;  2PJ0 A;  5LRJ A;  5I4M A;  4MHP A;  1XEB A;  3CXP A;  3MN8 A;  3B3S A;  2FS5 A;  2ANP A;  2P6E A;  2B5G A;  3PEI A;  3WC5 A;  3IJ3 A;  3BJ8 A;  3GUX A;  2FCK A;  3IFE A;  4H2K A;  4OC1 A;  3WR7 A;  4H6Z A;  3PBE A;  1HDU A;  4KVX A;  3TOB A;  5KTA A;  2C6G A;  4B5O A;  1M4D A;  3SJE A;  4KS9 A;  4JZ0 A;  2IL4 A;  2FIA A;  2BL1 A;  4HKF A;  1Q2C A;  4BMH A;  3C26 A;  1BPM A;  3SI2 A;  4P10 A;  3D68 A;  2DXQ A;  3FXT A;  2FL4 A;  1QSO A;  1B87 A;  1TF8 A;  1EE3 P;  3DR8 A;  1R43 A;  2PJ5 A;  3FYN A;  4MRI A;  2FT0 A;  4R3K A;  1S7N A;  1YRE A;  2F8H A;  3JRU A;  4XPK A;  5G20 A;  1IOI A;  1ZLI A;  3EFA A;  3W6S A;  3FIX A;  1M4I A;  4UWJ A;  2V8D A;  2VL1 A;  1F2P A;  2G9D A;  1XFO A;  3IO1 A;  3R9E A;  3S9M A;  2RB7 A;  4A39 A;  3ISX A;  5F49 A;  1X10 A;  2PJ3 A;  2RC4 A;  5JM6 A;  1YW6 A;  1JWQ A;  4IK2 A;  3H8E A;  2PJ4 A;  4NGM A;  3B8G A;  1BO4 A;  4ORF A;  4R3L A;  5D8N A;  2CNM A;  2AJ6 A;  4MCS A;  4PXB A;  3RBU A;  1CP7 A;  1ZO0 A;  3H8F A;  2P0W A;  4FD4 A;  4LUA A;  3GB0 A;  4RUH A;  3N7Z A;  3EY5 A;  3FRM A;  1IYK A;  4K30 A;  4KOS A;  5F47 A;  1KWM A;  3SJG A;  2DPS A;  4IAV A;  3K9T A;  1YSJ A;  4HNW B;  4NCZ A;  4OME A;  3VH9 A;  2PJB A;  2PIY A;  3NE8 A;  1LAM A;  3FJU A;  3CT9 A;  3JVN A;  3FEC A;  4L8A A;  2B4D B;  4XPL A;  3ISZ A;  3BI1 A;  3B3V A;  4F8Z A;  5AG6 A;  2Y0M A;  1GYT A;  3OWC A;  2OZH A;  3E0K A;  3KHX A;  3KHZ A;  3PB8 X;  2I79 A;  4PK2 A;  4CGM A;  2OOT A;  1TF9 A;  5AG7 A;  4MHD A;  2Q0Y A;  4NGQ A;  4P4J A;  5CPA A;  2KCW A;  4MBU A;  3BLN A;  3D2P A;  4UWI A;  4UCN A;  1Z4E A;  2ZEG A;  4J3G A;  1I12 A;  2OZG A;  1M4L A;  2Z3L A;  4JD6 A;  2XEI A;  3LMS A;  5H86 A; 
#chains in the Genus database with same CATH homology
 4A32 A;  4KVM E;  1QST A;  2VBQ A;  4HNY B;  3ZJ0 A;  1Z4R A;  1S7K A;  4YGO A;  2Z3P A;  1IID A;  2YGW A;  4A95 A;  3RYO A;  1XE4 A;  2WPX A;  4NF1 A;  4LX9 A;  4NXY A;  2CNT A;  2B4D A;  4KOX A;  4NSQ A;  3S6H A;  1XIX A;  3TE4 A;  4JXR A;  5F48 A;  1U6M A;  2G3A A;  2VEZ A;  4GS4 A;  2B3U A;  2REE A;  2PDO A;  3CXS A;  1S7F A;  3KKW A;  4DNC A;  5E96 A;  2R1I A;  5F46 A;  4I49 A;  2YND A;  3GKR A;  3K9U A;  1QSN A;  1MK4 A;  2Z11 A;  2FIW A;  4KOW A;  3MGD A;  1XF8 A;  2PSW A;  2X7B A;  1RXT A;  3R1K A;  3BJ7 A;  4C2X A;  3TCV A;  2GAN A;  4CRZ B;  1YK3 A;  4QVT A;  5H84 A;  2Q4V A;  4CS0 B;  1YLE A;  4B5P B;  1CM0 A;  2C27 A;  2B3V A;  5IX3 A;  5HH1 A;  5C88 A;  1TIQ A;  4PSX A;  2YNE A;  4A30 A;  2ZW5 A;  4MJ8 A;  1V0C A;  4CAX A;  4XNH B;  4PV6 A;  4C7I A;  2VI7 A;  4RI1 A;  3EXN A;  2AE6 A;  3H4Q A;  3R96 A;  1Q2D A;  2GE3 A;  4AVA A;  5JQ4 A;  4QB9 A;  2Q44 A;  5KTC A;  2JDC A;  4A33 A;  2Z3N A;  4L89 A;  1IYL A;  1NMT A;  3I3G A;  4FD6 A;  1M44 A;  4UBR A;  4KVO E;  2OZU A;  2PR1 A;  4NEX A;  4B5P A;  2Q4Y A;  2ATR A;  4UCP A;  2K5T A;  3R9F A;  4JWP A;  1J4J A;  2BUE A;  3TO7 A;  4A31 A;  2WPW A;  5EC4 A;  1YVK A;  2Q7B A;  1Y9W A;  4U9Z A;  3CXQ A;  4B12 A;  1IIC A;  3DR6 A;  2FXF A;  3FNC A;  3ZZI A;  2O28 A;  4YFJ A;  2P6F A;  4CYP A;  4CGO A;  1N71 A;  1VKC A;  1OZP A;  1WK4 A;  2ZW4 A;  3G3S A;  4XNH C;  4AVB A;  4UFW A;  3SHP A;  4B13 A;  3F8K A;  1KUY A;  1Z9U A;  3IWG A;  1Y7R A;  2QML A;  4XPD B;  4UCM A;  5CNP A;  4B11 A;  1KZF A;  1KUV A;  4UFX A;  4U9Y A;  3SXN A;  2OB0 A;  3TO9 A;  2PRB A;  4MFJ A;  3V8I A;  4R9M A;  3JUW A;  1M1D A;  2H5M A;  1M4G A;  1MJB A;  1P4N A;  1S5K A;  5IB0 A;  4KLV A;  4KOY A;  4OAD A;  2FE7 A;  5A27 A;  3TT2 A;  4Y49 C;  3S6G A;  1VHS A;  4CAE A;  1RO5 A;  2JLM A;  5HMN A;  3UY5 A;  3GY9 A;  4MFK A;  2REF A;  4AG7 A;  1YR0 A;  2GIV A;  4KSF A;  5AG5 A;  4M85 A;  1QSM A;  5DWN A;  2VZZ A;  3LD2 A;  5G21 A;  2PQ8 A;  2NMT A;  1PUA A;  4YRH A;  3GYA A;  1S3Z A;  3D3S A;  5DWM A;  3R95 A;  4F0Y A;  3PP9 A;  1S60 A;  4CYQ A;  1GHE A;  4R57 A;  3LOD A;  2Q04 A;  4XPD C;  3S6F A;  2R7H A;  1K4J A;  2Z3O A;  4R87 A;  1ON0 A;  1Y9K A;  1SQH A;  2F5I A;  4MFZ A;  5A28 A;  5AGE A;  2R8V A;  4KOT A;  4Q36 A;  4PSW A;  4MFL A;  1NSL A;  3A9L A;  2QIR A;  4M3S A;  4JJX A;  3F0A A;  3EO4 A;  4ZGY B;  4CAW A;  4RS2 A;  2EVN A;  5FVJ A;  4AG9 A;  5G22 A;  5KTD A;  2ZXV A;  4UA3 A;  3T9Y A;  2ZW6 A;  4X5K A;  2Z3K A;  2DPT A;  5GCN A;  4KUA A;  4AB7 A;  4KZT A;  1B6B A;  4H89 A;  4C2Y A;  5BWA B;  2ARH A;  4CYO A;  3S6K A;  2YNC A;  1MJA A;  3I9S A;  1YVO A;  2ZPA A;  2PR8 A;  2CXA A;  4C68 A;  1MJ9 A;  4U5Y A;  2D4P A;  2VXK A;  2YNC C;  2BSW A;  5JPH A;  4QBJ A;  2JEV A;  3F5B A;  2P6G A;  4ZBG A;  2J8R A;  4BBH A;  4C2Z A;  3EC4 A;  4E2A A;  3IWE A;  4Y49 B;  2B4B A;  2ZW7 A;  4KOV A;  1PU9 A;  4MFQ A;  3G8W A;  4Q38 A;  4KSA A;  2B58 A;  3IU1 A;  4PK3 A;  1CJW A;  4JLY A;  3VWE A;  5C82 A;  1Q2Y A;  4IF5 A;  4A2Z A;  1QSR A;  2HV2 A;  2VQY A;  2Z10 A;  3IU2 A;  3H5Z A;  3JTK A;  4KLW A;  3TO6 A;  2JDD A;  2QEC A;  3PZJ A;  1UFH A;  3TTH A;  3TFY A;  1NE9 A;  2J8N A;  2EUI A;  3NE7 A;  2CY2 A;  4FD7 A;  2Z0Z A;  2J8M A;  1KUX A;  4MY0 A;  5AG4 A;  1IB1 E;  3D8P A;  1BOB A;  4H6U A;  4QUS A;  3QAH A;  5EBV A;  4CAF A;  5J8F A;  2HQY A;  2Z3M A;  4C7H A;  4IUS A;  2R98 A;  2VZY A;  4CGN A;  4MI4 A;  4MY3 A;  2WUU A;  4E8O A;  4CGP A;  3DDD A;  4CGL A;  2G3T A;  1YX0 A;  1XMT A;  4OLL A;  2HUZ A;  4KOR A;  3R9G A;  1P0H A;  2A4N A;  1I21 A;  4CYN A;  2BEI A;  2OU2 A;  5IV0 A;  3TOA A;  3W6X A;  1I1D A;  4OAE A;  4UFV A;  3P2F A;  3T90 A;  4ONU A;  2FSR A;  3DNS A;  2PC1 A;  3FBU A;  4E0A A;  3IGR A;  2G0B A;  1R57 A;  2B5G B;  2WSA A;  3VWD A;  4B14 A;  4JXQ A;  3PGP A;  3SXO A;  5ISV A;  5G1Z A;  2OH1 A;  4KUB A;  4MFP A;  4FD5 A;  4CRY B;  5I0C A;  4B10 A;  4HNX B;  3FB3 A;  5J8C A;  2D4O A;  2I00 A;  1WWZ A;  1LRZ A;  3QB8 A;  3DSB A;  4F0X A;  3D2M A;  3P2H A;  4QC6 A;  4EVY A;  1YGH A;  4II9 A;  4F6A A;  4CAV A;  3W91 A;  1FY7 A;  1L0C A;  4KOU A;  1S7L A;  2CNS A;  1XEB A;  3CXP A;  2FS5 A;  2P6E A;  2B5G A;  3BJ8 A;  2FCK A;  3WR7 A;  4H6Z A;  3TOB A;  4KVX A;  5KTA A;  4B5O A;  1M4D A;  4KS9 A;  2IL4 A;  2FIA A;  2BL1 A;  4HKF A;  1Q2C A;  4BMH A;  3C26 A;  3FXT A;  2DXQ A;  1QSO A;  2FL4 A;  1B87 A;  3DR8 A;  4AVC A;  3FYN A;  2FT0 A;  4R3K A;  1S7N A;  1YRE A;  4XPK A;  5G20 A;  3EFA A;  3W6S A;  3FIX A;  1M4I A;  4UWJ A;  3R9E A;  5F49 A;  2RC4 A;  3B8G A;  1BO4 A;  4ORF A;  4R3L A;  2CNM A;  2AJ6 A;  1ZO0 A;  2P0W A;  4FD4 A;  4LUA A;  3N7Z A;  3EY5 A;  3FRM A;  1IYK A;  4K30 A;  4KOS A;  5F47 A;  2DPS A;  4HNW B;  4NCZ A;  3JVN A;  4L8A A;  4XPL A;  2B4D B;  5AG6 A;  2Y0M A;  3OWC A;  2OZH A;  3E0K A;  4CGM A;  2I79 A;  4PK2 A;  5AG7 A;  4MHD A;  2Q0Y A;  2KCW A;  4MBU A;  3BLN A;  3D2P A;  4UWI A;  4UCN A;  1Z4E A;  4J3G A;  4JD6 A;  1I12 A;  2OZG A;  2Z3L A;  5H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...