4KOTA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefotaxime
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 43
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kotA00
3I9SA 2HV2A 3SXOA 1B87A 1M1DA 1YVOA 2OZHA 5HH1A 2D4OA 2FL4A 4ORFA 4MHDA 1YX0A 1QSRA 4XPDB 4HNYB 2IL4A 4QUSA 2D4PA 4CRYB 5E96A 3TCVA 3LD2A 2OU2A 3G8WA 1P0HA 1K4JA 4NXYA 3NE7A 5DWMA 1IIDA 3G3SA 3MGDA 4AB7A 4XNHB 4KOTA 1IICA 4H6UA 5J8FA 1MJ9A 2ZW7A 2PQ8A 2FIWA 4YRHA 4XPKA 4NSQA 3DSBA 2B4DA 1MJAA 4H6ZA 4KLVA 1WWZA 3BLNA 1NMTA 3S6KA 3JVNA 4L89A 4OAEA 4U9ZA 3DDDA 5IB0A 4LX9A 2K5TA 4FD6A 2BL1A 2ARHA 5H86A 3F5BA 3UY5A 2REEA 5F47A 1R57A 1I21A 2PR8A 2VQYA 2X7BA 3CXPA 4QB9A 1VKCA 3R1KA 3K9UA 4PSWA 4CAWA 5H84A 5KTCA 2VZYA 1IYKA 2ZPAA 2Q4YA 5FVJA 5KTAA 5JQ4A 3P2HA 1UFHA 1S7FA 4OADA 3VWDA 4CRZB 2BEIA 3TO6A 1NSLA 2O28A 2PSWA 3C26A 4AG7A 1IYLA 5EBVA 4E0AA 4KORA 2OZUA 4M3SA 3TO9A 2QMLA 1TIQA 1ON0A 4XPDC 4E2AA 1KUVA 4U9YA 4KVOE 4EVYA 2RC4A 3TFYA 1U6MA 2JEVA 1XMTA 1CJWA 1BOBA 4PV6A 4MJ8A 1I12A 3QAHA 4XNHC 4RS2A 2REFA 2JLMA 3P2FA 1BO4A 2B3VA 1KUXA 2R1IA 2A4NA 3E0KA 2Z11A 4U5YA 1RXTA 1XE4A 2ATRA 4B5OA 5IV0A 4MY3A 3D8PA 1LRZA 2B4DB 2FIAA 4IUSA 3DR8A 3F8KA 1MJBA 1VHSA 2GIVA 2VI7A 5F46A 5JPHA 3RYOA 2QIRA 4ZBGA 3S6GA 4KOSA 2CNMA 1QSOA 1CM0A 3EY5A 3W91A 5J8CA 2ZW6A 2CY2A 1M4IA 4JJXA 4UWJA 1M4DA 2JDCA 2FCKA 2EUIA 3H4QA 3R9EA 4K30A 2Y0MA 2G3AA 3D2PA 2PDOA 4PSXA 4UWIA 2DXQA 3FYNA 4HNXB 2G3TA 4BMHA 3IGRA 1QSTA 3PP9A 4JWPA 2WPWA 4NEXA 3DR6A 4R3LA 1Z4RA 1Z4EA 4L8AA 1Q2CA 2OZGA 4CAVA 1Y9WA 3R9FA 3R96A 1V0CA 3EO4A 3GY9A 3T90A 2I00A 4F6AA 5EC4A 4R9MA 5C88A 1MK4A 1J4JA 2Q0YA 2R98A 3F0AA 2JDDA 2FE7A 3SXNA 2GANA 2EVNA 4GS4A 4UA3A 3LODA 1OZPA 3T9YA 1YR0A 1S7LA 4J3GA 3FB3A 1L0CA 4E8OA 3EC4A 1FY7A 1YGHA 1YVKA 2KCWA 1S7KA 3B8GA 3FNCA 2ZW4A 3GKRA 4NF1A 4F0YA 2PC1A 2Q44A 3DNSA 4KUAA 4AVAA 2VEZA 4X5KA 3PZJA 2J8MA 2FS5A 3D3SA 2VZZA 1PU9A 3VWEA 1Q2YA 4HNWB 1YK3A 4NCZA 3S6HA 2I79A 3ZJ0A 4CAXA 2CNSA 4KOYA 1PUAA 2QECA 3GYAA 3JUWA 2J8NA 5C82A 1N71A 4KOVA 1QSMA 1Z9UA 4M85A 4R57A 5KTDA 3R9GA 4QC6A 4FD5A 3TE4A 2Z10A 2Q4VA 3V8IA 1Y7RA 4QVTA 4RI1A 3FBUA 4YGOA 5F49A 5F48A 1B6BA 4KZTA 4IF5A 4KVXA 3WR7A 5I0CA 4MY0A 4JLYA 1KZFA 1Y9KA 4Y49C 1WK4A 5CNPA 2WPXA 1S3ZA 1XEBA 2OB0A 4MBUA 2HQYA 4AG9A 1RO5A 4HKFA 1I1DA 3S6FA 4JXRA 2HUZA 5ISVA 1P4NA 1S7NA 3IWGA 3TOAA 3CXSA 2Z0ZA 1YREA 2B3UA 1XIXA 3PGPA 3BJ8A 2FXFA 4R87A 5HMNA 2H5MA 2FSRA 4R3KA 3KKWA 4KLWA 1YLEA 5DWNA 2B4BA 1GHEA 1S60A 2R8VA 2R7HA 2OH1A 5IX3A 4Y49B 3FRMA 3FIXA 2PRBA 4AVCA 4AVBA 2GE3A 4FD7A 1M4GA 4YFJA 4I49A 4MI4A 3D2MA 4QBJA 4II9A 1QSNA 4H89A 2BSWA 3TT2A 4KUBA 1Q2DA 2J8RA 3R95A 3TO7A 2VXKA 3W6XA 2P6EA 4KOUA 2PR1A 3TOBA 4PK3A 3CXQA 2C27A 4UBRA 3N7ZA 4XPLA 1IB1E 1M44A 2CNTA 4KOWA 4JD6A 3OWCA 4LUAA 2P6GA 4DNCA 2BUEA 3QB8A 1SQHA 3EFAA 4KVME 2Q7BA 1S5KA 2B5GB 4B5PB 4ONUA 2FT0A 1XF8A 3ZZIA 3BJ7A 3SHPA 4KOXA 3FXTA 3I3GA 2AJ6A 2ZXVA 2P6FA 2AE6A 2F5IA 3W6SA 4FD4A 2ZW5A 3TTHA 3EXNA 2VBQA 2Q04A 1KUYA 1NE9A 4OLLA 2G0BA 2B58A 2P0WA 2NMTA 5GCNA 4JXQA 4CS0B 2B5GA 4B5PA 4PK2A
chains in the Genus database with same CATH superfamily
3I9SA 2HV2A 3SXOA 1B87A 1M1DA 2EK9A 1YVOA 5ELYA 2V8VA 2OZHA 3A9LA 5HH1A 1LOKA 2D4OA 2FL4A 5K8PA 4ORFA 1KWMA 2XEIA 4MHDA 1YX0A 2G9DA 2Q51A 4KSAA 1QSRA 4XPDB 5J1QA 4HNYB 4BINA 4P6YA 1FT7A 2IL4A 3RAMA 4QUSA 2D4PA 3H8GA 4NJQA 4MHZA 3FECA 4A33A 4CRYB 4MMOA 4MFJA 5E96A 3LD2A 2OU2A 3G8WA 4ZY2A 3TCVA 4DJLA 2AFXA 2IQ6A 1K4JA 1BAVA 1P0HA 4NXYA 4BD9A 3NE7A 5DWMA 4ZX9A 1IIDA 4OIWA 3G3SA 3MGDA 4PXDA 4M6HA 2PJ2A 2CIJA 4AB7A 3IU2A 4KOTA 4XNHB 1IICA 4H6UA 1YW6A 5DS0A 5J8FA 1MJ9A 2ZW7A 4OKOA 2PQ8A 2FIWA 4YRHA 2QVPA 1F2OA 4NJRA 4XPKA 4ONWA 4NSQA 4A32A 1VGYA 3DSBA 2B4DA 1MJAA 4NGNA 4H6ZA 4KLVA 1WWZA 2YNCA 3BLNA 3WABA 5LYFA 2Z3OA 4B6ZA 3GLJA 1Y0YA 1NMTA 4P4DA 3S6KA 3IU1A 3V38A 3JVNA 4L89A 4BBHA 3FMCA 4OAEA 4U9ZA 3DDDA 4CAFA 2ZEFA 5IB0A 4B11A 4LX9A 2BOAA 2K5TA 4FD6A 2BL1A 2ARHA 5H86A 3F5BA 3UY5A 5A27A 4ZY0A 4A94A 2REEA 2PIYA 4UFWA 2DEAA 2C6CA 3WT4A 5F47A 1R57A 1I21A 2PR8A 2VQYA 3PB6X 4A31A 1ELLP 2F7VA 2X7BA 6CPAA 3D4UA 3CXPA 3PFEA 4QB9A 1VKCA 2EWBA 4UCNA 4MHNA 4NGSA 4MXUA 1BPNA 3R1KA 4UEZA 2YGWA 3K9UA 4PSWA 4CAWA 2PJ1A 5H84A 5KTCA 2VZYA 1IYKA 2ZPAA 3IC1A 5BWAB 2Q4YA 5FVJA 4F8ZA 5CBMA 5JQ4A 5KTAA 3PB7X 4KSIA 3P2HA 3FJUA 4O23A 3K9TA 1UFHA 1S7FA 4F0XA 3IEHA 3MN8A 4OADA 3VWDA 4CRZB 5K8NA 2ZOFA 2BEIA 3D7GA 5G22A 4NGPA 1LAMA 3TO6A 2C6PA 1IGBA 1JWQA 3PB8X 3IO1A 3SI2A 3N5FA 1NSLA 4W9YA 2O28A 2PSWA 3C26A 4AG7A 1IYLA 3RBUA 4WWVA 5EBVA 4A38A 4E0AA 4KORA 3FEEA 2OZUA 4M3SA 3TO9A 4ZY1A 2QMLA 4IAVA 5HVHA 1TIQA 1Z5RA 2C1CA 4OC5A 1ON0A 4Q36A 4XPDC 3ISXA 3RNZA 4YU9A 2WYRA 4EFDA 1F57A 3B35A 4E2AA 1KUVA 4U9YA 3LWUA 4A39A 1ZO0A 4KVOE 4EVYA 1TKFA 2AFMA 2RC4A 3D66A 3IWWA 2CTBA 4CYNA 3TFYA 1U6MA 3QNVA 2JEVA 4Z65A 1A2ZA 1XMTA 1CJWA 4GXHA 4CYOA 1BOBA 2IMOA 4C68A 4PPZA 2Z3KA 3L2NA 4PV6A 4MJ8A 1I12A 2YNDA 3QAYA 2EBJA 4C2YA 3QAHA 4MFPA 3VATA 4C7IA 4XNHC 1QQ9A 2CXAA 3NH4A 4RS2A 5AG5A 3B3SA 2C6GA 2NYQA 2REFA 2JLMA 3P2FA 4YWYA 1BO4A 2B3VA 2V8HA 4JYWA 2ZEGA 1KUXA 4OC3A 3D68A 5D29A 3IIBA 2AFSA 2R1IA 2PJ7A 2A4NA 3E0KA 2QYVA 2PJ4A 2Z11A 1HDQA 1Z8XA 2O53A 1RXTA 1XE4A 4U5YA 2ATRA 4B5OA 2CF4A 5IV0A 4P4FA 1BLLE 3D8PA 1LRZA 1AUGA 4MY3A 4P10A 1TF8A 4MHPA 2B4DB 1IOIA 1ZG8A 1CG2A 1CP7A 2FIAA 4IUSA 3DR8A 4UIBA 3F8KA 1MJBA 4CGMA 5CPAA 4LQ6A 3WC5A 1VHSA 2GIVA 2VI7A 3FH4A 3JTKA 5F46A 5JPHA 5LYDA 1LFWA 2PJAA 2ABZA 3RYOA 2QIRA 5AGEA 4ZBGA 3S6GA 4KOSA 2F8HA 2JEWA 2CNMA 1QSOA 3SI1A 1CM0A 3EY5A 3W91A 2PIZA 2Z3MA 2PJ3A 3S9MA 5J8CA 2ZW6A 2CY2A 1M4IA 4OC2A 4JJXA 4UWJA 3K2KA 4ZGYB 3H8EA 2BCOA 3CPXA 3KQZA 1M4DA 2JDCA 4M6GA 2FCKA 2EUIA 4C2XA 3H4QA 3R9EA 5LYIA 4K30A 1VIXA 2Y0MA 2Z3LA 3B2YA 4KSFA 1ARMA 3D7HA 4DUKA 8CPAA 1TXRA 3S9NA 2G3AA 1LCPA 1YMEA 1FNOA 3D2PA 3GUXA 2PDOA 2Q4ZA 4PSXA 4UWIA 5HXDA 2DXQA 3FYNA 4HNXB 1F2PA 1GYTA 2G3TA 4A2ZA 4P4IA 4BMHA 3IGRA 1QSTA 3ISZA 3HLPA 1Z2LA 3PP9A 4R76A 5HVGA 4JWPA 3KI9A 2PCUA 4R6TA 2AFOA 4B12A 2WPWA 4NEXA 2AFZA 2VL1A 3DR6A 2HC9A 4R3LA 4UF4A 1Z4RA 1XFOA 4UEFA 5K8OA 1Z4EA 2RB7A 1Q2CA 2OZGA 4L8AA 2GLFA 4CAVA 1Y9WA 4FWUA 3R9FA 1LANA 3R96A 3PEIA 1R3NA 2ZEPA 1V0CA 3KZWA 2XEGA 3B3VA 2ODFA 3PBEA 3EO4A 3GY9A 3T90A 2I00A 3CT9A 4F6AA 1Y0RA 4R9MA 5EC4A 5C88A 4F9VA 4MCRA 4CYPA 1MK4A 1J4JA 2Q0YA 4MFKA 4NGTA 1R43A 2R98A 3F0AA 3SJGA 3H8FA 5G1ZA 3NFZA 2JBJA 3TX8A 4P4JA 1M4LA 4CPAA 2JDDA 4K3NA 2FE7A 3CZXA 3SXNA 2DPTA 2GANA 2EVNA 2PJBA 3FVLA 4GS4A 4UA3A 3LODA 1OZPA 5D8NA 3T9YA 1YR0A 1S7LA 4M6IA 4J3GA 3FB3A 4AXVA 2V8DA 3KQXA 3PB9X 5AG4A 1VHOA 4MCQA 3D7FA 1L0CA 5LYLA 4OMEA 4E8OA 3GB0A 3PB4X 5JGFA 4PQAA 4P45A 1Z8LA 3EC4A 1FY7A 5IB9A 1TF9A 2BO9A 4MCSA 2EO8A 2ZEOA 3I1UA 1YGHA 2Q7SA 3BXMA 1YVKA 2KCWA 4B14A 2YNCC 1TKHA 1AMPA 3BHXA 1S7KA 3B8GA 2NSMA 3V7ZA 4C2ZA 3FNCA 2ZW4A 3GKRA 4NF1A 4Q7AA 2PC1A 4F0YA 2Q44A 3NE8A 4GM5A 3S9LA 3DNSA 2I3CA 4KUAA 4AVAA 4CAEA 4ZX8A 2VEZA 4JZ0A 4ZI6A 4X5KA 3PZJA 2J8MA 2FS5A 1UWYA 1YLOA 3D3SA 4KS9A 4RN7A 2VZZA 1PU9A 3VWEA 1Q2YA 3KR4A 4HNWB 1YK3A 1Z8WA 4NCZA 2WUUA 3S6HA 4LQGA 2I79A 3ZJ0A 4CAXA 2CNSA 5EMIA 1ZLIA 4KOYA 1PUAA 3LMSA 2QECA 2ZEMA 4Q38A 2AFUA 1TKJA 3D7DA 2PJ8A 3GYAA 1XRYA 3JUWA 2OOTA 2WZNA 4UEEA 4MFLA 3FX6A 3KHXA 1ZG7A 2J8NA 3KL9A 1BPMA 1PYTB 1CPSA 4OC0A 5C82A 5F09A 1N71A 4KOVA 2XEFA 1QSMA 5JH9A 1Z9UA 2PJ9A 5LRGA 2FVGA 4M85A 3VARA 2Z3NA 4R57A 5KTDA 3R9GA 5K8MA 4QC6A 4FD5A 2XEJA 4C7HA 2ANPA 4MRIA 4CGLA 1XMBA 3WC7A 1CP6A 1X12A 1PCAA 2Z10A 1XJOA 3PBBA 2Q4VA 4PXEA 3TE4A 5HVFA 3V8IA 1Y7RA 4QVTA 4RI1A 3FBUA 4YGOA 4MFQA 5F49A 5F48A 3SJEA 4UIAA 1IU8A 4OIDA 1B6BA 4KZTA 1DTDA 3B3TA 4IF5A 1DE4C 4KVXA 4MHYA 4UCMA 3H5ZA 3WR7A 4PXCA 5I0CA 3D67A 4MY0A 3VH9A 4JLYA 1KZFA 1Y9KA 1ZG9A 1WK4A 4Y49C 5CNPA 5G20A 2WPXA 1S3ZA 1XEBA 2OB0A 2GREA 4DYOA 4MBUA 2HQYA 2DF5A 4AG9A 1RO5A 4HKFA 2ZENA 1I1DA 3S6FA 3KGQA 4JXRA 2PVWA 2HUZA 3IWEA 4B13A 4X8IA 2Z3PA 5ISVA 1JQGA 1P4NA 1S7NA 1IOFA 1Z8TA 3IWGA 1Q7LA 4IHMA 3T8WA 3TOAA 2OR4A 3CXSA 2Z0ZA 1RTQA 1YREA 2JBKA 2AFWA 2B3UA 4X3RA 1XIXA 4WJBA 3TC8A 3PGPA 1X10A 4UCPA 2PJ5A 3BI1A 3BJ8A 3CPAA 2ZOGA 3HUVA 4CYQA 2FXFA 3JRUA 4R87A 4RUHA 5HMNA 2H5MA 2FSRA 3B7IA 5LRKA 4OC4A 4R3KA 1ARLA 3KKWA 4KLWA 4A95A 4TWEA 1YLEA 5DWNA 3SJFA 4MFZA 2PE3A 1ZLHA 2B4BA 3GIUA 1GHEA 1S60A 4OP4A 4R7MA 5LRJA 2R8VA 2R7HA 2PJCA 4A30A 2OH1A 5IX3A 3DLJA 2V8GA 4Y49B 3FF3A 3FRMA 3FIXA 4HPSA 2HB6A 2PRBA 1IY7A 2PJ6A 4AVCA 2ZEHA 4AVBA 1HDUA 2GE3A 3NH8A 4FD7A 1M4GA 4CGPA 4YFJA 2EK8A 3KR5A 1EE3P 4I49A 4MI4A 4EMEA 2POKA 4CGNA 2CTCA 3D2MA 3KASA 4QBJA 5JM6A 1VHEA 4II9A 2J9AA 1QSNA 3DGVA 1Y7EA 2RFHA 3CDXA 2O4HA 2GLJA 3KHZA 3IJ3A 4H89A 4X2TA 3SI0A 4NGQA 7CPAA 4R8FA 2PVVA 2BSWA 3TT2A 4KUBA 1Q2DA 2J8RA 3PRTA 3R95A 3TO7A 2V77A 1NSAA 4B10A 4MCPA 4UFVA 4CGOA 4G1PA 2VXKA 5I4MA 3LACA 4FUUA 3W6XA 1QMUA 2P6EA 2PR1A 4KOUA 3TOBA 4A37A 4PK3A 4H2KA 4P4BA 3CXQA 2C27A 4UBRA 3N7ZA 3SJXA 3MRUA 1HEEA 2DPSA 4XPLA 4F9UA 1IB1E 1M44A 4IK2A 2CNTA 2PJ0A 3IFEA 4KOWA 5THWA 4TNUA 4JD6A 3OWCA 3RO0A 1XOVA 2Q43A 1H8LA 3B3CA 4LUAA 2P6GA 4DNCA 5A28A 2BUEA 3QB8A 1CX8A 4ZYQA 2PRQA 2GU2A 1SQHA 3BI0A 3EFAA 3PFOA 4KVME 4PXBA 1S5KA 2Q7BA 4OC1A 1OBRA 1CPXA 4FAIA 2B5GB 4B5PB 2ZEEA 1CBXA 2FT0A 3B3WA 3FEDA 1XF8A 2ZEDA 4ONUA 3ZZIA 3BJ7A 3SHPA 4FBEA 4KOXA 3FXTA 4P44A 5AG6A 4NGRA 3I3GA 2AJ6A 2ZXVA 2P6FA 3RZAA 4NGMA 2AE6A 1YW4A 2F5IA 4NFRA 3NA6A 1LAPA 1XBUA 2QJ8A 5G21A 3W6SA 4FD4A 2YNEA 1YQEA 2ZW5A 4B5PA 1YSJA 1ELMP 3TTHA 2GFQA 3EXNA 2VBQA 2Q04A 1KUYA 1NE9A 4OLLA 4UFXA 2G0BA 2ZELA 5AG7A 1AYEA 3WC6A 2IJZA 4EWTA 4P4EA 2B58A 2P0WA 2NMTA 2WSAA 5GCNA 4JXQA 4CS0B 2B5GA 3NH5A 4PK2A
chains in the Genus database with same CATH topology
3I9SA 2HV2A 3SXOA 1B87A 1M1DA 1YVOA 2OZHA 3A9LA 5HH1A 2D4OA 2FL4A 4ORFA 4MHDA 1YX0A 4KSAA 1QSRA 4XPDB 4HNYB 2IL4A 4QUSA 2D4PA 4A33A 4CRYB 4MFJA 5E96A 3LD2A 2OU2A 3G8WA 3TCVA 1P0HA 1K4JA 4NXYA 3NE7A 5DWMA 1IIDA 3G3SA 3MGDA 4AB7A 3IU2A 4KOTA 4XNHB 1IICA 4H6UA 5J8FA 1MJ9A 2ZW7A 2PQ8A 2FIWA 4YRHA 4XPKA 4NSQA 4A32A 3DSBA 2B4DA 1MJAA 4H6ZA 4KLVA 1WWZA 2YNCA 3BLNA 2Z3OA 1NMTA 3S6KA 3IU1A 3JVNA 4L89A 4BBHA 4OAEA 4U9ZA 3DDDA 4CAFA 5IB0A 4B11A 4LX9A 2K5TA 4FD6A 2BL1A 2ARHA 5H86A 3F5BA 3UY5A 5A27A 2REEA 4UFWA 5F47A 1R57A 1I21A 2PR8A 2VQYA 4A31A 2X7BA 3CXPA 4QB9A 4UCNA 1VKCA 3R1KA 2YGWA 3K9UA 4PSWA 4CAWA 5H84A 5KTCA 2VZYA 1IYKA 2ZPAA 5BWAB 2Q4YA 5FVJA 5KTAA 5JQ4A 3P2HA 1UFHA 1S7FA 4F0XA 4OADA 3VWDA 4CRZB 2BEIA 5G22A 3TO6A 1NSLA 2O28A 2PSWA 3C26A 4AG7A 1IYLA 5EBVA 4E0AA 4KORA 2OZUA 4M3SA 3TO9A 2QMLA 1TIQA 1ON0A 4Q36A 4XPDC 4E2AA 1KUVA 4U9YA 1ZO0A 4KVOE 4EVYA 4CYNA 2RC4A 3TFYA 1U6MA 2JEVA 1XMTA 1CJWA 4CYOA 1BOBA 4C68A 2Z3KA 4PV6A 4MJ8A 1I12A 2YNDA 4C2YA 3QAHA 4MFPA 4C7IA 4XNHC 2CXAA 4RS2A 5AG5A 2REFA 2JLMA 3P2FA 1BO4A 2B3VA 1KUXA 2R1IA 2A4NA 3E0KA 2Z11A 4U5YA 1RXTA 1XE4A 2ATRA 4B5OA 5IV0A 4MY3A 3D8PA 1LRZA 2B4DB 2FIAA 4IUSA 3DR8A 3F8KA 1MJBA 4CGMA 1VHSA 2GIVA 2VI7A 3JTKA 5F46A 5JPHA 3RYOA 2QIRA 5AGEA 4ZBGA 3S6GA 4KOSA 2CNMA 1QSOA 1CM0A 3EY5A 3W91A 2Z3MA 5J8CA 2ZW6A 2CY2A 1M4IA 4JJXA 4UWJA 4ZGYB 1M4DA 2JDCA 2FCKA 2EUIA 4C2XA 3H4QA 3R9EA 4K30A 2Y0MA 2Z3LA 4KSFA 2G3AA 3D2PA 2PDOA 4PSXA 4UWIA 2DXQA 3FYNA 4HNXB 2G3TA 4A2ZA 4BMHA 3IGRA 1QSTA 3PP9A 4JWPA 4B12A 2WPWA 4NEXA 3DR6A 4R3LA 1Z4RA 1Z4EA 4L8AA 1Q2CA 2OZGA 4CAVA 1Y9WA 3R9FA 3R96A 1V0CA 3EO4A 3GY9A 3T90A 2I00A 4F6AA 5EC4A 4R9MA 5C88A 4CYPA 1MK4A 1J4JA 2Q0YA 4MFKA 2R98A 3F0AA 5G1ZA 2JDDA 2FE7A 3SXNA 2DPTA 2GANA 2EVNA 4GS4A 4UA3A 3LODA 1OZPA 3T9YA 1YR0A 1S7LA 4J3GA 3FB3A 5AG4A 1L0CA 4E8OA 3EC4A 1FY7A 1YGHA 1YVKA 2KCWA 4B14A 2YNCC 1S7KA 3B8GA 4C2ZA 3FNCA 2ZW4A 3GKRA 4NF1A 4F0YA 2PC1A 2Q44A 3DNSA 4KUAA 4AVAA 4CAEA 2VEZA 4X5KA 3PZJA 2J8MA 2FS5A 4KS9A 3D3SA 2VZZA 1PU9A 3VWEA 1Q2YA 4HNWB 1YK3A 4NCZA 2WUUA 3S6HA 2I79A 3ZJ0A 4CAXA 2CNSA 4KOYA 1PUAA 4Q38A 2QECA 3GYAA 3JUWA 4MFLA 2J8NA 5C82A 1N71A 4KOVA 1QSMA 1Z9UA 4M85A 2Z3NA 4R57A 5KTDA 3R9GA 4QC6A 4FD5A 4C7HA 4CGLA 3TE4A 2Z10A 2Q4VA 3V8IA 1Y7RA 4QVTA 4RI1A 3FBUA 4YGOA 4MFQA 5F49A 5F48A 1B6BA 4KZTA 4IF5A 4KVXA 4UCMA 3H5ZA 3WR7A 5I0CA 4MY0A 4JLYA 1KZFA 1Y9KA 4Y49C 1WK4A 5CNPA 5G20A 2WPXA 1S3ZA 1XEBA 2OB0A 4MBUA 2HQYA 4AG9A 1RO5A 4HKFA 1I1DA 3S6FA 4JXRA 3IWEA 2HUZA 4B13A 5ISVA 2Z3PA 1P4NA 1S7NA 3IWGA 3TOAA 3CXSA 2Z0ZA 1YREA 2B3UA 1XIXA 3PGPA 4UCPA 3BJ8A 4CYQA 2FXFA 4R87A 5HMNA 2H5MA 2FSRA 4R3KA 3KKWA 4KLWA 4A95A 1YLEA 5DWNA 4MFZA 2B4BA 1GHEA 1S60A 2R8VA 2R7HA 4A30A 2OH1A 5IX3A 4Y49B 3FRMA 3FIXA 2PRBA 4AVCA 4AVBA 2GE3A 4FD7A 1M4GA 4CGPA 4YFJA 4I49A 4MI4A 4CGNA 3D2MA 4QBJA 4II9A 1QSNA 4H89A 2BSWA 3TT2A 4KUBA 1Q2DA 2J8RA 3R95A 3TO7A 4B10A 4UFVA 4CGOA 2VXKA 3W6XA 2P6EA 4KOUA 2PR1A 3TOBA 4PK3A 3CXQA 2C27A 4UBRA 3N7ZA 2DPSA 4XPLA 1IB1E 1M44A 2CNTA 4KOWA 4JD6A 3OWCA 4LUAA 2P6GA 4DNCA 5A28A 2BUEA 3QB8A 1SQHA 3EFAA 4KVME 2Q7BA 1S5KA 2B5GB 4B5PB 4ONUA 2FT0A 1XF8A 3ZZIA 3BJ7A 3SHPA 4KOXA 3FXTA 5AG6A 3I3GA 2AJ6A 2ZXVA 2P6FA 2AE6A 2F5IA 5G21A 3W6SA 4FD4A 2YNEA 2ZW5A 3TTHA 3EXNA 2VBQA 2Q04A 1KUYA 1NE9A 4OLLA 4UFXA 2G0BA 5AG7A 2B58A 2P0WA 2NMTA 2WSAA 5GCNA 4JXQA 4CS0B 2B5GA 4B5PA 4PK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I9S A;  2HV2 A;  3SXO A;  1B87 A;  1M1D A;  1YVO A;  2OZH A;  5HH1 A;  2D4O A;  2FL4 A;  4ORF A;  4MHD A;  1YX0 A;  1QSR A;  4XPD B;  4HNY B;  2IL4 A;  4QUS A;  2D4P A;  4CRY B;  5E96 A;  3TCV A;  3LD2 A;  2OU2 A;  3G8W A;  1P0H A;  1K4J A;  4NXY A;  3NE7 A;  5DWM A;  1IID A;  3G3S A;  3MGD A;  4AB7 A;  4XNH B;  4KOT A;  1IIC A;  4H6U A;  5J8F A;  1MJ9 A;  2ZW7 A;  2PQ8 A;  2FIW A;  4YRH A;  4XPK A;  4NSQ A;  3DSB A;  2B4D A;  1MJA A;  4H6Z A;  4KLV A;  1WWZ A;  3BLN A;  1NMT A;  3S6K A;  3JVN A;  4L89 A;  4OAE A;  4U9Z A;  3DDD A;  5IB0 A;  4LX9 A;  2K5T A;  4FD6 A;  2BL1 A;  2ARH A;  5H86 A;  3F5B A;  3UY5 A;  2REE A;  5F47 A;  1R57 A;  1I21 A;  2PR8 A;  2VQY A;  2X7B A;  3CXP A;  4QB9 A;  1VKC A;  3R1K A;  3K9U A;  4PSW A;  4CAW A;  5H84 A;  5KTC A;  2VZY A;  1IYK A;  2ZPA A;  2Q4Y A;  5FVJ A;  5KTA A;  5JQ4 A;  3P2H A;  1UFH A;  1S7F A;  4OAD A;  3VWD A;  4CRZ B;  2BEI A;  3TO6 A;  1NSL A;  2O28 A;  2PSW A;  3C26 A;  4AG7 A;  1IYL A;  5EBV A;  4E0A A;  4KOR A;  2OZU A;  4M3S A;  3TO9 A;  2QML A;  1TIQ A;  1ON0 A;  4XPD C;  4E2A A;  1KUV A;  4U9Y A;  4KVO E;  4EVY A;  2RC4 A;  3TFY A;  1U6M A;  2JEV A;  1XMT A;  1CJW A;  1BOB A;  4PV6 A;  4MJ8 A;  1I12 A;  3QAH A;  4XNH C;  4RS2 A;  2REF A;  2JLM A;  3P2F A;  1BO4 A;  2B3V A;  1KUX A;  2R1I A;  2A4N A;  3E0K A;  2Z11 A;  4U5Y A;  1RXT A;  1XE4 A;  2ATR A;  4B5O A;  5IV0 A;  4MY3 A;  3D8P A;  1LRZ A;  2B4D B;  2FIA A;  4IUS A;  3DR8 A;  3F8K A;  1MJB A;  1VHS A;  2GIV A;  2VI7 A;  5F46 A;  5JPH A;  3RYO A;  2QIR A;  4ZBG A;  3S6G A;  4KOS A;  2CNM A;  1QSO A;  1CM0 A;  3EY5 A;  3W91 A;  5J8C A;  2ZW6 A;  2CY2 A;  1M4I A;  4JJX A;  4UWJ A;  1M4D A;  2JDC A;  2FCK A;  2EUI A;  3H4Q A;  3R9E A;  4K30 A;  2Y0M A;  2G3A A;  3D2P A;  2PDO A;  4PSX A;  4UWI A;  2DXQ A;  3FYN A;  4HNX B;  2G3T A;  4BMH A;  3IGR A;  1QST A;  3PP9 A;  4JWP A;  2WPW A;  4NEX A;  3DR6 A;  4R3L A;  1Z4R A;  1Z4E A;  4L8A A;  1Q2C A;  2OZG A;  4CAV A;  1Y9W A;  3R9F A;  3R96 A;  1V0C A;  3EO4 A;  3GY9 A;  3T90 A;  2I00 A;  4F6A A;  5EC4 A;  4R9M A;  5C88 A;  1MK4 A;  1J4J A;  2Q0Y A;  2R98 A;  3F0A A;  2JDD A;  2FE7 A;  3SXN A;  2GAN A;  2EVN A;  4GS4 A;  4UA3 A;  3LOD A;  1OZP A;  3T9Y A;  1YR0 A;  1S7L A;  4J3G A;  3FB3 A;  1L0C A;  4E8O A;  3EC4 A;  1FY7 A;  1YGH A;  1YVK A;  2KCW A;  1S7K A;  3B8G A;  3FNC A;  2ZW4 A;  3GKR A;  4NF1 A;  4F0Y A;  2PC1 A;  2Q44 A;  3DNS A;  4KUA A;  4AVA A;  2VEZ A;  4X5K A;  3PZJ A;  2J8M A;  2FS5 A;  3D3S A;  2VZZ A;  1PU9 A;  3VWE A;  1Q2Y A;  4HNW B;  1YK3 A;  4NCZ A;  3S6H A;  2I79 A;  3ZJ0 A;  4CAX A;  2CNS A;  4KOY A;  1PUA A;  2QEC A;  3GYA A;  3JUW A;  2J8N A;  5C82 A;  1N71 A;  4KOV A;  1QSM A;  1Z9U A;  4M85 A;  4R57 A;  5KTD A;  3R9G A;  4QC6 A;  4FD5 A;  3TE4 A;  2Z10 A;  2Q4V A;  3V8I A;  1Y7R A;  4QVT A;  4RI1 A;  3FBU A;  4YGO A;  5F49 A;  5F48 A;  1B6B A;  4KZT A;  4IF5 A;  4KVX A;  3WR7 A;  5I0C A;  4MY0 A;  4JLY A;  1KZF A;  1Y9K A;  4Y49 C;  1WK4 A;  5CNP A;  2WPX A;  1S3Z A;  1XEB A;  2OB0 A;  4MBU A;  2HQY A;  4AG9 A;  1RO5 A;  4HKF A;  1I1D A;  3S6F A;  4JXR A;  2HUZ A;  5ISV A;  1P4N A;  1S7N A;  3IWG A;  3TOA A;  3CXS A;  2Z0Z A;  1YRE A;  2B3U A;  1XIX A;  3PGP A;  3BJ8 A;  2FXF A;  4R87 A;  5HMN A;  2H5M A;  2FSR A;  4R3K A;  3KKW A;  4KLW A;  1YLE A;  5DWN A;  2B4B A;  1GHE A;  1S60 A;  2R8V A;  2R7H A;  2OH1 A;  5IX3 A;  4Y49 B;  3FRM A;  3FIX A;  2PRB A;  4AVC A;  4AVB A;  2GE3 A;  4FD7 A;  1M4G A;  4YFJ A;  4I49 A;  4MI4 A;  3D2M A;  4QBJ A;  4II9 A;  1QSN A;  4H89 A;  2BSW A;  3TT2 A;  4KUB A;  1Q2D A;  2J8R A;  3R95 A;  3TO7 A;  2VXK A;  3W6X A;  2P6E A;  4KOU A;  2PR1 A;  3TOB A;  4PK3 A;  3CXQ A;  2C27 A;  4UBR A;  3N7Z A;  4XPL A;  1IB1 E;  1M44 A;  2CNT A;  4KOW A;  4JD6 A;  3OWC A;  4LUA A;  2P6G A;  4DNC A;  2BUE A;  3QB8 A;  1SQH A;  3EFA A;  4KVM E;  2Q7B A;  1S5K A;  2B5G B;  4B5P B;  4ONU A;  2FT0 A;  1XF8 A;  3ZZI A;  3BJ7 A;  3SHP A;  4KOX A;  3FXT A;  3I3G A;  2AJ6 A;  2ZXV A;  2P6F A;  2AE6 A;  2F5I A;  3W6S A;  4FD4 A;  2ZW5 A;  3TTH A;  3EXN A;  2VBQ A;  2Q04 A;  1KUY A;  1NE9 A;  4OLL A;  2G0B A;  2B58 A;  2P0W A;  2NMT A;  5GCN A;  4JXQ A;  4CS0 B;  2B5G A;  4B5P A;  4PK2 A; 
#chains in the Genus database with same CATH topology
 3I9S A;  2HV2 A;  3SXO A;  1B87 A;  1M1D A;  2EK9 A;  1YVO A;  5ELY A;  2V8V A;  2OZH A;  3A9L A;  5HH1 A;  1LOK A;  2D4O A;  2FL4 A;  5K8P A;  4ORF A;  1KWM A;  2XEI A;  4MHD A;  1YX0 A;  2G9D A;  2Q51 A;  4KSA A;  1QSR A;  4XPD B;  5J1Q A;  4HNY B;  4BIN A;  4P6Y A;  1FT7 A;  2IL4 A;  3RAM A;  4QUS A;  2D4P A;  3H8G A;  4NJQ A;  4MHZ A;  3FEC A;  4A33 A;  4CRY B;  4MMO A;  4MFJ A;  5E96 A;  3LD2 A;  2OU2 A;  3G8W A;  4ZY2 A;  3TCV A;  4DJL A;  2AFX A;  2IQ6 A;  1K4J A;  1BAV A;  1P0H A;  4NXY A;  4BD9 A;  3NE7 A;  5DWM A;  4ZX9 A;  1IID A;  4OIW A;  3G3S A;  3MGD A;  4PXD A;  4M6H A;  2PJ2 A;  2CIJ A;  4AB7 A;  3IU2 A;  4KOT A;  4XNH B;  1IIC A;  4H6U A;  1YW6 A;  5DS0 A;  5J8F A;  1MJ9 A;  2ZW7 A;  4OKO A;  2PQ8 A;  2FIW A;  4YRH A;  2QVP A;  1F2O A;  4NJR A;  4XPK A;  4ONW A;  4NSQ A;  4A32 A;  1VGY A;  3DSB A;  2B4D A;  1MJA A;  4NGN A;  4H6Z A;  4KLV A;  1WWZ A;  2YNC A;  3BLN A;  3WAB A;  5LYF A;  2Z3O A;  4B6Z A;  3GLJ A;  1Y0Y A;  1NMT A;  4P4D A;  3S6K A;  3IU1 A;  3V38 A;  3JVN A;  4L89 A;  4BBH A;  3FMC A;  4OAE A;  4U9Z A;  3DDD A;  4CAF A;  2ZEF A;  5IB0 A;  4B11 A;  4LX9 A;  2BOA A;  2K5T A;  4FD6 A;  2BL1 A;  2ARH A;  5H86 A;  3F5B A;  3UY5 A;  5A27 A;  4ZY0 A;  4A94 A;  2REE A;  2PIY A;  4UFW A;  2DEA A;  2C6C A;  3WT4 A;  5F47 A;  1R57 A;  1I21 A;  2PR8 A;  2VQY A;  3PB6 X;  4A31 A;  1ELL P;  2F7V A;  2X7B A;  6CPA A;  3D4U A;  3CXP A;  3PFE A;  4QB9 A;  1VKC A;  2EWB A;  4UCN A;  4MHN A;  4NGS A;  4MXU A;  1BPN A;  3R1K A;  4UEZ A;  2YGW A;  3K9U A;  4PSW A;  4CAW A;  2PJ1 A;  5H84 A;  5KTC A;  2VZY A;  1IYK A;  2ZPA A;  3IC1 A;  5BWA B;  2Q4Y A;  5FVJ A;  4F8Z A;  5CBM A;  5JQ4 A;  5KTA A;  3PB7 X;  4KSI A;  3P2H A;  3FJU A;  4O23 A;  3K9T A;  1UFH A;  1S7F A;  4F0X A;  3IEH A;  3MN8 A;  4OAD A;  3VWD A;  4CRZ B;  5K8N A;  2ZOF A;  2BEI A;  3D7G A;  5G22 A;  4NGP A;  1LAM A;  3TO6 A;  2C6P A;  1IGB A;  1JWQ A;  3PB8 X;  3IO1 A;  3SI2 A;  3N5F A;  1NSL A;  4W9Y A;  2O28 A;  2PSW A;  3C26 A;  4AG7 A;  1IYL A;  3RBU A;  4WWV A;  5EBV A;  4A38 A;  4E0A A;  4KOR A;  3FEE A;  2OZU A;  4M3S A;  3TO9 A;  4ZY1 A;  2QML A;  4IAV A;  5HVH A;  1TIQ A;  1Z5R A;  2C1C A;  4OC5 A;  1ON0 A;  4Q36 A;  4XPD C;  3ISX A;  3RNZ A;  4YU9 A;  2WYR A;  4EFD A;  1F57 A;  3B35 A;  4E2A A;  1KUV A;  4U9Y A;  3LWU A;  4A39 A;  1ZO0 A;  4KVO E;  4EVY A;  1TKF A;  2AFM A;  2RC4 A;  3D66 A;  3IWW A;  2CTB A;  4CYN A;  3TFY A;  1U6M A;  3QNV A;  2JEV A;  4Z65 A;  1A2Z A;  1XMT A;  1CJW A;  4GXH A;  4CYO A;  1BOB A;  2IMO A;  4C68 A;  4PPZ A;  2Z3K A;  3L2N A;  4PV6 A;  4MJ8 A;  1I12 A;  2YND A;  3QAY A;  2EBJ A;  4C2Y A;  3QAH A;  4MFP A;  3VAT A;  4C7I A;  4XNH C;  1QQ9 A;  2CXA A;  3NH4 A;  4RS2 A;  5AG5 A;  3B3S A;  2C6G A;  2NYQ A;  2REF A;  2JLM A;  3P2F A;  4YWY A;  1BO4 A;  2B3V A;  2V8H A;  4JYW A;  2ZEG A;  1KUX A;  4OC3 A;  3D68 A;  5D29 A;  3IIB A;  2AFS A;  2R1I A;  2PJ7 A;  2A4N A;  3E0K A;  2QYV A;  2PJ4 A;  2Z11 A;  1HDQ A;  1Z8X A;  2O53 A;  1RXT A;  1XE4 A;  4U5Y A;  2ATR A;  4B5O A;  2CF4 A;  5IV0 A;  4P4F A;  1BLL E;  3D8P A;  1LRZ A;  1AUG A;  4MY3 A;  4P10 A;  1TF8 A;  4MHP A;  2B4D B;  1IOI A;  1ZG8 A;  1CG2 A;  1CP7 A;  2FIA A;  4IUS A;  3DR8 A;  4UIB A;  3F8K A;  1MJB A;  4CGM A;  5CPA A;  4LQ6 A;  3WC5 A;  1VHS A;  2GIV A;  2VI7 A;  3FH4 A;  3JTK A;  5F46 A;  5JPH A;  5LYD A;  1LFW A;  2PJA A;  2ABZ A;  3RYO A;  2QIR A;  5AGE A;  4ZBG A;  3S6G A;  4KOS A;  2F8H A;  2JEW A;  2CNM A;  1QSO A;  3SI1 A;  1CM0 A;  3EY5 A;  3W91 A;  2PIZ A;  2Z3M A;  2PJ3 A;  3S9M A;  5J8C A;  2ZW6 A;  2CY2 A;  1M4I A;  4OC2 A;  4JJX A;  4UWJ A;  3K2K A;  4ZGY B;  3H8E A;  2BCO A;  3CPX A;  3KQZ A;  1M4D A;  2JDC A;  4M6G A;  2FCK A;  2EUI A;  4C2X A;  3H4Q A;  3R9E A;  5LYI A;  4K30 A;  1VIX A;  2Y0M A;  2Z3L A;  3B2Y A;  4KSF A;  1ARM A;  3D7H A;  4DUK A;  8CPA A;  1TXR A;  3S9N A;  2G3A A;  1LCP A;  1YME A;  1FNO A;  3D2P A;  3GUX A;  2PDO A;  2Q4Z A;  4PSX A;  4UWI A;  5HXD A;  2DXQ A;  3FYN A;  4HNX B;  1F2P A;  1GYT A;  2G3T A;  4A2Z A;  4P4I A;  4BMH A;  3IGR A;  1QST A;  3ISZ A;  3HLP A;  1Z2L A;  3PP9 A;  4R76 A;  5HVG A;  4JWP A;  3KI9 A;  2PCU A;  4R6T A;  2AFO A;  4B12 A;  2WPW A;  4NEX A;  2AFZ A;  2VL1 A;  3DR6 A;  2HC9 A;  4R3L A;  4UF4 A;  1Z4R A;  1XFO A;  4UEF A;  5K8O A;  1Z4E A;  2RB7 A;  1Q2C A;  2OZG A;  4L8A A;  2GLF A;  4CAV A;  1Y9W A;  4FWU A;  3R9F A;  1LAN A;  3R96 A;  3PEI A;  1R3N A;  2ZEP A;  1V0C A;  3KZW A;  2XEG A;  3B3V A;  2ODF A;  3PBE A;  3EO4 A;  3GY9 A;  3T90 A;  2I00 A;  3CT9 A;  4F6A A;  1Y0R A;  4R9M A;  5EC4 A;  5C88 A;  4F9V A;  4MCR A;  4CYP A;  1MK4 A;  1J4J A;  2Q0Y A;  4MFK A;  4NGT A;  1R43 A;  2R98 A;  3F0A A;  3SJG A;  3H8F A;  5G1Z A;  3NFZ A;  2JBJ A;  3TX8 A;  4P4J A;  1M4L A;  4CPA A;  2JDD A;  4K3N A;  2FE7 A;  3CZX A;  3SXN A;  2DPT A;  2GAN A;  2EVN A;  2PJB A;  3FVL A;  4GS4 A;  4UA3 A;  3LOD A;  1OZP A;  5D8N A;  3T9Y A;  1YR0 A;  1S7L A;  4M6I A;  4J3G A;  3FB3 A;  4AXV A;  2V8D A;  3KQX A;  3PB9 X;  5AG4 A;  1VHO A;  4MCQ A;  3D7F A;  1L0C A;  5LYL A;  4OME A;  4E8O A;  3GB0 A;  3PB4 X;  5JGF A;  4PQA A;  4P45 A;  1Z8L A;  3EC4 A;  1FY7 A;  5IB9 A;  1TF9 A;  2BO9 A;  4MCS A;  2EO8 A;  2ZEO A;  3I1U A;  1YGH A;  2Q7S A;  3BXM A;  1YVK A;  2KCW A;  4B14 A;  2YNC C;  1TKH A;  1AMP A;  3BHX A;  1S7K A;  3B8G A;  2NSM A;  3V7Z A;  4C2Z A;  3FNC A;  2ZW4 A;  3GKR A;  4NF1 A;  4Q7A A;  2PC1 A;  4F0Y A;  2Q44 A;  3NE8 A;  4GM5 A;  3S9L A;  3DNS A;  2I3C A;  4KUA A;  4AVA A;  4CAE A;  4ZX8 A;  2VEZ A;  4JZ0 A;  4ZI6 A;  4X5K A;  3PZJ A;  2J8M A;  2FS5 A;  1UWY A;  1YLO A;  3D3S A;  4KS9 A;  4RN7 A;  2VZZ A;  1PU9 A;  3VWE A;  1Q2Y A;  3KR4 A;  4HNW B;  1YK3 A;  1Z8W A;  4NCZ A;  2WUU A;  3S6H A;  4LQG A;  2I79 A;  3ZJ0 A;  4CAX A;  2CNS A;  5EMI A;  1ZLI A;  4KOY A;  1PUA A;  3LMS A;  2QEC A;  2ZEM A;  4Q38 A;  2AFU A;  1TKJ A;  3D7D A;  2PJ8 A;  3GYA A;  1XRY A;  3JUW A;  2OOT A;  2WZN A;  4UEE A;  4MFL A;  3FX6 A;  3KHX A;  1ZG7 A;  2J8N A;  3KL9 A;  1BPM A;  1PYT B;  1CPS A;  4OC0 A;  5C82 A;  5F09 A;  1N71 A;  4KOV A;  2XEF A;  1QSM A;  5JH9 A;  1Z9U A;  2PJ9 A;  5LRG A;  2FVG A;  4M85 A;  3VAR A;  2Z3N A;  4R57 A;  5KTD A;  3R9G A;  5K8M A;  4QC6 A;  4FD5 A;  2XEJ A;  4C7H A;  2ANP A;  4MRI A;  4CGL A;  1XMB A;  3WC7 A;  1CP6 A;  1X12 A;  1PCA A;  2Z10 A;  1XJO A;  3PBB A;  2Q4V A;  4PXE A;  3TE4 A;  5HVF A;  3V8I A;  1Y7R A;  4QVT A;  4RI1 A;  3FBU A;  4YGO A;  4MFQ A;  5F49 A;  5F48 A;  3SJE A;  4UIA A;  1IU8 A;  4OID A;  1B6B A;  4KZT A;  1DTD A;  3B3T A;  4IF5 A;  1DE4 C;  4KVX A;  4MHY A;  4UCM A;  3H5Z A;  3WR7 A;  4PXC A;  5I0C A;  3D67 A;  4MY0 A;  3VH9 A;  4JLY A;  1KZF A;  1Y9K A;  1ZG9 A;  1WK4 A;  4Y49 C;  5CNP A;  5G20 A;  2WPX A;  1S3Z A;  1XEB A;  2OB0 A;  2GRE A;  4DYO A;  4MBU A;  2HQY A;  2DF5 A;  4AG9 A;  1RO5 A;  4HKF A;  2ZEN A;  1I1D A;  3S6F A;  3KGQ A;  4JXR A;  2PVW A;  2HUZ A;  3IWE A;  4B13 A;  4X8I A;  2Z3P A;  5ISV A;  1JQG A;  1P4N A;  1S7N A;  1IOF A;  1Z8T A;  3IWG A;  1Q7L A;  4IHM A;  3T8W A;  3TOA A;  2OR4 A;  3CXS A;  2Z0Z A;  1RTQ A;  1YRE A;  2JBK A;  2AFW A;  2B3U A;  4X3R A;  1XIX A;  4WJB A;  3TC8 A;  3PGP A;  1X10 A;  4UCP A;  2PJ5 A;  3BI1 A;  3BJ8 A;  3CPA A;  2ZOG A;  3HUV A;  4CYQ A;  2FXF A;  3JRU A;  4R87 A;  4RUH A;  5HMN A;  2H5M A;  2FSR A;  3B7I A;  5LRK A;  4OC4 A;  4R3K A;  1ARL A;  3KKW A;  4KLW A;  4A95 A;  4TWE A;  1YLE A;  5DWN A;  3SJF A;  4MFZ A;  2PE3 A;  1ZLH A;  2B4B A;  3GIU A;  1GHE A;  1S60 A;  4OP4 A;  4R7M A;  5LRJ A;  2R8V A;  2R7H A;  2PJC A;  4A30 A;  2OH1 A;  5IX3 A;  3DLJ A;  2V8G A;  4Y49 B;  3FF3 A;  3FRM A;  3FIX A;  4HPS A;  2HB6 A;  2PRB A;  1IY7 A;  2PJ6 A;  4AVC A;  2ZEH A;  4AVB A;  1HDU A;  2GE3 A;  3NH8 A;  4FD7 A;  1M4G A;  4CGP A;  4YFJ A;  2EK8 A;  3KR5 A;  1EE3 P;  4I49 A;  4MI4 A;  4EME A;  2POK A;  4CGN A;  2CTC A;  3D2M A;  3KAS A;  4QBJ A;  5JM6 A;  1VHE A;  4II9 A;  2J9A A;  1QSN A;  3DGV A;  1Y7E A;  2RFH A;  3CDX A;  2O4H A;  2GLJ A;  3KHZ A;  3IJ3 A;  4H89 A;  4X2T A;  3SI0 A;  4NGQ A;  7CPA A;  4R8F A;  2PVV A;  2BSW A;  3TT2 A;  4KUB A;  1Q2D A;  2J8R A;  3PRT A;  3R95 A;  3TO7 A;  2V77 A;  1NSA A;  4B10 A;  4MCP A;  4UFV A;  4CGO A;  4G1P A;  2VXK A;  5I4M A;  3LAC A;  4FUU A;  3W6X A;  1QMU A;  2P6E A;  2PR1 A;  4KOU A;  3TOB A;  4A37 A;  4PK3 A;  4H2K A;  4P4B A;  3CXQ A;  2C27 A;  4UBR A;  3N7Z A;  3SJX A;  3MRU A;  1HEE A;  2DPS A;  4XPL A;  4F9U A;  1IB1 E;  1M44 A;  4IK2 A;  2CNT A;  2PJ0 A;  3IFE A;  4KOW A;  5THW A;  4TNU A;  4JD6 A;  3OWC A;  3RO0 A;  1XOV A;  2Q43 A;  1H8L A;  3B3C A;  4LUA A;  2P6G A;  4DNC A;  5A28 A;  2BUE A;  3QB8 A;  1CX8 A;  4ZYQ A;  2PRQ A;  2GU2 A;  1SQH A;  3BI0 A;  3EFA A;  3PFO A;  4KVM E;  4PXB A;  1S5K A;  2Q7B A;  4OC1 A;  1OBR A;  1CPX A;  4FAI A;  2B5G B;  4B5P B;  2ZEE A;  1CBX A;  2FT0 A;  3B3W A;  3FED A;  1XF8 A;  2ZED A;  4ONU A;  3ZZI A;  3BJ7 A;  3SHP A;  4FBE A;  4KOX A;  3FXT A;  4P44 A;  5AG6 A;  4NGR A;  3I3G A;  2AJ6 A;  2ZXV A;  2P6F A;  3RZA A;  4NGM A;  2AE6 A;  1YW4 A;  2F5I A;  4NFR A;  3NA6 A;  1LAP A;  1XBU A;  2QJ8 A;  5G21 A;  3W6S A;  4FD4 A;  2YNE A;  1YQE A;  2ZW5 A;  4B5P A;  1YSJ A;  1ELM P;  3TTH A;  2GFQ A;  3EXN A;  2VBQ A;  2Q04 A;  1KUY A;  1NE9 A;  4OLL A;  4UFX A;  2G0B A;  2ZEL A;  5AG7 A;  1AYE A;  3WC6 A;  2IJZ A;  4EWT A;  4P4E A;  2B58 A;  2P0W A;  2NMT A;  2WSA A;  5GCN A;  4JXQ A;  4CS0 B;  2B5G A;  3NH5 A;  4PK2 A; 
#chains in the Genus database with same CATH homology
 3I9S A;  2HV2 A;  3SXO A;  1B87 A;  1M1D A;  1YVO A;  2OZH A;  3A9L A;  5HH1 A;  2D4O A;  2FL4 A;  4ORF A;  4MHD A;  1YX0 A;  4KSA A;  1QSR A;  4XPD B;  4HNY B;  2IL4 A;  4QUS A;  2D4P A;  4A33 A;  4CRY B;  4MFJ A;  5E96 A;  3LD2 A;  2OU2 A;  3G8W A;  3TCV A;  1P0H A;  1K4J A;  4NXY A;  3NE7 A;  5DWM A;  1IID A;  3G3S A;  3MGD A;  4AB7 A;  3IU2 A;  4KOT A;  4XNH B;  1IIC A;  4H6U A;  5J8F A;  1MJ9 A;  2ZW7 A;  2PQ8 A;  2FIW A;  4YRH A;  4XPK A;  4NSQ A;  4A32 A;  3DSB A;  2B4D A;  1MJA A;  4H6Z A;  4KLV A;  1WWZ A;  2YNC A;  3BLN A;  2Z3O A;  1NMT A;  3S6K A;  3IU1 A;  3JVN A;  4L89 A;  4BBH A;  4OAE A;  4U9Z A;  3DDD A;  4CAF A;  5IB0 A;  4B11 A;  4LX9 A;  2K5T A;  4FD6 A;  2BL1 A;  2ARH A;  5H86 A;  3F5B A;  3UY5 A;  5A27 A;  2REE A;  4UFW A;  5F47 A;  1R57 A;  1I21 A;  2PR8 A;  2VQY A;  4A31 A;  2X7B A;  3CXP A;  4QB9 A;  4UCN A;  1VKC A;  3R1K A;  2YGW A;  3K9U A;  4PSW A;  4CAW A;  5H84 A;  5KTC A;  2VZY A;  1IYK A;  2ZPA A;  5BWA B;  2Q4Y A;  5FVJ A;  5KTA A;  5JQ4 A;  3P2H A;  1UFH A;  1S7F A;  4F0X A;  4OAD A;  3VWD A;  4CRZ B;  2BEI A;  5G22 A;  3TO6 A;  1NSL A;  2O28 A;  2PSW A;  3C26 A;  4AG7 A;  1IYL A;  5EBV A;  4E0A A;  4KOR A;  2OZU A;  4M3S A;  3TO9 A;  2QML A;  1TIQ A;  1ON0 A;  4Q36 A;  4XPD C;  4E2A A;  1KUV A;  4U9Y A;  1ZO0 A;  4KVO E;  4EVY A;  4CYN A;  2RC4 A;  3TFY A;  1U6M A;  2JEV A;  1XMT A;  1CJW A;  4CYO A;  1BOB A;  4C68 A;  2Z3K A;  4PV6 A;  4MJ8 A;  1I12 A;  2YND A;  4C2Y A;  3QAH A;  4MFP A;  4C7I A;  4XNH C;  2CXA A;  4RS2 A;  5AG5 A;  2REF A;  2JLM A;  3P2F A;  1BO4 A;  2B3V A;  1KUX A;  2R1I A;  2A4N A;  3E0K A;  2Z11 A;  4U5Y A;  1RXT A;  1XE4 A;  2ATR A;  4B5O A;  5IV0 A;  4MY3 A;  3D8P A;  1LRZ A;  2B4D B;  2FIA A;  4IUS A;  3DR8 A;  3F8K A;  1MJB A;  4CGM A;  1VHS A;  2GIV A;  2VI7 A;  3JTK A;  5F46 A;  5JPH A;  3RYO A;  2QIR A;  5AGE A;  4ZBG A;  3S6G A;  4KOS A;  2CNM A;  1QSO A;  1CM0 A;  3EY5 A;  3W91 A;  2Z3M A;  5J8C A;  2ZW6 A;  2CY2 A;  1M4I A;  4JJX A;  4UWJ A;  4ZGY B;  1M4D A;  2JDC A;  2FCK A;  2EUI A;  4C2X A;  3H4Q A;  3R9E A;  4K30 A;  2Y0M A;  2Z3L A;  4KSF A;  2G3A A;  3D2P A;  2PDO A;  4PSX A;  4UWI A;  2DXQ A;  3FYN A;  4HNX B;  2G3T A;  4A2Z A;  4BMH A;  3IGR A;  1QST A;  3PP9 A;  4JWP A;  4B12 A;  2WPW A;  4NEX A;  3DR6 A;  4R3L A;  1Z4R A;  1Z4E A;  4L8A A;  1Q2C A;  2OZG A;  4CAV A;  1Y9W A;  3R9F A;  3R96 A;  1V0C A;  3EO4 A;  3GY9 A;  3T90 A;  2I00 A;  4F6A A;  5EC4 A;  4R9M A;  5C88 A;  4CYP A;  1MK4 A;  1J4J A;  2Q0Y A;  4MFK A;  2R98 A;  3F0A A;  5G1Z A;  2JDD A;  2FE7 A;  3SXN A;  2DPT A;  2GAN A;  2EVN A;  4GS4 A;  4UA3 A;  3LOD A;  1OZP A;  3T9Y A;  1YR0 A;  1S7L A;  4J3G A;  3FB3 A;  5AG4 A;  1L0C A;  4E8O A;  3EC4 A;  1FY7 A;  1YGH A;  1YVK A;  2KCW A;  4B14 A;  2YNC C;  1S7K A;  3B8G A;  4C2Z A;  3FNC A;  2ZW4 A;  3GKR A;  4NF1 A;  4F0Y A;  2PC1 A;  2Q44 A;  3DNS A;  4KUA A;  4AVA A;  4CAE A;  2VEZ A;  4X5K A;  3PZJ A;  2J8M A;  2FS5 A;  4KS9 A;  3D3S A;  2VZZ A;  1PU9 A;  3VWE A;  1Q2Y A;  4HNW B;  1YK3 A;  4NCZ A;  2WUU A;  3S6H A;  2I79 A;  3ZJ0 A;  4CAX A;  2CNS A;  4KOY A;  1PUA A;  4Q38 A;  2QEC A;  3GYA A;  3JUW A;  4MFL A;  2J8N A;  5C82 A;  1N71 A;  4KOV A;  1QSM A;  1Z9U A;  4M85 A;  2Z3N A;  4R57 A;  5KTD A;  3R9G A;  4QC6 A;  4FD5 A;  4C7H A;  4CGL A;  3TE4 A;  2Z10 A;  2Q4V A;  3V8I A;  1Y7R A;  4QVT A;  4RI1 A;  3FBU A;  4YGO A;  4MFQ A;  5F49 A;  5F48 A;  1B6B A;  4KZT A;  4IF5 A;  4KVX A;  4UCM A;  3H5Z A;  3WR7 A;  5I0C A;  4MY0 A;  4JLY A;  1KZF A;  1Y9K A;  4Y49 C;  1WK4 A;  5CNP A;  5G20 A;  2WPX A;  1S3Z A;  1XEB A;  2OB0 A;  4MBU A;  2HQY A;  4AG9 A;  1RO5 A;  4HKF A;  1I1D A;  3S6F A;  4JXR A;  3IWE A;  2HUZ A;  4B13 A;  5ISV A;  2Z3P A;  1P4N A;  1S7N A;  3IWG A;  3TOA A;  3CXS A;  2Z0Z A;  1YRE A;  2B3U A;  1XIX A;  3PGP A;  4UCP A;  3BJ8 A;  4CYQ A;  2FXF A;  4R87 A;  5HMN A;  2H5M A;  2FSR A;  4R3K A;  3KKW A;  4KLW A;  4A95 A;  1YLE A;  5DWN A;  4MFZ A;  2B4B A;  1GHE A;  1S60 A;  2R8V A;  2R7H A;  4A30 A;  2OH1 A;  5IX3 A;  4Y49 B;  3FRM A;  3FIX A;  2PRB A;  4AVC A;  4AVB A;  2GE3 A;  4FD7 A;  1M4G A;  4CGP A;  4YFJ A;  4I49 A;  4MI4 A;  4CGN A;  3D2M A;  4QBJ A;  4II9 A;  1QSN A;  4H89 A;  2BSW A;  3TT2 A;  4KUB A;  1Q2D A;  2J8R A;  3R95 A;  3TO7 A;  4B10 A;  4UFV A;  4CGO A;  2VXK A;  3W6X A;  2P6E A;  4KOU A;  2PR1 A;  3TOB A;  4PK3 A;  3CXQ A;  2C27 A;  4UBR A;  3N7Z A;  2DPS A;  4XPL A;  1IB1 E;  1M44 A;  2CNT A;  4KOW A;  4JD6 A;  3OWC A;  4LUA A;  2P6G A;  4DNC A;  5A28 A;  2BUE A;  3QB8 A;  1SQH A;  3EFA A;  4KVM E;  2Q7B A;  1S5K A;  2B5G B;  4B5P B;  4ONU A;  2FT0 A;  1XF8 A;  3ZZI A;  3BJ7 A;  3SHP A;  4KOX A;  3FXT A;  5AG6 A;  3I3G A;  2AJ6 A;  2ZXV A;  2P6F A;  2AE6 A;  2F5I A;  5G21 A;  3W6S A;  4FD4 A;  2YNE A;  2ZW5 A;  3TTH A;  3EXN A;  2VBQ A;  2Q04 A;  1KUY A;  1NE9 A;  4OLL A;  4UFX A;  2G0B A;  5AG7 A;  2B58 A;  2P0W A;  2NMT A;  2WSA A;  5GCN A;  4JXQ A;  4CS0 B;  2B5G A;  4B5P A;  4PK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...