4KOTA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefotaxime
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 43
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kotA00
2ZW7A 2FIAA 4QC6A 2PSWA 2A4NA 2JLMA 4LX9A 3P2HA 3VWEA 2ZW6A 3G3SA 3EXNA 4JWPA 2X7BA 2ZXVA 2QECA 4AVCA 3F0AA 4PV6A 1S7LA 2BUEA 2B5GA 1UFHA 3I3GA 2J8MA 5C88A 1LRZA 4B5PA 4XPLA 4KVXA 2R8VA 2G3AA 3KKWA 4OAEA 4XNHC 3DDDA 3TOAA 3BJ8A 4L8AA 5CNPA 1YVKA 2B3VA 1OZPA 1XIXA 2OZHA 4CRZB 5EBVA 4KZTA 4UA3A 2EVNA 1YX0A 3VWDA 5F48A 4H6UA 3PZJA 3W6XA 4E0AA 2P0WA 4CAWA 4RI1A 4YGOA 3TO7A 2C27A 2KCWA 4E8OA 3TFYA 1M44A 3P2FA 1BO4A 1Z4EA 4NEXA 3D2PA 3D2MA 1M4DA 4UBRA 2Q4VA 3FNCA 2Z10A 1BOBA 4FD6A 3SHPA 5IX3A 1QSRA 4AVAA 3TTHA 4EVYA 2QMLA 1S7KA 2HQYA 3EY5A 3RYOA 3DR6A 2FSRA 2VQYA 4ORFA 3UY5A 3ZZIA 2FL4A 3TE4A 4GS4A 2FIWA 3ZJ0A 3LD2A 5F47A 1KUYA 1MJAA 2ZW4A 2ARHA 3R95A 4KOWA 5IB0A 2OB0A 4I49A 4AG7A 3DR8A 4E2AA 4YFJA 4KUBA 1S5KA 3CXSA 2WPWA 2GE3A 4KVOE 4UWJA 1NE9A 1NSLA 1N71A 3NE7A 1IIDA 3R1KA 4LUAA 4CRYB 4JD6A 2AE6A 4R87A 4MBUA 1V0CA 2CNTA 4HKFA 4PSWA 3IWGA 3W91A 3BJ7A 3LODA 4KOUA 4L89A 3CXQA 5H86A 2VZYA 4F6AA 2FT0A 3F5BA 3FYNA 2OZGA 3QB8A 3DNSA 3W6SA 4AVBA 3FBUA 3FXTA 5HH1A 4JXQA 2P6EA 3B8GA 2I00A 2OU2A 1L0CA 4CS0B 3S6KA 5F49A 3EO4A 2PC1A 2B5GB 1QSOA 1Q2YA 2OZUA 4MY3A 2Q7BA 1YK3A 4B5PB 1KUXA 4KLWA 4NF1A 2JDCA 3T90A 3R9EA 1YLEA 3G8WA 4PK2A 2Z11A 2Z0ZA 4U9YA 1CM0A 2BL1A 4RS2A 2J8RA 4X5KA 2G0BA 2B58A 3D3SA 3JUWA 2P6FA 1FY7A 1MK4A 4MI4A 5DWMA 2D4PA 5KTDA 4FD5A 2D4OA 2R98A 3CXPA 4IF5A 2CNMA 1MJ9A 1IYKA 1XF8A 3C26A 3R9FA 5IV0A 4UWIA 2R1IA 4MHDA 1QSNA 1Q2CA 3S6FA 4QBJA 2GIVA 2VZZA 3TT2A 1S3ZA 4KOVA 2OH1A 1S7FA 5J8FA 4M3SA 1J4JA 1RO5A 1I12A 1B87A 2BEIA 4XNHB 4KOXA 5I0CA 2RC4A 4KOYA 3D8PA 2BSWA 4XPDB 4ZBGA 4K30A 4PK3A 2HUZA 4OLLA 2DXQA 2H5MA 1I1DA 2B4BA 1ON0A 3PGPA 2FXFA 1Q2DA 1QSTA 1MJBA 2Q04A 1GHEA 2ZW5A 4KVME 5FVJA 2CY2A 1Y7RA 2GANA 2F5IA 1M4GA 2EUIA 1QSMA 1YGHA 3IGRA 2B4DA 4R9MA 5HMNA 1CJWA 1YVOA 4BMHA 1VHSA 3V8IA 5DWNA 4AG9A 4CAXA 4R3LA 3R9GA 2IL4A 2PR1A 4FD7A 4MY0A 1KZFA 2VEZA 2QIRA 5J8CA 1K4JA 2I79A 4DNCA 4CAVA 2Y0MA 2P6GA 4OADA 4J3GA 4KOSA 5GCNA 4Y49B 3FB3A 3JVNA 2VXKA 1P4NA 3TCVA 4II9A 1XMTA 3EC4A 4ONUA 4JXRA 4NXYA 3FRMA 2B3UA 4QUSA 4HNYB 5E96A 1KUVA 4KLVA 5ISVA 3DSBA 1SQHA 1IYLA 3I9SA 1I21A 4U5YA 3OWCA 3R96A 2K5TA 2JDDA 1U6MA 1PU9A 4H89A 4XPKA 4KOTA 3PP9A 4R57A 1B6BA 4QVTA 1YR0A 1NMTA 4HNWB 2FS5A 4XPDC 2AJ6A 2VBQA 3BLNA 3N7ZA 3WR7A 4R3KA 4F0YA 1Y9KA 4H6ZA 2J8NA 5KTAA 2NMTA 2HV2A 1P0HA 2CNSA 2PR8A 3SXNA 3S6GA 2O28A 4KUAA 3SXOA 3K9UA 4U9ZA 1IICA 1YREA 3MGDA 3QAHA 5EC4A 2FE7A 1XE4A 5H84A 3TOBA 2Q44A 3GYAA 4M85A 3GKRA 4JLYA 1Y9WA 5F46A 1M1DA 4YRHA 5JQ4A 2PRBA 1IB1E 3H4QA 3TO9A 3F8KA 2REFA 1XEBA 2REEA 1S7NA 2PDOA 4JJXA 1Z9UA 5JPHA 1WK4A 2B4DB 2G3TA 1PUAA 4MJ8A 4NSQA 3E0KA 1S60A 1M4IA 4Y49C 4HNXB 1R57A 1RXTA 4QB9A 3S6HA 1VKCA 2PQ8A 2ZPAA 2WPXA 2FCKA 2ATRA 3EFAA 4AB7A 4PSXA 2Q4YA 3T9YA 3GY9A 3TO6A 2Q0YA 4NCZA 1WWZA 5KTCA 3FIXA 2R7HA 4B5OA 4IUSA 4KORA 1TIQA 5C82A 1Z4RA 2JEVA 4FD4A 2VI7A
chains in the Genus database with same CATH superfamily
2PJAA 2ZW7A 2FIAA 4QC6A 2PSWA 4UIAA 3GUXA 1DTDA 3A9LA 2A4NA 1CP7A 3SJEA 2WZNA 2JLMA 1YSJA 2Z3PA 4LX9A 3P2HA 2ZEHA 3NH4A 3PBBA 5IB9A 3VWEA 3PB8X 2ZW6A 3G3SA 1Z8XA 2YNEA 3EXNA 1QQ9A 3L2NA 2X7BA 4JWPA 4OC1A 2ZXVA 2QECA 4AVCA 3F0AA 3QAYA 3B3SA 4PV6A 3SI1A 3T8WA 1S7LA 1XBUA 2BUEA 4M6IA 2PJBA 2B5GA 1TKHA 5LRGA 2ODFA 1CBXA 1UFHA 3I3GA 1HDQA 2GLFA 5A28A 2J8MA 5C88A 1LRZA 2Q4ZA 4B5PA 4XPLA 4KVXA 2R8VA 2G3AA 1YW6A 4NJRA 3KKWA 4OAEA 4M6HA 4MCPA 4XNHC 2AFZA 3PB7X 4NFRA 2CF4A 3DDDA 4C7IA 3TOAA 1IOIA 1TF8A 2YNDA 2V8VA 2ZEPA 3BJ8A 4L8AA 5CNPA 1YVKA 3FJUA 1JQGA 1F2OA 4P4IA 3PB6X 4UFXA 2DPSA 2B3VA 5K8OA 3D7DA 1OZPA 1XIXA 2OZHA 3H8EA 3WC5A 1VIXA 1Z5RA 2QYVA 2Z3LA 2PJCA 2POKA 5EBVA 4KZTA 4UA3A 2EVNA 2ZEDA 4CRZB 1YX0A 3VWDA 5F48A 4H6UA 3PZJA 3W6XA 4E0AA 2P0WA 4CAWA 4PPZA 4RI1A 1IGBA 2PJ2A 3BHXA 4YGOA 3TO7A 3RO0A 2C27A 2KCWA 4E8OA 3TFYA 3VATA 2O53A 1LFWA 1M44A 3P2FA 5HVHA 4DYOA 1BO4A 3BI1A 2BCOA 1Z4EA 4NEXA 3D2PA 3FH4A 3S9LA 4IHMA 5G20A 5G1ZA 2RFHA 3CT9A 1CP6A 1M4LA 3D2MA 1M4DA 3K9TA 4UBRA 2Q4VA 3FNCA 3H8GA 2Z10A 4OC0A 5K8MA 1BOBA 4R6TA 4FD6A 1ZO0A 3SHPA 5IX3A 2F8HA 4TWEA 1QSRA 4AVAA 3TTHA 4EVYA 2EK9A 2QMLA 1TKFA 1S7KA 2C1CA 2G9DA 4P6YA 2HQYA 3EY5A 3RYOA 3KQXA 5JH9A 4P10A 3DR6A 4A2ZA 1AUGA 2PVWA 3PB4X 3D66A 2FSRA 2VQYA 4UCPA 3ISZA 4ORFA 2C6PA 3UY5A 3ZZIA 2FL4A 3TE4A 3IWEA 4GS4A 1KWMA 2FIWA 3ZJ0A 3LD2A 5F47A 2Q51A 4OC2A 5I4MA 1KUYA 1MJAA 2ZW4A 2FVGA 4MCSA 4UEFA 2ARHA 3R95A 4KOWA 4CGPA 2YNCC 4F9UA 5IB0A 4IAVA 4P45A 1ARLA 2OB0A 4I49A 3GIUA 4AG7A 4ZY0A 1EE3P 2WUUA 4PXBA 3DR8A 4E2AA 1F57A 4PQAA 5CPAA 4YFJA 4KUBA 1S5KA 2Z3NA 3CXSA 4X8IA 2WPWA 2ZEEA 4HPSA 4WWVA 3BXMA 2GE3A 4KVOE 4UWJA 1NE9A 1NSLA 4DJLA 1BLLE 5HVFA 1N71A 3NE7A 4EWTA 1IIDA 3R1KA 1YW4A 4LUAA 4CRYB 4JD6A 2AE6A 3N5FA 4MBUA 4OC4A 4R87A 5D29A 1V0CA 2AFXA 1Z2LA 2CNTA 4B13A 3D7HA 2PRQA 4HKFA 4PSWA 5AG5A 3IWGA 5K8PA 5LYDA 3QNVA 3W91A 1ZLHA 4WJBA 3BJ7A 3LODA 4CAEA 4R7MA 2WSAA 1R43A 4KOUA 4L89A 4MFLA 4CYQA 5JGFA 2C6CA 3KZWA 5G21A 3CXQA 5H86A 2VZYA 3S9MA 2AFSA 4F6AA 2FT0A 4OMEA 4UFVA 2PVVA 2YNCA 3F5BA 3FYNA 2OZGA 3QB8A 3DNSA 4MCQA 3W6SA 4AVBA 3PRTA 3FBUA 3FXTA 2VL1A 5HH1A 2F7VA 2ZEGA 1X12A 2GREA 4NGQA 4JXQA 5AG7A 3WC7A 2PIYA 2P6EA 3ISXA 3PB9X 2PJ6A 3B8GA 2I00A 2OU2A 1FNOA 4A38A 1L0CA 1XMBA 2Z3MA 4CS0B 1X10A 1F2PA 2PJ1A 1LAMA 4CYPA 3B7IA 3LACA 3FMCA 2V8GA 3KR4A 3S6KA 5F49A 4BBHA 2PJ8A 3EO4A 2OOTA 2PC1A 3D68A 4A39A 3BI0A 3NA6A 3B3TA 2B5GB 1TXRA 3NE8A 1QSOA 1Q2YA 2OZUA 5A27A 4MY3A 2Q7BA 1ZG8A 1YK3A 3WC6A 3NH8A 4B5PB 1KUXA 4MRIA 1CPSA 1UWYA 1JWQA 3NFZA 4KLWA 4NF1A 2JDCA 1CPXA 2PJ3A 3T90A 3R9EA 1BPMA 2Q7SA 1YLEA 3G8WA 4NGRA 4MHNA 4CAFA 4UIBA 5D8NA 4PK2A 2Z11A 2AFUA 2Z0ZA 3WABA 3KI9A 4MFZA 4U9YA 4A32A 1CM0A 2BL1A 1ELMP 1XRYA 2J8RA 4JZ0A 4RS2A 2G0BA 4X5KA 2B58A 3D3SA 3JUWA 2P6FA 1FY7A 3SJXA 1MK4A 4MI4A 5DWMA 2D4PA 5KTDA 4FD5A 2D4OA 3B3VA 2R98A 3CXPA 3H8FA 2V8HA 3KQZA 2CNMA 1MJ9A 1IYKA 1Y0YA 4IF5A 4MHYA 1XF8A 4NGPA 1GYTA 4A30A 3C26A 2EO8A 3R9FA 5IV0A 5LYIA 3FVLA 4UWIA 3D7GA 2R1IA 4A31A 1Y0RA 4MHDA 1QSNA 1Q2CA 3S6FA 4QBJA 2GIVA 2J9AA 4OC5A 2XEIA 2VZZA 3TT2A 1S3ZA 4KOVA 2EK8A 3FX6A 2OH1A 1S7FA 5J8FA 3LWUA 4ZX9A 4M3SA 1J4JA 1RO5A 3D67A 4O23A 1I12A 2HB6A 1B87A 2BEIA 4XNHB 4NGNA 4FAIA 1ZG7A 2EBJA 4KOXA 1ARMA 5I0CA 2RC4A 4KOYA 2BSWA 3D8PA 4IK2A 4XPDB 4ZGYB 4ZBGA 4K30A 1R3NA 4PK3A 2PJ7A 3IJ3A 1ZLIA 4PXEA 4CGLA 4CGMA 1PYTB 2HUZA 4OLLA 4C7HA 2DXQA 2H5MA 3CDXA 1QMUA 4ZX8A 4LQGA 2DPTA 1LANA 2O4HA 3V7ZA 5K8NA 4OKOA 3HUVA 1I1DA 2B4BA 1ON0A 3PGPA 2FXFA 3IEHA 1Q2DA 1VHOA 1QSTA 4MCRA 1MJBA 2Q04A 2RB7A 1GHEA 3SI0A 5LYLA 4Z65A 4UCMA 2PJ4A 2ANPA 2ZW5A 4KVME 5LRJA 5FVJA 3SJFA 4EMEA 2CY2A 4FUUA 3JRUA 4OIDA 1Y7RA 2GANA 2PJ0A 1TKJA 1M4GA 2F5IA 2EUIA 4B10A 1OBRA 1QSMA 1XJOA 1YGHA 3IC1A 3IGRA 4X3RA 2B4DA 3TC8A 4CYOA 4R9MA 5HMNA 4H2KA 1CJWA 2I3CA 1YVOA 4BMHA 1VHSA 3RBUA 3V8IA 4GXHA 4K3NA 2JEWA 5DWNA 4AG9A 2CTBA 4UEZA 3RAMA 3K2KA 1Y7EA 4P4DA 4CPAA 2C6GA 2CTCA 4CAXA 4R3LA 3R9GA 2IL4A 2PR1A 4NGTA 4FD7A 4MY0A 4P4JA 1KZFA 2VEZA 3WT4A 2QIRA 5J8CA 4ZI6A 1AYEA 3PFEA 1K4JA 3KL9A 2I79A 4NGSA 4OIWA 2JBJA 4DNCA 4C2ZA 2CIJA 4CAVA 4UFWA 2Y0MA 5BWAB 2ABZA 2P6GA 1CX8A 2PIZA 3B3CA 4OADA 1RTQA 2PJ5A 3DGVA 3H5ZA 5CBMA 4J3GA 2EWBA 1LAPA 4KOSA 5GCNA 4Y49B 2AFOA 5F09A 4NGMA 4LQ6A 1TF9A 3FB3A 4Q36A 2GU2A 3DLJA 3JVNA 4X2TA 3MRUA 4P4EA 2VXKA 3PEIA 1P4NA 3GB0A 1Z8LA 2XEFA 3TCVA 1BPNA 2PE3A 1IU8A 1XMTA 3EC4A 3IIBA 2Z3OA 3HLPA 4JXRA 4ONUA 4R76A 4II9A 5AG6A 4NXYA 3FRMA 2B3UA 4QUSA 5LYFA 4HNYB 3B35A 1CG2A 2GLJA 3NH5A 4UF4A 3FF3A 2JBKA 5E96A 1KUVA 3IO1A 4KLVA 4MFJA 4MXUA 5ISVA 2ZOGA 3DSBA 4UEEA 2HC9A 3CPXA 3TX8A 4OP4A 1SQHA 4P4FA 3KGQA 4YU9A 1IYLA 3PFOA 3FEEA 3I9SA 1I21A 5AG4A 6CPAA 4U5YA 3OWCA 3R96A 2K5TA 2ZOFA 1HDUA 4GM5A 2JDDA 1H8LA 2BOAA 4FWUA 4P44A 3V38A 2QJ8A 1LOKA 4A94A 4EFDA 1U6MA 3KHZA 1PU9A 4H89A 4C68A 1IY7A 2ZEFA 4XPKA 4KOTA 3PP9A 4R57A 1B6BA 4QVTA 1YR0A 1NMTA 4FBEA 4HNWB 2WYRA 4KSFA 3CPAA 3S9NA 4F8ZA 2FS5A 4XPDC 1A2ZA 2AFWA 2AJ6A 5LRKA 4TNUA 1FT7A 3VARA 2VBQA 2PCUA 2ZELA 3FEDA 3BLNA 3N7ZA 3WR7A 2V77A 2XEGA 4R3KA 3IFEA 4F0YA 4A33A 3B2YA 1Y9KA 4ONWA 4H6ZA 1XOVA 2J8NA 1VGYA 4KS9A 4MHZA 5KTAA 4MFPA 3FECA 2ZENA 3RNZA 2NMTA 5HVGA 2HV2A 1P0HA 2CNSA 2PR8A 3SXNA 4YWYA 2Q43A 4Q38A 4G1PA 3S6GA 2AFMA 3IU2A 2O28A 4RN7A 1ZG9A 3LMSA 4KUAA 4F9VA 2PJ9A 3RZAA 3SXOA 3K9UA 4ZYQA 4U9ZA 5J1QA 4CGNA 1VHEA 2OR4A 1IICA 1YREA 3MGDA 3QAHA 5EC4A 1HEEA 2FE7A 3PBEA 1XE4A 4C2YA 4PXCA 4CYNA 1ELLP 5H84A 3TOBA 2Q44A 3JTKA 2IMOA 1DE4C 2NSMA 3GYAA 3MN8A 2ZEOA 4M85A 2V8DA 3GKRA 1NSAA 2BO9A 2YGWA 2IJZA 4JLYA 1Y9WA 1Z8TA 5ELYA 4RUHA 5F46A 5AGEA 1M1DA 4YRHA 5JQ4A 2PRBA 1IB1E 3H4QA 3TO9A 3F8KA 2REFA 4MFQA 3CZXA 4R8FA 1LCPA 1XEBA 2NYQA 2REEA 1S7NA 3VH9A 4W9YA 4AXVA 3KR5A 4B11A 3D7FA 4ZY1A 2XEJA 4MHPA 7CPAA 1BAVA 2PDOA 2CXAA 3KASA 3KHXA 4JJXA 1IOFA 2GFQA 1Z9UA 1XFOA 2IQ6A 5JPHA 1WK4A 1YLOA 2B4DB 2G3TA 1PUAA 4Q7AA 5THWA 4MJ8A 4NSQA 3E0KA 1S60A 1Z8WA 1M4IA 4Y49C 4HNXB 1R57A 4B12A 1RXTA 3IU1A 4KSIA 4MMOA 4QB9A 2Z3KA 4KSAA 4DUKA 2DF5A 3S6HA 1VKCA 2PQ8A 2ZPAA 1AMPA 2WPXA 3D4UA 3I1UA 4F0XA 2FCKA 2ATRA 3EFAA 3IWWA 4B6ZA 3SI2A 4AB7A 4B14A 4PSXA 5G22A 2Q4YA 4CGOA 4PXDA 3T9YA 4P4BA 4C2XA 4ZY2A 3GY9A 3TO6A 4JYWA 2Q0YA 4NCZA 3SJGA 5DS0A 1WWZA 4BINA 3B3WA 3GLJA 4A37A 1PCAA 4M6GA 4UCNA 5HXDA 4OC3A 5EMIA 5KTCA 3FIXA 4BD9A 2DEAA 4A95A 2QVPA 2R7HA 4B5OA 4IUSA 4KORA 1TIQA 4NJQA 4MFKA 5JM6A 1YQEA 5C82A 8CPAA 1Q7LA 1Z4RA 1YMEA 2JEVA 4FD4A 2ZEMA 2VI7A
chains in the Genus database with same CATH topology
2ZW7A 2FIAA 4QC6A 2PSWA 3A9LA 2A4NA 2JLMA 2Z3PA 4LX9A 3P2HA 3VWEA 2ZW6A 3G3SA 2YNEA 3EXNA 4JWPA 2X7BA 2ZXVA 2QECA 4AVCA 3F0AA 4PV6A 1S7LA 2BUEA 2B5GA 1UFHA 3I3GA 5A28A 2J8MA 5C88A 1LRZA 4B5PA 4XPLA 4KVXA 2R8VA 2G3AA 3KKWA 4OAEA 4XNHC 3DDDA 4C7IA 3TOAA 2YNDA 3BJ8A 4L8AA 5CNPA 1YVKA 4UFXA 2DPSA 2B3VA 1OZPA 1XIXA 2OZHA 2Z3LA 5EBVA 4CRZB 4KZTA 4UA3A 2EVNA 1YX0A 3VWDA 5F48A 4H6UA 3PZJA 3W6XA 4E0AA 2P0WA 4CAWA 4RI1A 4YGOA 3TO7A 2C27A 2KCWA 4E8OA 3TFYA 1M44A 3P2FA 1BO4A 1Z4EA 4NEXA 3D2PA 5G20A 5G1ZA 3D2MA 1M4DA 4UBRA 2Q4VA 3FNCA 2Z10A 1BOBA 4FD6A 1ZO0A 3SHPA 5IX3A 1QSRA 4AVAA 3TTHA 4EVYA 2QMLA 1S7KA 2HQYA 3EY5A 3RYOA 3DR6A 4A2ZA 2FSRA 2VQYA 4UCPA 4ORFA 3UY5A 3ZZIA 2FL4A 3TE4A 3IWEA 4GS4A 2FIWA 3ZJ0A 3LD2A 5F47A 1KUYA 1MJAA 2ZW4A 2ARHA 3R95A 4KOWA 4CGPA 2YNCC 5IB0A 2OB0A 4I49A 4AG7A 2WUUA 3DR8A 4E2AA 4YFJA 4KUBA 1S5KA 2Z3NA 3CXSA 2WPWA 2GE3A 4KVOE 4UWJA 1NE9A 1NSLA 1N71A 3NE7A 1IIDA 3R1KA 4LUAA 4CRYB 4JD6A 2AE6A 4R87A 4MBUA 1V0CA 2CNTA 4B13A 4HKFA 4PSWA 5AG5A 3IWGA 3W91A 3BJ7A 3LODA 4CAEA 2WSAA 4KOUA 4L89A 4MFLA 4CYQA 5G21A 3CXQA 5H86A 2VZYA 4F6AA 2FT0A 4UFVA 3F5BA 2YNCA 3FYNA 2OZGA 3QB8A 3DNSA 3W6SA 4AVBA 3FBUA 3FXTA 5HH1A 4JXQA 5AG7A 2P6EA 3B8GA 2I00A 2OU2A 1L0CA 2Z3MA 4CS0B 4CYPA 3S6KA 5F49A 4BBHA 3EO4A 2PC1A 2B5GB 1QSOA 1Q2YA 2OZUA 5A27A 4MY3A 2Q7BA 1YK3A 4B5PB 1KUXA 4KLWA 4NF1A 2JDCA 3T90A 3R9EA 1YLEA 3G8WA 4CAFA 4PK2A 2Z11A 2Z0ZA 4MFZA 4U9YA 4A32A 1CM0A 2BL1A 4RS2A 2J8RA 4X5KA 2G0BA 2B58A 3JUWA 3D3SA 2P6FA 1FY7A 1MK4A 4MI4A 5DWMA 2D4PA 5KTDA 4FD5A 2D4OA 2R98A 3CXPA 4IF5A 2CNMA 1MJ9A 1IYKA 1XF8A 4A30A 3C26A 3R9FA 5IV0A 4UWIA 2R1IA 4A31A 4MHDA 1QSNA 1Q2CA 3S6FA 4QBJA 2GIVA 2VZZA 3TT2A 1S3ZA 4KOVA 2OH1A 1S7FA 5J8FA 4M3SA 1J4JA 1RO5A 1I12A 1B87A 2BEIA 4XNHB 4KOXA 5I0CA 2RC4A 4KOYA 3D8PA 2BSWA 4XPDB 4ZGYB 4ZBGA 4K30A 4PK3A 4CGLA 4CGMA 2HUZA 4OLLA 4C7HA 2DXQA 2H5MA 2DPTA 1I1DA 2B4BA 1ON0A 3PGPA 2FXFA 1Q2DA 1QSTA 1MJBA 2Q04A 1GHEA 4UCMA 2ZW5A 4KVME 5FVJA 2CY2A 1Y7RA 2GANA 2F5IA 1M4GA 4B10A 2EUIA 1QSMA 1YGHA 3IGRA 4CYOA 2B4DA 4R9MA 5HMNA 1CJWA 1YVOA 4BMHA 1VHSA 3V8IA 5DWNA 4AG9A 4CAXA 4R3LA 3R9GA 2IL4A 2PR1A 4FD7A 4MY0A 1KZFA 2VEZA 2QIRA 5J8CA 1K4JA 2I79A 4DNCA 4C2ZA 4CAVA 4UFWA 2Y0MA 5BWAB 2P6GA 4OADA 3H5ZA 4J3GA 4KOSA 5GCNA 4Y49B 3FB3A 4Q36A 3JVNA 2VXKA 1P4NA 3TCVA 4II9A 1XMTA 3EC4A 4ONUA 2Z3OA 4JXRA 5AG6A 4NXYA 3FRMA 2B3UA 4QUSA 4HNYB 5E96A 1KUVA 4KLVA 4MFJA 5ISVA 3DSBA 1SQHA 1IYLA 3I9SA 1I21A 5AG4A 4U5YA 3OWCA 3R96A 2K5TA 2JDDA 1U6MA 1PU9A 4H89A 4C68A 4XPKA 4KOTA 3PP9A 4R57A 1B6BA 4QVTA 1YR0A 1NMTA 4HNWB 4KSFA 2FS5A 4XPDC 2AJ6A 2VBQA 3BLNA 3N7ZA 3WR7A 4R3KA 4F0YA 4A33A 1Y9KA 4H6ZA 2J8NA 4KS9A 5KTAA 4MFPA 2NMTA 2HV2A 1P0HA 2CNSA 2PR8A 3SXNA 4Q38A 3S6GA 3IU2A 2O28A 4KUAA 3SXOA 3K9UA 4U9ZA 4CGNA 1IICA 1YREA 3MGDA 3QAHA 5EC4A 2FE7A 4CYNA 1XE4A 4C2YA 5H84A 3TOBA 2Q44A 3JTKA 3GYAA 4M85A 3GKRA 2YGWA 4JLYA 1Y9WA 5F46A 5AGEA 1M1DA 4YRHA 5JQ4A 2PRBA 1IB1E 3H4QA 3TO9A 3F8KA 2REFA 4MFQA 1XEBA 2REEA 1S7NA 4B11A 2PDOA 2CXAA 4JJXA 1Z9UA 5JPHA 1WK4A 2B4DB 2G3TA 1PUAA 4MJ8A 4NSQA 3E0KA 1S60A 1M4IA 4Y49C 4HNXB 1R57A 4B12A 1RXTA 3IU1A 4QB9A 2Z3KA 4KSAA 3S6HA 1VKCA 2PQ8A 2ZPAA 2WPXA 4F0XA 2FCKA 2ATRA 3EFAA 4AB7A 4B14A 4PSXA 5G22A 2Q4YA 4CGOA 3T9YA 4C2XA 3GY9A 3TO6A 2Q0YA 4NCZA 1WWZA 4UCNA 5KTCA 3FIXA 4A95A 2R7HA 4B5OA 4IUSA 4KORA 1TIQA 4MFKA 5C82A 1Z4RA 2JEVA 4FD4A 2VI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW7 A;  2FIA A;  4QC6 A;  2PSW A;  2A4N A;  2JLM A;  4LX9 A;  3P2H A;  3VWE A;  2ZW6 A;  3G3S A;  3EXN A;  4JWP A;  2X7B A;  2ZXV A;  2QEC A;  4AVC A;  3F0A A;  4PV6 A;  1S7L A;  2BUE A;  2B5G A;  1UFH A;  3I3G A;  2J8M A;  5C88 A;  1LRZ A;  4B5P A;  4XPL A;  4KVX A;  2R8V A;  2G3A A;  3KKW A;  4OAE A;  4XNH C;  3DDD A;  3TOA A;  3BJ8 A;  4L8A A;  5CNP A;  1YVK A;  2B3V A;  1OZP A;  1XIX A;  2OZH A;  4CRZ B;  5EBV A;  4KZT A;  4UA3 A;  2EVN A;  1YX0 A;  3VWD A;  5F48 A;  4H6U A;  3PZJ A;  3W6X A;  4E0A A;  2P0W A;  4CAW A;  4RI1 A;  4YGO A;  3TO7 A;  2C27 A;  2KCW A;  4E8O A;  3TFY A;  1M44 A;  3P2F A;  1BO4 A;  1Z4E A;  4NEX A;  3D2P A;  3D2M A;  1M4D A;  4UBR A;  2Q4V A;  3FNC A;  2Z10 A;  1BOB A;  4FD6 A;  3SHP A;  5IX3 A;  1QSR A;  4AVA A;  3TTH A;  4EVY A;  2QML A;  1S7K A;  2HQY A;  3EY5 A;  3RYO A;  3DR6 A;  2FSR A;  2VQY A;  4ORF A;  3UY5 A;  3ZZI A;  2FL4 A;  3TE4 A;  4GS4 A;  2FIW A;  3ZJ0 A;  3LD2 A;  5F47 A;  1KUY A;  1MJA A;  2ZW4 A;  2ARH A;  3R95 A;  4KOW A;  5IB0 A;  2OB0 A;  4I49 A;  4AG7 A;  3DR8 A;  4E2A A;  4YFJ A;  4KUB A;  1S5K A;  3CXS A;  2WPW A;  2GE3 A;  4KVO E;  4UWJ A;  1NE9 A;  1NSL A;  1N71 A;  3NE7 A;  1IID A;  3R1K A;  4LUA A;  4CRY B;  4JD6 A;  2AE6 A;  4R87 A;  4MBU A;  1V0C A;  2CNT A;  4HKF A;  4PSW A;  3IWG A;  3W91 A;  3BJ7 A;  3LOD A;  4KOU A;  4L89 A;  3CXQ A;  5H86 A;  2VZY A;  4F6A A;  2FT0 A;  3F5B A;  3FYN A;  2OZG A;  3QB8 A;  3DNS A;  3W6S A;  4AVB A;  3FBU A;  3FXT A;  5HH1 A;  4JXQ A;  2P6E A;  3B8G A;  2I00 A;  2OU2 A;  1L0C A;  4CS0 B;  3S6K A;  5F49 A;  3EO4 A;  2PC1 A;  2B5G B;  1QSO A;  1Q2Y A;  2OZU A;  4MY3 A;  2Q7B A;  1YK3 A;  4B5P B;  1KUX A;  4KLW A;  4NF1 A;  2JDC A;  3T90 A;  3R9E A;  1YLE A;  3G8W A;  4PK2 A;  2Z11 A;  2Z0Z A;  4U9Y A;  1CM0 A;  2BL1 A;  4RS2 A;  2J8R A;  4X5K A;  2G0B A;  2B58 A;  3D3S A;  3JUW A;  2P6F A;  1FY7 A;  1MK4 A;  4MI4 A;  5DWM A;  2D4P A;  5KTD A;  4FD5 A;  2D4O A;  2R98 A;  3CXP A;  4IF5 A;  2CNM A;  1MJ9 A;  1IYK A;  1XF8 A;  3C26 A;  3R9F A;  5IV0 A;  4UWI A;  2R1I A;  4MHD A;  1QSN A;  1Q2C A;  3S6F A;  4QBJ A;  2GIV A;  2VZZ A;  3TT2 A;  1S3Z A;  4KOV A;  2OH1 A;  1S7F A;  5J8F A;  4M3S A;  1J4J A;  1RO5 A;  1I12 A;  1B87 A;  2BEI A;  4XNH B;  4KOX A;  5I0C A;  2RC4 A;  4KOY A;  3D8P A;  2BSW A;  4XPD B;  4ZBG A;  4K30 A;  4PK3 A;  2HUZ A;  4OLL A;  2DXQ A;  2H5M A;  1I1D A;  2B4B A;  1ON0 A;  3PGP A;  2FXF A;  1Q2D A;  1QST A;  1MJB A;  2Q04 A;  1GHE A;  2ZW5 A;  4KVM E;  5FVJ A;  2CY2 A;  1Y7R A;  2GAN A;  2F5I A;  1M4G A;  2EUI A;  1QSM A;  1YGH A;  3IGR A;  2B4D A;  4R9M A;  5HMN A;  1CJW A;  1YVO A;  4BMH A;  1VHS A;  3V8I A;  5DWN A;  4AG9 A;  4CAX A;  4R3L A;  3R9G A;  2IL4 A;  2PR1 A;  4FD7 A;  4MY0 A;  1KZF A;  2VEZ A;  2QIR A;  5J8C A;  1K4J A;  2I79 A;  4DNC A;  4CAV A;  2Y0M A;  2P6G A;  4OAD A;  4J3G A;  4KOS A;  5GCN A;  4Y49 B;  3FB3 A;  3JVN A;  2VXK A;  1P4N A;  3TCV A;  4II9 A;  1XMT A;  3EC4 A;  4ONU A;  4JXR A;  4NXY A;  3FRM A;  2B3U A;  4QUS A;  4HNY B;  5E96 A;  1KUV A;  4KLV A;  5ISV A;  3DSB A;  1SQH A;  1IYL A;  3I9S A;  1I21 A;  4U5Y A;  3OWC A;  3R96 A;  2K5T A;  2JDD A;  1U6M A;  1PU9 A;  4H89 A;  4XPK A;  4KOT A;  3PP9 A;  4R57 A;  1B6B A;  4QVT A;  1YR0 A;  1NMT A;  4HNW B;  2FS5 A;  4XPD C;  2AJ6 A;  2VBQ A;  3BLN A;  3N7Z A;  3WR7 A;  4R3K A;  4F0Y A;  1Y9K A;  4H6Z A;  2J8N A;  5KTA A;  2NMT A;  2HV2 A;  1P0H A;  2CNS A;  2PR8 A;  3SXN A;  3S6G A;  2O28 A;  4KUA A;  3SXO A;  3K9U A;  4U9Z A;  1IIC A;  1YRE A;  3MGD A;  3QAH A;  5EC4 A;  2FE7 A;  1XE4 A;  5H84 A;  3TOB A;  2Q44 A;  3GYA A;  4M85 A;  3GKR A;  4JLY A;  1Y9W A;  5F46 A;  1M1D A;  4YRH A;  5JQ4 A;  2PRB A;  1IB1 E;  3H4Q A;  3TO9 A;  3F8K A;  2REF A;  1XEB A;  2REE A;  1S7N A;  2PDO A;  4JJX A;  1Z9U A;  5JPH A;  1WK4 A;  2B4D B;  2G3T A;  1PUA A;  4MJ8 A;  4NSQ A;  3E0K A;  1S60 A;  1M4I A;  4Y49 C;  4HNX B;  1R57 A;  1RXT A;  4QB9 A;  3S6H A;  1VKC A;  2PQ8 A;  2ZPA A;  2WPX A;  2FCK A;  2ATR A;  3EFA A;  4AB7 A;  4PSX A;  2Q4Y A;  3T9Y A;  3GY9 A;  3TO6 A;  2Q0Y A;  4NCZ A;  1WWZ A;  5KTC A;  3FIX A;  2R7H A;  4B5O A;  4IUS A;  4KOR A;  1TIQ A;  5C82 A;  1Z4R A;  2JEV A;  4FD4 A;  2VI7 A; 
#chains in the Genus database with same CATH topology
 2PJA A;  2ZW7 A;  2FIA A;  4QC6 A;  2PSW A;  4UIA A;  3GUX A;  1DTD A;  3A9L A;  2A4N A;  1CP7 A;  3SJE A;  2WZN A;  2JLM A;  1YSJ A;  2Z3P A;  4LX9 A;  3P2H A;  2ZEH A;  3NH4 A;  3PBB A;  5IB9 A;  3VWE A;  3PB8 X;  2ZW6 A;  3G3S A;  1Z8X A;  2YNE A;  3EXN A;  1QQ9 A;  3L2N A;  2X7B A;  4JWP A;  4OC1 A;  2ZXV A;  2QEC A;  4AVC A;  3F0A A;  3QAY A;  3B3S A;  4PV6 A;  3SI1 A;  3T8W A;  1S7L A;  1XBU A;  2BUE A;  4M6I A;  2PJB A;  2B5G A;  1TKH A;  5LRG A;  2ODF A;  1CBX A;  1UFH A;  3I3G A;  1HDQ A;  2GLF A;  5A28 A;  2J8M A;  5C88 A;  1LRZ A;  2Q4Z A;  4B5P A;  4XPL A;  4KVX A;  2R8V A;  2G3A A;  1YW6 A;  4NJR A;  3KKW A;  4OAE A;  4M6H A;  4MCP A;  4XNH C;  2AFZ A;  3PB7 X;  4NFR A;  2CF4 A;  3DDD A;  4C7I A;  3TOA A;  1IOI A;  1TF8 A;  2YND A;  2V8V A;  2ZEP A;  3BJ8 A;  4L8A A;  5CNP A;  1YVK A;  3FJU A;  1JQG A;  1F2O A;  4P4I A;  3PB6 X;  4UFX A;  2DPS A;  2B3V A;  5K8O A;  3D7D A;  1OZP A;  1XIX A;  2OZH A;  3H8E A;  3WC5 A;  1VIX A;  1Z5R A;  2QYV A;  2Z3L A;  2PJC A;  2POK A;  5EBV A;  4KZT A;  4UA3 A;  2EVN A;  2ZED A;  4CRZ B;  1YX0 A;  3VWD A;  5F48 A;  4H6U A;  3PZJ A;  3W6X A;  4E0A A;  2P0W A;  4CAW A;  4PPZ A;  4RI1 A;  1IGB A;  2PJ2 A;  3BHX A;  4YGO A;  3TO7 A;  3RO0 A;  2C27 A;  2KCW A;  4E8O A;  3TFY A;  3VAT A;  2O53 A;  1LFW A;  1M44 A;  3P2F A;  5HVH A;  4DYO A;  1BO4 A;  3BI1 A;  2BCO A;  1Z4E A;  4NEX A;  3D2P A;  3FH4 A;  3S9L A;  4IHM A;  5G20 A;  5G1Z A;  2RFH A;  3CT9 A;  1CP6 A;  1M4L A;  3D2M A;  1M4D A;  3K9T A;  4UBR A;  2Q4V A;  3FNC A;  3H8G A;  2Z10 A;  4OC0 A;  5K8M A;  1BOB A;  4R6T A;  4FD6 A;  1ZO0 A;  3SHP A;  5IX3 A;  2F8H A;  4TWE A;  1QSR A;  4AVA A;  3TTH A;  4EVY A;  2EK9 A;  2QML A;  1TKF A;  1S7K A;  2C1C A;  2G9D A;  4P6Y A;  2HQY A;  3EY5 A;  3RYO A;  3KQX A;  5JH9 A;  4P10 A;  3DR6 A;  4A2Z A;  1AUG A;  2PVW A;  3PB4 X;  3D66 A;  2FSR A;  2VQY A;  4UCP A;  3ISZ A;  4ORF A;  2C6P A;  3UY5 A;  3ZZI A;  2FL4 A;  3TE4 A;  3IWE A;  4GS4 A;  1KWM A;  2FIW A;  3ZJ0 A;  3LD2 A;  5F47 A;  2Q51 A;  4OC2 A;  5I4M A;  1KUY A;  1MJA A;  2ZW4 A;  2FVG A;  4MCS A;  4UEF A;  2ARH A;  3R95 A;  4KOW A;  4CGP A;  2YNC C;  4F9U A;  5IB0 A;  4IAV A;  4P45 A;  1ARL A;  2OB0 A;  4I49 A;  3GIU A;  4AG7 A;  4ZY0 A;  1EE3 P;  2WUU A;  4PXB A;  3DR8 A;  4E2A A;  1F57 A;  4PQA A;  5CPA A;  4YFJ A;  4KUB A;  1S5K A;  2Z3N A;  3CXS A;  4X8I A;  2WPW A;  2ZEE A;  4HPS A;  4WWV A;  3BXM A;  2GE3 A;  4KVO E;  4UWJ A;  1NE9 A;  1NSL A;  4DJL A;  1BLL E;  5HVF A;  1N71 A;  3NE7 A;  4EWT A;  1IID A;  3R1K A;  1YW4 A;  4LUA A;  4CRY B;  4JD6 A;  2AE6 A;  3N5F A;  4MBU A;  4OC4 A;  4R87 A;  5D29 A;  1V0C A;  2AFX A;  1Z2L A;  2CNT A;  4B13 A;  3D7H A;  2PRQ A;  4HKF A;  4PSW A;  5AG5 A;  3IWG A;  5K8P A;  5LYD A;  3QNV A;  3W91 A;  1ZLH A;  4WJB A;  3BJ7 A;  3LOD A;  4CAE A;  4R7M A;  2WSA A;  1R43 A;  4KOU A;  4L89 A;  4MFL A;  4CYQ A;  5JGF A;  2C6C A;  3KZW A;  5G21 A;  3CXQ A;  5H86 A;  2VZY A;  3S9M A;  2AFS A;  4F6A A;  2FT0 A;  4OME A;  4UFV A;  2PVV A;  2YNC A;  3F5B A;  3FYN A;  2OZG A;  3QB8 A;  3DNS A;  4MCQ A;  3W6S A;  4AVB A;  3PRT A;  3FBU A;  3FXT A;  2VL1 A;  5HH1 A;  2F7V A;  2ZEG A;  1X12 A;  2GRE A;  4NGQ A;  4JXQ A;  5AG7 A;  3WC7 A;  2PIY A;  2P6E A;  3ISX A;  3PB9 X;  2PJ6 A;  3B8G A;  2I00 A;  2OU2 A;  1FNO A;  4A38 A;  1L0C A;  1XMB A;  2Z3M A;  4CS0 B;  1X10 A;  1F2P A;  2PJ1 A;  1LAM A;  4CYP A;  3B7I A;  3LAC A;  3FMC A;  2V8G A;  3KR4 A;  3S6K A;  5F49 A;  4BBH A;  2PJ8 A;  3EO4 A;  2OOT A;  2PC1 A;  3D68 A;  4A39 A;  3BI0 A;  3NA6 A;  3B3T A;  2B5G B;  1TXR A;  3NE8 A;  1QSO A;  1Q2Y A;  2OZU A;  5A27 A;  4MY3 A;  2Q7B A;  1ZG8 A;  1YK3 A;  3WC6 A;  3NH8 A;  4B5P B;  1KUX A;  4MRI A;  1CPS A;  1UWY A;  1JWQ A;  3NFZ A;  4KLW A;  4NF1 A;  2JDC A;  1CPX A;  2PJ3 A;  3T90 A;  3R9E A;  1BPM A;  2Q7S A;  1YLE A;  3G8W A;  4NGR A;  4MHN A;  4CAF A;  4UIB A;  5D8N A;  4PK2 A;  2Z11 A;  2AFU A;  2Z0Z A;  3WAB A;  3KI9 A;  4MFZ A;  4U9Y A;  4A32 A;  1CM0 A;  2BL1 A;  1ELM P;  1XRY A;  2J8R A;  4JZ0 A;  4RS2 A;  2G0B A;  4X5K A;  2B58 A;  3D3S A;  3JUW A;  2P6F A;  1FY7 A;  3SJX A;  1MK4 A;  4MI4 A;  5DWM A;  2D4P A;  5KTD A;  4FD5 A;  2D4O A;  3B3V A;  2R98 A;  3CXP A;  3H8F A;  2V8H A;  3KQZ A;  2CNM A;  1MJ9 A;  1IYK A;  1Y0Y A;  4IF5 A;  4MHY A;  1XF8 A;  4NGP A;  1GYT A;  4A30 A;  3C26 A;  2EO8 A;  3R9F A;  5IV0 A;  5LYI A;  3FVL A;  4UWI A;  3D7G A;  2R1I A;  4A31 A;  1Y0R A;  4MHD A;  1QSN A;  1Q2C A;  3S6F A;  4QBJ A;  2GIV A;  2J9A A;  4OC5 A;  2XEI A;  2VZZ A;  3TT2 A;  1S3Z A;  4KOV A;  2EK8 A;  3FX6 A;  2OH1 A;  1S7F A;  5J8F A;  3LWU A;  4ZX9 A;  4M3S A;  1J4J A;  1RO5 A;  3D67 A;  4O23 A;  1I12 A;  2HB6 A;  1B87 A;  2BEI A;  4XNH B;  4NGN A;  4FAI A;  1ZG7 A;  2EBJ A;  4KOX A;  1ARM A;  5I0C A;  2RC4 A;  4KOY A;  2BSW A;  3D8P A;  4IK2 A;  4XPD B;  4ZGY B;  4ZBG A;  4K30 A;  1R3N A;  4PK3 A;  2PJ7 A;  3IJ3 A;  1ZLI A;  4PXE A;  4CGL A;  4CGM A;  1PYT B;  2HUZ A;  4OLL A;  4C7H A;  2DXQ A;  2H5M A;  3CDX A;  1QMU A;  4ZX8 A;  4LQG A;  2DPT A;  1LAN A;  2O4H A;  3V7Z A;  5K8N A;  4OKO A;  3HUV A;  1I1D A;  2B4B A;  1ON0 A;  3PGP A;  2FXF A;  3IEH A;  1Q2D A;  1VHO A;  1QST A;  4MCR A;  1MJB A;  2Q04 A;  2RB7 A;  1GHE A;  3SI0 A;  5LYL A;  4Z65 A;  4UCM A;  2PJ4 A;  2ANP A;  2ZW5 A;  4KVM E;  5LRJ A;  5FVJ A;  3SJF A;  4EME A;  2CY2 A;  4FUU A;  3JRU A;  4OID A;  1Y7R A;  2GAN A;  2PJ0 A;  1TKJ A;  1M4G A;  2F5I A;  2EUI A;  4B10 A;  1OBR A;  1QSM A;  1XJO A;  1YGH A;  3IC1 A;  3IGR A;  4X3R A;  2B4D A;  3TC8 A;  4CYO A;  4R9M A;  5HMN A;  4H2K A;  1CJW A;  2I3C A;  1YVO A;  4BMH A;  1VHS A;  3RBU A;  3V8I A;  4GXH A;  4K3N A;  2JEW A;  5DWN A;  4AG9 A;  2CTB A;  4UEZ A;  3RAM A;  3K2K A;  1Y7E A;  4P4D A;  4CPA A;  2C6G A;  2CTC A;  4CAX A;  4R3L A;  3R9G A;  2IL4 A;  2PR1 A;  4NGT A;  4FD7 A;  4MY0 A;  4P4J A;  1KZF A;  2VEZ A;  3WT4 A;  2QIR A;  5J8C A;  4ZI6 A;  1AYE A;  3PFE A;  1K4J A;  3KL9 A;  2I79 A;  4NGS A;  4OIW A;  2JBJ A;  4DNC A;  4C2Z A;  2CIJ A;  4CAV A;  4UFW A;  2Y0M A;  5BWA B;  2ABZ A;  2P6G A;  1CX8 A;  2PIZ A;  3B3C A;  4OAD A;  1RTQ A;  2PJ5 A;  3DGV A;  3H5Z A;  5CBM A;  4J3G A;  2EWB A;  1LAP A;  4KOS A;  5GCN A;  4Y49 B;  2AFO A;  5F09 A;  4NGM A;  4LQ6 A;  1TF9 A;  3FB3 A;  4Q36 A;  2GU2 A;  3DLJ A;  3JVN A;  4X2T A;  3MRU A;  4P4E A;  2VXK A;  3PEI A;  1P4N A;  3GB0 A;  1Z8L A;  2XEF A;  3TCV A;  1BPN A;  2PE3 A;  1IU8 A;  1XMT A;  3EC4 A;  3IIB A;  2Z3O A;  3HLP A;  4JXR A;  4ONU A;  4R76 A;  4II9 A;  5AG6 A;  4NXY A;  3FRM A;  2B3U A;  4QUS A;  5LYF A;  4HNY B;  3B35 A;  1CG2 A;  2GLJ A;  3NH5 A;  4UF4 A;  3FF3 A;  2JBK A;  5E96 A;  1KUV A;  3IO1 A;  4KLV A;  4MFJ A;  4MXU A;  5ISV A;  2ZOG A;  3DSB A;  4UEE A;  2HC9 A;  3CPX A;  3TX8 A;  4OP4 A;  1SQH A;  4P4F A;  3KGQ A;  4YU9 A;  1IYL A;  3PFO A;  3FEE A;  3I9S A;  1I21 A;  5AG4 A;  6CPA A;  4U5Y A;  3OWC A;  3R96 A;  2K5T A;  2ZOF A;  1HDU A;  4GM5 A;  2JDD A;  1H8L A;  2BOA A;  4FWU A;  4P44 A;  3V38 A;  2QJ8 A;  1LOK A;  4A94 A;  4EFD A;  1U6M A;  3KHZ A;  1PU9 A;  4H89 A;  4C68 A;  1IY7 A;  2ZEF A;  4XPK A;  4KOT A;  3PP9 A;  4R57 A;  1B6B A;  4QVT A;  1YR0 A;  1NMT A;  4FBE A;  4HNW B;  2WYR A;  4KSF A;  3CPA A;  3S9N A;  4F8Z A;  2FS5 A;  4XPD C;  1A2Z A;  2AFW A;  2AJ6 A;  5LRK A;  4TNU A;  1FT7 A;  3VAR A;  2VBQ A;  2PCU A;  2ZEL A;  3FED A;  3BLN A;  3N7Z A;  3WR7 A;  2V77 A;  2XEG A;  4R3K A;  3IFE A;  4F0Y A;  4A33 A;  3B2Y A;  1Y9K A;  4ONW A;  4H6Z A;  1XOV A;  2J8N A;  1VGY A;  4KS9 A;  4MHZ A;  5KTA A;  4MFP A;  3FEC A;  2ZEN A;  3RNZ A;  2NMT A;  5HVG A;  2HV2 A;  1P0H A;  2CNS A;  2PR8 A;  3SXN A;  4YWY A;  2Q43 A;  4Q38 A;  4G1P A;  3S6G A;  2AFM A;  3IU2 A;  2O28 A;  4RN7 A;  1ZG9 A;  3LMS A;  4KUA A;  4F9V A;  2PJ9 A;  3RZA A;  3SXO A;  3K9U A;  4ZYQ A;  4U9Z A;  5J1Q A;  4CGN A;  1VHE A;  2OR4 A;  1IIC A;  1YRE A;  3MGD A;  3QAH A;  5EC4 A;  1HEE A;  2FE7 A;  3PBE A;  1XE4 A;  4C2Y A;  4PXC A;  4CYN A;  1ELL P;  5H84 A;  3TOB A;  2Q44 A;  3JTK A;  2IMO A;  1DE4 C;  2NSM A;  3GYA A;  3MN8 A;  2ZEO A;  4M85 A;  2V8D A;  3GKR A;  1NSA A;  2BO9 A;  2YGW A;  2IJZ A;  4JLY A;  1Y9W A;  1Z8T A;  5ELY A;  4RUH A;  5F46 A;  5AGE A;  1M1D A;  4YRH A;  5JQ4 A;  2PRB A;  1IB1 E;  3H4Q A;  3TO9 A;  3F8K A;  2REF A;  4MFQ A;  3CZX A;  4R8F A;  1LCP A;  1XEB A;  2NYQ A;  2REE A;  1S7N A;  3VH9 A;  4W9Y A;  4AXV A;  3KR5 A;  4B11 A;  3D7F A;  4ZY1 A;  2XEJ A;  4MHP A;  7CPA A;  1BAV A;  2PDO A;  2CXA A;  3KAS A;  3KHX A;  4JJX A;  1IOF A;  2GFQ A;  1Z9U A;  1XFO A;  2IQ6 A;  5JPH A;  1WK4 A;  1YLO A;  2B4D B;  2G3T A;  1PUA A;  4Q7A A;  5THW A;  4MJ8 A;  4NSQ A;  3E0K A;  1S60 A;  1Z8W A;  1M4I A;  4Y49 C;  4HNX B;  1R57 A;  4B12 A;  1RXT A;  3IU1 A;  4KSI A;  4MMO A;  4QB9 A;  2Z3K A;  4KSA A;  4DUK A;  2DF5 A;  3S6H A;  1VKC A;  2PQ8 A;  2ZPA A;  1AMP A;  2WPX A;  3D4U A;  3I1U A;  4F0X A;  2FCK A;  2ATR A;  3EFA A;  3IWW A;  4B6Z A;  3SI2 A;  4AB7 A;  4B14 A;  4PSX A;  5G22 A;  2Q4Y A;  4CGO A;  4PXD A;  3T9Y A;  4P4B A;  4C2X A;  4ZY2 A;  3GY9 A;  3TO6 A;  4JYW A;  2Q0Y A;  4NCZ A;  3SJG A;  5DS0 A;  1WWZ A;  4BIN A;  3B3W A;  3GLJ A;  4A37 A;  1PCA A;  4M6G A;  4UCN A;  5HXD A;  4OC3 A;  5EMI A;  5KTC A;  3FIX A;  4BD9 A;  2DEA A;  4A95 A;  2QVP A;  2R7H A;  4B5O A;  4IUS A;  4KOR A;  1TIQ A;  4NJQ A;  4MFK A;  5JM6 A;  1YQE A;  5C82 A;  8CPA A;  1Q7L A;  1Z4R A;  1YME A;  2JEV A;  4FD4 A;  2ZEM A;  2VI7 A; 
#chains in the Genus database with same CATH homology
 2ZW7 A;  2FIA A;  4QC6 A;  2PSW A;  3A9L A;  2A4N A;  2JLM A;  2Z3P A;  4LX9 A;  3P2H A;  3VWE A;  2ZW6 A;  3G3S A;  2YNE A;  3EXN A;  4JWP A;  2X7B A;  2ZXV A;  2QEC A;  4AVC A;  3F0A A;  4PV6 A;  1S7L A;  2BUE A;  2B5G A;  1UFH A;  3I3G A;  5A28 A;  2J8M A;  5C88 A;  1LRZ A;  4B5P A;  4XPL A;  4KVX A;  2R8V A;  2G3A A;  3KKW A;  4OAE A;  4XNH C;  3DDD A;  4C7I A;  3TOA A;  2YND A;  3BJ8 A;  4L8A A;  5CNP A;  1YVK A;  4UFX A;  2DPS A;  2B3V A;  1OZP A;  1XIX A;  2OZH A;  2Z3L A;  5EBV A;  4CRZ B;  4KZT A;  4UA3 A;  2EVN A;  1YX0 A;  3VWD A;  5F48 A;  4H6U A;  3PZJ A;  3W6X A;  4E0A A;  2P0W A;  4CAW A;  4RI1 A;  4YGO A;  3TO7 A;  2C27 A;  2KCW A;  4E8O A;  3TFY A;  1M44 A;  3P2F A;  1BO4 A;  1Z4E A;  4NEX A;  3D2P A;  5G20 A;  5G1Z A;  3D2M A;  1M4D A;  4UBR A;  2Q4V A;  3FNC A;  2Z10 A;  1BOB A;  4FD6 A;  1ZO0 A;  3SHP A;  5IX3 A;  1QSR A;  4AVA A;  3TTH A;  4EVY A;  2QML A;  1S7K A;  2HQY A;  3EY5 A;  3RYO A;  3DR6 A;  4A2Z A;  2FSR A;  2VQY A;  4UCP A;  4ORF A;  3UY5 A;  3ZZI A;  2FL4 A;  3TE4 A;  3IWE A;  4GS4 A;  2FIW A;  3ZJ0 A;  3LD2 A;  5F47 A;  1KUY A;  1MJA A;  2ZW4 A;  2ARH A;  3R95 A;  4KOW A;  4CGP A;  2YNC C;  5IB0 A;  2OB0 A;  4I49 A;  4AG7 A;  2WUU A;  3DR8 A;  4E2A A;  4YFJ A;  4KUB A;  1S5K A;  2Z3N A;  3CXS A;  2WPW A;  2GE3 A;  4KVO E;  4UWJ A;  1NE9 A;  1NSL A;  1N71 A;  3NE7 A;  1IID A;  3R1K A;  4LUA A;  4CRY B;  4JD6 A;  2AE6 A;  4R87 A;  4MBU A;  1V0C A;  2CNT A;  4B13 A;  4HKF A;  4PSW A;  5AG5 A;  3IWG A;  3W91 A;  3BJ7 A;  3LOD A;  4CAE A;  2WSA A;  4KOU A;  4L89 A;  4MFL A;  4CYQ A;  5G21 A;  3CXQ A;  5H86 A;  2VZY A;  4F6A A;  2FT0 A;  4UFV A;  3F5B A;  2YNC A;  3FYN A;  2OZG A;  3QB8 A;  3DNS A;  3W6S A;  4AVB A;  3FBU A;  3FXT A;  5HH1 A;  4JXQ A;  5AG7 A;  2P6E A;  3B8G A;  2I00 A;  2OU2 A;  1L0C A;  2Z3M A;  4CS0 B;  4CYP A;  3S6K A;  5F49 A;  4BBH A;  3EO4 A;  2PC1 A;  2B5G B;  1QSO A;  1Q2Y A;  2OZU A;  5A27 A;  4MY3 A;  2Q7B A;  1YK3 A;  4B5P B;  1KUX A;  4KLW A;  4NF1 A;  2JDC A;  3T90 A;  3R9E A;  1YLE A;  3G8W A;  4CAF A;  4PK2 A;  2Z11 A;  2Z0Z A;  4MFZ A;  4U9Y A;  4A32 A;  1CM0 A;  2BL1 A;  4RS2 A;  2J8R A;  4X5K A;  2G0B A;  2B58 A;  3JUW A;  3D3S A;  2P6F A;  1FY7 A;  1MK4 A;  4MI4 A;  5DWM A;  2D4P A;  5KTD A;  4FD5 A;  2D4O A;  2R98 A;  3CXP A;  4IF5 A;  2CNM A;  1MJ9 A;  1IYK A;  1XF8 A;  4A30 A;  3C26 A;  3R9F A;  5IV0 A;  4UWI A;  2R1I A;  4A31 A;  4MHD A;  1QSN A;  1Q2C A;  3S6F A;  4QBJ A;  2GIV A;  2VZZ A;  3TT2 A;  1S3Z A;  4KOV A;  2OH1 A;  1S7F A;  5J8F A;  4M3S A;  1J4J A;  1RO5 A;  1I12 A;  1B87 A;  2BEI A;  4XNH B;  4KOX A;  5I0C A;  2RC4 A;  4KOY A;  3D8P A;  2BSW A;  4XPD B;  4ZGY B;  4ZBG A;  4K30 A;  4PK3 A;  4CGL A;  4CGM A;  2HUZ A;  4OLL A;  4C7H A;  2DXQ A;  2H5M A;  2DPT A;  1I1D A;  2B4B A;  1ON0 A;  3PGP A;  2FXF A;  1Q2D A;  1QST A;  1MJB A;  2Q04 A;  1GHE A;  4UCM A;  2ZW5 A;  4KVM E;  5FVJ A;  2CY2 A;  1Y7R A;  2GAN A;  2F5I A;  1M4G A;  4B10 A;  2EUI A;  1QSM A;  1YGH A;  3IGR A;  4CYO A;  2B4D A;  4R9M A;  5HMN A;  1CJW A;  1YVO A;  4BMH A;  1VHS A;  3V8I A;  5DWN A;  4AG9 A;  4CAX A;  4R3L A;  3R9G A;  2IL4 A;  2PR1 A;  4FD7 A;  4MY0 A;  1KZF A;  2VEZ A;  2QIR A;  5J8C A;  1K4J A;  2I79 A;  4DNC A;  4C2Z A;  4CAV A;  4UFW A;  2Y0M A;  5BWA B;  2P6G A;  4OAD A;  3H5Z A;  4J3G A;  4KOS A;  5GCN A;  4Y49 B;  3FB3 A;  4Q36 A;  3JVN A;  2VXK A;  1P4N A;  3TCV A;  4II9 A;  1XMT A;  3EC4 A;  4ONU A;  2Z3O A;  4JXR A;  5AG6 A;  4NXY A;  3FRM A;  2B3U A;  4QUS A;  4HNY B;  5E96 A;  1KUV A;  4KLV A;  4MFJ A;  5ISV A;  3DSB A;  1SQH A;  1IYL A;  3I9S A;  1I21 A;  5AG4 A;  4U5Y A;  3OWC A;  3R96 A;  2K5T A;  2JDD A;  1U6M A;  1PU9 A;  4H89 A;  4C68 A;  4XPK A;  4KOT A;  3PP9 A;  4R57 A;  1B6B A;  4QVT A;  1YR0 A;  1NMT A;  4HNW B;  4KSF A;  2FS5 A;  4XPD C;  2AJ6 A;  2VBQ A;  3BLN A;  3N7Z A;  3WR7 A;  4R3K A;  4F0Y A;  4A33 A;  1Y9K A;  4H6Z A;  2J8N A;  4KS9 A;  5KTA A;  4MFP A;  2NMT A;  2HV2 A;  1P0H A;  2CNS A;  2PR8 A;  3SXN A;  4Q38 A;  3S6G A;  3IU2 A;  2O28 A;  4KUA A;  3SXO A;  3K9U A;  4U9Z A;  4CGN A;  1IIC A;  1YRE A;  3MGD A;  3QAH A;  5EC4 A;  2FE7 A;  4CYN A;  1XE4 A;  4C2Y A;  5H84 A;  3TOB A;  2Q44 A;  3JTK A;  3GYA A;  4M85 A;  3GKR A;  2YGW A;  4JLY A;  1Y9W A;  5F46 A;  5AGE A;  1M1D A;  4YRH A;  5JQ4 A;  2PRB A;  1IB1 E;  3H4Q A;  3TO9 A;  3F8K A;  2REF A;  4MFQ A;  1XEB A;  2REE A;  1S7N A;  4B11 A;  2PDO A;  2CXA A;  4JJX A;  1Z9U A;  5JPH A;  1WK4 A;  2B4D B;  2G3T A;  1PUA A;  4MJ8 A;  4NSQ A;  3E0K A;  1S60 A;  1M4I A;  4Y49 C;  4HNX B;  1R57 A;  4B12 A;  1RXT A;  3IU1 A;  4QB9 A;  2Z3K A;  4KSA A;  3S6H A;  1VKC A;  2PQ8 A;  2ZPA A;  2WPX A;  4F0X A;  2FCK A;  2ATR A;  3EFA A;  4AB7 A;  4B14 A;  4PSX A;  5G22 A;  2Q4Y A;  4CGO A;  3T9Y A;  4C2X A;  3GY9 A;  3TO6 A;  2Q0Y A;  4NCZ A;  1WWZ A;  4UCN A;  5KTC A;  3FIX A;  4A95 A;  2R7H A;  4B5O A;  4IUS A;  4KOR A;  1TIQ A;  4MFK A;  5C82 A;  1Z4R A;  2JEV A;  4FD4 A;  2VI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...