4KOTA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefotaxime
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 43
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kotA00
2J8RA 1Y7RA 2ZW7A 1L0CA 1B6BA 3F0AA 4CS0B 1YVOA 5CNPA 3E0KA 3S6GA 1YK3A 2A4NA 4B5PA 2Y0MA 1MK4A 1OZPA 1RO5A 2Q4VA 4YFJA 2OZHA 2D4PA 3GYAA 2CNMA 4AG9A 4FD5A 5F48A 1P0HA 2FIWA 2D4OA 4KVOE 5DWMA 2I00A 1SQHA 2EVNA 2PC1A 2X7BA 2OZGA 2Q0YA 1BOBA 2FE7A 4UWJA 4KOYA 2B5GA 1S7LA 2ARHA 3VWEA 4Y49B 2I79A 1WWZA 4LUAA 1IB1E 4Y49C 5C82A 4J3GA 1QSRA 4PK3A 3FB3A 4AVAA 3S6HA 3P2HA 3FYNA 4KLVA 4F0YA 4UWIA 3N7ZA 3BLNA 2FSRA 4OADA 2JDCA 2KCWA 3TOBA 2FIAA 4JD6A 3T9YA 2JLMA 4AVBA 4LX9A 3D8PA 3LD2A 5ISVA 4PV6A 2OH1A 3TO9A 1P4NA 4R87A 4NEXA 4XNHC 1M4DA 4H6ZA 5F47A 3D3SA 5H84A 2ZW5A 5J8CA 2FT0A 2BSWA 2FCKA 2OZUA 1N71A 2B5GB 3EFAA 3TCVA 4OAEA 3SXOA 5DWNA 4KORA 4H6UA 1XIXA 4E0AA 3R1KA 4II9A 1K4JA 2EUIA 2ZPAA 2VI7A 1Z9UA 3G8WA 1IYKA 4ZBGA 2WPXA 4EVYA 3S6FA 4JXRA 4QVTA 2R1IA 4MY0A 2FS5A 3DR6A 1S5KA 4CAXA 4BMHA 4KUBA 4CRZB 3G3SA 4H89A 1S7NA 5FVJA 2G0BA 1NSLA 3GKRA 3GY9A 3V8IA 3DSBA 3FBUA 4NXYA 4L8AA 4MHDA 4FD6A 2PR1A 2VBQA 2Q7BA 4HNXB 2GE3A 4QB9A 1TIQA 4YRHA 3LODA 2B58A 3EY5A 3EC4A 2GANA 3QAHA 3VWDA 1CM0A 3F5BA 5KTDA 2BL1A 4KOTA 2G3TA 4KOVA 1YR0A 1S7KA 1XMTA 3DR8A 1S7FA 3K9UA 1FY7A 4HNWB 2BUEA 2K5TA 3R96A 4JJXA 1S3ZA 5KTCA 2P6FA 1KZFA 4JLYA 2ATRA 1Q2CA 2VQYA 2OU2A 2VZZA 3FIXA 4U5YA 2AJ6A 2REFA 1YX0A 4MI4A 3R9EA 2G3AA 3BJ8A 5GCNA 2B3VA 2PR8A 4KOSA 4HKFA 4E2AA 4KOWA 3OWCA 1S60A 5HMNA 3D2MA 3H4QA 4QBJA 2WPWA 3TE4A 5IX3A 2O28A 3DDDA 4PSXA 2VXKA 4XPDB 3JUWA 1PUAA 4XPDC 2RC4A 1Y9KA 4I49A 3QB8A 1ON0A 3T90A 3CXPA 2PQ8A 4GS4A 4PK2A 5F46A 1RXTA 1BO4A 3ZZIA 1M4GA 1KUVA 4PSWA 4CAVA 3EO4A 1IYLA 2P6GA 1IICA 2JDDA 3P2FA 2ZW4A 4UA3A 4FD4A 4RI1A 1R57A 4QUSA 4KUAA 3CXQA 5J8FA 4KLWA 3W91A 3ZJ0A 2J8NA 1YGHA 2P6EA 4KOXA 4M3SA 2F5IA 2PRBA 2AE6A 4R3LA 4L89A 2R98A 3R9FA 1I21A 1U6MA 3R95A 2FL4A 1M4IA 2B4DA 1WK4A 5JQ4A 3SXNA 3EXNA 3FNCA 1M44A 3IWGA 1Q2YA 5F49A 3WR7A 2C27A 4X5KA 1Y9WA 4KOUA 1QSNA 1NE9A 4NSQA 4R9MA 2VEZA 4CAWA 1YREA 1VKCA 3NE7A 4NCZA 4KVXA 4HNYB 3S6KA 3RYOA 3MGDA 1PU9A 2Q04A 5IB0A 4XPLA 3W6XA 2HUZA 1MJAA 2QECA 2OB0A 3DNSA 2FXFA 3F8KA 3PGPA 3B8GA 2NMTA 4B5OA 4R57A 1MJ9A 2DXQA 2Q4YA 1V0CA 1XEBA 2ZXVA 2CNSA 1XE4A 2B4DB 2BEIA 3TTHA 3I3GA 5HH1A 2Z10A 4CRYB 3PZJA 2GIVA 1IIDA 1CJWA 5EC4A 2PDOA 4MY3A 1MJBA 2J8MA 5JPHA 1QSOA 4AG7A 1M1DA 2CY2A 1YLEA 4FD7A 3FRMA 2B3UA 1Z4RA 4RS2A 4IF5A 4K30A 4XPKA 1UFHA 1KUXA 4B5PB 2VZYA 2R8VA 3I9SA 4MJ8A 2REEA 4UBRA 4XNHB 2B4BA 4MBUA 5H86A 1Z4EA 4YGOA 1I12A 4F6AA 2Z11A 4R3KA 4U9ZA 5I0CA 4IUSA 4M85A 2PSWA 4KVME 2P0WA 4QC6A 3TT2A 3JVNA 3TO6A 4JXQA 4JWPA 5EBVA 2HQYA 3KKWA 1J4JA 3CXSA 4NF1A 3PP9A 1GHEA 4ONUA 3TO7A 4KZTA 2IL4A 4U9YA 3TFYA 2ZW6A 1B87A 3SHPA 1YVKA 2QIRA 5KTAA 4ORFA 2JEVA 3R9GA 2CNTA 1NMTA 1LRZA 3C26A 4E8OA 4AB7A 2H5MA 2HV2A 3IGRA 5E96A 1KUYA 1XF8A 4DNCA 4OLLA 1Q2DA 3BJ7A 1QSMA 2R7HA 2Q44A 1I1DA 5IV0A 2Z0ZA 1VHSA 2QMLA 3TOAA 3W6SA 3FXTA 4AVCA 5C88A 3D2PA 3UY5A 1QSTA
chains in the Genus database with same CATH superfamily
3I1UA 2J8RA 2PIYA 1Y7RA 2ZW7A 3D7GA 1L0CA 1B6BA 1VHEA 3F0AA 3KHXA 4CS0B 1ZLIA 3PB9X 1YVOA 5CNPA 3BHXA 3E0KA 1LOKA 4C68A 3S6GA 1YK3A 2IMOA 2A4NA 2EK9A 4R7MA 4B5PA 6CPAA 2Y0MA 1MK4A 1OZPA 1RO5A 1YW6A 2ZEGA 3DLJA 2Q4VA 3LACA 4YFJA 4BINA 2V8DA 1LCPA 5D29A 1ELMP 3CPXA 4MCPA 4C2YA 5AG5A 4UCMA 3FECA 2OZHA 4MFJA 2D4PA 3GYAA 1GYTA 2CNMA 4AG9A 4FD5A 5F48A 1P0HA 4Q36A 2FIWA 3D7HA 2D4OA 3H8GA 4KVOE 2I00A 1SQHA 2EVNA 2PC1A 3KGQA 1X12A 5DWMA 1EE3P 1PYTB 1Q7LA 4B12A 4ZGYB 2X7BA 3KZWA 2OZGA 2YNDA 1ARLA 2DPTA 2Q0YA 4TWEA 1BOBA 2FE7A 2Q4ZA 3B3SA 4MCQA 4UWJA 4KOYA 2B5GA 1S7LA 2ARHA 3RNZA 1LAPA 3VWEA 4Y49B 2I79A 4MFQA 4WJBA 1WWZA 4LUAA 1IB1E 2ZEMA 4X3RA 4Y49C 5C82A 4J3GA 4CAFA 1QSRA 1YW4A 3FB3A 3QAYA 4OKOA 3A9LA 4PK3A 4AVAA 3S6HA 3P2HA 4MFLA 3FYNA 5LYIA 4UF4A 2GFQA 3KL9A 4KLVA 1F2PA 3GIUA 4PPZA 4F0YA 4UWIA 2EK8A 2BOAA 3N7ZA 2PJ1A 4OMEA 3BLNA 2FSRA 4OADA 2JDCA 4F9VA 3NH5A 2KCWA 3TOBA 1LANA 2FIAA 4JD6A 3T9YA 4NGNA 4A94A 3VH9A 4M6IA 3HLPA 4IHMA 2PJBA 2V77A 4H2KA 4OC2A 3IEHA 2JLMA 5DS0A 5A27A 4GXHA 4AVBA 3GUXA 4LX9A 3D8PA 3LD2A 5ISVA 2QVPA 3QNVA 4PV6A 3SI1A 5F09A 2AFSA 3IU2A 2OH1A 3TO9A 1P4NA 4R87A 4NEXA 1ARMA 2V8GA 1XRYA 3PBBA 4NFRA 4XNHC 1M4DA 4H6ZA 5F47A 3D3SA 5H84A 2ZW5A 2OOTA 5AG7A 1YMEA 5J8CA 2FT0A 1BAVA 2BSWA 2PJ6A 4P4IA 2FCKA 2OZUA 3RZAA 1N71A 2B5GB 3PB4X 2GU2A 3EFAA 3TCVA 4FBEA 4OAEA 3SXOA 2PRQA 5DWNA 4OP4A 4P10A 4UFXA 4KORA 4H6UA 4UCNA 2Q51A 5I4MA 1XIXA 2C1CA 4E0AA 3R1KA 4R6TA 4CYNA 1CP7A 4II9A 2PJCA 4CYQA 4F0XA 4UEZA 5HVGA 2F8HA 1K4JA 3PB7X 3WC7A 4Q7AA 2EUIA 2ABZA 2ZPAA 1CP6A 2VI7A 2PJ0A 1Z9UA 2O53A 7CPAA 4A37A 3G8WA 1IYKA 2GLJA 4ZBGA 1Z8XA 2PJAA 1AUGA 4ZY1A 1Y0YA 2WPXA 4EVYA 3S6FA 2C6GA 4JXRA 2Q43A 4P45A 4QVTA 3WABA 2HC9A 2R1IA 2PJ8A 4MY0A 2FS5A 3DR6A 1S5KA 1CG2A 2WZNA 1F57A 4CAXA 1TXRA 4BMHA 4KUBA 2RFHA 4UEEA 4MHYA 2ZEHA 4CRZB 3TC8A 3G3SA 4MFPA 4H89A 1S7NA 1OBRA 5FVJA 4CYPA 1DTDA 1HDQA 2CF4A 2G0BA 2IJZA 2ZOGA 4UCPA 3GKRA 1NSLA 5A28A 3GY9A 4YU9A 2XEIA 1R43A 5JH9A 3D68A 3DSBA 3FBUA 4MMOA 3SJXA 3V8IA 4NXYA 4L8AA 4MHDA 3IWWA 4FD6A 3PB8X 2PR1A 2VBQA 3TX8A 2Q7BA 3T8WA 4HNXB 2GE3A 2QJ8A 4QB9A 1R3NA 2Q7SA 1TIQA 4YRHA 3BXMA 1XFOA 1F2OA 5D8NA 5CPAA 1CX8A 1Y0RA 3LODA 2B58A 3EY5A 1M4LA 2F7VA 2Z3NA 2WSAA 3JTKA 3EC4A 4W9YA 4A39A 2GANA 3QAHA 3VWDA 1CM0A 3FJUA 1RTQA 3F5BA 4OC1A 5KTDA 2BL1A 1IY7A 4KOTA 2G3TA 4KOVA 3B3CA 1YR0A 1S7KA 1XMTA 3DR8A 1S7FA 4PQAA 3K9UA 4C7HA 3KQXA 1FY7A 5K8NA 4HNWB 2BUEA 3WT4A 2JBJA 4CYOA 1LFWA 2NSMA 2K5TA 4A32A 1XBUA 2EBJA 2WYRA 4FWUA 3R96A 1TF8A 4CAEA 5HXDA 4JJXA 2JBKA 3RO0A 2VL1A 1S3ZA 1BPMA 4Z65A 5KTCA 5G22A 2P6FA 2V8VA 3N5FA 1YSJA 2HB6A 3S9NA 5JM6A 1KZFA 4JLYA 4KS9A 2ATRA 1Q2CA 2VQYA 1DE4C 1AYEA 2OU2A 2VZZA 3FIXA 4U5YA 1H8LA 2AJ6A 5K8MA 4BBHA 3D7FA 3S9MA 2REFA 3PBEA 1YX0A 3H8FA 3VARA 2G9DA 4MI4A 2PE3A 3WC6A 2PJ9A 3R9EA 3B7IA 2G3AA 3BJ8A 3RAMA 4ONWA 5GCNA 2B3VA 2PR8A 4A2ZA 3CZXA 2PJ5A 4KOSA 5LRGA 4OC5A 2ZELA 4EMEA 2DEAA 4HKFA 4B6ZA 4E2AA 1ZG8A 3IJ3A 4KOWA 4A33A 3OWCA 4OIDA 1S60A 5HMNA 2YNCA 4NJQA 1UWYA 3D2MA 3K9TA 5ELYA 2NYQA 3H4QA 4QBJA 2WPWA 3WC5A 3TE4A 5IX3A 3LMSA 4UFWA 1TKFA 4OIWA 2O28A 4CGPA 3DDDA 4PSXA 2VXKA 2AFWA 3ISZA 4XPDB 3GLJA 1ZG9A 3JUWA 4CGMA 4MXUA 1PUAA 4XPDC 2AFZA 2RC4A 1Y9KA 4B11A 4B14A 1ELLP 3QB8A 4I49A 1ON0A 3T90A 3IO1A 1ZLHA 3D67A 5HVFA 3CXPA 3H8EA 4C2XA 2PQ8A 4UFVA 3IU1A 4UIBA 4DYOA 1IOIA 5AG4A 1IU8A 4GS4A 1IGBA 4PK2A 3IC1A 3NA6A 1RXTA 3NH4A 1BO4A 4P4JA 2FVGA 4P4EA 3ZZIA 4X8IA 2C6CA 1M4GA 4GM5A 1KUVA 2Z3OA 4PSWA 4CAVA 4RUHA 3EO4A 1IYLA 1Z2LA 3D4UA 3V7ZA 1CPSA 4M6GA 5THWA 1ZG7A 2P6GA 3MRUA 4LQGA 4NGSA 1IICA 2JDDA 2WUUA 1LAMA 2ZW4A 3P2FA 4PXEA 4UA3A 4A95A 4FD4A 2EO8A 2V8HA 4RI1A 4MFZA 1R57A 5JGFA 4QUSA 4NGPA 1JWQA 4PXDA 4F9UA 5G20A 4KUAA 3CXQA 5J8FA 4KLWA 3W91A 4FUUA 3ZJ0A 2J9AA 4OC0A 2YNCC 4MFKA 5LYLA 2J8NA 4MCRA 1YGHA 1BPNA 2XEGA 3CPAA 4DJLA 1YQEA 2P6EA 4KOXA 4M3SA 5G21A 2F5IA 4KSFA 2PRBA 1Z8LA 2CTCA 2AE6A 5K8OA 4R3LA 2YGWA 4WWVA 5LRJA 2AFMA 3PRTA 4L89A 2R98A 3R9FA 1I21A 1U6MA 3R95A 2FL4A 1M4IA 2B4DA 1WK4A 4JYWA 4UIAA 3SXNA 3EXNA 4P4DA 5JQ4A 3FNCA 1M44A 1Z8TA 3IWGA 2POKA 1Q2YA 4O23A 5F49A 2AFXA 3WR7A 4EWTA 4CGLA 2C27A 4X5KA 1Y9WA 4KOUA 1QSNA 3PFEA 1NE9A 4NSQA 4G1PA 4NJRA 2VEZA 4R9MA 5LYDA 4CAWA 1YREA 4ZYQA 2AFOA 4F8ZA 1VKCA 2ZEOA 3NE7A 4NCZA 2I3CA 2ZEEA 2EWBA 1Z8WA 3IWEA 4C2ZA 3KHZA 3B3VA 2ODFA 4KVXA 4ZX8A 4NGQA 4HNYB 1YLOA 4NGMA 4ZY0A 3B3TA 1VIXA 3S6KA 3KR4A 2BO9A 3BI1A 3RYOA 4B13A 8CPAA 3MGDA 1PU9A 2ZOFA 2Q04A 2XEJA 2PJ3A 4XPLA 5IB0A 3W6XA 2HUZA 1ZO0A 1MJAA 2QECA 4NGRA 2OB0A 3DNSA 2ZEPA 2FXFA 3F8KA 2Z3KA 5EMIA 2DF5A 3PGPA 2C6PA 3B8GA 1NSAA 1KWMA 2NMTA 4IAVA 4B5OA 4R57A 4P44A 1MJ9A 3FX6A 2DXQA 2Q4YA 4K3NA 4JZ0A 1V0CA 1XEBA 3DGVA 4TNUA 5F46A 3SJGA 2CNSA 2ZXVA 4CGOA 1XE4A 2B4DB 2BEIA 3TTHA 3I3GA 5HH1A 2Z10A 3ISXA 3L2NA 4RN7A 4A31A 4CRYB 3PZJA 2CIJA 1XOVA 4R8FA 1Y7EA 4BD9A 2GIVA 5HVHA 4IK2A 4CGNA 1IIDA 5J1QA 4A30A 3D66A 1CJWA 5EC4A 2Z3MA 3IFEA 2JEWA 3NE8A 2Z3LA 3MN8A 4MHZA 1X10A 2PDOA 1A2ZA 3FEEA 4MY3A 3FEDA 3PB6X 1MJBA 2J8MA 5JPHA 2GLFA 2PVVA 3SJFA 1QSOA 2QYVA 4OC3A 4YWYA 3K2KA 4AG7A 4OC4A 4KSAA 4CPAA 4NGTA 4PXBA 5CBMA 1XMBA 1M1DA 4P4FA 2CY2A 1YLEA 3CT9A 4FD7A 2PCUA 3FRMA 2B3UA 1Z4RA 3SI2A 3FH4A 5K8PA 4RS2A 4IF5A 3B2YA 1VGYA 1IOFA 4K30A 4XPKA 3D7DA 1UFHA 3NH8A 2PJ2A 4P6YA 1KUXA 4UEFA 2ANPA 4B5PB 4R76A 4MRIA 2VZYA 2ZEFA 2R8VA 3I9SA 2PVWA 5LYFA 3VATA 1QMUA 4MJ8A 1TKJA 2REEA 3B3WA 3HUVA 4LQ6A 4UBRA 4B10A 1PCAA 3KQZA 1CPXA 2OR4A 1QQ9A 3JRUA 4XNHB 2B4BA 3PFOA 4MBUA 5H86A 1Z4EA 3BI0A 4YGOA 4ZI6A 1I12A 3FF3A 4F6AA 4HPSA 4ZX9A 2ZEDA 3S9LA 2Z11A 4R3KA 4U9ZA 5I0CA 4IUSA 4MHPA 2PSWA 4KVME 2P0WA 4M85A 4QC6A 2CTBA 3B35A 3GB0A 3JVNA 3PEIA 3TO6A 3TT2A 4JXQA 3FVLA 4JWPA 3H5ZA 5EBVA 2HQYA 3KKWA 1FT7A 3V38A 3RBUA 1J4JA 3CXSA 1CBXA 4NF1A 1BLLE 3PP9A 1GHEA 1TF9A 4ONUA 5G1ZA 1AMPA 2IL4A 4KZTA 4U9YA 3TO7A 2ZW6A 3TFYA 1B87A 1HDUA 4PXCA 4C7IA 3SHPA 1YVKA 2PJ7A 2QIRA 4ORFA 4X2TA 5KTAA 3KI9A 2JEVA 3R9GA 1XJOA 2CNTA 3IIBA 4KSIA 1JQGA 4MHNA 1NMTA 1LRZA 4Q38A 3C26A 2DPSA 4E8OA 4EFDA 4FAIA 2O4HA 4AB7A 2H5MA 2PJ4A 3SJEA 4A38A 4M6HA 4ZY2A 3SI0A 2HV2A 3IGRA 5E96A 2AFUA 5BWAB 5AG6A 1KUYA 1XF8A 2YNEA 4DNCA 3LWUA 2Z3PA 4OLLA 1Q2DA 3KASA 2GREA 3KR5A 3BJ7A 4MCSA 2IQ6A 1VHOA 2PIZA 1QSMA 4P4BA 2R7HA 2Q44A 1I1DA 2RB7A 3CDXA 5AGEA 5IV0A 5IB9A 4DUKA 5LRKA 2Z0ZA 2XEFA 1TKHA 1FNOA 1VHSA 1Z5RA 2QMLA 3TOAA 3W6SA 2BCOA 2CXAA 1HEEA 3FXTA 2ZENA 3NFZA 4AVCA 3FMCA 5C88A 3D2PA 3UY5A 4AXVA 1QSTA
chains in the Genus database with same CATH topology
2J8RA 1Y7RA 2ZW7A 1L0CA 1B6BA 3F0AA 4CS0B 1YVOA 5CNPA 3E0KA 4C68A 3S6GA 1YK3A 2A4NA 4B5PA 2Y0MA 1MK4A 1OZPA 1RO5A 2Q4VA 4YFJA 4C2YA 5AG5A 4UCMA 2OZHA 4MFJA 2D4PA 3GYAA 2CNMA 4AG9A 4FD5A 5F48A 1P0HA 4Q36A 2FIWA 2D4OA 4KVOE 5DWMA 2I00A 1SQHA 2EVNA 2PC1A 4ZGYB 4B12A 2X7BA 2OZGA 2YNDA 2DPTA 2Q0YA 1BOBA 2FE7A 4UWJA 4KOYA 2B5GA 1S7LA 2ARHA 3VWEA 4Y49B 2I79A 4MFQA 1WWZA 4LUAA 1IB1E 4Y49C 5C82A 4J3GA 4CAFA 1QSRA 4PK3A 3FB3A 4AVAA 3A9LA 3S6HA 3P2HA 4MFLA 3FYNA 4KLVA 4F0YA 4UWIA 3N7ZA 3BLNA 2FSRA 4OADA 2JDCA 2KCWA 3TOBA 2FIAA 4JD6A 3T9YA 5A27A 2JLMA 4AVBA 4LX9A 3D8PA 3LD2A 5ISVA 4PV6A 3IU2A 2OH1A 3TO9A 1P4NA 4R87A 4NEXA 4XNHC 1M4DA 4H6ZA 5F47A 3D3SA 5H84A 2ZW5A 5J8CA 5AG7A 2FT0A 2BSWA 2FCKA 2OZUA 1N71A 2B5GB 3EFAA 3TCVA 4OAEA 3SXOA 5DWNA 4UFXA 4UCNA 4KORA 4H6UA 1XIXA 4E0AA 3R1KA 4CYNA 4II9A 4CYQA 4F0XA 1K4JA 2EUIA 2ZPAA 2VI7A 1Z9UA 3G8WA 1IYKA 4ZBGA 2WPXA 4EVYA 3S6FA 4JXRA 4QVTA 2R1IA 4MY0A 2FS5A 3DR6A 1S5KA 4CAXA 4BMHA 4KUBA 4CRZB 3G3SA 4MFPA 4H89A 1S7NA 5FVJA 4CYPA 2G0BA 4UCPA 3GKRA 1NSLA 5A28A 3GY9A 3V8IA 3DSBA 3FBUA 4NXYA 4L8AA 4MHDA 4FD6A 2PR1A 2VBQA 2Q7BA 4HNXB 2GE3A 4QB9A 1TIQA 4YRHA 3LODA 2B58A 3EY5A 2Z3NA 2WSAA 3JTKA 3EC4A 2GANA 3QAHA 3VWDA 1CM0A 3F5BA 5KTDA 2BL1A 4KOTA 2G3TA 4KOVA 1YR0A 1S7KA 1XMTA 3DR8A 1S7FA 3K9UA 4C7HA 1FY7A 4HNWB 2BUEA 4CYOA 4A32A 2K5TA 3R96A 4CAEA 4JJXA 1S3ZA 5KTCA 5G22A 2P6FA 1KZFA 4JLYA 4KS9A 2ATRA 1Q2CA 2VQYA 2OU2A 2VZZA 3FIXA 4U5YA 2AJ6A 4BBHA 2REFA 1YX0A 4MI4A 3R9EA 2G3AA 3BJ8A 5GCNA 2B3VA 2PR8A 4A2ZA 4KOSA 4HKFA 4E2AA 4KOWA 4A33A 3OWCA 1S60A 5HMNA 2YNCA 3D2MA 3H4QA 4QBJA 2WPWA 3TE4A 5IX3A 4UFWA 2O28A 4CGPA 3DDDA 4PSXA 2VXKA 4XPDB 3JUWA 4CGMA 1PUAA 4XPDC 2RC4A 1Y9KA 4B11A 4B14A 4I49A 3QB8A 1ON0A 3T90A 3CXPA 4C2XA 2PQ8A 4UFVA 3IU1A 5AG4A 4GS4A 4PK2A 5F46A 1RXTA 1BO4A 3ZZIA 1M4GA 1KUVA 2Z3OA 4PSWA 4CAVA 3EO4A 1IYLA 2P6GA 4A95A 1IICA 2JDDA 2WUUA 2ZW4A 3P2FA 4UA3A 4FD4A 4RI1A 4MFZA 1R57A 4QUSA 5G20A 4KUAA 3CXQA 5J8FA 4KLWA 3W91A 3ZJ0A 2YNCC 4MFKA 2J8NA 1YGHA 2P6EA 4KOXA 4M3SA 5G21A 2F5IA 4KSFA 2PRBA 2AE6A 4R3LA 2YGWA 4L89A 2R98A 3R9FA 1I21A 1U6MA 3R95A 2FL4A 1M4IA 2B4DA 1WK4A 5JQ4A 3SXNA 3EXNA 3FNCA 1M44A 3IWGA 1Q2YA 5F49A 3WR7A 4CGLA 2C27A 4X5KA 1Y9WA 4KOUA 1QSNA 1NE9A 4NSQA 4R9MA 2VEZA 4CAWA 1YREA 1VKCA 3NE7A 4NCZA 4C2ZA 3IWEA 4KVXA 4HNYB 3S6KA 3RYOA 4B13A 3MGDA 1PU9A 2Q04A 5IB0A 4XPLA 3W6XA 2HUZA 1ZO0A 1MJAA 2QECA 2OB0A 3DNSA 2FXFA 3F8KA 2Z3KA 3PGPA 3B8GA 2NMTA 4B5OA 4R57A 1MJ9A 2DXQA 2Q4YA 1V0CA 1XEBA 4CGOA 2ZXVA 2CNSA 1XE4A 2B4DB 2BEIA 3TTHA 3I3GA 5HH1A 2Z10A 4A31A 4CRYB 3PZJA 2GIVA 4CGNA 1IIDA 4A30A 1CJWA 5EC4A 2Z3MA 2Z3LA 2PDOA 4MY3A 1MJBA 2J8MA 5JPHA 1QSOA 4AG7A 4KSAA 1M1DA 2CY2A 1YLEA 4FD7A 3FRMA 2B3UA 1Z4RA 4RS2A 4IF5A 4K30A 4XPKA 1UFHA 1KUXA 4B5PB 2VZYA 2R8VA 3I9SA 4MJ8A 2REEA 4UBRA 4B10A 4XNHB 2B4BA 4MBUA 5H86A 1Z4EA 4YGOA 1I12A 4F6AA 2Z11A 4R3KA 4U9ZA 5I0CA 4IUSA 2PSWA 4KVME 2P0WA 4M85A 4QC6A 3TT2A 3JVNA 3TO6A 4JXQA 4JWPA 3H5ZA 5EBVA 2HQYA 3KKWA 1J4JA 3CXSA 4NF1A 3PP9A 1GHEA 4ONUA 5G1ZA 4KZTA 2IL4A 4U9YA 3TO7A 3TFYA 2ZW6A 1B87A 4C7IA 3SHPA 1YVKA 2QIRA 5KTAA 4ORFA 2JEVA 3R9GA 2CNTA 1NMTA 1LRZA 4Q38A 3C26A 2DPSA 4E8OA 4AB7A 2H5MA 2HV2A 3IGRA 5E96A 5BWAB 5AG6A 1KUYA 1XF8A 2YNEA 4DNCA 2Z3PA 4OLLA 1Q2DA 3BJ7A 1QSMA 2R7HA 2Q44A 1I1DA 5AGEA 5IV0A 2Z0ZA 1VHSA 2QMLA 3TOAA 3W6SA 3FXTA 2CXAA 4AVCA 5C88A 3D2PA 3UY5A 1QSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8R A;  1Y7R A;  2ZW7 A;  1L0C A;  1B6B A;  3F0A A;  4CS0 B;  1YVO A;  5CNP A;  3E0K A;  3S6G A;  1YK3 A;  2A4N A;  4B5P A;  2Y0M A;  1MK4 A;  1OZP A;  1RO5 A;  2Q4V A;  4YFJ A;  2OZH A;  2D4P A;  3GYA A;  2CNM A;  4AG9 A;  4FD5 A;  5F48 A;  1P0H A;  2FIW A;  2D4O A;  4KVO E;  5DWM A;  2I00 A;  1SQH A;  2EVN A;  2PC1 A;  2X7B A;  2OZG A;  2Q0Y A;  1BOB A;  2FE7 A;  4UWJ A;  4KOY A;  2B5G A;  1S7L A;  2ARH A;  3VWE A;  4Y49 B;  2I79 A;  1WWZ A;  4LUA A;  1IB1 E;  4Y49 C;  5C82 A;  4J3G A;  1QSR A;  4PK3 A;  3FB3 A;  4AVA A;  3S6H A;  3P2H A;  3FYN A;  4KLV A;  4F0Y A;  4UWI A;  3N7Z A;  3BLN A;  2FSR A;  4OAD A;  2JDC A;  2KCW A;  3TOB A;  2FIA A;  4JD6 A;  3T9Y A;  2JLM A;  4AVB A;  4LX9 A;  3D8P A;  3LD2 A;  5ISV A;  4PV6 A;  2OH1 A;  3TO9 A;  1P4N A;  4R87 A;  4NEX A;  4XNH C;  1M4D A;  4H6Z A;  5F47 A;  3D3S A;  5H84 A;  2ZW5 A;  5J8C A;  2FT0 A;  2BSW A;  2FCK A;  2OZU A;  1N71 A;  2B5G B;  3EFA A;  3TCV A;  4OAE A;  3SXO A;  5DWN A;  4KOR A;  4H6U A;  1XIX A;  4E0A A;  3R1K A;  4II9 A;  1K4J A;  2EUI A;  2ZPA A;  2VI7 A;  1Z9U A;  3G8W A;  1IYK A;  4ZBG A;  2WPX A;  4EVY A;  3S6F A;  4JXR A;  4QVT A;  2R1I A;  4MY0 A;  2FS5 A;  3DR6 A;  1S5K A;  4CAX A;  4BMH A;  4KUB A;  4CRZ B;  3G3S A;  4H89 A;  1S7N A;  5FVJ A;  2G0B A;  1NSL A;  3GKR A;  3GY9 A;  3V8I A;  3DSB A;  3FBU A;  4NXY A;  4L8A A;  4MHD A;  4FD6 A;  2PR1 A;  2VBQ A;  2Q7B A;  4HNX B;  2GE3 A;  4QB9 A;  1TIQ A;  4YRH A;  3LOD A;  2B58 A;  3EY5 A;  3EC4 A;  2GAN A;  3QAH A;  3VWD A;  1CM0 A;  3F5B A;  5KTD A;  2BL1 A;  4KOT A;  2G3T A;  4KOV A;  1YR0 A;  1S7K A;  1XMT A;  3DR8 A;  1S7F A;  3K9U A;  1FY7 A;  4HNW B;  2BUE A;  2K5T A;  3R96 A;  4JJX A;  1S3Z A;  5KTC A;  2P6F A;  1KZF A;  4JLY A;  2ATR A;  1Q2C A;  2VQY A;  2OU2 A;  2VZZ A;  3FIX A;  4U5Y A;  2AJ6 A;  2REF A;  1YX0 A;  4MI4 A;  3R9E A;  2G3A A;  3BJ8 A;  5GCN A;  2B3V A;  2PR8 A;  4KOS A;  4HKF A;  4E2A A;  4KOW A;  3OWC A;  1S60 A;  5HMN A;  3D2M A;  3H4Q A;  4QBJ A;  2WPW A;  3TE4 A;  5IX3 A;  2O28 A;  3DDD A;  4PSX A;  2VXK A;  4XPD B;  3JUW A;  1PUA A;  4XPD C;  2RC4 A;  1Y9K A;  4I49 A;  3QB8 A;  1ON0 A;  3T90 A;  3CXP A;  2PQ8 A;  4GS4 A;  4PK2 A;  5F46 A;  1RXT A;  1BO4 A;  3ZZI A;  1M4G A;  1KUV A;  4PSW A;  4CAV A;  3EO4 A;  1IYL A;  2P6G A;  1IIC A;  2JDD A;  3P2F A;  2ZW4 A;  4UA3 A;  4FD4 A;  4RI1 A;  1R57 A;  4QUS A;  4KUA A;  3CXQ A;  5J8F A;  4KLW A;  3W91 A;  3ZJ0 A;  2J8N A;  1YGH A;  2P6E A;  4KOX A;  4M3S A;  2F5I A;  2PRB A;  2AE6 A;  4R3L A;  4L89 A;  2R98 A;  3R9F A;  1I21 A;  1U6M A;  3R95 A;  2FL4 A;  1M4I A;  2B4D A;  1WK4 A;  5JQ4 A;  3SXN A;  3EXN A;  3FNC A;  1M44 A;  3IWG A;  1Q2Y A;  5F49 A;  3WR7 A;  2C27 A;  4X5K A;  1Y9W A;  4KOU A;  1QSN A;  1NE9 A;  4NSQ A;  4R9M A;  2VEZ A;  4CAW A;  1YRE A;  1VKC A;  3NE7 A;  4NCZ A;  4KVX A;  4HNY B;  3S6K A;  3RYO A;  3MGD A;  1PU9 A;  2Q04 A;  5IB0 A;  4XPL A;  3W6X A;  2HUZ A;  1MJA A;  2QEC A;  2OB0 A;  3DNS A;  2FXF A;  3F8K A;  3PGP A;  3B8G A;  2NMT A;  4B5O A;  4R57 A;  1MJ9 A;  2DXQ A;  2Q4Y A;  1V0C A;  1XEB A;  2ZXV A;  2CNS A;  1XE4 A;  2B4D B;  2BEI A;  3TTH A;  3I3G A;  5HH1 A;  2Z10 A;  4CRY B;  3PZJ A;  2GIV A;  1IID A;  1CJW A;  5EC4 A;  2PDO A;  4MY3 A;  1MJB A;  2J8M A;  5JPH A;  1QSO A;  4AG7 A;  1M1D A;  2CY2 A;  1YLE A;  4FD7 A;  3FRM A;  2B3U A;  1Z4R A;  4RS2 A;  4IF5 A;  4K30 A;  4XPK A;  1UFH A;  1KUX A;  4B5P B;  2VZY A;  2R8V A;  3I9S A;  4MJ8 A;  2REE A;  4UBR A;  4XNH B;  2B4B A;  4MBU A;  5H86 A;  1Z4E A;  4YGO A;  1I12 A;  4F6A A;  2Z11 A;  4R3K A;  4U9Z A;  5I0C A;  4IUS A;  4M85 A;  2PSW A;  4KVM E;  2P0W A;  4QC6 A;  3TT2 A;  3JVN A;  3TO6 A;  4JXQ A;  4JWP A;  5EBV A;  2HQY A;  3KKW A;  1J4J A;  3CXS A;  4NF1 A;  3PP9 A;  1GHE A;  4ONU A;  3TO7 A;  4KZT A;  2IL4 A;  4U9Y A;  3TFY A;  2ZW6 A;  1B87 A;  3SHP A;  1YVK A;  2QIR A;  5KTA A;  4ORF A;  2JEV A;  3R9G A;  2CNT A;  1NMT A;  1LRZ A;  3C26 A;  4E8O A;  4AB7 A;  2H5M A;  2HV2 A;  3IGR A;  5E96 A;  1KUY A;  1XF8 A;  4DNC A;  4OLL A;  1Q2D A;  3BJ7 A;  1QSM A;  2R7H A;  2Q44 A;  1I1D A;  5IV0 A;  2Z0Z A;  1VHS A;  2QML A;  3TOA A;  3W6S A;  3FXT A;  4AVC A;  5C88 A;  3D2P A;  3UY5 A;  1QST A; 
#chains in the Genus database with same CATH topology
 3I1U A;  2J8R A;  2PIY A;  1Y7R A;  2ZW7 A;  3D7G A;  1L0C A;  1B6B A;  1VHE A;  3F0A A;  3KHX A;  4CS0 B;  1ZLI A;  3PB9 X;  1YVO A;  5CNP A;  3BHX A;  3E0K A;  1LOK A;  4C68 A;  3S6G A;  1YK3 A;  2IMO A;  2A4N A;  2EK9 A;  4R7M A;  4B5P A;  6CPA A;  2Y0M A;  1MK4 A;  1OZP A;  1RO5 A;  1YW6 A;  2ZEG A;  3DLJ A;  2Q4V A;  3LAC A;  4YFJ A;  4BIN A;  2V8D A;  1LCP A;  5D29 A;  1ELM P;  3CPX A;  4MCP A;  4C2Y A;  5AG5 A;  4UCM A;  3FEC A;  2OZH A;  4MFJ A;  2D4P A;  3GYA A;  1GYT A;  2CNM A;  4AG9 A;  4FD5 A;  5F48 A;  1P0H A;  4Q36 A;  2FIW A;  3D7H A;  2D4O A;  3H8G A;  4KVO E;  2I00 A;  1SQH A;  2EVN A;  2PC1 A;  3KGQ A;  1X12 A;  5DWM A;  1EE3 P;  1PYT B;  1Q7L A;  4B12 A;  4ZGY B;  2X7B A;  3KZW A;  2OZG A;  2YND A;  1ARL A;  2DPT A;  2Q0Y A;  4TWE A;  1BOB A;  2FE7 A;  2Q4Z A;  3B3S A;  4MCQ A;  4UWJ A;  4KOY A;  2B5G A;  1S7L A;  2ARH A;  3RNZ A;  1LAP A;  3VWE A;  4Y49 B;  2I79 A;  4MFQ A;  4WJB A;  1WWZ A;  4LUA A;  1IB1 E;  2ZEM A;  4X3R A;  4Y49 C;  5C82 A;  4J3G A;  4CAF A;  1QSR A;  1YW4 A;  3FB3 A;  3QAY A;  4OKO A;  3A9L A;  4PK3 A;  4AVA A;  3S6H A;  3P2H A;  4MFL A;  3FYN A;  5LYI A;  4UF4 A;  2GFQ A;  3KL9 A;  4KLV A;  1F2P A;  3GIU A;  4PPZ A;  4F0Y A;  4UWI A;  2EK8 A;  2BOA A;  3N7Z A;  2PJ1 A;  4OME A;  3BLN A;  2FSR A;  4OAD A;  2JDC A;  4F9V A;  3NH5 A;  2KCW A;  3TOB A;  1LAN A;  2FIA A;  4JD6 A;  3T9Y A;  4NGN A;  4A94 A;  3VH9 A;  4M6I A;  3HLP A;  4IHM A;  2PJB A;  2V77 A;  4H2K A;  4OC2 A;  3IEH A;  2JLM A;  5DS0 A;  5A27 A;  4GXH A;  4AVB A;  3GUX A;  4LX9 A;  3D8P A;  3LD2 A;  5ISV A;  2QVP A;  3QNV A;  4PV6 A;  3SI1 A;  5F09 A;  2AFS A;  3IU2 A;  2OH1 A;  3TO9 A;  1P4N A;  4R87 A;  4NEX A;  1ARM A;  2V8G A;  1XRY A;  3PBB A;  4NFR A;  4XNH C;  1M4D A;  4H6Z A;  5F47 A;  3D3S A;  5H84 A;  2ZW5 A;  2OOT A;  5AG7 A;  1YME A;  5J8C A;  2FT0 A;  1BAV A;  2BSW A;  2PJ6 A;  4P4I A;  2FCK A;  2OZU A;  3RZA A;  1N71 A;  2B5G B;  3PB4 X;  2GU2 A;  3EFA A;  3TCV A;  4FBE A;  4OAE A;  3SXO A;  2PRQ A;  5DWN A;  4OP4 A;  4P10 A;  4UFX A;  4KOR A;  4H6U A;  4UCN A;  2Q51 A;  5I4M A;  1XIX A;  2C1C A;  4E0A A;  3R1K A;  4R6T A;  4CYN A;  1CP7 A;  4II9 A;  2PJC A;  4CYQ A;  4F0X A;  4UEZ A;  5HVG A;  2F8H A;  1K4J A;  3PB7 X;  3WC7 A;  4Q7A A;  2EUI A;  2ABZ A;  2ZPA A;  1CP6 A;  2VI7 A;  2PJ0 A;  1Z9U A;  2O53 A;  7CPA A;  4A37 A;  3G8W A;  1IYK A;  2GLJ A;  4ZBG A;  1Z8X A;  2PJA A;  1AUG A;  4ZY1 A;  1Y0Y A;  2WPX A;  4EVY A;  3S6F A;  2C6G A;  4JXR A;  2Q43 A;  4P45 A;  4QVT A;  3WAB A;  2HC9 A;  2R1I A;  2PJ8 A;  4MY0 A;  2FS5 A;  3DR6 A;  1S5K A;  1CG2 A;  2WZN A;  1F57 A;  4CAX A;  1TXR A;  4BMH A;  4KUB A;  2RFH A;  4UEE A;  4MHY A;  2ZEH A;  4CRZ B;  3TC8 A;  3G3S A;  4MFP A;  4H89 A;  1S7N A;  1OBR A;  5FVJ A;  4CYP A;  1DTD A;  1HDQ A;  2CF4 A;  2G0B A;  2IJZ A;  2ZOG A;  4UCP A;  3GKR A;  1NSL A;  5A28 A;  3GY9 A;  4YU9 A;  2XEI A;  1R43 A;  5JH9 A;  3D68 A;  3DSB A;  3FBU A;  4MMO A;  3SJX A;  3V8I A;  4NXY A;  4L8A A;  4MHD A;  3IWW A;  4FD6 A;  3PB8 X;  2PR1 A;  2VBQ A;  3TX8 A;  2Q7B A;  3T8W A;  4HNX B;  2GE3 A;  2QJ8 A;  4QB9 A;  1R3N A;  2Q7S A;  1TIQ A;  4YRH A;  3BXM A;  1XFO A;  1F2O A;  5D8N A;  5CPA A;  1CX8 A;  1Y0R A;  3LOD A;  2B58 A;  3EY5 A;  1M4L A;  2F7V A;  2Z3N A;  2WSA A;  3JTK A;  3EC4 A;  4W9Y A;  4A39 A;  2GAN A;  3QAH A;  3VWD A;  1CM0 A;  3FJU A;  1RTQ A;  3F5B A;  4OC1 A;  5KTD A;  2BL1 A;  1IY7 A;  4KOT A;  2G3T A;  4KOV A;  3B3C A;  1YR0 A;  1S7K A;  1XMT A;  3DR8 A;  1S7F A;  4PQA A;  3K9U A;  4C7H A;  3KQX A;  1FY7 A;  5K8N A;  4HNW B;  2BUE A;  3WT4 A;  2JBJ A;  4CYO A;  1LFW A;  2NSM A;  2K5T A;  4A32 A;  1XBU A;  2EBJ A;  2WYR A;  4FWU A;  3R96 A;  1TF8 A;  4CAE A;  5HXD A;  4JJX A;  2JBK A;  3RO0 A;  2VL1 A;  1S3Z A;  1BPM A;  4Z65 A;  5KTC A;  5G22 A;  2P6F A;  2V8V A;  3N5F A;  1YSJ A;  2HB6 A;  3S9N A;  5JM6 A;  1KZF A;  4JLY A;  4KS9 A;  2ATR A;  1Q2C A;  2VQY A;  1DE4 C;  1AYE A;  2OU2 A;  2VZZ A;  3FIX A;  4U5Y A;  1H8L A;  2AJ6 A;  5K8M A;  4BBH A;  3D7F A;  3S9M A;  2REF A;  3PBE A;  1YX0 A;  3H8F A;  3VAR A;  2G9D A;  4MI4 A;  2PE3 A;  3WC6 A;  2PJ9 A;  3R9E A;  3B7I A;  2G3A A;  3BJ8 A;  3RAM A;  4ONW A;  5GCN A;  2B3V A;  2PR8 A;  4A2Z A;  3CZX A;  2PJ5 A;  4KOS A;  5LRG A;  4OC5 A;  2ZEL A;  4EME A;  2DEA A;  4HKF A;  4B6Z A;  4E2A A;  1ZG8 A;  3IJ3 A;  4KOW A;  4A33 A;  3OWC A;  4OID A;  1S60 A;  5HMN A;  2YNC A;  4NJQ A;  1UWY A;  3D2M A;  3K9T A;  5ELY A;  2NYQ A;  3H4Q A;  4QBJ A;  2WPW A;  3WC5 A;  3TE4 A;  5IX3 A;  3LMS A;  4UFW A;  1TKF A;  4OIW A;  2O28 A;  4CGP A;  3DDD A;  4PSX A;  2VXK A;  2AFW A;  3ISZ A;  4XPD B;  3GLJ A;  1ZG9 A;  3JUW A;  4CGM A;  4MXU A;  1PUA A;  4XPD C;  2AFZ A;  2RC4 A;  1Y9K A;  4B11 A;  4B14 A;  1ELL P;  3QB8 A;  4I49 A;  1ON0 A;  3T90 A;  3IO1 A;  1ZLH A;  3D67 A;  5HVF A;  3CXP A;  3H8E A;  4C2X A;  2PQ8 A;  4UFV A;  3IU1 A;  4UIB A;  4DYO A;  1IOI A;  5AG4 A;  1IU8 A;  4GS4 A;  1IGB A;  4PK2 A;  3IC1 A;  3NA6 A;  1RXT A;  3NH4 A;  1BO4 A;  4P4J A;  2FVG A;  4P4E A;  3ZZI A;  4X8I A;  2C6C A;  1M4G A;  4GM5 A;  1KUV A;  2Z3O A;  4PSW A;  4CAV A;  4RUH A;  3EO4 A;  1IYL A;  1Z2L A;  3D4U A;  3V7Z A;  1CPS A;  4M6G A;  5THW A;  1ZG7 A;  2P6G A;  3MRU A;  4LQG A;  4NGS A;  1IIC A;  2JDD A;  2WUU A;  1LAM A;  2ZW4 A;  3P2F A;  4PXE A;  4UA3 A;  4A95 A;  4FD4 A;  2EO8 A;  2V8H A;  4RI1 A;  4MFZ A;  1R57 A;  5JGF A;  4QUS A;  4NGP A;  1JWQ A;  4PXD A;  4F9U A;  5G20 A;  4KUA A;  3CXQ A;  5J8F A;  4KLW A;  3W91 A;  4FUU A;  3ZJ0 A;  2J9A A;  4OC0 A;  2YNC C;  4MFK A;  5LYL A;  2J8N A;  4MCR A;  1YGH A;  1BPN A;  2XEG A;  3CPA A;  4DJL A;  1YQE A;  2P6E A;  4KOX A;  4M3S A;  5G21 A;  2F5I A;  4KSF A;  2PRB A;  1Z8L A;  2CTC A;  2AE6 A;  5K8O A;  4R3L A;  2YGW A;  4WWV A;  5LRJ A;  2AFM A;  3PRT A;  4L89 A;  2R98 A;  3R9F A;  1I21 A;  1U6M A;  3R95 A;  2FL4 A;  1M4I A;  2B4D A;  1WK4 A;  4JYW A;  4UIA A;  3SXN A;  3EXN A;  4P4D A;  5JQ4 A;  3FNC A;  1M44 A;  1Z8T A;  3IWG A;  2POK A;  1Q2Y A;  4O23 A;  5F49 A;  2AFX A;  3WR7 A;  4EWT A;  4CGL A;  2C27 A;  4X5K A;  1Y9W A;  4KOU A;  1QSN A;  3PFE A;  1NE9 A;  4NSQ A;  4G1P A;  4NJR A;  2VEZ A;  4R9M A;  5LYD A;  4CAW A;  1YRE A;  4ZYQ A;  2AFO A;  4F8Z A;  1VKC A;  2ZEO A;  3NE7 A;  4NCZ A;  2I3C A;  2ZEE A;  2EWB A;  1Z8W A;  3IWE A;  4C2Z A;  3KHZ A;  3B3V A;  2ODF A;  4KVX A;  4ZX8 A;  4NGQ A;  4HNY B;  1YLO A;  4NGM A;  4ZY0 A;  3B3T A;  1VIX A;  3S6K A;  3KR4 A;  2BO9 A;  3BI1 A;  3RYO A;  4B13 A;  8CPA A;  3MGD A;  1PU9 A;  2ZOF A;  2Q04 A;  2XEJ A;  2PJ3 A;  4XPL A;  5IB0 A;  3W6X A;  2HUZ A;  1ZO0 A;  1MJA A;  2QEC A;  4NGR A;  2OB0 A;  3DNS A;  2ZEP A;  2FXF A;  3F8K A;  2Z3K A;  5EMI A;  2DF5 A;  3PGP A;  2C6P A;  3B8G A;  1NSA A;  1KWM A;  2NMT A;  4IAV A;  4B5O A;  4R57 A;  4P44 A;  1MJ9 A;  3FX6 A;  2DXQ A;  2Q4Y A;  4K3N A;  4JZ0 A;  1V0C A;  1XEB A;  3DGV A;  4TNU A;  5F46 A;  3SJG A;  2CNS A;  2ZXV A;  4CGO A;  1XE4 A;  2B4D B;  2BEI A;  3TTH A;  3I3G A;  5HH1 A;  2Z10 A;  3ISX A;  3L2N A;  4RN7 A;  4A31 A;  4CRY B;  3PZJ A;  2CIJ A;  1XOV A;  4R8F A;  1Y7E A;  4BD9 A;  2GIV A;  5HVH A;  4IK2 A;  4CGN A;  1IID A;  5J1Q A;  4A30 A;  3D66 A;  1CJW A;  5EC4 A;  2Z3M A;  3IFE A;  2JEW A;  3NE8 A;  2Z3L A;  3MN8 A;  4MHZ A;  1X10 A;  2PDO A;  1A2Z A;  3FEE A;  4MY3 A;  3FED A;  3PB6 X;  1MJB A;  2J8M A;  5JPH A;  2GLF A;  2PVV A;  3SJF A;  1QSO A;  2QYV A;  4OC3 A;  4YWY A;  3K2K A;  4AG7 A;  4OC4 A;  4KSA A;  4CPA A;  4NGT A;  4PXB A;  5CBM A;  1XMB A;  1M1D A;  4P4F A;  2CY2 A;  1YLE A;  3CT9 A;  4FD7 A;  2PCU A;  3FRM A;  2B3U A;  1Z4R A;  3SI2 A;  3FH4 A;  5K8P A;  4RS2 A;  4IF5 A;  3B2Y A;  1VGY A;  1IOF A;  4K30 A;  4XPK A;  3D7D A;  1UFH A;  3NH8 A;  2PJ2 A;  4P6Y A;  1KUX A;  4UEF A;  2ANP A;  4B5P B;  4R76 A;  4MRI A;  2VZY A;  2ZEF A;  2R8V A;  3I9S A;  2PVW A;  5LYF A;  3VAT A;  1QMU A;  4MJ8 A;  1TKJ A;  2REE A;  3B3W A;  3HUV A;  4LQ6 A;  4UBR A;  4B10 A;  1PCA A;  3KQZ A;  1CPX A;  2OR4 A;  1QQ9 A;  3JRU A;  4XNH B;  2B4B A;  3PFO A;  4MBU A;  5H86 A;  1Z4E A;  3BI0 A;  4YGO A;  4ZI6 A;  1I12 A;  3FF3 A;  4F6A A;  4HPS A;  4ZX9 A;  2ZED A;  3S9L A;  2Z11 A;  4R3K A;  4U9Z A;  5I0C A;  4IUS A;  4MHP A;  2PSW A;  4KVM E;  2P0W A;  4M85 A;  4QC6 A;  2CTB A;  3B35 A;  3GB0 A;  3JVN A;  3PEI A;  3TO6 A;  3TT2 A;  4JXQ A;  3FVL A;  4JWP A;  3H5Z A;  5EBV A;  2HQY A;  3KKW A;  1FT7 A;  3V38 A;  3RBU A;  1J4J A;  3CXS A;  1CBX A;  4NF1 A;  1BLL E;  3PP9 A;  1GHE A;  1TF9 A;  4ONU A;  5G1Z A;  1AMP A;  2IL4 A;  4KZT A;  4U9Y A;  3TO7 A;  2ZW6 A;  3TFY A;  1B87 A;  1HDU A;  4PXC A;  4C7I A;  3SHP A;  1YVK A;  2PJ7 A;  2QIR A;  4ORF A;  4X2T A;  5KTA A;  3KI9 A;  2JEV A;  3R9G A;  1XJO A;  2CNT A;  3IIB A;  4KSI A;  1JQG A;  4MHN A;  1NMT A;  1LRZ A;  4Q38 A;  3C26 A;  2DPS A;  4E8O A;  4EFD A;  4FAI A;  2O4H A;  4AB7 A;  2H5M A;  2PJ4 A;  3SJE A;  4A38 A;  4M6H A;  4ZY2 A;  3SI0 A;  2HV2 A;  3IGR A;  5E96 A;  2AFU A;  5BWA B;  5AG6 A;  1KUY A;  1XF8 A;  2YNE A;  4DNC A;  3LWU A;  2Z3P A;  4OLL A;  1Q2D A;  3KAS A;  2GRE A;  3KR5 A;  3BJ7 A;  4MCS A;  2IQ6 A;  1VHO A;  2PIZ A;  1QSM A;  4P4B A;  2R7H A;  2Q44 A;  1I1D A;  2RB7 A;  3CDX A;  5AGE A;  5IV0 A;  5IB9 A;  4DUK A;  5LRK A;  2Z0Z A;  2XEF A;  1TKH A;  1FNO A;  1VHS A;  1Z5R A;  2QML A;  3TOA A;  3W6S A;  2BCO A;  2CXA A;  1HEE A;  3FXT A;  2ZEN A;  3NFZ A;  4AVC A;  3FMC A;  5C88 A;  3D2P A;  3UY5 A;  4AXV A;  1QST A; 
#chains in the Genus database with same CATH homology
 2J8R A;  1Y7R A;  2ZW7 A;  1L0C A;  1B6B A;  3F0A A;  4CS0 B;  1YVO A;  5CNP A;  3E0K A;  4C68 A;  3S6G A;  1YK3 A;  2A4N A;  4B5P A;  2Y0M A;  1MK4 A;  1OZP A;  1RO5 A;  2Q4V A;  4YFJ A;  4C2Y A;  5AG5 A;  4UCM A;  2OZH A;  4MFJ A;  2D4P A;  3GYA A;  2CNM A;  4AG9 A;  4FD5 A;  5F48 A;  1P0H A;  4Q36 A;  2FIW A;  2D4O A;  4KVO E;  5DWM A;  2I00 A;  1SQH A;  2EVN A;  2PC1 A;  4ZGY B;  4B12 A;  2X7B A;  2OZG A;  2YND A;  2DPT A;  2Q0Y A;  1BOB A;  2FE7 A;  4UWJ A;  4KOY A;  2B5G A;  1S7L A;  2ARH A;  3VWE A;  4Y49 B;  2I79 A;  4MFQ A;  1WWZ A;  4LUA A;  1IB1 E;  4Y49 C;  5C82 A;  4J3G A;  4CAF A;  1QSR A;  4PK3 A;  3FB3 A;  4AVA A;  3A9L A;  3S6H A;  3P2H A;  4MFL A;  3FYN A;  4KLV A;  4F0Y A;  4UWI A;  3N7Z A;  3BLN A;  2FSR A;  4OAD A;  2JDC A;  2KCW A;  3TOB A;  2FIA A;  4JD6 A;  3T9Y A;  5A27 A;  2JLM A;  4AVB A;  4LX9 A;  3D8P A;  3LD2 A;  5ISV A;  4PV6 A;  3IU2 A;  2OH1 A;  3TO9 A;  1P4N A;  4R87 A;  4NEX A;  4XNH C;  1M4D A;  4H6Z A;  5F47 A;  3D3S A;  5H84 A;  2ZW5 A;  5J8C A;  5AG7 A;  2FT0 A;  2BSW A;  2FCK A;  2OZU A;  1N71 A;  2B5G B;  3EFA A;  3TCV A;  4OAE A;  3SXO A;  5DWN A;  4UFX A;  4UCN A;  4KOR A;  4H6U A;  1XIX A;  4E0A A;  3R1K A;  4CYN A;  4II9 A;  4CYQ A;  4F0X A;  1K4J A;  2EUI A;  2ZPA A;  2VI7 A;  1Z9U A;  3G8W A;  1IYK A;  4ZBG A;  2WPX A;  4EVY A;  3S6F A;  4JXR A;  4QVT A;  2R1I A;  4MY0 A;  2FS5 A;  3DR6 A;  1S5K A;  4CAX A;  4BMH A;  4KUB A;  4CRZ B;  3G3S A;  4MFP A;  4H89 A;  1S7N A;  5FVJ A;  4CYP A;  2G0B A;  4UCP A;  3GKR A;  1NSL A;  5A28 A;  3GY9 A;  3V8I A;  3DSB A;  3FBU A;  4NXY A;  4L8A A;  4MHD A;  4FD6 A;  2PR1 A;  2VBQ A;  2Q7B A;  4HNX B;  2GE3 A;  4QB9 A;  1TIQ A;  4YRH A;  3LOD A;  2B58 A;  3EY5 A;  2Z3N A;  2WSA A;  3JTK A;  3EC4 A;  2GAN A;  3QAH A;  3VWD A;  1CM0 A;  3F5B A;  5KTD A;  2BL1 A;  4KOT A;  2G3T A;  4KOV A;  1YR0 A;  1S7K A;  1XMT A;  3DR8 A;  1S7F A;  3K9U A;  4C7H A;  1FY7 A;  4HNW B;  2BUE A;  4CYO A;  4A32 A;  2K5T A;  3R96 A;  4CAE A;  4JJX A;  1S3Z A;  5KTC A;  5G22 A;  2P6F A;  1KZF A;  4JLY A;  4KS9 A;  2ATR A;  1Q2C A;  2VQY A;  2OU2 A;  2VZZ A;  3FIX A;  4U5Y A;  2AJ6 A;  4BBH A;  2REF A;  1YX0 A;  4MI4 A;  3R9E A;  2G3A A;  3BJ8 A;  5GCN A;  2B3V A;  2PR8 A;  4A2Z A;  4KOS A;  4HKF A;  4E2A A;  4KOW A;  4A33 A;  3OWC A;  1S60 A;  5HMN A;  2YNC A;  3D2M A;  3H4Q A;  4QBJ A;  2WPW A;  3TE4 A;  5IX3 A;  4UFW A;  2O28 A;  4CGP A;  3DDD A;  4PSX A;  2VXK A;  4XPD B;  3JUW A;  4CGM A;  1PUA A;  4XPD C;  2RC4 A;  1Y9K A;  4B11 A;  4B14 A;  4I49 A;  3QB8 A;  1ON0 A;  3T90 A;  3CXP A;  4C2X A;  2PQ8 A;  4UFV A;  3IU1 A;  5AG4 A;  4GS4 A;  4PK2 A;  5F46 A;  1RXT A;  1BO4 A;  3ZZI A;  1M4G A;  1KUV A;  2Z3O A;  4PSW A;  4CAV A;  3EO4 A;  1IYL A;  2P6G A;  4A95 A;  1IIC A;  2JDD A;  2WUU A;  2ZW4 A;  3P2F A;  4UA3 A;  4FD4 A;  4RI1 A;  4MFZ A;  1R57 A;  4QUS A;  5G20 A;  4KUA A;  3CXQ A;  5J8F A;  4KLW A;  3W91 A;  3ZJ0 A;  2YNC C;  4MFK A;  2J8N A;  1YGH A;  2P6E A;  4KOX A;  4M3S A;  5G21 A;  2F5I A;  4KSF A;  2PRB A;  2AE6 A;  4R3L A;  2YGW A;  4L89 A;  2R98 A;  3R9F A;  1I21 A;  1U6M A;  3R95 A;  2FL4 A;  1M4I A;  2B4D A;  1WK4 A;  5JQ4 A;  3SXN A;  3EXN A;  3FNC A;  1M44 A;  3IWG A;  1Q2Y A;  5F49 A;  3WR7 A;  4CGL A;  2C27 A;  4X5K A;  1Y9W A;  4KOU A;  1QSN A;  1NE9 A;  4NSQ A;  4R9M A;  2VEZ A;  4CAW A;  1YRE A;  1VKC A;  3NE7 A;  4NCZ A;  4C2Z A;  3IWE A;  4KVX A;  4HNY B;  3S6K A;  3RYO A;  4B13 A;  3MGD A;  1PU9 A;  2Q04 A;  5IB0 A;  4XPL A;  3W6X A;  2HUZ A;  1ZO0 A;  1MJA A;  2QEC A;  2OB0 A;  3DNS A;  2FXF A;  3F8K A;  2Z3K A;  3PGP A;  3B8G A;  2NMT A;  4B5O A;  4R57 A;  1MJ9 A;  2DXQ A;  2Q4Y A;  1V0C A;  1XEB A;  4CGO A;  2ZXV A;  2CNS A;  1XE4 A;  2B4D B;  2BEI A;  3TTH A;  3I3G A;  5HH1 A;  2Z10 A;  4A31 A;  4CRY B;  3PZJ A;  2GIV A;  4CGN A;  1IID A;  4A30 A;  1CJW A;  5EC4 A;  2Z3M A;  2Z3L A;  2PDO A;  4MY3 A;  1MJB A;  2J8M A;  5JPH A;  1QSO A;  4AG7 A;  4KSA A;  1M1D A;  2CY2 A;  1YLE A;  4FD7 A;  3FRM A;  2B3U A;  1Z4R A;  4RS2 A;  4IF5 A;  4K30 A;  4XPK A;  1UFH A;  1KUX A;  4B5P B;  2VZY A;  2R8V A;  3I9S A;  4MJ8 A;  2REE A;  4UBR A;  4B10 A;  4XNH B;  2B4B A;  4MBU A;  5H86 A;  1Z4E A;  4YGO A;  1I12 A;  4F6A A;  2Z11 A;  4R3K A;  4U9Z A;  5I0C A;  4IUS A;  2PSW A;  4KVM E;  2P0W A;  4M85 A;  4QC6 A;  3TT2 A;  3JVN A;  3TO6 A;  4JXQ A;  4JWP A;  3H5Z A;  5EBV A;  2HQY A;  3KKW A;  1J4J A;  3CXS A;  4NF1 A;  3PP9 A;  1GHE A;  4ONU A;  5G1Z A;  4KZT A;  2IL4 A;  4U9Y A;  3TO7 A;  3TFY A;  2ZW6 A;  1B87 A;  4C7I A;  3SHP A;  1YVK A;  2QIR A;  5KTA A;  4ORF A;  2JEV A;  3R9G A;  2CNT A;  1NMT A;  1LRZ A;  4Q38 A;  3C26 A;  2DPS A;  4E8O A;  4AB7 A;  2H5M A;  2HV2 A;  3IGR A;  5E96 A;  5BWA B;  5AG6 A;  1KUY A;  1XF8 A;  2YNE A;  4DNC A;  2Z3P A;  4OLL A;  1Q2D A;  3BJ7 A;  1QSM A;  2R7H A;  2Q44 A;  1I1D A;  5AGE A;  5IV0 A;  2Z0Z A;  1VHS A;  2QML A;  3TOA A;  3W6S A;  3FXT A;  2CXA A;  4AVC A;  5C88 A;  3D2P A;  3UY5 A;  1QST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...