2Z10A

Crystal structure of putative acetyltransferase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
188
structure length
187
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosomal-protein-alanine acetyltransferase
publication title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography
pubmed doi rcsb
source organism Thermus thermophilus
total genus 59
structure length 187
sequence length 188
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2z10A00
5IX3A 4CS0B 5F48A 3IGRA 3DSBA 1Z4RA 3I3GA 4JLYA 1B6BA 3C26A 3FXTA 1IIDA 3DR6A 2PR8A 1PUAA 3W6SA 2ZPAA 1ON0A 2ZW7A 3TO7A 1S3ZA 4ONUA 4M3SA 2Q44A 3GY9A 4KOYA 1M44A 5IV0A 4MBUA 2G3TA 4IF5A 1R57A 4NEXA 3B8GA 2J8MA 2REFA 1M4GA 4R3KA 2GE3A 2QIRA 2PDOA 3IWGA 2WPXA 1PU9A 4U9ZA 2B4DB 3S6HA 4KVXA 2Z10A 1J4JA 4R9MA 1QSTA 5HH1A 2FXFA 2AE6A 1I1DA 3KKWA 5E96A 4KLWA 3W6XA 3P2HA 1KUXA 3OWCA 3S6FA 1L0CA 4UBRA 5J8CA 2O28A 2PR1A 2OH1A 4KOVA 4LUAA 1XE4A 3G3SA 4R87A 4ZBGA 2P6FA 1KZFA 2KCWA 3NE7A 4JXQA 5KTAA 1KUYA 1QSNA 4KUAA 4AB7A 5IB0A 4F0YA 4KUBA 3FNCA 2PQ8A 4XNHB 4PSXA 2B3VA 2OZGA 1SQHA 5J8FA 3QAHA 5FVJA 4JWPA 2QECA 4L8AA 4PK2A 2VI7A 3TE4A 2GANA 4ORFA 4FD6A 1YK3A 4XPDB 2HV2A 2G0BA 2P6EA 2VEZA 3EC4A 4CRYB 1YVKA 4QUSA 1IICA 4LX9A 1QSOA 1P0HA 1S60A 2RC4A 1N71A 2FE7A 5KTCA 3SHPA 3F0AA 2B58A 1NE9A 3F5BA 3K9UA 1CJWA 3N7ZA 2X7BA 4K30A 2FT0A 3H4QA 4NF1A 1M4IA 5C82A 4R3LA 4Y49B 2R1IA 3VWDA 2B5GB 4AG7A 4KZTA 4XNHC 1XEBA 3R95A 3FRMA 3T9YA 4UA3A 5F49A 3W91A 1GHEA 3PP9A 4PV6A 3D2MA 2VBQA 3BLNA 1YX0A 3FIXA 4UWIA 4MI4A 3FYNA 4BMHA 4B5OA 1S5KA 4UWJA 1XF8A 4JXRA 1UFHA 4KOUA 4IUSA 2P6GA 4XPDC 3TOBA 2B5GA 1I12A 2F5IA 2DXQA 2Z11A 4AVAA 4KLVA 5JPHA 1OZPA 3R96A 1MJBA 2PRBA 2Y0MA 5DWNA 3ZJ0A 4XPKA 1VKCA 2BSWA 2REEA 3PGPA 1RXTA 3FBUA 4Y49C 2FL4A 1CM0A 2VQYA 3UY5A 2BEIA 1XIXA 4PK3A 4I49A 4KORA 2J8NA 3TOAA 1VHSA 2Q04A 2D4PA 3GYAA 4L89A 2VZYA 2CNTA 3LD2A 4CAVA 4AG9A 1B87A 4OADA 4B5PB 2Q4YA 4HNXB 1YR0A 1BO4A 2Z0ZA 5CNPA 4AVBA 4MJ8A 4QC6A 4NSQA 1BOBA 4U5YA 1M1DA 1WK4A 1K4JA 3D3SA 2AJ6A 3ZZIA 4II9A 2JDDA 4B5PA 2ZW5A 2OB0A 2PSWA 4OAEA 1Q2CA 5C88A 4MY0A 3JUWA 4PSWA 3CXQA 3DR8A 1QSMA 3JVNA 4E0AA 2I79A 4YRHA 1FY7A 5KTDA 1Q2YA 1Y9WA 2EUIA 4R57A 3BJ8A 2C27A 5DWMA 2H5MA 4YFJA 1IB1E 3TFYA 2VZZA 3MGDA 4GS4A 1MJAA 4KOWA 5ISVA 1KUVA 3SXOA 2ZW6A 3S6KA 4E2AA 5HMNA 1YREA 4XPLA 1WWZA 3E0KA 3WR7A 5GCNA 1S7FA 2HUZA 5EC4A 1U6MA 2A4NA 5I0CA 4QVTA 1RO5A 2K5TA 4CAWA 2EVNA 2GIVA 2ATRA 4CAXA 5EBVA 5F46A 1TIQA 2IL4A 3CXPA 1M4DA 2R7HA 2BL1A 2ARHA 1MK4A 3EXNA 2Q4VA 3V8IA 2Q0YA 4U9YA 3SXNA 2R8VA 1NSLA 1Y9KA 3R9FA 1S7NA 1QSRA 3LODA 2P0WA 3TCVA 3QB8A 3DNSA 2PC1A 5H84A 2FIAA 2OZUA 3PZJA 3GKRA 3EY5A 3TT2A 3VWEA 1S7LA 4H6UA 4MHDA 2ZXVA 2CY2A 3R9GA 1Q2DA 2JDCA 4EVYA 2WPWA 3TO9A 4M85A 1S7KA 3DDDA 4FD7A 4HKFA 4HNWB 4KVOE 3D8PA 5JQ4A 1I21A 4E8OA 2I00A 2B4DA 2ZW4A 1P4NA 1LRZA 4J3GA 4RS2A 2QMLA 1IYKA 2OZHA 2FCKA 4QB9A 1V0CA 4JD6A 4KVME 3R9EA 1IYLA 3EFAA 4H6ZA 2J8RA 4NCZA 2Q7BA 3R1KA 1XMTA 3CXSA 3RYOA 4AVCA 2OU2A 4RI1A 4H89A 2NMTA 3TTHA 4FD4A 2CNSA 5F47A 2JEVA 3BJ7A 3TO6A 4CRZB 4KOXA 2G3AA 2FS5A 2FIWA 3S6GA 4KOTA 3P2FA 2BUEA 4OLLA 3FB3A 1Z4EA 1Z9UA 4F6AA 1NMTA 2HQYA 3EO4A 2B3UA 1YLEA 1YGHA 3G8WA 4MY3A 4YGOA 1YVOA 1MJ9A 4HNYB 4FD5A 3D2PA 2R98A 3I9SA 4DNCA 2FSRA 1Y7RA 4NXYA 4X5KA 3F8KA 2B4BA 4QBJA 3T90A 2CNMA 4JJXA 2D4OA 2VXKA 5H86A 2JLMA 4KOSA
chains in the Genus database with same CATH superfamily
5IX3A 1XRYA 4CS0B 1Z2LA 4OMEA 5F48A 3IGRA 5K8OA 3DSBA 5J8CA 1Z4RA 4P10A 3I3GA 4JLYA 1B6BA 3C26A 3FXTA 1IIDA 2Q7SA 2CXAA 3QNVA 5CPAA 3DR6A 3HLPA 3SJGA 2PR8A 1JQGA 2ZEGA 1PUAA 3W6SA 2ZPAA 3N5FA 2JBJA 3RBUA 1ON0A 3LWUA 5DS0A 1PCAA 2ZW7A 3SI1A 3KQXA 3TO7A 1BAVA 4CGMA 4C2ZA 1S3ZA 3IC1A 4ONUA 2GU2A 4M3SA 2RB7A 1VHOA 2Q44A 3GY9A 4KOYA 1M44A 5IV0A 2V8VA 5LRJA 4MBUA 2G3TA 4IF5A 1R57A 4KS9A 4NEXA 3B8GA 3NA6A 2J8MA 2GREA 1M4GA 2REFA 2GE3A 4R3KA 4C7HA 2QIRA 3WC5A 3PB8X 4F9VA 3KQZA 2PDOA 1HDUA 2ZEMA 3IWGA 2WPXA 1PU9A 1Y0YA 2B4DB 4MMOA 4NGTA 2DPTA 4OC1A 4U9ZA 3D7GA 4KVXA 3S6HA 1H8LA 2Z10A 1TKFA 4NGSA 5HVHA 1J4JA 4R9MA 4YU9A 1QSTA 5HH1A 4MFKA 1KWMA 2FXFA 2AE6A 1TF8A 3KL9A 1I1DA 1UWYA 4TNUA 5G22A 2PIYA 5HVFA 1X12A 3KKWA 5E96A 4PXCA 5HVGA 1LOKA 4KLWA 4F0XA 3W6XA 4A39A 2EWBA 5K8PA 3P2HA 4OC5A 4LQ6A 1KUXA 3D7FA 4NGPA 3WC7A 4A32A 3OWCA 1LAPA 1L0CA 2ZENA 4UBRA 1BLLE 3S6FA 4CYPA 3PBBA 1AYEA 3TC8A 2O28A 1CX8A 2WYRA 2ZOGA 1ELLP 3B7IA 5AGEA 1DE4C 2PR1A 3PB4X 2OH1A 1Z8LA 2V77A 2ZEPA 4KOVA 4LUAA 4B10A 4P6YA 1XE4A 3CPXA 1IOFA 3G3SA 4R87A 4ZBGA 2P6FA 1KZFA 2KCWA 3NE7A 4JXQA 4MRIA 1KUYA 1QSNA 4KUAA 4B6ZA 2Z3KA 3RZAA 4MCRA 5KTAA 4AB7A 5IB0A 3IU2A 3KHXA 4FBEA 2EK9A 4F0YA 5A27A 3K9TA 4KUBA 1FT7A 2PVWA 2PQ8A 3FNCA 4XNHB 3JTKA 4PSXA 2B3VA 2OZGA 1SQHA 5J8FA 3QAHA 1GYTA 2WZNA 5FVJA 4JWPA 4CYNA 2QECA 4L8AA 3D67A 4PK2A 3IWEA 2F7VA 3I1UA 3PFEA 4CGNA 2OR4A 2PJ6A 5G21A 1A2ZA 1TF9A 4Z65A 2VI7A 5JH9A 4CYQA 4A94A 3TE4A 2GANA 2PJAA 4UF4A 4ORFA 4OP4A 4FD6A 1YK3A 3T8WA 4NJRA 4XPDB 5THWA 3IJ3A 1PYTB 2HV2A 3FX6A 3SJXA 3S9NA 2G0BA 2P6EA 2ZEDA 3FH4A 2VEZA 3FECA 3EC4A 4PXEA 1YVKA 4R76A 4CRYB 2POKA 4EMEA 4QUSA 1IICA 4LX9A 1IY7A 1QSOA 1P0HA 1S60A 2RC4A 4A30A 4UCPA 3MN8A 1N71A 2FE7A 5KTCA 2PJ5A 3SHPA 3F0AA 2B58A 1NE9A 5AG6A 3F5BA 3HUVA 3K9UA 4A95A 5AG4A 1CJWA 3N7ZA 2C6GA 2X7BA 2AFXA 4K30A 2FT0A 2CTCA 3H4QA 4NF1A 3D4UA 1EE3P 2PJ8A 2NYQA 2Z3OA 4P4IA 4H2KA 1M4IA 3ISXA 5C82A 4R3LA 4TWEA 3B35A 4Y49B 2R1IA 3VWDA 1AMPA 2B5GB 2ZEOA 4MHNA 4AG7A 4KZTA 4OC2A 4CGPA 4XNHC 2V8DA 1CG2A 3WC6A 5JM6A 1TXRA 1XEBA 1ZO0A 3VH9A 3R95A 2ABZA 4F9UA 3FRMA 4X2TA 3T9YA 4UA3A 2C1CA 1LAMA 4OC0A 2RFHA 4MXUA 2JBKA 5F49A 2AFOA 1GHEA 3W91A 3PP9A 3CT9A 4PV6A 4X3RA 4ZY2A 3D2MA 2VBQA 3WT4A 3BLNA 1YX0A 1IU8A 3FIXA 2Z3PA 2CF4A 3KGQA 4MI4A 4UWIA 3FYNA 3FVLA 4UCNA 4BMHA 1RTQA 1S5KA 2PJ7A 4UWJA 4B5OA 7CPAA 1XF8A 4JXRA 1Z8TA 3KR4A 1UFHA 4KOUA 3H8GA 4CGOA 4IUSA 2P6GA 4XPDC 3TOBA 3IO1A 2B5GA 1I12A 2F5IA 2DXQA 3NH4A 3PBEA 1DTDA 2Z11A 4Q7AA 1IGBA 4AVAA 4KLVA 2AFZA 5JPHA 1M4LA 2PRQA 3PB9X 1OZPA 4OIDA 3BI0A 3R96A 1MJBA 2PRBA 2Y0MA 1BPNA 5DWNA 3ZJ0A 4JZ0A 5LRGA 4XPKA 1VKCA 5LRKA 4GM5A 2BSWA 4KSAA 2REEA 3WABA 3RNZA 4P45A 1CPSA 2BCOA 3B3VA 2ZEEA 1Q7LA 4MCPA 4ZI6A 1ZLIA 3PGPA 1RXTA 3FBUA 4P4BA 1QMUA 3H5ZA 3D7HA 3KI9A 4HPSA 4IAVA 4Y49C 4B11A 2G9DA 3FEDA 4YWYA 1CP6A 2FL4A 1CM0A 2AFSA 2VQYA 2YGWA 4MCSA 3UY5A 2BEIA 1XIXA 4PK3A 3QAYA 2PJ2A 4I49A 4KORA 4EFDA 3IEHA 4MFZA 2QJ8A 4Q36A 1XBUA 2Q43A 2J8NA 2J9AA 5G1ZA 3TOAA 4MCQA 2PE3A 1VHSA 2Q04A 5CBMA 5D29A 2XEFA 5G20A 2D4PA 1IOIA 3GYAA 1LCPA 4L89A 4P4FA 2VZYA 4IK2A 2CNTA 3LD2A 4MFLA 4CAVA 4ZY0A 3IU1A 4AG9A 1B87A 4OADA 2PCUA 4OIWA 5HXDA 4B5PB 1YQEA 2Q4YA 4HNXB 1YR0A 1BO4A 2Q4ZA 2Z0ZA 3B3SA 4NFRA 5AG7A 5CNPA 4AVBA 4DJLA 1R43A 1R3NA 4KSIA 2JEWA 5ELYA 4GXHA 2FVGA 2PVVA 4MJ8A 2Z3NA 3KHZA 4MHPA 2VL1A 4QC6A 2YNEA 4NSQA 4UFWA 3BHXA 3V38A 4M6IA 4WWVA 1BOBA 4U5YA 5EMIA 2EO8A 2XEJA 1M1DA 1TKJA 2PJ1A 5IB9A 1WK4A 1K4JA 4A37A 3KZWA 3D3SA 2AJ6A 3H8EA 3ZZIA 4II9A 4UCMA 2JDDA 4B5PA 2ZW5A 3ISZA 4F8ZA 2OB0A 2PSWA 1X10A 4OAEA 3SJFA 3IIBA 1Q2CA 4OC3A 4B12A 5JGFA 2GLJA 3FJUA 4BD9A 5C88A 4MY0A 3JUWA 2ANPA 4RUHA 3KR5A 4NGNA 1F57A 4PSWA 3CXQA 4RN7A 3DR8A 3BI1A 2OOTA 1QSMA 5LYIA 1AUGA 1JWQA 3JVNA 4E0AA 2I79A 4B14A 4YRHA 1FY7A 5KTDA 1HDQA 1Q2YA 2C6PA 2QYVA 4UEZA 1Y9WA 4OKOA 2EUIA 5K8MA 3B3TA 4PQAA 4R57A 2WSAA 4MFPA 3BJ8A 2C27A 5DWMA 2H5MA 4YFJA 1IB1E 3TFYA 2VZZA 1Z5RA 4O23A 3SI0A 4BBHA 3MGDA 4GS4A 4PXBA 3FMCA 1MJAA 4DUKA 2O4HA 4KOWA 8CPAA 3L2NA 3PFOA 1KUVA 5ISVA 4M6HA 4C2XA 4KSFA 3SXOA 2ZW6A 3S6KA 4E2AA 3B3CA 4EWTA 4UIAA 3FF3A 2PJ0A 5HMNA 4MFQA 1YREA 4R6TA 1WWZA 2QVPA 1Y7EA 3E0KA 4XPLA 3NFZA 3WR7A 3LMSA 5GCNA 2DF5A 1S7FA 2HUZA 5EC4A 4UFVA 4ZX8A 1U6MA 2A4NA 2ODFA 3D68A 5I0CA 4QVTA 1RO5A 4ONWA 4C7IA 2K5TA 1F2OA 4CAEA 3PB7X 4CAWA 2EVNA 2GIVA 2ZEHA 5AG5A 2ATRA 4MFJA 4CAXA 2WUUA 5EBVA 5F46A 2PIZA 3V7ZA 1TIQA 2IL4A 3CXPA 1M4DA 2R7HA 3IFEA 2BL1A 2ARHA 4A31A 1MK4A 5D8NA 3EXNA 1VIXA 2Q4VA 4R7MA 3BXMA 2AFWA 2PJCA 3D7DA 4WJBA 3V8IA 2Q0YA 3NE8A 3SI2A 3LACA 4U9YA 2O53A 4PXDA 3SXNA 1OBRA 2R8VA 2ZEFA 4P4DA 1NSLA 4CAFA 1Y9KA 3R9FA 1YW4A 1S7NA 1QSRA 3JRUA 2EBJA 2CTBA 2P0WA 3LODA 4K3NA 2EK8A 4NGMA 3TCVA 4MHYA 2C6CA 3QB8A 4B13A 3DNSA 2PC1A 5H84A 4Q38A 3RAMA 2FIAA 3NH8A 3NH5A 4LQGA 1CPXA 2OZUA 3PZJA 4ZX9A 3GKRA 1NSAA 3EY5A 4P44A 1ZG8A 3S9MA 3TT2A 3VWEA 1S7LA 4H6UA 4MHDA 4DYOA 4W9YA 2ZXVA 4G1PA 2IMOA 3S9LA 2ZELA 2GLFA 1CBXA 3D66A 4UFXA 2IQ6A 1LANA 1CP7A 2XEGA 5I4MA 1ZG7A 2CY2A 3R9GA 6CPAA 2DEAA 5LYLA 2PJ9A 2HB6A 1Q2DA 4IHMA 2JDCA 4OC4A 1XFOA 1F2PA 3K2KA 5BWAB 3CZXA 1TKHA 4CYOA 2WPWA 2YNCA 3TO9A 4EVYA 2Q51A 4M85A 3VARA 4ZGYB 1S7KA 4PPZA 3DDDA 4FD7A 4HKFA 4CGLA 4HNWB 4NGRA 4KVOE 4FUUA 3D8PA 5JQ4A 1I21A 4M6GA 4C2YA 4E8OA 4CPAA 3KASA 3MRUA 2I00A 2B4DA 2IJZA 4NJQA 2ZW4A 1P4NA 1LRZA 4J3GA 1XJOA 1Z8WA 4RS2A 5K8NA 1ZG9A 5A28A 2QMLA 2F8HA 4AXVA 4X8IA 1IYKA 2OZHA 3GLJA 4FWUA 2I3CA 3TX8A 2FCKA 4QB9A 1V0CA 1XOVA 1QQ9A 1ZLHA 4JD6A 5J1QA 4MHZA 2CIJA 3PRTA 4KVME 2XEIA 2YNCC 3DGVA 1IYLA 3R9EA 3EFAA 4H6ZA 2J8RA 4NCZA 2Q7BA 1ARLA 1ARMA 1VGYA 1XMTA 3PEIA 3CXSA 3R1KA 3RYOA 4AVCA 3VATA 2DPSA 3FEEA 1LFWA 3A9LA 2OU2A 3GIUA 4RI1A 4BINA 1BPMA 4FAIA 4H89A 2NMTA 4UIBA 3TTHA 4FD4A 3H8FA 2CNSA 5F47A 2JEVA 2Z3LA 3BJ7A 3TO6A 4CRZB 4ZY1A 2YNDA 4KOXA 2G3AA 2FS5A 1XMBA 2AFMA 2FIWA 1FNOA 2Z3MA 4KOTA 3S6GA 3P2FA 3IWWA 2BUEA 4OLLA 4JYWA 3FB3A 5LYFA 1Z4EA 1Z9UA 3B3WA 1HEEA 3GB0A 1NMTA 2PJ4A 4F6AA 2HQYA 3EO4A 4A2ZA 2B3UA 2BO9A 1ELMP 2AFUA 3PB6X 4ZYQA 2V8HA 1YLEA 5F09A 1YGHA 1VHEA 2V8GA 3G8WA 4MY3A 2PJ3A 2PJBA 2GFQA 1YW6A 4YGOA 1YVOA 1MJ9A 2ZOFA 4A33A 4NGQA 4R8FA 1Z8XA 4HNYB 1YLOA 3B2YA 4A38A 4FD5A 3D2PA 2R98A 3I9SA 4P4JA 4DNCA 4UEFA 2FSRA 1Y0RA 1Y7RA 2HC9A 5LYDA 4NXYA 4X5KA 1YMEA 3DLJA 3F8KA 3RO0A 3SJEA 4C68A 2B4BA 3CDXA 4QBJA 3GUXA 4P4EA 2BOAA 2CNMA 3T90A 4JJXA 2D4OA 2VXKA 3CPAA 2JLMA 2NSMA 4UEEA 5H86A 4KOSA 1YSJA
chains in the Genus database with same CATH topology
5IX3A 4CS0B 5F48A 3IGRA 3DSBA 1Z4RA 3I3GA 4JLYA 1B6BA 3C26A 3FXTA 1IIDA 2CXAA 3DR6A 2PR8A 1PUAA 3W6SA 2ZPAA 1ON0A 2ZW7A 3TO7A 4CGMA 1S3ZA 4ONUA 4M3SA 2Q44A 3GY9A 4KOYA 1M44A 5IV0A 4MBUA 2G3TA 4IF5A 1R57A 4KS9A 4NEXA 3B8GA 2J8MA 2REFA 1M4GA 4R3KA 2GE3A 4C7HA 2QIRA 2PDOA 3IWGA 2WPXA 1PU9A 4U9ZA 2B4DB 3S6HA 2DPTA 4KVXA 2Z10A 1J4JA 4R9MA 1QSTA 5HH1A 4MFKA 2FXFA 2AE6A 1I1DA 5G22A 3KKWA 5E96A 4KLWA 4F0XA 3W6XA 3P2HA 1KUXA 4A32A 3OWCA 3S6FA 1L0CA 4UBRA 4CYPA 5J8CA 2O28A 5AGEA 2PR1A 2OH1A 4KOVA 4LUAA 4B10A 1XE4A 3G3SA 4R87A 4ZBGA 2P6FA 1KZFA 2KCWA 3NE7A 4JXQA 5KTAA 1KUYA 1QSNA 4KUAA 2Z3KA 4AB7A 5IB0A 3IU2A 4F0YA 5A27A 4KUBA 3FNCA 2PQ8A 4XNHB 3JTKA 4PSXA 2B3VA 2OZGA 1SQHA 5J8FA 3QAHA 5FVJA 4JWPA 4CYNA 2QECA 4L8AA 4PK2A 3IWEA 4CGNA 5G21A 2VI7A 4CYQA 3TE4A 2GANA 4ORFA 4FD6A 1YK3A 4XPDB 2HV2A 2G0BA 2P6EA 2VEZA 3EC4A 4CRYB 1YVKA 4QUSA 1IICA 4LX9A 1QSOA 1P0HA 1S60A 2RC4A 4A30A 4UCPA 1N71A 2FE7A 5KTCA 3SHPA 3F0AA 2B58A 1NE9A 5AG6A 3F5BA 3K9UA 5AG4A 4A95A 1CJWA 3N7ZA 2X7BA 4K30A 2FT0A 3H4QA 4NF1A 2Z3OA 1M4IA 5C82A 4R3LA 4Y49B 2R1IA 3VWDA 2B5GB 4AG7A 4KZTA 4CGPA 4XNHC 1XEBA 1ZO0A 3R95A 3FRMA 3T9YA 4UA3A 5F49A 3W91A 1GHEA 3PP9A 4PV6A 3D2MA 2VBQA 4C2ZA 3BLNA 1YX0A 3FIXA 4UWIA 2Z3PA 4MI4A 3FYNA 4UCNA 4BMHA 4B5OA 1S5KA 4UWJA 1XF8A 4JXRA 4CGOA 1UFHA 4KOUA 4IUSA 2P6GA 4XPDC 3TOBA 2B5GA 1I12A 2F5IA 2DXQA 2Z11A 4AVAA 4KLVA 5JPHA 1OZPA 3R96A 1MJBA 2PRBA 2Y0MA 5DWNA 3ZJ0A 4XPKA 1VKCA 2BSWA 4KSAA 2REEA 3PGPA 1RXTA 3FBUA 3H5ZA 4B11A 4Y49C 2FL4A 1CM0A 2VQYA 2YGWA 3UY5A 2BEIA 1XIXA 4PK3A 4I49A 4KORA 4MFZA 4Q36A 2J8NA 3TOAA 5G1ZA 1VHSA 2Q04A 5G20A 2D4PA 3GYAA 4L89A 2VZYA 2CNTA 3LD2A 4MFLA 4CAVA 3IU1A 4AG9A 1B87A 4OADA 4B5PB 2Q4YA 4HNXB 1YR0A 1BO4A 2Z0ZA 5AG7A 5CNPA 4AVBA 4MJ8A 4QC6A 2Z3NA 2YNEA 4NSQA 4UFWA 1BOBA 4U5YA 1M1DA 1WK4A 1K4JA 3D3SA 2AJ6A 3ZZIA 4II9A 4UCMA 2JDDA 4B5PA 2ZW5A 2OB0A 2PSWA 4OAEA 1Q2CA 4B12A 5C88A 4MY0A 3JUWA 4PSWA 3CXQA 3DR8A 1QSMA 3JVNA 4E0AA 2I79A 4B14A 4YRHA 1FY7A 5KTDA 1Q2YA 1Y9WA 2EUIA 4R57A 2WSAA 4MFPA 3BJ8A 2C27A 5DWMA 2H5MA 4YFJA 1IB1E 3TFYA 2VZZA 4BBHA 3MGDA 4GS4A 1MJAA 4KOWA 5ISVA 1KUVA 4C2XA 4KSFA 3SXOA 2ZW6A 3S6KA 4E2AA 5HMNA 4MFQA 1YREA 4XPLA 1WWZA 3E0KA 3WR7A 5GCNA 1S7FA 2HUZA 5EC4A 4UFVA 1U6MA 2A4NA 5I0CA 4QVTA 1RO5A 4C7IA 2K5TA 4CAEA 4CAWA 2EVNA 2GIVA 5AG5A 2ATRA 4MFJA 4CAXA 2WUUA 5EBVA 5F46A 1TIQA 2IL4A 3CXPA 1M4DA 2R7HA 2BL1A 2ARHA 4A31A 1MK4A 3EXNA 2Q4VA 3V8IA 2Q0YA 4U9YA 3SXNA 2R8VA 1NSLA 4CAFA 1Y9KA 3R9FA 1S7NA 1QSRA 3LODA 2P0WA 3TCVA 3QB8A 4B13A 3DNSA 2PC1A 5H84A 4Q38A 2FIAA 2OZUA 3PZJA 3GKRA 3EY5A 3TT2A 3VWEA 1S7LA 4H6UA 4MHDA 2ZXVA 4UFXA 2CY2A 3R9GA 1Q2DA 2JDCA 5BWAB 4EVYA 4CYOA 2WPWA 2YNCA 3TO9A 4M85A 4ZGYB 1S7KA 3DDDA 4FD7A 4HKFA 4CGLA 4HNWB 4KVOE 3D8PA 5JQ4A 1I21A 4E8OA 4C2YA 2I00A 2B4DA 2ZW4A 1P4NA 1LRZA 4J3GA 4RS2A 5A28A 2QMLA 1IYKA 2OZHA 2FCKA 4QB9A 1V0CA 4JD6A 4KVME 2YNCC 3R9EA 1IYLA 3EFAA 4H6ZA 2J8RA 4NCZA 2Q7BA 3R1KA 1XMTA 3CXSA 3RYOA 4AVCA 2DPSA 3A9LA 2OU2A 4RI1A 4H89A 2NMTA 3TTHA 4FD4A 2CNSA 5F47A 2JEVA 2Z3LA 3BJ7A 3TO6A 4CRZB 2YNDA 4KOXA 2G3AA 2FS5A 2FIWA 3S6GA 2Z3MA 4KOTA 3P2FA 2BUEA 4OLLA 3FB3A 1Z4EA 1Z9UA 4F6AA 1NMTA 2HQYA 3EO4A 4A2ZA 2B3UA 1YLEA 1YGHA 3G8WA 4MY3A 4YGOA 1YVOA 1MJ9A 4A33A 4HNYB 4FD5A 3D2PA 2R98A 3I9SA 4DNCA 2FSRA 1Y7RA 4NXYA 4X5KA 3F8KA 4C68A 2B4BA 4QBJA 3T90A 2CNMA 4JJXA 2D4OA 2VXKA 5H86A 2JLMA 4KOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IX3 A;  4CS0 B;  5F48 A;  3IGR A;  3DSB A;  1Z4R A;  3I3G A;  4JLY A;  1B6B A;  3C26 A;  3FXT A;  1IID A;  3DR6 A;  2PR8 A;  1PUA A;  3W6S A;  2ZPA A;  1ON0 A;  2ZW7 A;  3TO7 A;  1S3Z A;  4ONU A;  4M3S A;  2Q44 A;  3GY9 A;  4KOY A;  1M44 A;  5IV0 A;  4MBU A;  2G3T A;  4IF5 A;  1R57 A;  4NEX A;  3B8G A;  2J8M A;  2REF A;  1M4G A;  4R3K A;  2GE3 A;  2QIR A;  2PDO A;  3IWG A;  2WPX A;  1PU9 A;  4U9Z A;  2B4D B;  3S6H A;  4KVX A;  2Z10 A;  1J4J A;  4R9M A;  1QST A;  5HH1 A;  2FXF A;  2AE6 A;  1I1D A;  3KKW A;  5E96 A;  4KLW A;  3W6X A;  3P2H A;  1KUX A;  3OWC A;  3S6F A;  1L0C A;  4UBR A;  5J8C A;  2O28 A;  2PR1 A;  2OH1 A;  4KOV A;  4LUA A;  1XE4 A;  3G3S A;  4R87 A;  4ZBG A;  2P6F A;  1KZF A;  2KCW A;  3NE7 A;  4JXQ A;  5KTA A;  1KUY A;  1QSN A;  4KUA A;  4AB7 A;  5IB0 A;  4F0Y A;  4KUB A;  3FNC A;  2PQ8 A;  4XNH B;  4PSX A;  2B3V A;  2OZG A;  1SQH A;  5J8F A;  3QAH A;  5FVJ A;  4JWP A;  2QEC A;  4L8A A;  4PK2 A;  2VI7 A;  3TE4 A;  2GAN A;  4ORF A;  4FD6 A;  1YK3 A;  4XPD B;  2HV2 A;  2G0B A;  2P6E A;  2VEZ A;  3EC4 A;  4CRY B;  1YVK A;  4QUS A;  1IIC A;  4LX9 A;  1QSO A;  1P0H A;  1S60 A;  2RC4 A;  1N71 A;  2FE7 A;  5KTC A;  3SHP A;  3F0A A;  2B58 A;  1NE9 A;  3F5B A;  3K9U A;  1CJW A;  3N7Z A;  2X7B A;  4K30 A;  2FT0 A;  3H4Q A;  4NF1 A;  1M4I A;  5C82 A;  4R3L A;  4Y49 B;  2R1I A;  3VWD A;  2B5G B;  4AG7 A;  4KZT A;  4XNH C;  1XEB A;  3R95 A;  3FRM A;  3T9Y A;  4UA3 A;  5F49 A;  3W91 A;  1GHE A;  3PP9 A;  4PV6 A;  3D2M A;  2VBQ A;  3BLN A;  1YX0 A;  3FIX A;  4UWI A;  4MI4 A;  3FYN A;  4BMH A;  4B5O A;  1S5K A;  4UWJ A;  1XF8 A;  4JXR A;  1UFH A;  4KOU A;  4IUS A;  2P6G A;  4XPD C;  3TOB A;  2B5G A;  1I12 A;  2F5I A;  2DXQ A;  2Z11 A;  4AVA A;  4KLV A;  5JPH A;  1OZP A;  3R96 A;  1MJB A;  2PRB A;  2Y0M A;  5DWN A;  3ZJ0 A;  4XPK A;  1VKC A;  2BSW A;  2REE A;  3PGP A;  1RXT A;  3FBU A;  4Y49 C;  2FL4 A;  1CM0 A;  2VQY A;  3UY5 A;  2BEI A;  1XIX A;  4PK3 A;  4I49 A;  4KOR A;  2J8N A;  3TOA A;  1VHS A;  2Q04 A;  2D4P A;  3GYA A;  4L89 A;  2VZY A;  2CNT A;  3LD2 A;  4CAV A;  4AG9 A;  1B87 A;  4OAD A;  4B5P B;  2Q4Y A;  4HNX B;  1YR0 A;  1BO4 A;  2Z0Z A;  5CNP A;  4AVB A;  4MJ8 A;  4QC6 A;  4NSQ A;  1BOB A;  4U5Y A;  1M1D A;  1WK4 A;  1K4J A;  3D3S A;  2AJ6 A;  3ZZI A;  4II9 A;  2JDD A;  4B5P A;  2ZW5 A;  2OB0 A;  2PSW A;  4OAE A;  1Q2C A;  5C88 A;  4MY0 A;  3JUW A;  4PSW A;  3CXQ A;  3DR8 A;  1QSM A;  3JVN A;  4E0A A;  2I79 A;  4YRH A;  1FY7 A;  5KTD A;  1Q2Y A;  1Y9W A;  2EUI A;  4R57 A;  3BJ8 A;  2C27 A;  5DWM A;  2H5M A;  4YFJ A;  1IB1 E;  3TFY A;  2VZZ A;  3MGD A;  4GS4 A;  1MJA A;  4KOW A;  5ISV A;  1KUV A;  3SXO A;  2ZW6 A;  3S6K A;  4E2A A;  5HMN A;  1YRE A;  4XPL A;  1WWZ A;  3E0K A;  3WR7 A;  5GCN A;  1S7F A;  2HUZ A;  5EC4 A;  1U6M A;  2A4N A;  5I0C A;  4QVT A;  1RO5 A;  2K5T A;  4CAW A;  2EVN A;  2GIV A;  2ATR A;  4CAX A;  5EBV A;  5F46 A;  1TIQ A;  2IL4 A;  3CXP A;  1M4D A;  2R7H A;  2BL1 A;  2ARH A;  1MK4 A;  3EXN A;  2Q4V A;  3V8I A;  2Q0Y A;  4U9Y A;  3SXN A;  2R8V A;  1NSL A;  1Y9K A;  3R9F A;  1S7N A;  1QSR A;  3LOD A;  2P0W A;  3TCV A;  3QB8 A;  3DNS A;  2PC1 A;  5H84 A;  2FIA A;  2OZU A;  3PZJ A;  3GKR A;  3EY5 A;  3TT2 A;  3VWE A;  1S7L A;  4H6U A;  4MHD A;  2ZXV A;  2CY2 A;  3R9G A;  1Q2D A;  2JDC A;  4EVY A;  2WPW A;  3TO9 A;  4M85 A;  1S7K A;  3DDD A;  4FD7 A;  4HKF A;  4HNW B;  4KVO E;  3D8P A;  5JQ4 A;  1I21 A;  4E8O A;  2I00 A;  2B4D A;  2ZW4 A;  1P4N A;  1LRZ A;  4J3G A;  4RS2 A;  2QML A;  1IYK A;  2OZH A;  2FCK A;  4QB9 A;  1V0C A;  4JD6 A;  4KVM E;  3R9E A;  1IYL A;  3EFA A;  4H6Z A;  2J8R A;  4NCZ A;  2Q7B A;  3R1K A;  1XMT A;  3CXS A;  3RYO A;  4AVC A;  2OU2 A;  4RI1 A;  4H89 A;  2NMT A;  3TTH A;  4FD4 A;  2CNS A;  5F47 A;  2JEV A;  3BJ7 A;  3TO6 A;  4CRZ B;  4KOX A;  2G3A A;  2FS5 A;  2FIW A;  3S6G A;  4KOT A;  3P2F A;  2BUE A;  4OLL A;  3FB3 A;  1Z4E A;  1Z9U A;  4F6A A;  1NMT A;  2HQY A;  3EO4 A;  2B3U A;  1YLE A;  1YGH A;  3G8W A;  4MY3 A;  4YGO A;  1YVO A;  1MJ9 A;  4HNY B;  4FD5 A;  3D2P A;  2R98 A;  3I9S A;  4DNC A;  2FSR A;  1Y7R A;  4NXY A;  4X5K A;  3F8K A;  2B4B A;  4QBJ A;  3T90 A;  2CNM A;  4JJX A;  2D4O A;  2VXK A;  5H86 A;  2JLM A;  4KOS A; 
#chains in the Genus database with same CATH topology
 5IX3 A;  1XRY A;  4CS0 B;  1Z2L A;  4OME A;  5F48 A;  3IGR A;  5K8O A;  3DSB A;  5J8C A;  1Z4R A;  4P10 A;  3I3G A;  4JLY A;  1B6B A;  3C26 A;  3FXT A;  1IID A;  2Q7S A;  2CXA A;  3QNV A;  5CPA A;  3DR6 A;  3HLP A;  3SJG A;  2PR8 A;  1JQG A;  2ZEG A;  1PUA A;  3W6S A;  2ZPA A;  3N5F A;  2JBJ A;  3RBU A;  1ON0 A;  3LWU A;  5DS0 A;  1PCA A;  2ZW7 A;  3SI1 A;  3KQX A;  3TO7 A;  1BAV A;  4CGM A;  4C2Z A;  1S3Z A;  3IC1 A;  4ONU A;  2GU2 A;  4M3S A;  2RB7 A;  1VHO A;  2Q44 A;  3GY9 A;  4KOY A;  1M44 A;  5IV0 A;  2V8V A;  5LRJ A;  4MBU A;  2G3T A;  4IF5 A;  1R57 A;  4KS9 A;  4NEX A;  3B8G A;  3NA6 A;  2J8M A;  2GRE A;  1M4G A;  2REF A;  2GE3 A;  4R3K A;  4C7H A;  2QIR A;  3WC5 A;  3PB8 X;  4F9V A;  3KQZ A;  2PDO A;  1HDU A;  2ZEM A;  3IWG A;  2WPX A;  1PU9 A;  1Y0Y A;  2B4D B;  4MMO A;  4NGT A;  2DPT A;  4OC1 A;  4U9Z A;  3D7G A;  4KVX A;  3S6H A;  1H8L A;  2Z10 A;  1TKF A;  4NGS A;  5HVH A;  1J4J A;  4R9M A;  4YU9 A;  1QST A;  5HH1 A;  4MFK A;  1KWM A;  2FXF A;  2AE6 A;  1TF8 A;  3KL9 A;  1I1D A;  1UWY A;  4TNU A;  5G22 A;  2PIY A;  5HVF A;  1X12 A;  3KKW A;  5E96 A;  4PXC A;  5HVG A;  1LOK A;  4KLW A;  4F0X A;  3W6X A;  4A39 A;  2EWB A;  5K8P A;  3P2H A;  4OC5 A;  4LQ6 A;  1KUX A;  3D7F A;  4NGP A;  3WC7 A;  4A32 A;  3OWC A;  1LAP A;  1L0C A;  2ZEN A;  4UBR A;  1BLL E;  3S6F A;  4CYP A;  3PBB A;  1AYE A;  3TC8 A;  2O28 A;  1CX8 A;  2WYR A;  2ZOG A;  1ELL P;  3B7I A;  5AGE A;  1DE4 C;  2PR1 A;  3PB4 X;  2OH1 A;  1Z8L A;  2V77 A;  2ZEP A;  4KOV A;  4LUA A;  4B10 A;  4P6Y A;  1XE4 A;  3CPX A;  1IOF A;  3G3S A;  4R87 A;  4ZBG A;  2P6F A;  1KZF A;  2KCW A;  3NE7 A;  4JXQ A;  4MRI A;  1KUY A;  1QSN A;  4KUA A;  4B6Z A;  2Z3K A;  3RZA A;  4MCR A;  5KTA A;  4AB7 A;  5IB0 A;  3IU2 A;  3KHX A;  4FBE A;  2EK9 A;  4F0Y A;  5A27 A;  3K9T A;  4KUB A;  1FT7 A;  2PVW A;  2PQ8 A;  3FNC A;  4XNH B;  3JTK A;  4PSX A;  2B3V A;  2OZG A;  1SQH A;  5J8F A;  3QAH A;  1GYT A;  2WZN A;  5FVJ A;  4JWP A;  4CYN A;  2QEC A;  4L8A A;  3D67 A;  4PK2 A;  3IWE A;  2F7V A;  3I1U A;  3PFE A;  4CGN A;  2OR4 A;  2PJ6 A;  5G21 A;  1A2Z A;  1TF9 A;  4Z65 A;  2VI7 A;  5JH9 A;  4CYQ A;  4A94 A;  3TE4 A;  2GAN A;  2PJA A;  4UF4 A;  4ORF A;  4OP4 A;  4FD6 A;  1YK3 A;  3T8W A;  4NJR A;  4XPD B;  5THW A;  3IJ3 A;  1PYT B;  2HV2 A;  3FX6 A;  3SJX A;  3S9N A;  2G0B A;  2P6E A;  2ZED A;  3FH4 A;  2VEZ A;  3FEC A;  3EC4 A;  4PXE A;  1YVK A;  4R76 A;  4CRY B;  2POK A;  4EME A;  4QUS A;  1IIC A;  4LX9 A;  1IY7 A;  1QSO A;  1P0H A;  1S60 A;  2RC4 A;  4A30 A;  4UCP A;  3MN8 A;  1N71 A;  2FE7 A;  5KTC A;  2PJ5 A;  3SHP A;  3F0A A;  2B58 A;  1NE9 A;  5AG6 A;  3F5B A;  3HUV A;  3K9U A;  4A95 A;  5AG4 A;  1CJW A;  3N7Z A;  2C6G A;  2X7B A;  2AFX A;  4K30 A;  2FT0 A;  2CTC A;  3H4Q A;  4NF1 A;  3D4U A;  1EE3 P;  2PJ8 A;  2NYQ A;  2Z3O A;  4P4I A;  4H2K A;  1M4I A;  3ISX A;  5C82 A;  4R3L A;  4TWE A;  3B35 A;  4Y49 B;  2R1I A;  3VWD A;  1AMP A;  2B5G B;  2ZEO A;  4MHN A;  4AG7 A;  4KZT A;  4OC2 A;  4CGP A;  4XNH C;  2V8D A;  1CG2 A;  3WC6 A;  5JM6 A;  1TXR A;  1XEB A;  1ZO0 A;  3VH9 A;  3R95 A;  2ABZ A;  4F9U A;  3FRM A;  4X2T A;  3T9Y A;  4UA3 A;  2C1C A;  1LAM A;  4OC0 A;  2RFH A;  4MXU A;  2JBK A;  5F49 A;  2AFO A;  1GHE A;  3W91 A;  3PP9 A;  3CT9 A;  4PV6 A;  4X3R A;  4ZY2 A;  3D2M A;  2VBQ A;  3WT4 A;  3BLN A;  1YX0 A;  1IU8 A;  3FIX A;  2Z3P A;  2CF4 A;  3KGQ A;  4MI4 A;  4UWI A;  3FYN A;  3FVL A;  4UCN A;  4BMH A;  1RTQ A;  1S5K A;  2PJ7 A;  4UWJ A;  4B5O A;  7CPA A;  1XF8 A;  4JXR A;  1Z8T A;  3KR4 A;  1UFH A;  4KOU A;  3H8G A;  4CGO A;  4IUS A;  2P6G A;  4XPD C;  3TOB A;  3IO1 A;  2B5G A;  1I12 A;  2F5I A;  2DXQ A;  3NH4 A;  3PBE A;  1DTD A;  2Z11 A;  4Q7A A;  1IGB A;  4AVA A;  4KLV A;  2AFZ A;  5JPH A;  1M4L A;  2PRQ A;  3PB9 X;  1OZP A;  4OID A;  3BI0 A;  3R96 A;  1MJB A;  2PRB A;  2Y0M A;  1BPN A;  5DWN A;  3ZJ0 A;  4JZ0 A;  5LRG A;  4XPK A;  1VKC A;  5LRK A;  4GM5 A;  2BSW A;  4KSA A;  2REE A;  3WAB A;  3RNZ A;  4P45 A;  1CPS A;  2BCO A;  3B3V A;  2ZEE A;  1Q7L A;  4MCP A;  4ZI6 A;  1ZLI A;  3PGP A;  1RXT A;  3FBU A;  4P4B A;  1QMU A;  3H5Z A;  3D7H A;  3KI9 A;  4HPS A;  4IAV A;  4Y49 C;  4B11 A;  2G9D A;  3FED A;  4YWY A;  1CP6 A;  2FL4 A;  1CM0 A;  2AFS A;  2VQY A;  2YGW A;  4MCS A;  3UY5 A;  2BEI A;  1XIX A;  4PK3 A;  3QAY A;  2PJ2 A;  4I49 A;  4KOR A;  4EFD A;  3IEH A;  4MFZ A;  2QJ8 A;  4Q36 A;  1XBU A;  2Q43 A;  2J8N A;  2J9A A;  5G1Z A;  3TOA A;  4MCQ A;  2PE3 A;  1VHS A;  2Q04 A;  5CBM A;  5D29 A;  2XEF A;  5G20 A;  2D4P A;  1IOI A;  3GYA A;  1LCP A;  4L89 A;  4P4F A;  2VZY A;  4IK2 A;  2CNT A;  3LD2 A;  4MFL A;  4CAV A;  4ZY0 A;  3IU1 A;  4AG9 A;  1B87 A;  4OAD A;  2PCU A;  4OIW A;  5HXD A;  4B5P B;  1YQE A;  2Q4Y A;  4HNX B;  1YR0 A;  1BO4 A;  2Q4Z A;  2Z0Z A;  3B3S A;  4NFR A;  5AG7 A;  5CNP A;  4AVB A;  4DJL A;  1R43 A;  1R3N A;  4KSI A;  2JEW A;  5ELY A;  4GXH A;  2FVG A;  2PVV A;  4MJ8 A;  2Z3N A;  3KHZ A;  4MHP A;  2VL1 A;  4QC6 A;  2YNE A;  4NSQ A;  4UFW A;  3BHX A;  3V38 A;  4M6I A;  4WWV A;  1BOB A;  4U5Y A;  5EMI A;  2EO8 A;  2XEJ A;  1M1D A;  1TKJ A;  2PJ1 A;  5IB9 A;  1WK4 A;  1K4J A;  4A37 A;  3KZW A;  3D3S A;  2AJ6 A;  3H8E A;  3ZZI A;  4II9 A;  4UCM A;  2JDD A;  4B5P A;  2ZW5 A;  3ISZ A;  4F8Z A;  2OB0 A;  2PSW A;  1X10 A;  4OAE A;  3SJF A;  3IIB A;  1Q2C A;  4OC3 A;  4B12 A;  5JGF A;  2GLJ A;  3FJU A;  4BD9 A;  5C88 A;  4MY0 A;  3JUW A;  2ANP A;  4RUH A;  3KR5 A;  4NGN A;  1F57 A;  4PSW A;  3CXQ A;  4RN7 A;  3DR8 A;  3BI1 A;  2OOT A;  1QSM A;  5LYI A;  1AUG A;  1JWQ A;  3JVN A;  4E0A A;  2I79 A;  4B14 A;  4YRH A;  1FY7 A;  5KTD A;  1HDQ A;  1Q2Y A;  2C6P A;  2QYV A;  4UEZ A;  1Y9W A;  4OKO A;  2EUI A;  5K8M A;  3B3T A;  4PQA A;  4R57 A;  2WSA A;  4MFP A;  3BJ8 A;  2C27 A;  5DWM A;  2H5M A;  4YFJ A;  1IB1 E;  3TFY A;  2VZZ A;  1Z5R A;  4O23 A;  3SI0 A;  4BBH A;  3MGD A;  4GS4 A;  4PXB A;  3FMC A;  1MJA A;  4DUK A;  2O4H A;  4KOW A;  8CPA A;  3L2N A;  3PFO A;  1KUV A;  5ISV A;  4M6H A;  4C2X A;  4KSF A;  3SXO A;  2ZW6 A;  3S6K A;  4E2A A;  3B3C A;  4EWT A;  4UIA A;  3FF3 A;  2PJ0 A;  5HMN A;  4MFQ A;  1YRE A;  4R6T A;  1WWZ A;  2QVP A;  1Y7E A;  3E0K A;  4XPL A;  3NFZ A;  3WR7 A;  3LMS A;  5GCN A;  2DF5 A;  1S7F A;  2HUZ A;  5EC4 A;  4UFV A;  4ZX8 A;  1U6M A;  2A4N A;  2ODF A;  3D68 A;  5I0C A;  4QVT A;  1RO5 A;  4ONW A;  4C7I A;  2K5T A;  1F2O A;  4CAE A;  3PB7 X;  4CAW A;  2EVN A;  2GIV A;  2ZEH A;  5AG5 A;  2ATR A;  4MFJ A;  4CAX A;  2WUU A;  5EBV A;  5F46 A;  2PIZ A;  3V7Z A;  1TIQ A;  2IL4 A;  3CXP A;  1M4D A;  2R7H A;  3IFE A;  2BL1 A;  2ARH A;  4A31 A;  1MK4 A;  5D8N A;  3EXN A;  1VIX A;  2Q4V A;  4R7M A;  3BXM A;  2AFW A;  2PJC A;  3D7D A;  4WJB A;  3V8I A;  2Q0Y A;  3NE8 A;  3SI2 A;  3LAC A;  4U9Y A;  2O53 A;  4PXD A;  3SXN A;  1OBR A;  2R8V A;  2ZEF A;  4P4D A;  1NSL A;  4CAF A;  1Y9K A;  3R9F A;  1YW4 A;  1S7N A;  1QSR A;  3JRU A;  2EBJ A;  2CTB A;  2P0W A;  3LOD A;  4K3N A;  2EK8 A;  4NGM A;  3TCV A;  4MHY A;  2C6C A;  3QB8 A;  4B13 A;  3DNS A;  2PC1 A;  5H84 A;  4Q38 A;  3RAM A;  2FIA A;  3NH8 A;  3NH5 A;  4LQG A;  1CPX A;  2OZU A;  3PZJ A;  4ZX9 A;  3GKR A;  1NSA A;  3EY5 A;  4P44 A;  1ZG8 A;  3S9M A;  3TT2 A;  3VWE A;  1S7L A;  4H6U A;  4MHD A;  4DYO A;  4W9Y A;  2ZXV A;  4G1P A;  2IMO A;  3S9L A;  2ZEL A;  2GLF A;  1CBX A;  3D66 A;  4UFX A;  2IQ6 A;  1LAN A;  1CP7 A;  2XEG A;  5I4M A;  1ZG7 A;  2CY2 A;  3R9G A;  6CPA A;  2DEA A;  5LYL A;  2PJ9 A;  2HB6 A;  1Q2D A;  4IHM A;  2JDC A;  4OC4 A;  1XFO A;  1F2P A;  3K2K A;  5BWA B;  3CZX A;  1TKH A;  4CYO A;  2WPW A;  2YNC A;  3TO9 A;  4EVY A;  2Q51 A;  4M85 A;  3VAR A;  4ZGY B;  1S7K A;  4PPZ A;  3DDD A;  4FD7 A;  4HKF A;  4CGL A;  4HNW B;  4NGR A;  4KVO E;  4FUU A;  3D8P A;  5JQ4 A;  1I21 A;  4M6G A;  4C2Y A;  4E8O A;  4CPA A;  3KAS A;  3MRU A;  2I00 A;  2B4D A;  2IJZ A;  4NJQ A;  2ZW4 A;  1P4N A;  1LRZ A;  4J3G A;  1XJO A;  1Z8W A;  4RS2 A;  5K8N A;  1ZG9 A;  5A28 A;  2QML A;  2F8H A;  4AXV A;  4X8I A;  1IYK A;  2OZH A;  3GLJ A;  4FWU A;  2I3C A;  3TX8 A;  2FCK A;  4QB9 A;  1V0C A;  1XOV A;  1QQ9 A;  1ZLH A;  4JD6 A;  5J1Q A;  4MHZ A;  2CIJ A;  3PRT A;  4KVM E;  2XEI A;  2YNC C;  3DGV A;  1IYL A;  3R9E A;  3EFA A;  4H6Z A;  2J8R A;  4NCZ A;  2Q7B A;  1ARL A;  1ARM A;  1VGY A;  1XMT A;  3PEI A;  3CXS A;  3R1K A;  3RYO A;  4AVC A;  3VAT A;  2DPS A;  3FEE A;  1LFW A;  3A9L A;  2OU2 A;  3GIU A;  4RI1 A;  4BIN A;  1BPM A;  4FAI A;  4H89 A;  2NMT A;  4UIB A;  3TTH A;  4FD4 A;  3H8F A;  2CNS A;  5F47 A;  2JEV A;  2Z3L A;  3BJ7 A;  3TO6 A;  4CRZ B;  4ZY1 A;  2YND A;  4KOX A;  2G3A A;  2FS5 A;  1XMB A;  2AFM A;  2FIW A;  1FNO A;  2Z3M A;  4KOT A;  3S6G A;  3P2F A;  3IWW A;  2BUE A;  4OLL A;  4JYW A;  3FB3 A;  5LYF A;  1Z4E A;  1Z9U A;  3B3W A;  1HEE A;  3GB0 A;  1NMT A;  2PJ4 A;  4F6A A;  2HQY A;  3EO4 A;  4A2Z A;  2B3U A;  2BO9 A;  1ELM P;  2AFU A;  3PB6 X;  4ZYQ A;  2V8H A;  1YLE A;  5F09 A;  1YGH A;  1VHE A;  2V8G A;  3G8W A;  4MY3 A;  2PJ3 A;  2PJB A;  2GFQ A;  1YW6 A;  4YGO A;  1YVO A;  1MJ9 A;  2ZOF A;  4A33 A;  4NGQ A;  4R8F A;  1Z8X A;  4HNY B;  1YLO A;  3B2Y A;  4A38 A;  4FD5 A;  3D2P A;  2R98 A;  3I9S A;  4P4J A;  4DNC A;  4UEF A;  2FSR A;  1Y0R A;  1Y7R A;  2HC9 A;  5LYD A;  4NXY A;  4X5K A;  1YME A;  3DLJ A;  3F8K A;  3RO0 A;  3SJE A;  4C68 A;  2B4B A;  3CDX A;  4QBJ A;  3GUX A;  4P4E A;  2BOA A;  2CNM A;  3T90 A;  4JJX A;  2D4O A;  2VXK A;  3CPA A;  2JLM A;  2NSM A;  4UEE A;  5H86 A;  4KOS A;  1YSJ A; 
#chains in the Genus database with same CATH homology
 5IX3 A;  4CS0 B;  5F48 A;  3IGR A;  3DSB A;  1Z4R A;  3I3G A;  4JLY A;  1B6B A;  3C26 A;  3FXT A;  1IID A;  2CXA A;  3DR6 A;  2PR8 A;  1PUA A;  3W6S A;  2ZPA A;  1ON0 A;  2ZW7 A;  3TO7 A;  4CGM A;  1S3Z A;  4ONU A;  4M3S A;  2Q44 A;  3GY9 A;  4KOY A;  1M44 A;  5IV0 A;  4MBU A;  2G3T A;  4IF5 A;  1R57 A;  4KS9 A;  4NEX A;  3B8G A;  2J8M A;  2REF A;  1M4G A;  4R3K A;  2GE3 A;  4C7H A;  2QIR A;  2PDO A;  3IWG A;  2WPX A;  1PU9 A;  4U9Z A;  2B4D B;  3S6H A;  2DPT A;  4KVX A;  2Z10 A;  1J4J A;  4R9M A;  1QST A;  5HH1 A;  4MFK A;  2FXF A;  2AE6 A;  1I1D A;  5G22 A;  3KKW A;  5E96 A;  4KLW A;  4F0X A;  3W6X A;  3P2H A;  1KUX A;  4A32 A;  3OWC A;  3S6F A;  1L0C A;  4UBR A;  4CYP A;  5J8C A;  2O28 A;  5AGE A;  2PR1 A;  2OH1 A;  4KOV A;  4LUA A;  4B10 A;  1XE4 A;  3G3S A;  4R87 A;  4ZBG A;  2P6F A;  1KZF A;  2KCW A;  3NE7 A;  4JXQ A;  5KTA A;  1KUY A;  1QSN A;  4KUA A;  2Z3K A;  4AB7 A;  5IB0 A;  3IU2 A;  4F0Y A;  5A27 A;  4KUB A;  3FNC A;  2PQ8 A;  4XNH B;  3JTK A;  4PSX A;  2B3V A;  2OZG A;  1SQH A;  5J8F A;  3QAH A;  5FVJ A;  4JWP A;  4CYN A;  2QEC A;  4L8A A;  4PK2 A;  3IWE A;  4CGN A;  5G21 A;  2VI7 A;  4CYQ A;  3TE4 A;  2GAN A;  4ORF A;  4FD6 A;  1YK3 A;  4XPD B;  2HV2 A;  2G0B A;  2P6E A;  2VEZ A;  3EC4 A;  4CRY B;  1YVK A;  4QUS A;  1IIC A;  4LX9 A;  1QSO A;  1P0H A;  1S60 A;  2RC4 A;  4A30 A;  4UCP A;  1N71 A;  2FE7 A;  5KTC A;  3SHP A;  3F0A A;  2B58 A;  1NE9 A;  5AG6 A;  3F5B A;  3K9U A;  5AG4 A;  4A95 A;  1CJW A;  3N7Z A;  2X7B A;  4K30 A;  2FT0 A;  3H4Q A;  4NF1 A;  2Z3O A;  1M4I A;  5C82 A;  4R3L A;  4Y49 B;  2R1I A;  3VWD A;  2B5G B;  4AG7 A;  4KZT A;  4CGP A;  4XNH C;  1XEB A;  1ZO0 A;  3R95 A;  3FRM A;  3T9Y A;  4UA3 A;  5F49 A;  3W91 A;  1GHE A;  3PP9 A;  4PV6 A;  3D2M A;  2VBQ A;  4C2Z A;  3BLN A;  1YX0 A;  3FIX A;  4UWI A;  2Z3P A;  4MI4 A;  3FYN A;  4UCN A;  4BMH A;  4B5O A;  1S5K A;  4UWJ A;  1XF8 A;  4JXR A;  4CGO A;  1UFH A;  4KOU A;  4IUS A;  2P6G A;  4XPD C;  3TOB A;  2B5G A;  1I12 A;  2F5I A;  2DXQ A;  2Z11 A;  4AVA A;  4KLV A;  5JPH A;  1OZP A;  3R96 A;  1MJB A;  2PRB A;  2Y0M A;  5DWN A;  3ZJ0 A;  4XPK A;  1VKC A;  2BSW A;  4KSA A;  2REE A;  3PGP A;  1RXT A;  3FBU A;  3H5Z A;  4B11 A;  4Y49 C;  2FL4 A;  1CM0 A;  2VQY A;  2YGW A;  3UY5 A;  2BEI A;  1XIX A;  4PK3 A;  4I49 A;  4KOR A;  4MFZ A;  4Q36 A;  2J8N A;  3TOA A;  5G1Z A;  1VHS A;  2Q04 A;  5G20 A;  2D4P A;  3GYA A;  4L89 A;  2VZY A;  2CNT A;  3LD2 A;  4MFL A;  4CAV A;  3IU1 A;  4AG9 A;  1B87 A;  4OAD A;  4B5P B;  2Q4Y A;  4HNX B;  1YR0 A;  1BO4 A;  2Z0Z A;  5AG7 A;  5CNP A;  4AVB A;  4MJ8 A;  4QC6 A;  2Z3N A;  2YNE A;  4NSQ A;  4UFW A;  1BOB A;  4U5Y A;  1M1D A;  1WK4 A;  1K4J A;  3D3S A;  2AJ6 A;  3ZZI A;  4II9 A;  4UCM A;  2JDD A;  4B5P A;  2ZW5 A;  2OB0 A;  2PSW A;  4OAE A;  1Q2C A;  4B12 A;  5C88 A;  4MY0 A;  3JUW A;  4PSW A;  3CXQ A;  3DR8 A;  1QSM A;  3JVN A;  4E0A A;  2I79 A;  4B14 A;  4YRH A;  1FY7 A;  5KTD A;  1Q2Y A;  1Y9W A;  2EUI A;  4R57 A;  2WSA A;  4MFP A;  3BJ8 A;  2C27 A;  5DWM A;  2H5M A;  4YFJ A;  1IB1 E;  3TFY A;  2VZZ A;  4BBH A;  3MGD A;  4GS4 A;  1MJA A;  4KOW A;  5ISV A;  1KUV A;  4C2X A;  4KSF A;  3SXO A;  2ZW6 A;  3S6K A;  4E2A A;  5HMN A;  4MFQ A;  1YRE A;  4XPL A;  1WWZ A;  3E0K A;  3WR7 A;  5GCN A;  1S7F A;  2HUZ A;  5EC4 A;  4UFV A;  1U6M A;  2A4N A;  5I0C A;  4QVT A;  1RO5 A;  4C7I A;  2K5T A;  4CAE A;  4CAW A;  2EVN A;  2GIV A;  5AG5 A;  2ATR A;  4MFJ A;  4CAX A;  2WUU A;  5EBV A;  5F46 A;  1TIQ A;  2IL4 A;  3CXP A;  1M4D A;  2R7H A;  2BL1 A;  2ARH A;  4A31 A;  1MK4 A;  3EXN A;  2Q4V A;  3V8I A;  2Q0Y A;  4U9Y A;  3SXN A;  2R8V A;  1NSL A;  4CAF A;  1Y9K A;  3R9F A;  1S7N A;  1QSR A;  3LOD A;  2P0W A;  3TCV A;  3QB8 A;  4B13 A;  3DNS A;  2PC1 A;  5H84 A;  4Q38 A;  2FIA A;  2OZU A;  3PZJ A;  3GKR A;  3EY5 A;  3TT2 A;  3VWE A;  1S7L A;  4H6U A;  4MHD A;  2ZXV A;  4UFX A;  2CY2 A;  3R9G A;  1Q2D A;  2JDC A;  5BWA B;  4EVY A;  4CYO A;  2WPW A;  2YNC A;  3TO9 A;  4M85 A;  4ZGY B;  1S7K A;  3DDD A;  4FD7 A;  4HKF A;  4CGL A;  4HNW B;  4KVO E;  3D8P A;  5JQ4 A;  1I21 A;  4E8O A;  4C2Y A;  2I00 A;  2B4D A;  2ZW4 A;  1P4N A;  1LRZ A;  4J3G A;  4RS2 A;  5A28 A;  2QML A;  1IYK A;  2OZH A;  2FCK A;  4QB9 A;  1V0C A;  4JD6 A;  4KVM E;  2YNC C;  3R9E A;  1IYL A;  3EFA A;  4H6Z A;  2J8R A;  4NCZ A;  2Q7B A;  3R1K A;  1XMT A;  3CXS A;  3RYO A;  4AVC A;  2DPS A;  3A9L A;  2OU2 A;  4RI1 A;  4H89 A;  2NMT A;  3TTH A;  4FD4 A;  2CNS A;  5F47 A;  2JEV A;  2Z3L A;  3BJ7 A;  3TO6 A;  4CRZ B;  2YND A;  4KOX A;  2G3A A;  2FS5 A;  2FIW A;  3S6G A;  2Z3M A;  4KOT A;  3P2F A;  2BUE A;  4OLL A;  3FB3 A;  1Z4E A;  1Z9U A;  4F6A A;  1NMT A;  2HQY A;  3EO4 A;  4A2Z A;  2B3U A;  1YLE A;  1YGH A;  3G8W A;  4MY3 A;  4YGO A;  1YVO A;  1MJ9 A;  4A33 A;  4HNY B;  4FD5 A;  3D2P A;  2R98 A;  3I9S A;  4DNC A;  2FSR A;  1Y7R A;  4NXY A;  4X5K A;  3F8K A;  4C68 A;  2B4B A;  4QBJ A;  3T90 A;  2CNM A;  4JJX A;  2D4O A;  2VXK A;  5H86 A;  2JLM A;  4KOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...