2PSWA

Human mak3 homolog in complex with coa
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
SKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetyltransferase 13
publication title Structure of Human MAK3 homolog.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pswA00
4CAXA 3GYAA 2Q0YA 2JDDA 3TFYA 4OAEA 5F49A 2DXQA 4XPKA 4JJXA 5J8FA 5EC4A 2VEZA 2O28A 2VQYA 4Y49B 1CJWA 1QSOA 4FD7A 1M4DA 2I79A 2REEA 1IIDA 3LODA 4F6AA 2JLMA 4U9ZA 4KOYA 4KOTA 1VKCA 4UWIA 3EO4A 2R7HA 4F0YA 4AB7A 2J8MA 1M4GA 4NEXA 1L0CA 1B6BA 2K5TA 3TTHA 1YGHA 3R9EA 2FIAA 1TIQA 3FXTA 1FY7A 4XNHB 2FE7A 1OZPA 3W6XA 4R57A 2R8VA 1MJBA 2VZYA 3D2MA 3GY9A 1KUYA 4KOUA 4FD6A 4QB9A 2ATRA 2FT0A 4E8OA 3T90A 2CY2A 1Y9KA 5IV0A 2FL4A 2PR8A 4EVYA 4B5PB 1J4JA 5FVJA 2BSWA 4R3KA 2Z0ZA 1LRZA 3KKWA 1KUVA 4E2AA 2Q44A 3FNCA 1WWZA 1VHSA 2Z10A 3DR8A 1YVKA 4M85A 4PSWA 4PK2A 2Y0MA 3LD2A 4QC6A 4B5PA 1IB1E 4CAVA 2HQYA 3BJ7A 5KTAA 1K4JA 2P0WA 5IB0A 1QSMA 2P6FA 4Y49C 1SQHA 2CNMA 3DDDA 2BEIA 2FSRA 1QSRA 3TO6A 4RI1A 4NF1A 1Q2CA 2VBQA 2WPXA 2Z11A 2G3TA 1S7KA 2GANA 4ONUA 2OZHA 2PR1A 2AJ6A 5EBVA 5JPHA 3IWGA 3I9SA 5E96A 3R9GA 1Q2YA 2BUEA 1QSNA 2Q7BA 4IF5A 2WPWA 3TCVA 3W91A 2FIWA 1PU9A 3TOAA 4M3SA 4NCZA 2PSWA 4H6ZA 1Y7RA 1S7NA 4FD4A 4B5OA 4LX9A 3S6GA 4JWPA 4UBRA 2D4PA 4FD5A 5IX3A 3TE4A 3PGPA 4H6UA 4HNXB 4H89A 4YRHA 1S5KA 2I00A 2P6GA 3FB3A 4L8AA 3QAHA 3R96A 3TO7A 4R87A 1RXTA 2BL1A 1IYKA 1MJAA 1S3ZA 2B3UA 2OU2A 4KOVA 4KORA 4KVOE 3S6HA 2GE3A 3PP9A 4U9YA 1N71A 4I49A 4KUAA 3EY5A 4II9A 2VI7A 1KZFA 2J8NA 1KUXA 1CM0A 2PC1A 2HUZA 2A4NA 4JLYA 2OZGA 3ZZIA 4RS2A 2B4DB 2G3AA 5C88A 3V8IA 1QSTA 3FYNA 4IUSA 3WR7A 2Q4YA 4AVBA 4L89A 3H4QA 2PQ8A 1NE9A 1YLEA 1XMTA 1UFHA 4MBUA 2B4DA 4AG7A 5GCNA 1S7LA 3CXQA 4YFJA 5F47A 1IICA 2PDOA 1YVOA 4KVME 3DNSA 4MY0A 2ZXVA 2ZPAA 1XE4A 3FIXA 4QVTA 3P2FA 2NMTA 1P4NA 4J3GA 2QMLA 3R1KA 4KUBA 4CRYB 3R95A 3SXNA 2G0BA 4HNWB 2ZW7A 2F5IA 5KTDA 1M44A 2P6EA 2Q4VA 1XIXA 4PK3A 1I12A 3IGRA 1RO5A 2B5GB 2OB0A 3RYOA 4HNYB 2R98A 3PZJA 4KOWA 5F46A 3D3SA 2B4BA 3QB8A 2CNSA 1S7FA 3I3GA 3OWCA 5HH1A 3F8KA 2B5GA 2HV2A 4KVXA 1Z9UA 3TO9A 2GIVA 3JVNA 2B3VA 4HKFA 4BMHA 4PV6A 2Q04A 3DR6A 2H5MA 3D2PA 5H84A 4X5KA 1B87A 3EXNA 2QECA 4AG9A 3UY5A 5H86A 3BJ8A 2KCWA 4CS0B 4ZBGA 4DNCA 1YR0A 4OADA 5C82A 5HMNA 1YX0A 3G8WA 5KTCA 4YGOA 3FRMA 3DSBA 4KZTA 4AVCA 1BO4A 4UWJA 4XPDB 4KOSA 5CNPA 1M4IA 2REFA 5DWMA 4MJ8A 3P2HA 4GS4A 1I21A 2C27A 1NSLA 3EC4A 5JQ4A 4E0AA 3S6KA 3TOBA 2QIRA 2FXFA 1BOBA 3TT2A 1M1DA 3K9UA 2FCKA 5ISVA 3F5BA 3F0AA 4JXQA 1ON0A 4MY3A 1MJ9A 1U6MA 3MGDA 3R9FA 4OLLA 3VWEA 2ZW4A 4MI4A 4R9MA 1GHEA 1Z4EA 3G3SA 2JEVA 2B58A 1YREA 3SHPA 4JXRA 4AVAA 2ZW6A 4NSQA 2AE6A 1XF8A 4XPLA 3CXSA 3T9YA 3SXOA 3CXPA 4QBJA 2EVNA 2ARHA 1R57A 2JDCA 3NE7A 2R1IA 1WK4A 5F48A 3D8PA 3E0KA 2J8RA 4ORFA 2X7BA 4U5YA 1P0HA 4KOXA 3B8GA 3GKRA 4MHDA 2CNTA 4NXYA 4CRZB 5I0CA 1IYLA 2VXKA 4KLVA 4LUAA 4QUSA 4XPDC 4KLWA 3ZJ0A 5DWNA 3VWDA 4UA3A 1YK3A 2EUIA 1XEBA 1I1DA 4PSXA 4CAWA 3EFAA 2IL4A 2FS5A 1Q2DA 4JD6A 2PRBA 1Y9WA 2ZW5A 1Z4RA 3FBUA 3S6FA 2RC4A 2OH1A 2D4OA 1PUAA 1S60A 4R3LA 3JUWA 1V0CA 3N7ZA 3BLNA 4K30A 1NMTA 1MK4A 3C26A 2VZZA 3W6SA 4XNHC 5J8CA 2OZUA
chains in the Genus database with same CATH superfamily
4NJRA 4CAXA 4CYNA 3GYAA 3K9TA 5I4MA 2Q0YA 2QVPA 3PRTA 4P4IA 4C7IA 2CF4A 1H8LA 2PJ5A 2JDDA 2PJ4A 2PJ0A 4OAEA 4Q7AA 4UFXA 5CPAA 5F49A 2DXQA 4NGTA 4P4EA 1PCAA 3ISXA 4XPKA 4GM5A 4JJXA 2C6PA 4ZY1A 5J8FA 1FT7A 3B3VA 5EC4A 3PFOA 1XRYA 2VEZA 2O28A 2VQYA 4E8OA 2DEAA 2DF5A 4Y49B 2WUUA 1BLLE 1CJWA 1QSOA 4FD7A 1M4DA 2I79A 1BAVA 2REEA 1IIDA 4GXHA 3LODA 3D7DA 4F6AA 2I3CA 4NGQA 1X10A 2JEWA 2JLMA 4U9ZA 4KOYA 3BXMA 2ZELA 4KOTA 2XEFA 3DLJA 4Q38A 5IB9A 1VKCA 3PB6X 4UWIA 3EO4A 2R7HA 4F0YA 2BCOA 3CPXA 1ZO0A 4C2XA 4AB7A 3A9LA 2HC9A 1M4GA 2J8MA 4NEXA 4EFDA 1L0CA 1B6BA 1Y7EA 2ABZA 2K5TA 2YNDA 3QNVA 4MHNA 3TTHA 3B3TA 4P4FA 1YGHA 3R9EA 5D8NA 2FIAA 1TIQA 3FXTA 1FY7A 3WT4A 4UIBA 4XNHB 5A27A 2FE7A 4P4JA 4B14A 1OZPA 3W6XA 4R57A 2R8VA 2C6CA 2IJZA 4ZI6A 1MJBA 1EE3P 2CTBA 2CTCA 2VZYA 4CGMA 3VATA 3D2MA 3GY9A 1KUYA 1TXRA 4KOUA 4FD6A 4QB9A 4A39A 1ZG8A 2Z3NA 3SI0A 2ATRA 2FT0A 2PJAA 3HLPA 3T90A 4TNUA 2PJCA 4NGMA 2CY2A 1Y9KA 5THWA 4A37A 2PJ2A 3TC8A 7CPAA 5IV0A 4JZ0A 3IC1A 5K8MA 2ZOGA 4G1PA 2F8HA 8CPAA 2FL4A 4M6GA 3S9LA 2PR8A 3FJUA 4UEZA 4EVYA 5K8NA 4B5PB 5K8PA 1J4JA 4RUHA 1CPSA 3KR4A 5FVJA 2BSWA 4R3KA 2Z0ZA 1LRZA 3KKWA 3D7GA 1KUVA 4E2AA 3L2NA 2Q44A 3FNCA 1WWZA 3K2KA 1VHSA 4WWVA 2OOTA 2Z10A 4UEEA 3DR8A 2PJ8A 1YVKA 1F2PA 4CYOA 5G1ZA 4M85A 4PSWA 3IWEA 4Q36A 4PK2A 4Z65A 2Y0MA 3LD2A 4QC6A 3RAMA 1IB1E 1BPNA 4B5PA 4CAVA 2HQYA 1ARLA 3BJ7A 5AG7A 2GLJA 4C68A 5KTAA 1K4JA 2Q51A 2XEGA 5AG4A 2C6GA 3PB9X 2P0WA 1KWMA 2AFOA 5IB0A 2J9AA 3JRUA 3LACA 1Z2LA 1QSMA 2P6FA 2PVVA 3IEHA 1SQHA 2CNMA 3DDDA 4MCPA 4OC0A 4Y49C 1ARMA 4ZX9A 2BEIA 2FSRA 1QSRA 3TO6A 4RI1A 4NF1A 5LRGA 1Y0RA 1AMPA 1Q2CA 2VBQA 2WZNA 2WPXA 2Z11A 3FH4A 1TKHA 2G3TA 1S7KA 2GANA 4ONUA 2OZHA 5JM6A 1LAPA 1HDQA 5G21A 2PR1A 2G9DA 2AJ6A 5JGFA 5EBVA 5JPHA 3IWGA 3D4UA 3FECA 4EWTA 3VH9A 2VL1A 3I9SA 1DTDA 5E96A 5HVFA 3IU1A 2PE3A 4P44A 1Q2YA 2BUEA 4NGNA 1QSNA 2CIJA 1TKFA 4NJQA 3NE8A 3R9GA 1XJOA 4P6YA 2Q7BA 4O23A 3ISZA 4IF5A 2WPWA 3PB8X 4UFWA 3TCVA 5LRKA 2ZEMA 2OR4A 2AFUA 2V77A 4IK2A 3W91A 3RBUA 5LYFA 2FIWA 3B35A 1PU9A 3TOAA 4A32A 4HPSA 2Q43A 4M3SA 4NCZA 5G20A 2PSWA 5HVHA 4CGPA 4UIAA 4H6ZA 3KQXA 4H2KA 1CBXA 1Y7RA 1S7NA 4FD4A 4B5OA 4CAEA 4LX9A 2EBJA 3S6GA 4JWPA 4UBRA 1VIXA 2PIYA 2ZEOA 4MXUA 2D4PA 4FD5A 5IX3A 4C2YA 4ZY0A 5HXDA 3TE4A 4DUKA 3CDXA 2QYVA 3PGPA 1XOVA 4A31A 3IJ3A 5DS0A 4H6UA 4HNXB 1JQGA 3B7IA 2PVWA 2ZEDA 5LYDA 4H89A 2POKA 4YRHA 5D29A 2GLFA 1S5KA 2I00A 3S9MA 2O53A 2P6GA 2NYQA 3FB3A 4L8AA 2JBJA 3QAHA 1CX8A 1FNOA 4X8IA 2V8DA 3R96A 1ZLHA 3TO7A 4R87A 1F57A 4B11A 3IWWA 3GB0A 1RXTA 1CG2A 3PBBA 1CP7A 2BL1A 4P4BA 1IYKA 1ELLP 1MJAA 3MN8A 1S3ZA 3FMCA 2B3UA 2OU2A 4KOVA 2IQ6A 1DE4C 4KORA 4ZGYB 4MFQA 4KVOE 3FF3A 3NH4A 3S6HA 2ZOFA 1YW4A 2GE3A 4F0XA 3H8EA 2BO9A 3PP9A 4U9YA 2ZEGA 1N71A 4I49A 4F9UA 1VHOA 4UCNA 4KUAA 2AFWA 3EY5A 4II9A 4P45A 2JBKA 4M6IA 1LFWA 2VI7A 3D67A 1LCPA 2PRQA 1KZFA 2J8NA 4YWYA 1KUXA 2ANPA 3KHXA 4OIWA 1CM0A 2PC1A 2HUZA 1ZG9A 1Y0YA 2A4NA 2ZEEA 4JLYA 3SJGA 2OZGA 5A28A 4A94A 2RB7A 3ZZIA 4MFJA 1RTQA 1A2ZA 1LANA 1ZLIA 4RS2A 2B4DB 3WABA 2G3AA 5C88A 3V8IA 1YQEA 1QSTA 1Z5RA 4PXBA 4NGRA 3FYNA 3SJEA 4IUSA 3TFYA 3WR7A 1IOIA 1X12A 2PJ1A 2Q4YA 3KL9A 4MRIA 4AVBA 4K3NA 4L89A 4DJLA 3H4QA 2PQ8A 1NE9A 1YLEA 1XMTA 1XFOA 1XMBA 1M4LA 4LQ6A 1UFHA 3D7FA 1IY7A 4MBUA 4OIDA 4CGNA 2B4DA 4ZX8A 4AG7A 2BOAA 5GCNA 1S7LA 3CXQA 5LYIA 5F47A 4BINA 2V8VA 4YFJA 4P4DA 1IICA 2PDOA 3D7HA 1YVOA 4KVME 2O4HA 2PIZA 1IGBA 3DNSA 4B12A 4MY0A 2ZXVA 6CPAA 2ZPAA 1XE4A 3FIXA 1IU8A 3P2FA 2NMTA 1AYEA 2PJBA 4QVTA 1P4NA 4J3GA 3CPAA 2QMLA 5HVGA 3R1KA 3KASA 1ZG7A 2Q4ZA 4FWUA 4KUBA 4B6ZA 4CRYB 3R95A 3SXNA 2G0BA 2EWBA 3HUVA 1LAMA 4HNWB 4M6HA 4PPZA 4P10A 4OC2A 4R6TA 2CXAA 2F5IA 2ZW7A 5KTDA 1M44A 2P6EA 2Q4VA 2GU2A 4KS9A 3IO1A 1XIXA 1F2OA 4PK3A 2DPSA 1I12A 3IGRA 1RO5A 2B5GB 2OB0A 3RYOA 4HNYB 3BI0A 4F8ZA 2Z3KA 2R98A 1YLOA 3KHZA 3PZJA 4MHYA 3WC5A 5LYLA 4KOWA 4MHZA 4A30A 3SJFA 1NSAA 5F46A 2IMOA 2ODFA 3D3SA 2B4BA 4CPAA 3H5ZA 4NFRA 4FBEA 2WSAA 2F7VA 1R3NA 3PBEA 3QB8A 4MFKA 1UWYA 2CNSA 2EK8A 1S7FA 2PCUA 3I3GA 3MRUA 4KSFA 3OWCA 4NGPA 4C2ZA 5HH1A 3SI2A 3F8KA 2B5GA 2HV2A 4A95A 4BBHA 5K8OA 4KVXA 4KSAA 3PEIA 2AFMA 4LQGA 1Z9UA 3TO9A 2YNCA 4B10A 2GIVA 2NSMA 2YNEA 4MCQA 3CZXA 3JVNA 4C7HA 2B3VA 2ZEHA 4HKFA 4BMHA 4MFLA 4PV6A 4R8FA 2Q04A 3DR6A 1YMEA 2H5MA 3FEEA 2PJ6A 3D2PA 5H84A 4X5KA 1B87A 3NH5A 4IHMA 3BI1A 3NA6A 4CGOA 2ZEPA 4ONWA 3SJXA 3EXNA 5J1QA 1QMUA 2QECA 2RFHA 1Z8TA 3IIBA 3UY5A 4AG9A 5H86A 4RN7A 4ZY2A 3BJ8A 2KCWA 4CS0B 4ZBGA 2AFZA 1Q7LA 3JTKA 4DNCA 1Z8WA 3RNZA 1YR0A 4OADA 2HB6A 5C82A 5HMNA 1Z8LA 1YX0A 4A38A 2C1CA 3D66A 3G8WA 5KTCA 4AXVA 2GFQA 4TWEA 4YGOA 3B3WA 3FRMA 3DSBA 2Z3MA 4KZTA 2Z3PA 1BO4A 4UWJA 4AVCA 4XPDB 4NGSA 4KOSA 5CNPA 2FVGA 3BHXA 1M4IA 2REFA 2Z3OA 1JWQA 5DWMA 1R43A 4ZYQA 1AUGA 4MJ8A 4PXDA 3RO0A 4CYQA 3P2HA 4GS4A 1I21A 2C27A 1NSLA 3EC4A 3H8FA 4UEFA 2QJ8A 4R7MA 5JQ4A 3PB7X 4E0AA 3S6KA 3TOBA 2Q7SA 2QIRA 3LWUA 3FX6A 2FXFA 3N5FA 1BOBA 3KR5A 5AG5A 3GIUA 3TT2A 4BD9A 1M1DA 3S9NA 2AFSA 2DPTA 5LRJA 3K9UA 2FCKA 1OBRA 5ISVA 4YU9A 1YW6A 3F5BA 3NFZA 3F0AA 2XEJA 2V8GA 4JXQA 4UF4A 3H8GA 4MCRA 1ON0A 4MY3A 4CYPA 1MJ9A 1U6MA 5AGEA 4CGLA 3SI1A 2ZEFA 3MGDA 4MHPA 4W9YA 3R9FA 2YNCC 2Z3LA 3GUXA 2EO8A 4CAFA 3IU2A 2PJ7A 4OLLA 5ELYA 4KSIA 2ZW4A 4UCPA 3RZAA 3VWEA 3V7ZA 4MI4A 4R9MA 4EMEA 1GHEA 1ELMP 1Z4EA 3G3SA 2JEVA 2B58A 3I1UA 4OMEA 1YREA 3SHPA 3KI9A 4JXRA 4B13A 4AVAA 1PYTB 1VHEA 2ZW6A 3TX8A 4NSQA 1XBUA 2AE6A 2XEIA 1XF8A 4XPLA 3CXSA 3T9YA 2ZENA 3SXOA 3CXPA 3PB4X 4QBJA 2EVNA 1LOKA 1R57A 2ARHA 2JDCA 3NE7A 2R1IA 4IAVA 1WK4A 3LMSA 5AG6A 4MFZA 4F9VA 1HDUA 4PXCA 1HEEA 5F48A 4FAIA 1Z8XA 4A33A 2EK9A 3VARA 3D8PA 1CP6A 3E0KA 3GLJA 2J8RA 3NH8A 1QQ9A 4ORFA 4PXEA 4OC4A 3FVLA 2X7BA 4U5YA 4X2TA 1P0HA 4KOXA 5F09A 4A2ZA 3DGVA 2PJ3A 3B8GA 3GKRA 4PQAA 4JYWA 2CNTA 4MHDA 1TF8A 4NXYA 4CRZB 3B2YA 3D68A 5I0CA 3CT9A 5JH9A 1IYLA 2VXKA 4KLVA 4LUAA 5G22A 2WYRA 4QUSA 4XPDC 4KLWA 3WC6A 3ZJ0A 1BPMA 3T8WA 5DWNA 1GYTA 4WJBA 4UA3A 3VWDA 1YK3A 2EUIA 3V38A 1XEBA 1I1DA 3KZWA 3B3SA 4PSXA 4UCMA 5EMIA 4CAWA 1TKJA 3EFAA 4OC3A 2IL4A 2GREA 2FS5A 1TF9A 1Q2DA 4MMOA 4JD6A 2PRBA 1Y9WA 2YGWA 2PJ9A 2V8HA 2ZW5A 3PFEA 1Z4RA 3KGQA 4OC1A 4OC5A 3FEDA 4UFVA 4MCSA 3FBUA 4MFPA 3S6FA 5BWAB 2RC4A 2OH1A 1YSJA 3QAYA 2D4OA 1PUAA 1S60A 3KQZA 4OP4A 4R3LA 3JUWA 2AFXA 4OKOA 4DYOA 1CPXA 1V0CA 3WC7A 3N7ZA 3BLNA 4K30A 4X3RA 1NMTA 1MK4A 3C26A 4FUUA 2VZZA 3W6SA 1IOFA 3IFEA 4XNHC 5CBMA 4R76A 5J8CA 3B3CA 1VGYA 2OZUA
chains in the Genus database with same CATH topology
4CAXA 4CYNA 3GYAA 2Q0YA 4C7IA 2JDDA 3TFYA 4UFXA 4OAEA 5F49A 2DXQA 4XPKA 4JJXA 5J8FA 5EC4A 2VEZA 2O28A 2VQYA 4Y49B 2WUUA 1CJWA 1QSOA 4FD7A 1M4DA 2I79A 2REEA 1IIDA 3LODA 4F6AA 2JLMA 4U9ZA 4KOYA 4KOTA 4Q38A 1VKCA 4UWIA 3EO4A 2R7HA 4F0YA 4C2XA 1ZO0A 4AB7A 3A9LA 2J8MA 1M4GA 4NEXA 1L0CA 1B6BA 2K5TA 2YNDA 3TTHA 1YGHA 3R9EA 2FIAA 1TIQA 3FXTA 1FY7A 5A27A 4XNHB 2FE7A 4B14A 1OZPA 3W6XA 4R57A 2R8VA 1MJBA 2VZYA 4CGMA 3D2MA 3GY9A 1KUYA 4KOUA 4FD6A 4QB9A 2Z3NA 2ATRA 2FT0A 4E8OA 3T90A 2CY2A 1Y9KA 5IV0A 2FL4A 2PR8A 4EVYA 4B5PB 1J4JA 5FVJA 2BSWA 4R3KA 2Z0ZA 1LRZA 3KKWA 1KUVA 4E2AA 2Q44A 3FNCA 1WWZA 1VHSA 2Z10A 3DR8A 1YVKA 4CYOA 5G1ZA 4M85A 4PSWA 3IWEA 4Q36A 4PK2A 2Y0MA 3LD2A 4QC6A 4B5PA 1IB1E 4CAVA 2HQYA 3BJ7A 5AG7A 4C68A 5KTAA 1K4JA 5AG4A 2P0WA 5IB0A 1QSMA 2P6FA 4Y49C 1SQHA 2CNMA 3DDDA 2BEIA 2FSRA 1QSRA 3TO6A 4RI1A 4NF1A 1Q2CA 2VBQA 2WPXA 2Z11A 2G3TA 1S7KA 2GANA 4ONUA 2OZHA 5G21A 2PR1A 2AJ6A 5EBVA 5JPHA 3IWGA 3I9SA 5E96A 3IU1A 3R9GA 1Q2YA 2BUEA 1QSNA 2Q7BA 4IF5A 2WPWA 4UFWA 3TCVA 3W91A 2FIWA 1PU9A 3TOAA 4A32A 4M3SA 4NCZA 5G20A 2PSWA 4CGPA 4H6ZA 1Y7RA 1S7NA 4FD4A 4B5OA 4CAEA 4LX9A 3S6GA 4JWPA 4UBRA 2D4PA 4FD5A 5IX3A 4C2YA 3TE4A 3PGPA 4A31A 4H6UA 4HNXB 4H89A 4YRHA 1S5KA 2I00A 2P6GA 3FB3A 4L8AA 3QAHA 3R96A 3TO7A 4R87A 4B11A 1RXTA 2BL1A 1IYKA 1MJAA 1S3ZA 2B3UA 2OU2A 4KOVA 4KORA 4ZGYB 4MFQA 4KVOE 3S6HA 2GE3A 4F0XA 3PP9A 4U9YA 1N71A 4I49A 4UCNA 4KUAA 3EY5A 4II9A 2VI7A 1KZFA 2J8NA 1KUXA 1CM0A 2PC1A 2HUZA 2A4NA 4JLYA 2OZGA 5A28A 3ZZIA 4MFJA 4RS2A 2B4DB 2G3AA 5C88A 3V8IA 1QSTA 3FYNA 4IUSA 3WR7A 2Q4YA 4AVBA 4L89A 3H4QA 2PQ8A 1NE9A 1YLEA 1XMTA 1UFHA 4CGNA 4MBUA 2B4DA 4AG7A 5GCNA 1S7LA 3CXQA 4YFJA 5F47A 1IICA 2PDOA 1YVOA 4KVME 3DNSA 4B12A 4MY0A 2ZXVA 2ZPAA 1XE4A 3FIXA 4QVTA 3P2FA 2NMTA 4UCMA 1P4NA 4J3GA 2QMLA 3R1KA 4KUBA 4CRYB 3R95A 3SXNA 2G0BA 4HNWB 2CXAA 2F5IA 2ZW7A 5KTDA 1M44A 2P6EA 2Q4VA 4KS9A 1XIXA 4PK3A 2DPSA 1I12A 3IGRA 1RO5A 2B5GB 2OB0A 3RYOA 4HNYB 2Z3KA 2R98A 3PZJA 4KOWA 4A30A 5F46A 3D3SA 2B4BA 3H5ZA 2WSAA 4MFKA 3QB8A 2CNSA 4C2ZA 1S7FA 3I3GA 4KSFA 3OWCA 5HH1A 3F8KA 2B5GA 2HV2A 4A95A 4BBHA 4KVXA 4KSAA 1Z9UA 3TO9A 2YNCA 4B10A 2GIVA 2YNEA 3JVNA 4C7HA 2B3VA 4HKFA 4BMHA 4MFLA 4PV6A 2Q04A 3DR6A 2H5MA 3D2PA 5H84A 4X5KA 1B87A 4CGOA 3EXNA 2QECA 4AG9A 3UY5A 5H86A 3BJ8A 2KCWA 4CS0B 4ZBGA 3JTKA 4DNCA 1YR0A 4OADA 5C82A 5HMNA 1YX0A 3G8WA 5KTCA 4YGOA 3FRMA 3DSBA 2Z3MA 4KZTA 2Z3PA 1BO4A 4UWJA 4AVCA 4XPDB 4KOSA 5CNPA 1M4IA 2REFA 2Z3OA 5DWMA 4MJ8A 4CYQA 3P2HA 4GS4A 1I21A 2C27A 1NSLA 3EC4A 5JQ4A 4E0AA 3S6KA 3TOBA 2QIRA 2FXFA 1BOBA 5AG5A 3TT2A 1M1DA 2DPTA 3K9UA 2FCKA 5ISVA 3F5BA 3F0AA 4JXQA 1ON0A 4MY3A 4CYPA 1MJ9A 1U6MA 5AGEA 4CGLA 3MGDA 3R9FA 2YNCC 2Z3LA 4CAFA 3IU2A 4OLLA 3VWEA 2ZW4A 4UCPA 4MI4A 4R9MA 1GHEA 1Z4EA 3G3SA 2JEVA 2B58A 1YREA 3SHPA 4JXRA 4B13A 4AVAA 2ZW6A 4NSQA 2AE6A 1XF8A 4XPLA 3CXSA 3T9YA 3SXOA 3CXPA 4QBJA 2EVNA 2ARHA 1R57A 2JDCA 3NE7A 2R1IA 1WK4A 5AG6A 4MFZA 5F48A 4A33A 3D8PA 3E0KA 2J8RA 4ORFA 2X7BA 4U5YA 1P0HA 4KOXA 4A2ZA 3B8GA 3GKRA 4MHDA 2CNTA 4NXYA 4CRZB 5I0CA 1IYLA 2VXKA 4KLVA 4LUAA 5G22A 4QUSA 4XPDC 4KLWA 3ZJ0A 5DWNA 3VWDA 4UA3A 1YK3A 2EUIA 1XEBA 1I1DA 4PSXA 4CAWA 3EFAA 2IL4A 2FS5A 1Q2DA 4JD6A 2PRBA 1Y9WA 2YGWA 2ZW5A 1Z4RA 4UFVA 3FBUA 4MFPA 3S6FA 5BWAB 2RC4A 2OH1A 2D4OA 1PUAA 1S60A 4R3LA 3JUWA 1V0CA 3N7ZA 3BLNA 4K30A 1NMTA 1MK4A 3C26A 2VZZA 3W6SA 4XNHC 5J8CA 2OZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CAX A;  3GYA A;  2Q0Y A;  2JDD A;  3TFY A;  4OAE A;  5F49 A;  2DXQ A;  4XPK A;  4JJX A;  5J8F A;  5EC4 A;  2VEZ A;  2O28 A;  2VQY A;  4Y49 B;  1CJW A;  1QSO A;  4FD7 A;  1M4D A;  2I79 A;  2REE A;  1IID A;  3LOD A;  4F6A A;  2JLM A;  4U9Z A;  4KOY A;  4KOT A;  1VKC A;  4UWI A;  3EO4 A;  2R7H A;  4F0Y A;  4AB7 A;  2J8M A;  1M4G A;  4NEX A;  1L0C A;  1B6B A;  2K5T A;  3TTH A;  1YGH A;  3R9E A;  2FIA A;  1TIQ A;  3FXT A;  1FY7 A;  4XNH B;  2FE7 A;  1OZP A;  3W6X A;  4R57 A;  2R8V A;  1MJB A;  2VZY A;  3D2M A;  3GY9 A;  1KUY A;  4KOU A;  4FD6 A;  4QB9 A;  2ATR A;  2FT0 A;  4E8O A;  3T90 A;  2CY2 A;  1Y9K A;  5IV0 A;  2FL4 A;  2PR8 A;  4EVY A;  4B5P B;  1J4J A;  5FVJ A;  2BSW A;  4R3K A;  2Z0Z A;  1LRZ A;  3KKW A;  1KUV A;  4E2A A;  2Q44 A;  3FNC A;  1WWZ A;  1VHS A;  2Z10 A;  3DR8 A;  1YVK A;  4M85 A;  4PSW A;  4PK2 A;  2Y0M A;  3LD2 A;  4QC6 A;  4B5P A;  1IB1 E;  4CAV A;  2HQY A;  3BJ7 A;  5KTA A;  1K4J A;  2P0W A;  5IB0 A;  1QSM A;  2P6F A;  4Y49 C;  1SQH A;  2CNM A;  3DDD A;  2BEI A;  2FSR A;  1QSR A;  3TO6 A;  4RI1 A;  4NF1 A;  1Q2C A;  2VBQ A;  2WPX A;  2Z11 A;  2G3T A;  1S7K A;  2GAN A;  4ONU A;  2OZH A;  2PR1 A;  2AJ6 A;  5EBV A;  5JPH A;  3IWG A;  3I9S A;  5E96 A;  3R9G A;  1Q2Y A;  2BUE A;  1QSN A;  2Q7B A;  4IF5 A;  2WPW A;  3TCV A;  3W91 A;  2FIW A;  1PU9 A;  3TOA A;  4M3S A;  4NCZ A;  2PSW A;  4H6Z A;  1Y7R A;  1S7N A;  4FD4 A;  4B5O A;  4LX9 A;  3S6G A;  4JWP A;  4UBR A;  2D4P A;  4FD5 A;  5IX3 A;  3TE4 A;  3PGP A;  4H6U A;  4HNX B;  4H89 A;  4YRH A;  1S5K A;  2I00 A;  2P6G A;  3FB3 A;  4L8A A;  3QAH A;  3R96 A;  3TO7 A;  4R87 A;  1RXT A;  2BL1 A;  1IYK A;  1MJA A;  1S3Z A;  2B3U A;  2OU2 A;  4KOV A;  4KOR A;  4KVO E;  3S6H A;  2GE3 A;  3PP9 A;  4U9Y A;  1N71 A;  4I49 A;  4KUA A;  3EY5 A;  4II9 A;  2VI7 A;  1KZF A;  2J8N A;  1KUX A;  1CM0 A;  2PC1 A;  2HUZ A;  2A4N A;  4JLY A;  2OZG A;  3ZZI A;  4RS2 A;  2B4D B;  2G3A A;  5C88 A;  3V8I A;  1QST A;  3FYN A;  4IUS A;  3WR7 A;  2Q4Y A;  4AVB A;  4L89 A;  3H4Q A;  2PQ8 A;  1NE9 A;  1YLE A;  1XMT A;  1UFH A;  4MBU A;  2B4D A;  4AG7 A;  5GCN A;  1S7L A;  3CXQ A;  4YFJ A;  5F47 A;  1IIC A;  2PDO A;  1YVO A;  4KVM E;  3DNS A;  4MY0 A;  2ZXV A;  2ZPA A;  1XE4 A;  3FIX A;  4QVT A;  3P2F A;  2NMT A;  1P4N A;  4J3G A;  2QML A;  3R1K A;  4KUB A;  4CRY B;  3R95 A;  3SXN A;  2G0B A;  4HNW B;  2ZW7 A;  2F5I A;  5KTD A;  1M44 A;  2P6E A;  2Q4V A;  1XIX A;  4PK3 A;  1I12 A;  3IGR A;  1RO5 A;  2B5G B;  2OB0 A;  3RYO A;  4HNY B;  2R98 A;  3PZJ A;  4KOW A;  5F46 A;  3D3S A;  2B4B A;  3QB8 A;  2CNS A;  1S7F A;  3I3G A;  3OWC A;  5HH1 A;  3F8K A;  2B5G A;  2HV2 A;  4KVX A;  1Z9U A;  3TO9 A;  2GIV A;  3JVN A;  2B3V A;  4HKF A;  4BMH A;  4PV6 A;  2Q04 A;  3DR6 A;  2H5M A;  3D2P A;  5H84 A;  4X5K A;  1B87 A;  3EXN A;  2QEC A;  4AG9 A;  3UY5 A;  5H86 A;  3BJ8 A;  2KCW A;  4CS0 B;  4ZBG A;  4DNC A;  1YR0 A;  4OAD A;  5C82 A;  5HMN A;  1YX0 A;  3G8W A;  5KTC A;  4YGO A;  3FRM A;  3DSB A;  4KZT A;  4AVC A;  1BO4 A;  4UWJ A;  4XPD B;  4KOS A;  5CNP A;  1M4I A;  2REF A;  5DWM A;  4MJ8 A;  3P2H A;  4GS4 A;  1I21 A;  2C27 A;  1NSL A;  3EC4 A;  5JQ4 A;  4E0A A;  3S6K A;  3TOB A;  2QIR A;  2FXF A;  1BOB A;  3TT2 A;  1M1D A;  3K9U A;  2FCK A;  5ISV A;  3F5B A;  3F0A A;  4JXQ A;  1ON0 A;  4MY3 A;  1MJ9 A;  1U6M A;  3MGD A;  3R9F A;  4OLL A;  3VWE A;  2ZW4 A;  4MI4 A;  4R9M A;  1GHE A;  1Z4E A;  3G3S A;  2JEV A;  2B58 A;  1YRE A;  3SHP A;  4JXR A;  4AVA A;  2ZW6 A;  4NSQ A;  2AE6 A;  1XF8 A;  4XPL A;  3CXS A;  3T9Y A;  3SXO A;  3CXP A;  4QBJ A;  2EVN A;  2ARH A;  1R57 A;  2JDC A;  3NE7 A;  2R1I A;  1WK4 A;  5F48 A;  3D8P A;  3E0K A;  2J8R A;  4ORF A;  2X7B A;  4U5Y A;  1P0H A;  4KOX A;  3B8G A;  3GKR A;  4MHD A;  2CNT A;  4NXY A;  4CRZ B;  5I0C A;  1IYL A;  2VXK A;  4KLV A;  4LUA A;  4QUS A;  4XPD C;  4KLW A;  3ZJ0 A;  5DWN A;  3VWD A;  4UA3 A;  1YK3 A;  2EUI A;  1XEB A;  1I1D A;  4PSX A;  4CAW A;  3EFA A;  2IL4 A;  2FS5 A;  1Q2D A;  4JD6 A;  2PRB A;  1Y9W A;  2ZW5 A;  1Z4R A;  3FBU A;  3S6F A;  2RC4 A;  2OH1 A;  2D4O A;  1PUA A;  1S60 A;  4R3L A;  3JUW A;  1V0C A;  3N7Z A;  3BLN A;  4K30 A;  1NMT A;  1MK4 A;  3C26 A;  2VZZ A;  3W6S A;  4XNH C;  5J8C A;  2OZU A; 
#chains in the Genus database with same CATH topology
 4NJR A;  4CAX A;  4CYN A;  3GYA A;  3K9T A;  5I4M A;  2Q0Y A;  2QVP A;  3PRT A;  4P4I A;  4C7I A;  2CF4 A;  1H8L A;  2PJ5 A;  2JDD A;  2PJ4 A;  2PJ0 A;  4OAE A;  4Q7A A;  4UFX A;  5CPA A;  5F49 A;  2DXQ A;  4NGT A;  4P4E A;  1PCA A;  3ISX A;  4XPK A;  4GM5 A;  4JJX A;  2C6P A;  4ZY1 A;  5J8F A;  1FT7 A;  3B3V A;  5EC4 A;  3PFO A;  1XRY A;  2VEZ A;  2O28 A;  2VQY A;  4E8O A;  2DEA A;  2DF5 A;  4Y49 B;  2WUU A;  1BLL E;  1CJW A;  1QSO A;  4FD7 A;  1M4D A;  2I79 A;  1BAV A;  2REE A;  1IID A;  4GXH A;  3LOD A;  3D7D A;  4F6A A;  2I3C A;  4NGQ A;  1X10 A;  2JEW A;  2JLM A;  4U9Z A;  4KOY A;  3BXM A;  2ZEL A;  4KOT A;  2XEF A;  3DLJ A;  4Q38 A;  5IB9 A;  1VKC A;  3PB6 X;  4UWI A;  3EO4 A;  2R7H A;  4F0Y A;  2BCO A;  3CPX A;  1ZO0 A;  4C2X A;  4AB7 A;  3A9L A;  2HC9 A;  1M4G A;  2J8M A;  4NEX A;  4EFD A;  1L0C A;  1B6B A;  1Y7E A;  2ABZ A;  2K5T A;  2YND A;  3QNV A;  4MHN A;  3TTH A;  3B3T A;  4P4F A;  1YGH A;  3R9E A;  5D8N A;  2FIA A;  1TIQ A;  3FXT A;  1FY7 A;  3WT4 A;  4UIB A;  4XNH B;  5A27 A;  2FE7 A;  4P4J A;  4B14 A;  1OZP A;  3W6X A;  4R57 A;  2R8V A;  2C6C A;  2IJZ A;  4ZI6 A;  1MJB A;  1EE3 P;  2CTB A;  2CTC A;  2VZY A;  4CGM A;  3VAT A;  3D2M A;  3GY9 A;  1KUY A;  1TXR A;  4KOU A;  4FD6 A;  4QB9 A;  4A39 A;  1ZG8 A;  2Z3N A;  3SI0 A;  2ATR A;  2FT0 A;  2PJA A;  3HLP A;  3T90 A;  4TNU A;  2PJC A;  4NGM A;  2CY2 A;  1Y9K A;  5THW A;  4A37 A;  2PJ2 A;  3TC8 A;  7CPA A;  5IV0 A;  4JZ0 A;  3IC1 A;  5K8M A;  2ZOG A;  4G1P A;  2F8H A;  8CPA A;  2FL4 A;  4M6G A;  3S9L A;  2PR8 A;  3FJU A;  4UEZ A;  4EVY A;  5K8N A;  4B5P B;  5K8P A;  1J4J A;  4RUH A;  1CPS A;  3KR4 A;  5FVJ A;  2BSW A;  4R3K A;  2Z0Z A;  1LRZ A;  3KKW A;  3D7G A;  1KUV A;  4E2A A;  3L2N A;  2Q44 A;  3FNC A;  1WWZ A;  3K2K A;  1VHS A;  4WWV A;  2OOT A;  2Z10 A;  4UEE A;  3DR8 A;  2PJ8 A;  1YVK A;  1F2P A;  4CYO A;  5G1Z A;  4M85 A;  4PSW A;  3IWE A;  4Q36 A;  4PK2 A;  4Z65 A;  2Y0M A;  3LD2 A;  4QC6 A;  3RAM A;  1IB1 E;  1BPN A;  4B5P A;  4CAV A;  2HQY A;  1ARL A;  3BJ7 A;  5AG7 A;  2GLJ A;  4C68 A;  5KTA A;  1K4J A;  2Q51 A;  2XEG A;  5AG4 A;  2C6G A;  3PB9 X;  2P0W A;  1KWM A;  2AFO A;  5IB0 A;  2J9A A;  3JRU A;  3LAC A;  1Z2L A;  1QSM A;  2P6F A;  2PVV A;  3IEH A;  1SQH A;  2CNM A;  3DDD A;  4MCP A;  4OC0 A;  4Y49 C;  1ARM A;  4ZX9 A;  2BEI A;  2FSR A;  1QSR A;  3TO6 A;  4RI1 A;  4NF1 A;  5LRG A;  1Y0R A;  1AMP A;  1Q2C A;  2VBQ A;  2WZN A;  2WPX A;  2Z11 A;  3FH4 A;  1TKH A;  2G3T A;  1S7K A;  2GAN A;  4ONU A;  2OZH A;  5JM6 A;  1LAP A;  1HDQ A;  5G21 A;  2PR1 A;  2G9D A;  2AJ6 A;  5JGF A;  5EBV A;  5JPH A;  3IWG A;  3D4U A;  3FEC A;  4EWT A;  3VH9 A;  2VL1 A;  3I9S A;  1DTD A;  5E96 A;  5HVF A;  3IU1 A;  2PE3 A;  4P44 A;  1Q2Y A;  2BUE A;  4NGN A;  1QSN A;  2CIJ A;  1TKF A;  4NJQ A;  3NE8 A;  3R9G A;  1XJO A;  4P6Y A;  2Q7B A;  4O23 A;  3ISZ A;  4IF5 A;  2WPW A;  3PB8 X;  4UFW A;  3TCV A;  5LRK A;  2ZEM A;  2OR4 A;  2AFU A;  2V77 A;  4IK2 A;  3W91 A;  3RBU A;  5LYF A;  2FIW A;  3B35 A;  1PU9 A;  3TOA A;  4A32 A;  4HPS A;  2Q43 A;  4M3S A;  4NCZ A;  5G20 A;  2PSW A;  5HVH A;  4CGP A;  4UIA A;  4H6Z A;  3KQX A;  4H2K A;  1CBX A;  1Y7R A;  1S7N A;  4FD4 A;  4B5O A;  4CAE A;  4LX9 A;  2EBJ A;  3S6G A;  4JWP A;  4UBR A;  1VIX A;  2PIY A;  2ZEO A;  4MXU A;  2D4P A;  4FD5 A;  5IX3 A;  4C2Y A;  4ZY0 A;  5HXD A;  3TE4 A;  4DUK A;  3CDX A;  2QYV A;  3PGP A;  1XOV A;  4A31 A;  3IJ3 A;  5DS0 A;  4H6U A;  4HNX B;  1JQG A;  3B7I A;  2PVW A;  2ZED A;  5LYD A;  4H89 A;  2POK A;  4YRH A;  5D29 A;  2GLF A;  1S5K A;  2I00 A;  3S9M A;  2O53 A;  2P6G A;  2NYQ A;  3FB3 A;  4L8A A;  2JBJ A;  3QAH A;  1CX8 A;  1FNO A;  4X8I A;  2V8D A;  3R96 A;  1ZLH A;  3TO7 A;  4R87 A;  1F57 A;  4B11 A;  3IWW A;  3GB0 A;  1RXT A;  1CG2 A;  3PBB A;  1CP7 A;  2BL1 A;  4P4B A;  1IYK A;  1ELL P;  1MJA A;  3MN8 A;  1S3Z A;  3FMC A;  2B3U A;  2OU2 A;  4KOV A;  2IQ6 A;  1DE4 C;  4KOR A;  4ZGY B;  4MFQ A;  4KVO E;  3FF3 A;  3NH4 A;  3S6H A;  2ZOF A;  1YW4 A;  2GE3 A;  4F0X A;  3H8E A;  2BO9 A;  3PP9 A;  4U9Y A;  2ZEG A;  1N71 A;  4I49 A;  4F9U A;  1VHO A;  4UCN A;  4KUA A;  2AFW A;  3EY5 A;  4II9 A;  4P45 A;  2JBK A;  4M6I A;  1LFW A;  2VI7 A;  3D67 A;  1LCP A;  2PRQ A;  1KZF A;  2J8N A;  4YWY A;  1KUX A;  2ANP A;  3KHX A;  4OIW A;  1CM0 A;  2PC1 A;  2HUZ A;  1ZG9 A;  1Y0Y A;  2A4N A;  2ZEE A;  4JLY A;  3SJG A;  2OZG A;  5A28 A;  4A94 A;  2RB7 A;  3ZZI A;  4MFJ A;  1RTQ A;  1A2Z A;  1LAN A;  1ZLI A;  4RS2 A;  2B4D B;  3WAB A;  2G3A A;  5C88 A;  3V8I A;  1YQE A;  1QST A;  1Z5R A;  4PXB A;  4NGR A;  3FYN A;  3SJE A;  4IUS A;  3TFY A;  3WR7 A;  1IOI A;  1X12 A;  2PJ1 A;  2Q4Y A;  3KL9 A;  4MRI A;  4AVB A;  4K3N A;  4L89 A;  4DJL A;  3H4Q A;  2PQ8 A;  1NE9 A;  1YLE A;  1XMT A;  1XFO A;  1XMB A;  1M4L A;  4LQ6 A;  1UFH A;  3D7F A;  1IY7 A;  4MBU A;  4OID A;  4CGN A;  2B4D A;  4ZX8 A;  4AG7 A;  2BOA A;  5GCN A;  1S7L A;  3CXQ A;  5LYI A;  5F47 A;  4BIN A;  2V8V A;  4YFJ A;  4P4D A;  1IIC A;  2PDO A;  3D7H A;  1YVO A;  4KVM E;  2O4H A;  2PIZ A;  1IGB A;  3DNS A;  4B12 A;  4MY0 A;  2ZXV A;  6CPA A;  2ZPA A;  1XE4 A;  3FIX A;  1IU8 A;  3P2F A;  2NMT A;  1AYE A;  2PJB A;  4QVT A;  1P4N A;  4J3G A;  3CPA A;  2QML A;  5HVG A;  3R1K A;  3KAS A;  1ZG7 A;  2Q4Z A;  4FWU A;  4KUB A;  4B6Z A;  4CRY B;  3R95 A;  3SXN A;  2G0B A;  2EWB A;  3HUV A;  1LAM A;  4HNW B;  4M6H A;  4PPZ A;  4P10 A;  4OC2 A;  4R6T A;  2CXA A;  2F5I A;  2ZW7 A;  5KTD A;  1M44 A;  2P6E A;  2Q4V A;  2GU2 A;  4KS9 A;  3IO1 A;  1XIX A;  1F2O A;  4PK3 A;  2DPS A;  1I12 A;  3IGR A;  1RO5 A;  2B5G B;  2OB0 A;  3RYO A;  4HNY B;  3BI0 A;  4F8Z A;  2Z3K A;  2R98 A;  1YLO A;  3KHZ A;  3PZJ A;  4MHY A;  3WC5 A;  5LYL A;  4KOW A;  4MHZ A;  4A30 A;  3SJF A;  1NSA A;  5F46 A;  2IMO A;  2ODF A;  3D3S A;  2B4B A;  4CPA A;  3H5Z A;  4NFR A;  4FBE A;  2WSA A;  2F7V A;  1R3N A;  3PBE A;  3QB8 A;  4MFK A;  1UWY A;  2CNS A;  2EK8 A;  1S7F A;  2PCU A;  3I3G A;  3MRU A;  4KSF A;  3OWC A;  4NGP A;  4C2Z A;  5HH1 A;  3SI2 A;  3F8K A;  2B5G A;  2HV2 A;  4A95 A;  4BBH A;  5K8O A;  4KVX A;  4KSA A;  3PEI A;  2AFM A;  4LQG A;  1Z9U A;  3TO9 A;  2YNC A;  4B10 A;  2GIV A;  2NSM A;  2YNE A;  4MCQ A;  3CZX A;  3JVN A;  4C7H A;  2B3V A;  2ZEH A;  4HKF A;  4BMH A;  4MFL A;  4PV6 A;  4R8F A;  2Q04 A;  3DR6 A;  1YME A;  2H5M A;  3FEE A;  2PJ6 A;  3D2P A;  5H84 A;  4X5K A;  1B87 A;  3NH5 A;  4IHM A;  3BI1 A;  3NA6 A;  4CGO A;  2ZEP A;  4ONW A;  3SJX A;  3EXN A;  5J1Q A;  1QMU A;  2QEC A;  2RFH A;  1Z8T A;  3IIB A;  3UY5 A;  4AG9 A;  5H86 A;  4RN7 A;  4ZY2 A;  3BJ8 A;  2KCW A;  4CS0 B;  4ZBG A;  2AFZ A;  1Q7L A;  3JTK A;  4DNC A;  1Z8W A;  3RNZ A;  1YR0 A;  4OAD A;  2HB6 A;  5C82 A;  5HMN A;  1Z8L A;  1YX0 A;  4A38 A;  2C1C A;  3D66 A;  3G8W A;  5KTC A;  4AXV A;  2GFQ A;  4TWE A;  4YGO A;  3B3W A;  3FRM A;  3DSB A;  2Z3M A;  4KZT A;  2Z3P A;  1BO4 A;  4UWJ A;  4AVC A;  4XPD B;  4NGS A;  4KOS A;  5CNP A;  2FVG A;  3BHX A;  1M4I A;  2REF A;  2Z3O A;  1JWQ A;  5DWM A;  1R43 A;  4ZYQ A;  1AUG A;  4MJ8 A;  4PXD A;  3RO0 A;  4CYQ A;  3P2H A;  4GS4 A;  1I21 A;  2C27 A;  1NSL A;  3EC4 A;  3H8F A;  4UEF A;  2QJ8 A;  4R7M A;  5JQ4 A;  3PB7 X;  4E0A A;  3S6K A;  3TOB A;  2Q7S A;  2QIR A;  3LWU A;  3FX6 A;  2FXF A;  3N5F A;  1BOB A;  3KR5 A;  5AG5 A;  3GIU A;  3TT2 A;  4BD9 A;  1M1D A;  3S9N A;  2AFS A;  2DPT A;  5LRJ A;  3K9U A;  2FCK A;  1OBR A;  5ISV A;  4YU9 A;  1YW6 A;  3F5B A;  3NFZ A;  3F0A A;  2XEJ A;  2V8G A;  4JXQ A;  4UF4 A;  3H8G A;  4MCR A;  1ON0 A;  4MY3 A;  4CYP A;  1MJ9 A;  1U6M A;  5AGE A;  4CGL A;  3SI1 A;  2ZEF A;  3MGD A;  4MHP A;  4W9Y A;  3R9F A;  2YNC C;  2Z3L A;  3GUX A;  2EO8 A;  4CAF A;  3IU2 A;  2PJ7 A;  4OLL A;  5ELY A;  4KSI A;  2ZW4 A;  4UCP A;  3RZA A;  3VWE A;  3V7Z A;  4MI4 A;  4R9M A;  4EME A;  1GHE A;  1ELM P;  1Z4E A;  3G3S A;  2JEV A;  2B58 A;  3I1U A;  4OME A;  1YRE A;  3SHP A;  3KI9 A;  4JXR A;  4B13 A;  4AVA A;  1PYT B;  1VHE A;  2ZW6 A;  3TX8 A;  4NSQ A;  1XBU A;  2AE6 A;  2XEI A;  1XF8 A;  4XPL A;  3CXS A;  3T9Y A;  2ZEN A;  3SXO A;  3CXP A;  3PB4 X;  4QBJ A;  2EVN A;  1LOK A;  1R57 A;  2ARH A;  2JDC A;  3NE7 A;  2R1I A;  4IAV A;  1WK4 A;  3LMS A;  5AG6 A;  4MFZ A;  4F9V A;  1HDU A;  4PXC A;  1HEE A;  5F48 A;  4FAI A;  1Z8X A;  4A33 A;  2EK9 A;  3VAR A;  3D8P A;  1CP6 A;  3E0K A;  3GLJ A;  2J8R A;  3NH8 A;  1QQ9 A;  4ORF A;  4PXE A;  4OC4 A;  3FVL A;  2X7B A;  4U5Y A;  4X2T A;  1P0H A;  4KOX A;  5F09 A;  4A2Z A;  3DGV A;  2PJ3 A;  3B8G A;  3GKR A;  4PQA A;  4JYW A;  2CNT A;  4MHD A;  1TF8 A;  4NXY A;  4CRZ B;  3B2Y A;  3D68 A;  5I0C A;  3CT9 A;  5JH9 A;  1IYL A;  2VXK A;  4KLV A;  4LUA A;  5G22 A;  2WYR A;  4QUS A;  4XPD C;  4KLW A;  3WC6 A;  3ZJ0 A;  1BPM A;  3T8W A;  5DWN A;  1GYT A;  4WJB A;  4UA3 A;  3VWD A;  1YK3 A;  2EUI A;  3V38 A;  1XEB A;  1I1D A;  3KZW A;  3B3S A;  4PSX A;  4UCM A;  5EMI A;  4CAW A;  1TKJ A;  3EFA A;  4OC3 A;  2IL4 A;  2GRE A;  2FS5 A;  1TF9 A;  1Q2D A;  4MMO A;  4JD6 A;  2PRB A;  1Y9W A;  2YGW A;  2PJ9 A;  2V8H A;  2ZW5 A;  3PFE A;  1Z4R A;  3KGQ A;  4OC1 A;  4OC5 A;  3FED A;  4UFV A;  4MCS A;  3FBU A;  4MFP A;  3S6F A;  5BWA B;  2RC4 A;  2OH1 A;  1YSJ A;  3QAY A;  2D4O A;  1PUA A;  1S60 A;  3KQZ A;  4OP4 A;  4R3L A;  3JUW A;  2AFX A;  4OKO A;  4DYO A;  1CPX A;  1V0C A;  3WC7 A;  3N7Z A;  3BLN A;  4K30 A;  4X3R A;  1NMT A;  1MK4 A;  3C26 A;  4FUU A;  2VZZ A;  3W6S A;  1IOF A;  3IFE A;  4XNH C;  5CBM A;  4R76 A;  5J8C A;  3B3C A;  1VGY A;  2OZU A; 
#chains in the Genus database with same CATH homology
 4CAX A;  4CYN A;  3GYA A;  2Q0Y A;  4C7I A;  2JDD A;  3TFY A;  4UFX A;  4OAE A;  5F49 A;  2DXQ A;  4XPK A;  4JJX A;  5J8F A;  5EC4 A;  2VEZ A;  2O28 A;  2VQY A;  4Y49 B;  2WUU A;  1CJW A;  1QSO A;  4FD7 A;  1M4D A;  2I79 A;  2REE A;  1IID A;  3LOD A;  4F6A A;  2JLM A;  4U9Z A;  4KOY A;  4KOT A;  4Q38 A;  1VKC A;  4UWI A;  3EO4 A;  2R7H A;  4F0Y A;  4C2X A;  1ZO0 A;  4AB7 A;  3A9L A;  2J8M A;  1M4G A;  4NEX A;  1L0C A;  1B6B A;  2K5T A;  2YND A;  3TTH A;  1YGH A;  3R9E A;  2FIA A;  1TIQ A;  3FXT A;  1FY7 A;  5A27 A;  4XNH B;  2FE7 A;  4B14 A;  1OZP A;  3W6X A;  4R57 A;  2R8V A;  1MJB A;  2VZY A;  4CGM A;  3D2M A;  3GY9 A;  1KUY A;  4KOU A;  4FD6 A;  4QB9 A;  2Z3N A;  2ATR A;  2FT0 A;  4E8O A;  3T90 A;  2CY2 A;  1Y9K A;  5IV0 A;  2FL4 A;  2PR8 A;  4EVY A;  4B5P B;  1J4J A;  5FVJ A;  2BSW A;  4R3K A;  2Z0Z A;  1LRZ A;  3KKW A;  1KUV A;  4E2A A;  2Q44 A;  3FNC A;  1WWZ A;  1VHS A;  2Z10 A;  3DR8 A;  1YVK A;  4CYO A;  5G1Z A;  4M85 A;  4PSW A;  3IWE A;  4Q36 A;  4PK2 A;  2Y0M A;  3LD2 A;  4QC6 A;  4B5P A;  1IB1 E;  4CAV A;  2HQY A;  3BJ7 A;  5AG7 A;  4C68 A;  5KTA A;  1K4J A;  5AG4 A;  2P0W A;  5IB0 A;  1QSM A;  2P6F A;  4Y49 C;  1SQH A;  2CNM A;  3DDD A;  2BEI A;  2FSR A;  1QSR A;  3TO6 A;  4RI1 A;  4NF1 A;  1Q2C A;  2VBQ A;  2WPX A;  2Z11 A;  2G3T A;  1S7K A;  2GAN A;  4ONU A;  2OZH A;  5G21 A;  2PR1 A;  2AJ6 A;  5EBV A;  5JPH A;  3IWG A;  3I9S A;  5E96 A;  3IU1 A;  3R9G A;  1Q2Y A;  2BUE A;  1QSN A;  2Q7B A;  4IF5 A;  2WPW A;  4UFW A;  3TCV A;  3W91 A;  2FIW A;  1PU9 A;  3TOA A;  4A32 A;  4M3S A;  4NCZ A;  5G20 A;  2PSW A;  4CGP A;  4H6Z A;  1Y7R A;  1S7N A;  4FD4 A;  4B5O A;  4CAE A;  4LX9 A;  3S6G A;  4JWP A;  4UBR A;  2D4P A;  4FD5 A;  5IX3 A;  4C2Y A;  3TE4 A;  3PGP A;  4A31 A;  4H6U A;  4HNX B;  4H89 A;  4YRH A;  1S5K A;  2I00 A;  2P6G A;  3FB3 A;  4L8A A;  3QAH A;  3R96 A;  3TO7 A;  4R87 A;  4B11 A;  1RXT A;  2BL1 A;  1IYK A;  1MJA A;  1S3Z A;  2B3U A;  2OU2 A;  4KOV A;  4KOR A;  4ZGY B;  4MFQ A;  4KVO E;  3S6H A;  2GE3 A;  4F0X A;  3PP9 A;  4U9Y A;  1N71 A;  4I49 A;  4UCN A;  4KUA A;  3EY5 A;  4II9 A;  2VI7 A;  1KZF A;  2J8N A;  1KUX A;  1CM0 A;  2PC1 A;  2HUZ A;  2A4N A;  4JLY A;  2OZG A;  5A28 A;  3ZZI A;  4MFJ A;  4RS2 A;  2B4D B;  2G3A A;  5C88 A;  3V8I A;  1QST A;  3FYN A;  4IUS A;  3WR7 A;  2Q4Y A;  4AVB A;  4L89 A;  3H4Q A;  2PQ8 A;  1NE9 A;  1YLE A;  1XMT A;  1UFH A;  4CGN A;  4MBU A;  2B4D A;  4AG7 A;  5GCN A;  1S7L A;  3CXQ A;  4YFJ A;  5F47 A;  1IIC A;  2PDO A;  1YVO A;  4KVM E;  3DNS A;  4B12 A;  4MY0 A;  2ZXV A;  2ZPA A;  1XE4 A;  3FIX A;  4QVT A;  3P2F A;  2NMT A;  4UCM A;  1P4N A;  4J3G A;  2QML A;  3R1K A;  4KUB A;  4CRY B;  3R95 A;  3SXN A;  2G0B A;  4HNW B;  2CXA A;  2F5I A;  2ZW7 A;  5KTD A;  1M44 A;  2P6E A;  2Q4V A;  4KS9 A;  1XIX A;  4PK3 A;  2DPS A;  1I12 A;  3IGR A;  1RO5 A;  2B5G B;  2OB0 A;  3RYO A;  4HNY B;  2Z3K A;  2R98 A;  3PZJ A;  4KOW A;  4A30 A;  5F46 A;  3D3S A;  2B4B A;  3H5Z A;  2WSA A;  4MFK A;  3QB8 A;  2CNS A;  4C2Z A;  1S7F A;  3I3G A;  4KSF A;  3OWC A;  5HH1 A;  3F8K A;  2B5G A;  2HV2 A;  4A95 A;  4BBH A;  4KVX A;  4KSA A;  1Z9U A;  3TO9 A;  2YNC A;  4B10 A;  2GIV A;  2YNE A;  3JVN A;  4C7H A;  2B3V A;  4HKF A;  4BMH A;  4MFL A;  4PV6 A;  2Q04 A;  3DR6 A;  2H5M A;  3D2P A;  5H84 A;  4X5K A;  1B87 A;  4CGO A;  3EXN A;  2QEC A;  4AG9 A;  3UY5 A;  5H86 A;  3BJ8 A;  2KCW A;  4CS0 B;  4ZBG A;  3JTK A;  4DNC A;  1YR0 A;  4OAD A;  5C82 A;  5HMN A;  1YX0 A;  3G8W A;  5KTC A;  4YGO A;  3FRM A;  3DSB A;  2Z3M A;  4KZT A;  2Z3P A;  1BO4 A;  4UWJ A;  4AVC A;  4XPD B;  4KOS A;  5CNP A;  1M4I A;  2REF A;  2Z3O A;  5DWM A;  4MJ8 A;  4CYQ A;  3P2H A;  4GS4 A;  1I21 A;  2C27 A;  1NSL A;  3EC4 A;  5JQ4 A;  4E0A A;  3S6K A;  3TOB A;  2QIR A;  2FXF A;  1BOB A;  5AG5 A;  3TT2 A;  1M1D A;  2DPT A;  3K9U A;  2FCK A;  5ISV A;  3F5B A;  3F0A A;  4JXQ A;  1ON0 A;  4MY3 A;  4CYP A;  1MJ9 A;  1U6M A;  5AGE A;  4CGL A;  3MGD A;  3R9F A;  2YNC C;  2Z3L A;  4CAF A;  3IU2 A;  4OLL A;  3VWE A;  2ZW4 A;  4UCP A;  4MI4 A;  4R9M A;  1GHE A;  1Z4E A;  3G3S A;  2JEV A;  2B58 A;  1YRE A;  3SHP A;  4JXR A;  4B13 A;  4AVA A;  2ZW6 A;  4NSQ A;  2AE6 A;  1XF8 A;  4XPL A;  3CXS A;  3T9Y A;  3SXO A;  3CXP A;  4QBJ A;  2EVN A;  2ARH A;  1R57 A;  2JDC A;  3NE7 A;  2R1I A;  1WK4 A;  5AG6 A;  4MFZ A;  5F48 A;  4A33 A;  3D8P A;  3E0K A;  2J8R A;  4ORF A;  2X7B A;  4U5Y A;  1P0H A;  4KOX A;  4A2Z A;  3B8G A;  3GKR A;  4MHD A;  2CNT A;  4NXY A;  4CRZ B;  5I0C A;  1IYL A;  2VXK A;  4KLV A;  4LUA A;  5G22 A;  4QUS A;  4XPD C;  4KLW A;  3ZJ0 A;  5DWN A;  3VWD A;  4UA3 A;  1YK3 A;  2EUI A;  1XEB A;  1I1D A;  4PSX A;  4CAW A;  3EFA A;  2IL4 A;  2FS5 A;  1Q2D A;  4JD6 A;  2PRB A;  1Y9W A;  2YGW A;  2ZW5 A;  1Z4R A;  4UFV A;  3FBU A;  4MFP A;  3S6F A;  5BWA B;  2RC4 A;  2OH1 A;  2D4O A;  1PUA A;  1S60 A;  4R3L A;  3JUW A;  1V0C A;  3N7Z A;  3BLN A;  4K30 A;  1NMT A;  1MK4 A;  3C26 A;  2VZZ A;  3W6S A;  4XNH C;  5J8C A;  2OZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...