2PSWA

Human mak3 homolog in complex with coa
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
SKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-acetyltransferase 13
publication title Structure of Human MAK3 homolog.
rcsb
source organism Homo sapiens
total genus 35
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2pswA00
3CXSA 4X5KA 2J8MA 4KUBA 1NE9A 4FD4A 4JXRA 2X7BA 2Q04A 3TO9A 2O28A 5J8CA 1V0CA 4JJXA 4M3SA 4KUAA 2PC1A 1KZFA 4QVTA 3W6XA 4NXYA 3TOAA 4PK2A 3PZJA 1BO4A 4HNYB 3D2MA 1M44A 2ZW4A 4H6UA 2OZUA 1B87A 4BMHA 5GCNA 1M4GA 4KOWA 1S7LA 2ZXVA 2OU2A 2J8RA 2DXQA 2FCKA 3FRMA 1I12A 1UFHA 4AG7A 1S60A 4F6AA 1IB1E 5IB0A 5E96A 1TIQA 3DR8A 3FNCA 3DNSA 5ISVA 1WWZA 2PRBA 1MJAA 4CAXA 2B3VA 3UY5A 1IICA 2AE6A 3FYNA 3P2HA 4KOXA 3NE7A 4HNWB 3DSBA 4Y49B 1S5KA 2PDOA 5KTAA 1YR0A 2Z0ZA 1I1DA 1FY7A 3BJ7A 5DWNA 1J4JA 2Y0MA 2PR8A 4F0YA 4R3LA 4H89A 4L8AA 4XPDB 4AVBA 4JD6A 3F8KA 1XMTA 2FS5A 4HKFA 4M85A 4AB7A 1VKCA 1Y9KA 4KOTA 4UBRA 2HV2A 1GHEA 1Z9UA 4MI4A 1N71A 4K30A 1Y9WA 4XPDC 2BEIA 2P0WA 3TO7A 4YGOA 3TO6A 3ZZIA 3GYAA 1M4DA 3G3SA 3VWDA 3F0AA 4H6ZA 1B6BA 2IL4A 3SXNA 2I79A 1M4IA 2K5TA 4E2AA 3JUWA 3WR7A 2AJ6A 4AVAA 1PUAA 4UWIA 2JLMA 4MY0A 1U6MA 2R1IA 3GY9A 2B5GA 4II9A 4FD5A 4KVOE 4PV6A 2R98A 3PP9A 4OAEA 4XNHB 2B58A 2OH1A 3LODA 5H86A 5HMNA 4DNCA 3FBUA 2B5GB 2JDCA 2VQYA 3TOBA 3CXPA 2B4DA 2FE7A 2Q44A 1Z4EA 3IWGA 4XNHC 2J8NA 4PK3A 2JEVA 1XF8A 2VBQA 2OZHA 2OZGA 4R9MA 1QSNA 2BUEA 2Z10A 2VXKA 3RYOA 2B4DB 3FB3A 3D2PA 3DR6A 4KOYA 4KLVA 4QUSA 5IV0A 4R87A 2JDDA 2VEZA 3R9EA 1MJ9A 3N7ZA 4XPKA 4E0AA 4CRZB 5C88A 5F48A 1QSOA 3IGRA 1S3ZA 4FD6A 1P0HA 3FIXA 4B5PA 4QBJA 4KOVA 5KTCA 2G3TA 1KUYA 2G3AA 1YLEA 2FL4A 2Q4YA 2QMLA 2ZPAA 1ON0A 2HUZA 3R9FA 2CNMA 3W6SA 1R57A 4YFJA 3E0KA 2RC4A 4UWJA 4KZTA 2Q7BA 4B5PB 5C82A 1K4JA 5F49A 5JQ4A 4PSWA 2FXFA 1I21A 4KVXA 2VZYA 3P2FA 3OWCA 4IUSA 2CY2A 4R57A 1IYLA 4KVME 2B3UA 2FT0A 1NMTA 3T9YA 3I9SA 3BLNA 2D4OA 1YX0A 4R3KA 2BL1A 4LX9A 3VWEA 4ONUA 1XIXA 1VHSA 2G0BA 4CS0B 2A4NA 4EVYA 1L0CA 2QECA 2HQYA 2Q0YA 3T90A 1RO5A 4FD7A 1OZPA 1KUXA 2BSWA 2GIVA 4PSXA 1XE4A 2KCWA 4E8OA 1KUVA 4U9YA 2PR1A 3QB8A 1Q2CA 2C27A 2H5MA 5J8FA 3DDDA 1S7FA 1XEBA 4OLLA 2GE3A 2Z11A 4IF5A 3KKWA 2EVNA 3EY5A 3S6FA 4OADA 3QAHA 3EO4A 4KOSA 2FIAA 1MK4A 3TE4A 3H4QA 2D4PA 4JWPA 3D3SA 2P6FA 3TTHA 2CNTA 5EBVA 2ARHA 4HNXB 3EFAA 4MJ8A 5H84A 3D8PA 1QSTA 3LD2A 1YK3A 5CNPA 2GANA 1M1DA 2REEA 1P4NA 3SXOA 4NCZA 1PU9A 5DWMA 2PQ8A 3MGDA 2F5IA 1Z4RA 1Q2DA 4RS2A 4QC6A 1RXTA 3R96A 2P6GA 3F5BA 3K9UA 4GS4A 4AVCA 4XPLA 4CAWA 1BOBA 1CJWA 1YVOA 2WPWA 4I49A 4JXQA 2B4BA 4NEXA 3JVNA 4NSQA 4KLWA 2FIWA 5EC4A 1CM0A 4UA3A 2PSWA 2I00A 4CAVA 3TCVA 1WK4A 1SQHA 2Q4VA 2EUIA 2R8VA 2NMTA 1QSRA 5HH1A 4MBUA 3TFYA 4YRHA 4L89A 4B5OA 5FVJA 5IX3A 3BJ8A 1S7KA 2P6EA 4U5YA 3TT2A 3R9GA 4LUAA 3SHPA 2FSRA 4JLYA 2VZZA 1IIDA 5F47A 2ZW6A 2REFA 1QSMA 4NF1A 4ORFA 1YGHA 1LRZA 2ATRA 1IYKA 4Y49C 2VI7A 2OB0A 5KTDA 3GKRA 2WPXA 3W91A 3EC4A 4MY3A 2ZW7A 5I0CA 3S6GA 3S6HA 3B8GA 1NSLA 1S7NA 2CNSA 2QIRA 3CXQA 4ZBGA 4J3GA 1Q2YA 1YREA 3PGPA 1YVKA 4MHDA 3S6KA 3C26A 3FXTA 3R1KA 3EXNA 2R7HA 3I3GA 4KOUA 3R95A 5JPHA 5F46A 1Y7RA 4KORA 4CRYB 4RI1A 3G8WA 2ZW5A 4AG9A 1MJBA 3V8IA 4U9ZA 4QB9A 3ZJ0A
chains in the Genus database with same CATH superfamily
3CXSA 2XEIA 4X5KA 3PRTA 4P4FA 3D66A 2ZEMA 4A94A 2J8MA 1GYTA 4KUBA 2EWBA 1ARMA 1NE9A 4KSFA 2PJ3A 2IMOA 1AYEA 4FD4A 3TC8A 4JXRA 2X7BA 1VIXA 2AFSA 2Q04A 3TO9A 1H8LA 2O28A 3KR5A 5HVGA 1BAVA 1OBRA 1V0CA 4JJXA 4M3SA 5J8CA 4KUAA 5K8OA 2PC1A 1KZFA 3ISZA 4QVTA 4NXYA 3SI1A 3TOAA 3W6XA 4UCNA 3CDXA 4PK2A 3PEIA 3PZJA 4Q7AA 2PJ1A 1BO4A 4C2ZA 4HNYB 4PXCA 4YWYA 3D2MA 1M44A 2ZW4A 2POKA 4OMEA 3GUXA 1CPXA 3DGVA 4H6UA 2OZUA 1B87A 2Z3OA 3IJ3A 4BMHA 5GCNA 3B3VA 4M6GA 2ANPA 4IK2A 4FBEA 1M4GA 3HLPA 4KOWA 1S7LA 2ZXVA 4P10A 5AG6A 2NSMA 2OU2A 2J8RA 2GLJA 2DXQA 2FCKA 3FRMA 1I12A 2YNCA 1UFHA 4A38A 1R43A 4AG7A 1S60A 4OC4A 2PJ9A 4F6AA 5AG5A 1IOIA 1EE3P 2Z3PA 1TKFA 4F8ZA 1IB1E 1F2OA 2HC9A 3IO1A 4CGLA 3IIBA 1ZLIA 3LWUA 5IB0A 1Z2LA 4MFZA 3PB8X 1TKHA 4F9UA 3B35A 5E96A 2DPTA 1TIQA 3DR8A 3FNCA 3DNSA 3NH5A 4JYWA 5ISVA 2AFMA 3RBUA 1WWZA 4K3NA 2PRBA 5K8NA 1MJAA 4RUHA 1HDUA 4CAXA 1Y7EA 2B3VA 3QAYA 3UY5A 1IICA 4Z65A 1IGBA 2C1CA 1NSAA 2AFWA 2AE6A 4A31A 3FYNA 5DS0A 4AXVA 3P2HA 3ISXA 4KOXA 2YNCC 4NGNA 3NE7A 4HNWB 2JBKA 3DSBA 4Y49B 1S5KA 2PDOA 4M6IA 1HEEA 1ELMP 5KTAA 1YR0A 1VGYA 2YNDA 1I1DA 2Z0ZA 1FY7A 2EO8A 2PRQA 3BJ7A 1Y0YA 5DWNA 4IAVA 4C7IA 1J4JA 4P6YA 2Y0MA 4KSIA 2PR8A 2PJ5A 4F0YA 5LYLA 4A2ZA 2WZNA 4R3LA 4H89A 3KASA 4MMOA 4L8AA 3WABA 4XPDB 2PJ8A 4AVBA 4JD6A 3F8KA 5AG4A 3JTKA 1XMTA 3PBEA 2FS5A 4HKFA 4M85A 2PIYA 4MCQA 4AB7A 1VKCA 1XMBA 4UFXA 1Y9KA 2DEAA 2CF4A 4KOTA 4UBRA 2HV2A 1GHEA 3H8GA 4CAFA 1Z9UA 1YW4A 1N71A 4K30A 4MI4A 5BWAB 1XFOA 1Y9WA 1LANA 4XPDC 2JEWA 5AG7A 3NA6A 5A27A 5F09A 5JM6A 2BEIA 5LRGA 2PE3A 2P0WA 4PXDA 3D67A 3FH4A 5HXDA 3KZWA 1BPMA 3CPAA 4YGOA 3TO7A 3TO6A 3ZZIA 4CYNA 3GYAA 4GXHA 1M4DA 2WUUA 3WT4A 3G3SA 3VWDA 3SJXA 4Q38A 4P4IA 5LYDA 2WSAA 3F0AA 2G9DA 4H6ZA 1B6BA 2QYVA 2IL4A 2V8DA 3SXNA 5G1ZA 2I79A 1M4IA 2RFHA 2K5TA 3PBBA 4E2AA 2ZEPA 3JUWA 3WR7A 2NYQA 2AJ6A 4CGOA 1XRYA 4AVAA 2RB7A 2Q4ZA 3MRUA 1PUAA 1X12A 2OR4A 4UWIA 2JLMA 4MY0A 1U6MA 2R1IA 3GY9A 3B3CA 3N5FA 2B5GA 2PVWA 4CGNA 4II9A 4FD5A 1IY7A 4NGPA 4MXUA 1TKJA 4KVOE 4NGMA 4PV6A 2F7VA 2R98A 4MCPA 4MHYA 4OC2A 2C6GA 3PP9A 4X2TA 4OAEA 4XNHB 4F0XA 1LFWA 2B58A 2OH1A 1LCPA 3B3SA 4NGSA 1Z8XA 3LODA 2FVGA 3H8FA 5H86A 4FAIA 4F9VA 5HMNA 4DNCA 1TF8A 2YGWA 3FBUA 2B5GB 2JDCA 2VQYA 3TOBA 3CXPA 4MCSA 2Z3NA 1PCAA 2B4DA 2FE7A 2Q44A 1Z4EA 3IWGA 4XNHC 2J8NA 4PXBA 3SJGA 2Z3MA 4PK3A 3K9TA 2JEVA 1XF8A 3FX6A 2Z3KA 5CBMA 2VBQA 2OZHA 3FF3A 2QVPA 4UIAA 3RAMA 4MFPA 2OZGA 4R9MA 5JH9A 1QSNA 2BUEA 2Z10A 1XJOA 4ZI6A 4IHMA 2VXKA 3RYOA 1M4LA 1ZLHA 2AFZA 3SJFA 2B4DB 3FB3A 3H5ZA 3SI0A 1QMUA 3D2PA 2PIZA 5JGFA 4ONWA 3QNVA 2V8HA 3FVLA 3DR6A 4KOYA 4KLVA 4QUSA 5IV0A 2XEFA 4R87A 2JDDA 3S9NA 2VEZA 4R8FA 4MFLA 3R9EA 1MJ9A 4BD9A 1HDQA 2DF5A 3N7ZA 3NE8A 2BCOA 4ZY0A 1Z5RA 1IU8A 2ZELA 4XPKA 4E0AA 4CRZB 3D7GA 4WWVA 5C88A 4CAEA 4EFDA 3PB4X 4PPZA 5F48A 4MRIA 2Q51A 3GB0A 1QSOA 3HUVA 3IGRA 3PB6X 4NGQA 2PJ2A 1S3ZA 4FD6A 1P0HA 3FIXA 2HB6A 4B5PA 4QBJA 4O23A 5LYFA 3CT9A 4KOVA 5KTCA 2V8GA 2G3TA 4KSAA 1KUYA 2G3AA 4P4JA 3IU2A 7CPAA 2ZEHA 3B2YA 1YLEA 2FL4A 2Q4YA 4PXEA 3RNZA 2V77A 1LAMA 2QMLA 1ON0A 2ZPAA 2HUZA 4M6HA 4P4EA 5A28A 4X3RA 4NGRA 3R9FA 2CNMA 3IC1A 4NJRA 1R57A 4UFVA 2JBJA 3S9MA 3W6SA 1YLOA 4YFJA 3E0KA 1JQGA 1Y0RA 2RC4A 1R3NA 2PJBA 4KZTA 4UWJA 4EMEA 2Q7BA 2ABZA 2CIJA 4B5PB 4A37A 3KL9A 1AMPA 1PYTB 5C82A 1K4JA 3LMSA 5F49A 4PSWA 4P4BA 2FXFA 1I21A 5JQ4A 1LOKA 4KVXA 5K8PA 2VZYA 3KR4A 2YNEA 3BXMA 3P2FA 4JZ0A 3OWCA 2O4HA 4IUSA 2CY2A 4BINA 5G21A 1YSJA 1IYLA 1QQ9A 4KVME 4R57A 5THWA 2B3UA 3BI1A 3RO0A 4C7HA 2FT0A 3PB9X 4W9YA 1NMTA 3WC5A 3T9YA 3IWWA 2EK8A 1Z8LA 3I9SA 3BLNA 2D4OA 2EK9A 2OOTA 4A95A 1YX0A 3IFEA 4R3KA 5D29A 2BL1A 4LX9A 8CPAA 4OIDA 1A2ZA 1VHOA 2AFOA 3VWEA 3ZJ0A 1ZG7A 1Q7LA 4LQ6A 4ONUA 1VHSA 1XIXA 2G0BA 2XEJA 4CS0B 2PVVA 1CX8A 3D68A 1FT7A 2A4NA 3GLJA 3PB7X 4EVYA 2AFUA 1L0CA 3DLJA 2QECA 2HQYA 2PJ0A 2Q0YA 4OC3A 1RO5A 3T90A 4CYPA 4YU9A 4DJLA 4FD7A 3TX8A 1OZPA 1KUXA 4UCMA 2BSWA 2GIVA 4PSXA 4B10A 1XE4A 2Q7SA 2KCWA 4PQAA 4Q36A 2PJ4A 3D7HA 4E8OA 5ELYA 1KUVA 4U9YA 4NJQA 4X8IA 2GLFA 2PR1A 3IWEA 3QB8A 4BBHA 1Q2CA 2C27A 3KQZA 3V38A 4A33A 2H5MA 5J8FA 4B11A 2BO9A 3DDDA 1XBUA 4B6ZA 1S7FA 1XEBA 4OLLA 2ODFA 2GE3A 1LAPA 2Z11A 4IF5A 3KKWA 1ELLP 2ZEGA 2EVNA 3VH9A 3T8WA 3EY5A 3KGQA 3S6FA 4OADA 4ZX9A 3QAHA 3EO4A 4MHZA 4KOSA 4OIWA 2FIAA 1MK4A 3TE4A 3H4QA 4P44A 2D4PA 4JWPA 4B14A 3D3SA 2P6FA 4R6TA 3WC6A 4ZY1A 3TTHA 3PFOA 1X10A 1TXRA 2CNTA 2PJAA 2ARHA 5EBVA 2PJ6A 4HNXB 1CP6A 3JRUA 3EFAA 4KS9A 4MJ8A 5H84A 3D8PA 1QSTA 1XOVA 4UEZA 2Z3LA 3SJEA 3LD2A 4NFRA 1YK3A 5CNPA 4C2YA 4OC5A 2ZOGA 2GANA 1M1DA 1ZG9A 2J9AA 2REEA 3H8EA 3LACA 4LQGA 4CGPA 4CYQA 4UEEA 1P4NA 3SXOA 3FECA 4NCZA 1JWQA 2Q43A 1PU9A 4MFJA 1ZO0A 4RN7A 2ZEEA 4CYOA 2QJ8A 4DUKA 2AFXA 5G22A 4UFWA 2PQ8A 3MGDA 5DWMA 4B12A 1TF9A 2F5IA 6CPAA 3NH4A 4MFQA 4MHPA 4P4DA 4UIBA 1YMEA 1Z4RA 1Q2DA 2DPSA 4RS2A 4QC6A 2IJZA 1RXTA 5LRJA 3R96A 3BHXA 1ZG8A 2CTCA 4UEFA 2P6GA 3F5BA 3K9UA 3KHZA 4GS4A 4EWTA 2BOAA 3B3WA 3WC7A 4AVCA 4XPLA 4CAWA 3PFEA 2V8VA 1CP7A 1BOBA 4R7MA 1CJWA 2PJ7A 1YVOA 2WPWA 3FEEA 2ZEOA 1Z8TA 4I49A 4DYOA 4JXQA 2WYRA 2B4BA 3KHXA 4NEXA 4UF4A 3JVNA 4NSQA 4KLWA 2FIWA 4R76A 3CZXA 1F57A 5EC4A 1CM0A 1AUGA 4UA3A 5EMIA 3S9LA 2PSWA 2I00A 4CAVA 4TNUA 4ZY2A 1CG2A 4OKOA 3TCVA 5LYIA 1WK4A 1SQHA 2C6PA 2EUIA 2Q4VA 2R8VA 4FWUA 2NMTA 4OP4A 4OC1A 4CGMA 2CTBA 1QSRA 4A39A 3SI2A 1ARLA 4CPAA 3L2NA 3I1UA 1BPNA 4MBUA 5HH1A 4G1PA 5CPAA 3VATA 3TFYA 4YRHA 1FNOA 4L89A 1IOFA 2ZOFA 2CXAA 4B5OA 3V7ZA 1DE4C 5FVJA 5IX3A 2ZENA 1S7KA 3BJ8A 1CPSA 2P6EA 2IQ6A 4U5YA 3D7FA 2F8HA 3KI9A 3TT2A 3A9LA 4C68A 4OC0A 4TWEA 5D8NA 3R9GA 4LUAA 3SHPA 2FSRA 2XEGA 1F2PA 3D7DA 3NFZA 4B13A 4JLYA 2VZZA 4ZGYB 5AGEA 1IIDA 5F47A 2ZW6A 3FEDA 3FMCA 5J1QA 2REFA 1QSMA 4C2XA 4NF1A 4ORFA 1YGHA 5HVHA 1LRZA 5IB9A 5LRKA 2VL1A 4HPSA 1UWYA 4MCRA 2ATRA 1IYKA 4GM5A 4Y49C 2VI7A 2OB0A 2C6CA 5K8MA 4UCPA 4A30A 5KTDA 2GFQA 3GIUA 1Z8WA 3GKRA 2WPXA 3W91A 3EC4A 4MY3A 2ZW7A 4WJBA 2PCUA 4ZX8A 5I0CA 5HVFA 4FUUA 3S6GA 3S6HA 3B8GA 1NSLA 3MN8A 2EBJA 1BLLE 4A32A 1S7NA 2CNSA 1RTQA 2QIRA 4P45A 4H2KA 3CXQA 2ZEFA 4NGTA 2GREA 4ZBGA 4J3GA 1Q2YA 1YREA 3K2KA 3D4UA 3PGPA 1KWMA 3CPXA 1YVKA 4MHDA 4ZYQA 2PJCA 3S6KA 2I3CA 3KQXA 3C26A 3B7IA 3FXTA 1YW6A 1CBXA 1VHEA 3EXNA 3IEHA 3R1KA 2R7HA 4MFKA 3I3GA 2ZEDA 4KOUA 3NH8A 3B3TA 3R95A 5JPHA 5G20A 2GU2A 2O53A 3IU1A 1Y7RA 4KORA 4CRYB 1DTDA 5F46A 3VARA 4MHNA 3FJUA 4RI1A 3RZAA 3G8WA 2ZW5A 4AG9A 1MJBA 5I4MA 3V8IA 4U9ZA 4QB9A 3BI0A 1YQEA
chains in the Genus database with same CATH topology
3CXSA 4X5KA 2J8MA 4KUBA 1NE9A 4KSFA 4FD4A 4JXRA 2X7BA 2Q04A 3TO9A 2O28A 5J8CA 1V0CA 4JJXA 4M3SA 4KUAA 2PC1A 1KZFA 4QVTA 3W6XA 4NXYA 3TOAA 4UCNA 4PK2A 3PZJA 1BO4A 4C2ZA 4HNYB 3D2MA 1M44A 2ZW4A 4H6UA 2OZUA 1B87A 2Z3OA 4BMHA 5GCNA 1M4GA 4KOWA 1S7LA 2ZXVA 5AG6A 2OU2A 2J8RA 2DXQA 2FCKA 3FRMA 1I12A 2YNCA 1UFHA 4AG7A 1S60A 4F6AA 5AG5A 2Z3PA 1IB1E 4CGLA 5IB0A 4MFZA 5E96A 2DPTA 1TIQA 3DR8A 3FNCA 3DNSA 5ISVA 1WWZA 2PRBA 1MJAA 4CAXA 2B3VA 3UY5A 1IICA 4A31A 2AE6A 3FYNA 3P2HA 4KOXA 2YNCC 3NE7A 4HNWB 3DSBA 4Y49B 1S5KA 2PDOA 5KTAA 1YR0A 2YNDA 2Z0ZA 1I1DA 1FY7A 3BJ7A 5DWNA 4C7IA 1J4JA 2Y0MA 2PR8A 4F0YA 4A2ZA 4R3LA 4H89A 4L8AA 4XPDB 4AVBA 4JD6A 3F8KA 5AG4A 3JTKA 1XMTA 2FS5A 4HKFA 4M85A 4AB7A 1VKCA 4UFXA 1Y9KA 4KOTA 4UBRA 2HV2A 1GHEA 4CAFA 1Z9UA 4MI4A 1N71A 4K30A 5BWAB 1Y9WA 4XPDC 5AG7A 5A27A 2BEIA 2P0WA 3TO7A 4YGOA 3TO6A 3ZZIA 4CYNA 3GYAA 1M4DA 2WUUA 3G3SA 3VWDA 4Q38A 2WSAA 3F0AA 4H6ZA 1B6BA 2IL4A 3SXNA 5G1ZA 2I79A 1M4IA 2K5TA 4E2AA 3JUWA 4CGOA 3WR7A 2AJ6A 4AVAA 1PUAA 4UWIA 2JLMA 4MY0A 1U6MA 2R1IA 3GY9A 2B5GA 4CGNA 4II9A 4FD5A 4KVOE 4PV6A 2R98A 3PP9A 4OAEA 4XNHB 4F0XA 2B58A 2OH1A 3LODA 5H86A 5HMNA 4DNCA 2YGWA 3FBUA 2B5GB 2JDCA 2VQYA 3TOBA 3CXPA 2Z3NA 2B4DA 2FE7A 2Q44A 1Z4EA 3IWGA 4XNHC 2J8NA 2Z3MA 4PK3A 2JEVA 1XF8A 2Z3KA 2VBQA 2OZHA 4MFPA 2OZGA 4R9MA 1QSNA 2BUEA 2Z10A 2VXKA 3RYOA 2B4DB 3FB3A 3H5ZA 3D2PA 3DR6A 4KOYA 4KLVA 4QUSA 5IV0A 4R87A 2JDDA 2VEZA 4MFLA 3R9EA 1MJ9A 3N7ZA 4XPKA 4E0AA 4CRZB 5C88A 4CAEA 5F48A 1QSOA 3IGRA 1S3ZA 4FD6A 1P0HA 3FIXA 4B5PA 4QBJA 4KOVA 5KTCA 2G3TA 4KSAA 1KUYA 2G3AA 3IU2A 1YLEA 2FL4A 2Q4YA 5A28A 2QMLA 2ZPAA 1ON0A 2HUZA 3R9FA 2CNMA 3W6SA 1R57A 4UFVA 4YFJA 3E0KA 2RC4A 4UWJA 4KZTA 2Q7BA 4B5PB 5C82A 1K4JA 5F49A 5JQ4A 4PSWA 2FXFA 1I21A 4KVXA 2VZYA 2YNEA 3P2FA 3OWCA 4IUSA 2CY2A 5G21A 4R57A 1IYLA 4KVME 2B3UA 4C7HA 2FT0A 1NMTA 3T9YA 3I9SA 3BLNA 2D4OA 4A95A 1YX0A 4R3KA 2BL1A 4LX9A 3VWEA 4ONUA 1XIXA 1VHSA 2G0BA 4CS0B 2A4NA 4EVYA 1L0CA 2QECA 2HQYA 2Q0YA 3T90A 4CYPA 1RO5A 4FD7A 1OZPA 1KUXA 4UCMA 2BSWA 2GIVA 4PSXA 4B10A 1XE4A 2KCWA 4Q36A 4E8OA 1KUVA 4U9YA 3QB8A 2PR1A 3IWEA 4BBHA 1Q2CA 2C27A 4A33A 2H5MA 5J8FA 4B11A 3DDDA 1S7FA 1XEBA 4OLLA 2GE3A 2Z11A 4IF5A 3KKWA 2EVNA 3EY5A 3S6FA 4OADA 3QAHA 3EO4A 4KOSA 2FIAA 1MK4A 3TE4A 3H4QA 2D4PA 4JWPA 4B14A 3D3SA 2P6FA 3TTHA 2CNTA 5EBVA 2ARHA 4HNXB 3EFAA 4KS9A 4MJ8A 5H84A 3D8PA 1QSTA 2Z3LA 3LD2A 1YK3A 5CNPA 4C2YA 2GANA 1M1DA 2REEA 4CGPA 4CYQA 1P4NA 3SXOA 4NCZA 1PU9A 4MFJA 1ZO0A 4CYOA 5G22A 4UFWA 2PQ8A 3MGDA 5DWMA 4B12A 2F5IA 4MFQA 1Z4RA 1Q2DA 2DPSA 4RS2A 4QC6A 1RXTA 3R96A 2P6GA 3F5BA 3K9UA 4GS4A 4AVCA 4XPLA 4CAWA 1BOBA 1CJWA 1YVOA 2WPWA 4I49A 4JXQA 2B4BA 4NEXA 3JVNA 4NSQA 4KLWA 2FIWA 5EC4A 1CM0A 4UA3A 2PSWA 2I00A 4CAVA 3TCVA 1WK4A 1SQHA 2Q4VA 2EUIA 2R8VA 4CGMA 2NMTA 1QSRA 5HH1A 4MBUA 3TFYA 4YRHA 4L89A 2CXAA 4B5OA 5FVJA 5IX3A 3BJ8A 1S7KA 2P6EA 4U5YA 3TT2A 3A9LA 4C68A 4B13A 3R9GA 4LUAA 3SHPA 2FSRA 4JLYA 2VZZA 4ZGYB 5AGEA 1IIDA 5F47A 2ZW6A 2REFA 1QSMA 4C2XA 4NF1A 4ORFA 1YGHA 1LRZA 2ATRA 1IYKA 4Y49C 2VI7A 2OB0A 4UCPA 4A30A 5KTDA 3GKRA 2WPXA 3W91A 3EC4A 4MY3A 2ZW7A 5I0CA 3S6GA 3S6HA 3B8GA 1NSLA 4A32A 1S7NA 2CNSA 2QIRA 3CXQA 4ZBGA 4J3GA 1Q2YA 1YREA 3PGPA 1YVKA 4MHDA 3S6KA 3C26A 3FXTA 3R1KA 3EXNA 4MFKA 2R7HA 3I3GA 4KOUA 3R95A 5JPHA 5G20A 3IU1A 1Y7RA 4KORA 4CRYB 5F46A 4RI1A 3G8WA 2ZW5A 4AG9A 1MJBA 3V8IA 4U9ZA 4QB9A 3ZJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXS A;  4X5K A;  2J8M A;  4KUB A;  1NE9 A;  4FD4 A;  4JXR A;  2X7B A;  2Q04 A;  3TO9 A;  2O28 A;  5J8C A;  1V0C A;  4JJX A;  4M3S A;  4KUA A;  2PC1 A;  1KZF A;  4QVT A;  3W6X A;  4NXY A;  3TOA A;  4PK2 A;  3PZJ A;  1BO4 A;  4HNY B;  3D2M A;  1M44 A;  2ZW4 A;  4H6U A;  2OZU A;  1B87 A;  4BMH A;  5GCN A;  1M4G A;  4KOW A;  1S7L A;  2ZXV A;  2OU2 A;  2J8R A;  2DXQ A;  2FCK A;  3FRM A;  1I12 A;  1UFH A;  4AG7 A;  1S60 A;  4F6A A;  1IB1 E;  5IB0 A;  5E96 A;  1TIQ A;  3DR8 A;  3FNC A;  3DNS A;  5ISV A;  1WWZ A;  2PRB A;  1MJA A;  4CAX A;  2B3V A;  3UY5 A;  1IIC A;  2AE6 A;  3FYN A;  3P2H A;  4KOX A;  3NE7 A;  4HNW B;  3DSB A;  4Y49 B;  1S5K A;  2PDO A;  5KTA A;  1YR0 A;  2Z0Z A;  1I1D A;  1FY7 A;  3BJ7 A;  5DWN A;  1J4J A;  2Y0M A;  2PR8 A;  4F0Y A;  4R3L A;  4H89 A;  4L8A A;  4XPD B;  4AVB A;  4JD6 A;  3F8K A;  1XMT A;  2FS5 A;  4HKF A;  4M85 A;  4AB7 A;  1VKC A;  1Y9K A;  4KOT A;  4UBR A;  2HV2 A;  1GHE A;  1Z9U A;  4MI4 A;  1N71 A;  4K30 A;  1Y9W A;  4XPD C;  2BEI A;  2P0W A;  3TO7 A;  4YGO A;  3TO6 A;  3ZZI A;  3GYA A;  1M4D A;  3G3S A;  3VWD A;  3F0A A;  4H6Z A;  1B6B A;  2IL4 A;  3SXN A;  2I79 A;  1M4I A;  2K5T A;  4E2A A;  3JUW A;  3WR7 A;  2AJ6 A;  4AVA A;  1PUA A;  4UWI A;  2JLM A;  4MY0 A;  1U6M A;  2R1I A;  3GY9 A;  2B5G A;  4II9 A;  4FD5 A;  4KVO E;  4PV6 A;  2R98 A;  3PP9 A;  4OAE A;  4XNH B;  2B58 A;  2OH1 A;  3LOD A;  5H86 A;  5HMN A;  4DNC A;  3FBU A;  2B5G B;  2JDC A;  2VQY A;  3TOB A;  3CXP A;  2B4D A;  2FE7 A;  2Q44 A;  1Z4E A;  3IWG A;  4XNH C;  2J8N A;  4PK3 A;  2JEV A;  1XF8 A;  2VBQ A;  2OZH A;  2OZG A;  4R9M A;  1QSN A;  2BUE A;  2Z10 A;  2VXK A;  3RYO A;  2B4D B;  3FB3 A;  3D2P A;  3DR6 A;  4KOY A;  4KLV A;  4QUS A;  5IV0 A;  4R87 A;  2JDD A;  2VEZ A;  3R9E A;  1MJ9 A;  3N7Z A;  4XPK A;  4E0A A;  4CRZ B;  5C88 A;  5F48 A;  1QSO A;  3IGR A;  1S3Z A;  4FD6 A;  1P0H A;  3FIX A;  4B5P A;  4QBJ A;  4KOV A;  5KTC A;  2G3T A;  1KUY A;  2G3A A;  1YLE A;  2FL4 A;  2Q4Y A;  2QML A;  2ZPA A;  1ON0 A;  2HUZ A;  3R9F A;  2CNM A;  3W6S A;  1R57 A;  4YFJ A;  3E0K A;  2RC4 A;  4UWJ A;  4KZT A;  2Q7B A;  4B5P B;  5C82 A;  1K4J A;  5F49 A;  5JQ4 A;  4PSW A;  2FXF A;  1I21 A;  4KVX A;  2VZY A;  3P2F A;  3OWC A;  4IUS A;  2CY2 A;  4R57 A;  1IYL A;  4KVM E;  2B3U A;  2FT0 A;  1NMT A;  3T9Y A;  3I9S A;  3BLN A;  2D4O A;  1YX0 A;  4R3K A;  2BL1 A;  4LX9 A;  3VWE A;  4ONU A;  1XIX A;  1VHS A;  2G0B A;  4CS0 B;  2A4N A;  4EVY A;  1L0C A;  2QEC A;  2HQY A;  2Q0Y A;  3T90 A;  1RO5 A;  4FD7 A;  1OZP A;  1KUX A;  2BSW A;  2GIV A;  4PSX A;  1XE4 A;  2KCW A;  4E8O A;  1KUV A;  4U9Y A;  2PR1 A;  3QB8 A;  1Q2C A;  2C27 A;  2H5M A;  5J8F A;  3DDD A;  1S7F A;  1XEB A;  4OLL A;  2GE3 A;  2Z11 A;  4IF5 A;  3KKW A;  2EVN A;  3EY5 A;  3S6F A;  4OAD A;  3QAH A;  3EO4 A;  4KOS A;  2FIA A;  1MK4 A;  3TE4 A;  3H4Q A;  2D4P A;  4JWP A;  3D3S A;  2P6F A;  3TTH A;  2CNT A;  5EBV A;  2ARH A;  4HNX B;  3EFA A;  4MJ8 A;  5H84 A;  3D8P A;  1QST A;  3LD2 A;  1YK3 A;  5CNP A;  2GAN A;  1M1D A;  2REE A;  1P4N A;  3SXO A;  4NCZ A;  1PU9 A;  5DWM A;  2PQ8 A;  3MGD A;  2F5I A;  1Z4R A;  1Q2D A;  4RS2 A;  4QC6 A;  1RXT A;  3R96 A;  2P6G A;  3F5B A;  3K9U A;  4GS4 A;  4AVC A;  4XPL A;  4CAW A;  1BOB A;  1CJW A;  1YVO A;  2WPW A;  4I49 A;  4JXQ A;  2B4B A;  4NEX A;  3JVN A;  4NSQ A;  4KLW A;  2FIW A;  5EC4 A;  1CM0 A;  4UA3 A;  2PSW A;  2I00 A;  4CAV A;  3TCV A;  1WK4 A;  1SQH A;  2Q4V A;  2EUI A;  2R8V A;  2NMT A;  1QSR A;  5HH1 A;  4MBU A;  3TFY A;  4YRH A;  4L89 A;  4B5O A;  5FVJ A;  5IX3 A;  3BJ8 A;  1S7K A;  2P6E A;  4U5Y A;  3TT2 A;  3R9G A;  4LUA A;  3SHP A;  2FSR A;  4JLY A;  2VZZ A;  1IID A;  5F47 A;  2ZW6 A;  2REF A;  1QSM A;  4NF1 A;  4ORF A;  1YGH A;  1LRZ A;  2ATR A;  1IYK A;  4Y49 C;  2VI7 A;  2OB0 A;  5KTD A;  3GKR A;  2WPX A;  3W91 A;  3EC4 A;  4MY3 A;  2ZW7 A;  5I0C A;  3S6G A;  3S6H A;  3B8G A;  1NSL A;  1S7N A;  2CNS A;  2QIR A;  3CXQ A;  4ZBG A;  4J3G A;  1Q2Y A;  1YRE A;  3PGP A;  1YVK A;  4MHD A;  3S6K A;  3C26 A;  3FXT A;  3R1K A;  3EXN A;  2R7H A;  3I3G A;  4KOU A;  3R95 A;  5JPH A;  5F46 A;  1Y7R A;  4KOR A;  4CRY B;  4RI1 A;  3G8W A;  2ZW5 A;  4AG9 A;  1MJB A;  3V8I A;  4U9Z A;  4QB9 A;  3ZJ0 A; 
#chains in the Genus database with same CATH topology
 3CXS A;  2XEI A;  4X5K A;  3PRT A;  4P4F A;  3D66 A;  2ZEM A;  4A94 A;  2J8M A;  1GYT A;  4KUB A;  2EWB A;  1ARM A;  1NE9 A;  4KSF A;  2PJ3 A;  2IMO A;  1AYE A;  4FD4 A;  3TC8 A;  4JXR A;  2X7B A;  1VIX A;  2AFS A;  2Q04 A;  3TO9 A;  1H8L A;  2O28 A;  3KR5 A;  5HVG A;  1BAV A;  1OBR A;  1V0C A;  4JJX A;  4M3S A;  5J8C A;  4KUA A;  5K8O A;  2PC1 A;  1KZF A;  3ISZ A;  4QVT A;  4NXY A;  3SI1 A;  3TOA A;  3W6X A;  4UCN A;  3CDX A;  4PK2 A;  3PEI A;  3PZJ A;  4Q7A A;  2PJ1 A;  1BO4 A;  4C2Z A;  4HNY B;  4PXC A;  4YWY A;  3D2M A;  1M44 A;  2ZW4 A;  2POK A;  4OME A;  3GUX A;  1CPX A;  3DGV A;  4H6U A;  2OZU A;  1B87 A;  2Z3O A;  3IJ3 A;  4BMH A;  5GCN A;  3B3V A;  4M6G A;  2ANP A;  4IK2 A;  4FBE A;  1M4G A;  3HLP A;  4KOW A;  1S7L A;  2ZXV A;  4P10 A;  5AG6 A;  2NSM A;  2OU2 A;  2J8R A;  2GLJ A;  2DXQ A;  2FCK A;  3FRM A;  1I12 A;  2YNC A;  1UFH A;  4A38 A;  1R43 A;  4AG7 A;  1S60 A;  4OC4 A;  2PJ9 A;  4F6A A;  5AG5 A;  1IOI A;  1EE3 P;  2Z3P A;  1TKF A;  4F8Z A;  1IB1 E;  1F2O A;  2HC9 A;  3IO1 A;  4CGL A;  3IIB A;  1ZLI A;  3LWU A;  5IB0 A;  1Z2L A;  4MFZ A;  3PB8 X;  1TKH A;  4F9U A;  3B35 A;  5E96 A;  2DPT A;  1TIQ A;  3DR8 A;  3FNC A;  3DNS A;  3NH5 A;  4JYW A;  5ISV A;  2AFM A;  3RBU A;  1WWZ A;  4K3N A;  2PRB A;  5K8N A;  1MJA A;  4RUH A;  1HDU A;  4CAX A;  1Y7E A;  2B3V A;  3QAY A;  3UY5 A;  1IIC A;  4Z65 A;  1IGB A;  2C1C A;  1NSA A;  2AFW A;  2AE6 A;  4A31 A;  3FYN A;  5DS0 A;  4AXV A;  3P2H A;  3ISX A;  4KOX A;  2YNC C;  4NGN A;  3NE7 A;  4HNW B;  2JBK A;  3DSB A;  4Y49 B;  1S5K A;  2PDO A;  4M6I A;  1HEE A;  1ELM P;  5KTA A;  1YR0 A;  1VGY A;  2YND A;  1I1D A;  2Z0Z A;  1FY7 A;  2EO8 A;  2PRQ A;  3BJ7 A;  1Y0Y A;  5DWN A;  4IAV A;  4C7I A;  1J4J A;  4P6Y A;  2Y0M A;  4KSI A;  2PR8 A;  2PJ5 A;  4F0Y A;  5LYL A;  4A2Z A;  2WZN A;  4R3L A;  4H89 A;  3KAS A;  4MMO A;  4L8A A;  3WAB A;  4XPD B;  2PJ8 A;  4AVB A;  4JD6 A;  3F8K A;  5AG4 A;  3JTK A;  1XMT A;  3PBE A;  2FS5 A;  4HKF A;  4M85 A;  2PIY A;  4MCQ A;  4AB7 A;  1VKC A;  1XMB A;  4UFX A;  1Y9K A;  2DEA A;  2CF4 A;  4KOT A;  4UBR A;  2HV2 A;  1GHE A;  3H8G A;  4CAF A;  1Z9U A;  1YW4 A;  1N71 A;  4K30 A;  4MI4 A;  5BWA B;  1XFO A;  1Y9W A;  1LAN A;  4XPD C;  2JEW A;  5AG7 A;  3NA6 A;  5A27 A;  5F09 A;  5JM6 A;  2BEI A;  5LRG A;  2PE3 A;  2P0W A;  4PXD A;  3D67 A;  3FH4 A;  5HXD A;  3KZW A;  1BPM A;  3CPA A;  4YGO A;  3TO7 A;  3TO6 A;  3ZZI A;  4CYN A;  3GYA A;  4GXH A;  1M4D A;  2WUU A;  3WT4 A;  3G3S A;  3VWD A;  3SJX A;  4Q38 A;  4P4I A;  5LYD A;  2WSA A;  3F0A A;  2G9D A;  4H6Z A;  1B6B A;  2QYV A;  2IL4 A;  2V8D A;  3SXN A;  5G1Z A;  2I79 A;  1M4I A;  2RFH A;  2K5T A;  3PBB A;  4E2A A;  2ZEP A;  3JUW A;  3WR7 A;  2NYQ A;  2AJ6 A;  4CGO A;  1XRY A;  4AVA A;  2RB7 A;  2Q4Z A;  3MRU A;  1PUA A;  1X12 A;  2OR4 A;  4UWI A;  2JLM A;  4MY0 A;  1U6M A;  2R1I A;  3GY9 A;  3B3C A;  3N5F A;  2B5G A;  2PVW A;  4CGN A;  4II9 A;  4FD5 A;  1IY7 A;  4NGP A;  4MXU A;  1TKJ A;  4KVO E;  4NGM A;  4PV6 A;  2F7V A;  2R98 A;  4MCP A;  4MHY A;  4OC2 A;  2C6G A;  3PP9 A;  4X2T A;  4OAE A;  4XNH B;  4F0X A;  1LFW A;  2B58 A;  2OH1 A;  1LCP A;  3B3S A;  4NGS A;  1Z8X A;  3LOD A;  2FVG A;  3H8F A;  5H86 A;  4FAI A;  4F9V A;  5HMN A;  4DNC A;  1TF8 A;  2YGW A;  3FBU A;  2B5G B;  2JDC A;  2VQY A;  3TOB A;  3CXP A;  4MCS A;  2Z3N A;  1PCA A;  2B4D A;  2FE7 A;  2Q44 A;  1Z4E A;  3IWG A;  4XNH C;  2J8N A;  4PXB A;  3SJG A;  2Z3M A;  4PK3 A;  3K9T A;  2JEV A;  1XF8 A;  3FX6 A;  2Z3K A;  5CBM A;  2VBQ A;  2OZH A;  3FF3 A;  2QVP A;  4UIA A;  3RAM A;  4MFP A;  2OZG A;  4R9M A;  5JH9 A;  1QSN A;  2BUE A;  2Z10 A;  1XJO A;  4ZI6 A;  4IHM A;  2VXK A;  3RYO A;  1M4L A;  1ZLH A;  2AFZ A;  3SJF A;  2B4D B;  3FB3 A;  3H5Z A;  3SI0 A;  1QMU A;  3D2P A;  2PIZ A;  5JGF A;  4ONW A;  3QNV A;  2V8H A;  3FVL A;  3DR6 A;  4KOY A;  4KLV A;  4QUS A;  5IV0 A;  2XEF A;  4R87 A;  2JDD A;  3S9N A;  2VEZ A;  4R8F A;  4MFL A;  3R9E A;  1MJ9 A;  4BD9 A;  1HDQ A;  2DF5 A;  3N7Z A;  3NE8 A;  2BCO A;  4ZY0 A;  1Z5R A;  1IU8 A;  2ZEL A;  4XPK A;  4E0A A;  4CRZ B;  3D7G A;  4WWV A;  5C88 A;  4CAE A;  4EFD A;  3PB4 X;  4PPZ A;  5F48 A;  4MRI A;  2Q51 A;  3GB0 A;  1QSO A;  3HUV A;  3IGR A;  3PB6 X;  4NGQ A;  2PJ2 A;  1S3Z A;  4FD6 A;  1P0H A;  3FIX A;  2HB6 A;  4B5P A;  4QBJ A;  4O23 A;  5LYF A;  3CT9 A;  4KOV A;  5KTC A;  2V8G A;  2G3T A;  4KSA A;  1KUY A;  2G3A A;  4P4J A;  3IU2 A;  7CPA A;  2ZEH A;  3B2Y A;  1YLE A;  2FL4 A;  2Q4Y A;  4PXE A;  3RNZ A;  2V77 A;  1LAM A;  2QML A;  1ON0 A;  2ZPA A;  2HUZ A;  4M6H A;  4P4E A;  5A28 A;  4X3R A;  4NGR A;  3R9F A;  2CNM A;  3IC1 A;  4NJR A;  1R57 A;  4UFV A;  2JBJ A;  3S9M A;  3W6S A;  1YLO A;  4YFJ A;  3E0K A;  1JQG A;  1Y0R A;  2RC4 A;  1R3N A;  2PJB A;  4KZT A;  4UWJ A;  4EME A;  2Q7B A;  2ABZ A;  2CIJ A;  4B5P B;  4A37 A;  3KL9 A;  1AMP A;  1PYT B;  5C82 A;  1K4J A;  3LMS A;  5F49 A;  4PSW A;  4P4B A;  2FXF A;  1I21 A;  5JQ4 A;  1LOK A;  4KVX A;  5K8P A;  2VZY A;  3KR4 A;  2YNE A;  3BXM A;  3P2F A;  4JZ0 A;  3OWC A;  2O4H A;  4IUS A;  2CY2 A;  4BIN A;  5G21 A;  1YSJ A;  1IYL A;  1QQ9 A;  4KVM E;  4R57 A;  5THW A;  2B3U A;  3BI1 A;  3RO0 A;  4C7H A;  2FT0 A;  3PB9 X;  4W9Y A;  1NMT A;  3WC5 A;  3T9Y A;  3IWW A;  2EK8 A;  1Z8L A;  3I9S A;  3BLN A;  2D4O A;  2EK9 A;  2OOT A;  4A95 A;  1YX0 A;  3IFE A;  4R3K A;  5D29 A;  2BL1 A;  4LX9 A;  8CPA A;  4OID A;  1A2Z A;  1VHO A;  2AFO A;  3VWE A;  3ZJ0 A;  1ZG7 A;  1Q7L A;  4LQ6 A;  4ONU A;  1VHS A;  1XIX A;  2G0B A;  2XEJ A;  4CS0 B;  2PVV A;  1CX8 A;  3D68 A;  1FT7 A;  2A4N A;  3GLJ A;  3PB7 X;  4EVY A;  2AFU A;  1L0C A;  3DLJ A;  2QEC A;  2HQY A;  2PJ0 A;  2Q0Y A;  4OC3 A;  1RO5 A;  3T90 A;  4CYP A;  4YU9 A;  4DJL A;  4FD7 A;  3TX8 A;  1OZP A;  1KUX A;  4UCM A;  2BSW A;  2GIV A;  4PSX A;  4B10 A;  1XE4 A;  2Q7S A;  2KCW A;  4PQA A;  4Q36 A;  2PJ4 A;  3D7H A;  4E8O A;  5ELY A;  1KUV A;  4U9Y A;  4NJQ A;  4X8I A;  2GLF A;  2PR1 A;  3IWE A;  3QB8 A;  4BBH A;  1Q2C A;  2C27 A;  3KQZ A;  3V38 A;  4A33 A;  2H5M A;  5J8F A;  4B11 A;  2BO9 A;  3DDD A;  1XBU A;  4B6Z A;  1S7F A;  1XEB A;  4OLL A;  2ODF A;  2GE3 A;  1LAP A;  2Z11 A;  4IF5 A;  3KKW A;  1ELL P;  2ZEG A;  2EVN A;  3VH9 A;  3T8W A;  3EY5 A;  3KGQ A;  3S6F A;  4OAD A;  4ZX9 A;  3QAH A;  3EO4 A;  4MHZ A;  4KOS A;  4OIW A;  2FIA A;  1MK4 A;  3TE4 A;  3H4Q A;  4P44 A;  2D4P A;  4JWP A;  4B14 A;  3D3S A;  2P6F A;  4R6T A;  3WC6 A;  4ZY1 A;  3TTH A;  3PFO A;  1X10 A;  1TXR A;  2CNT A;  2PJA A;  2ARH A;  5EBV A;  2PJ6 A;  4HNX B;  1CP6 A;  3JRU A;  3EFA A;  4KS9 A;  4MJ8 A;  5H84 A;  3D8P A;  1QST A;  1XOV A;  4UEZ A;  2Z3L A;  3SJE A;  3LD2 A;  4NFR A;  1YK3 A;  5CNP A;  4C2Y A;  4OC5 A;  2ZOG A;  2GAN A;  1M1D A;  1ZG9 A;  2J9A A;  2REE A;  3H8E A;  3LAC A;  4LQG A;  4CGP A;  4CYQ A;  4UEE A;  1P4N A;  3SXO A;  3FEC A;  4NCZ A;  1JWQ A;  2Q43 A;  1PU9 A;  4MFJ A;  1ZO0 A;  4RN7 A;  2ZEE A;  4CYO A;  2QJ8 A;  4DUK A;  2AFX A;  5G22 A;  4UFW A;  2PQ8 A;  3MGD A;  5DWM A;  4B12 A;  1TF9 A;  2F5I A;  6CPA A;  3NH4 A;  4MFQ A;  4MHP A;  4P4D A;  4UIB A;  1YME A;  1Z4R A;  1Q2D A;  2DPS A;  4RS2 A;  4QC6 A;  2IJZ A;  1RXT A;  5LRJ A;  3R96 A;  3BHX A;  1ZG8 A;  2CTC A;  4UEF A;  2P6G A;  3F5B A;  3K9U A;  3KHZ A;  4GS4 A;  4EWT A;  2BOA A;  3B3W A;  3WC7 A;  4AVC A;  4XPL A;  4CAW A;  3PFE A;  2V8V A;  1CP7 A;  1BOB A;  4R7M A;  1CJW A;  2PJ7 A;  1YVO A;  2WPW A;  3FEE A;  2ZEO A;  1Z8T A;  4I49 A;  4DYO A;  4JXQ A;  2WYR A;  2B4B A;  3KHX A;  4NEX A;  4UF4 A;  3JVN A;  4NSQ A;  4KLW A;  2FIW A;  4R76 A;  3CZX A;  1F57 A;  5EC4 A;  1CM0 A;  1AUG A;  4UA3 A;  5EMI A;  3S9L A;  2PSW A;  2I00 A;  4CAV A;  4TNU A;  4ZY2 A;  1CG2 A;  4OKO A;  3TCV A;  5LYI A;  1WK4 A;  1SQH A;  2C6P A;  2EUI A;  2Q4V A;  2R8V A;  4FWU A;  2NMT A;  4OP4 A;  4OC1 A;  4CGM A;  2CTB A;  1QSR A;  4A39 A;  3SI2 A;  1ARL A;  4CPA A;  3L2N A;  3I1U A;  1BPN A;  4MBU A;  5HH1 A;  4G1P A;  5CPA A;  3VAT A;  3TFY A;  4YRH A;  1FNO A;  4L89 A;  1IOF A;  2ZOF A;  2CXA A;  4B5O A;  3V7Z A;  1DE4 C;  5FVJ A;  5IX3 A;  2ZEN A;  1S7K A;  3BJ8 A;  1CPS A;  2P6E A;  2IQ6 A;  4U5Y A;  3D7F A;  2F8H A;  3KI9 A;  3TT2 A;  3A9L A;  4C68 A;  4OC0 A;  4TWE A;  5D8N A;  3R9G A;  4LUA A;  3SHP A;  2FSR A;  2XEG A;  1F2P A;  3D7D A;  3NFZ A;  4B13 A;  4JLY A;  2VZZ A;  4ZGY B;  5AGE A;  1IID A;  5F47 A;  2ZW6 A;  3FED A;  3FMC A;  5J1Q A;  2REF A;  1QSM A;  4C2X A;  4NF1 A;  4ORF A;  1YGH A;  5HVH A;  1LRZ A;  5IB9 A;  5LRK A;  2VL1 A;  4HPS A;  1UWY A;  4MCR A;  2ATR A;  1IYK A;  4GM5 A;  4Y49 C;  2VI7 A;  2OB0 A;  2C6C A;  5K8M A;  4UCP A;  4A30 A;  5KTD A;  2GFQ A;  3GIU A;  1Z8W A;  3GKR A;  2WPX A;  3W91 A;  3EC4 A;  4MY3 A;  2ZW7 A;  4WJB A;  2PCU A;  4ZX8 A;  5I0C A;  5HVF A;  4FUU A;  3S6G A;  3S6H A;  3B8G A;  1NSL A;  3MN8 A;  2EBJ A;  1BLL E;  4A32 A;  1S7N A;  2CNS A;  1RTQ A;  2QIR A;  4P45 A;  4H2K A;  3CXQ A;  2ZEF A;  4NGT A;  2GRE A;  4ZBG A;  4J3G A;  1Q2Y A;  1YRE A;  3K2K A;  3D4U A;  3PGP A;  1KWM A;  3CPX A;  1YVK A;  4MHD A;  4ZYQ A;  2PJC A;  3S6K A;  2I3C A;  3KQX A;  3C26 A;  3B7I A;  3FXT A;  1YW6 A;  1CBX A;  1VHE A;  3EXN A;  3IEH A;  3R1K A;  2R7H A;  4MFK A;  3I3G A;  2ZED A;  4KOU A;  3NH8 A;  3B3T A;  3R95 A;  5JPH A;  5G20 A;  2GU2 A;  2O53 A;  3IU1 A;  1Y7R A;  4KOR A;  4CRY B;  1DTD A;  5F46 A;  3VAR A;  4MHN A;  3FJU A;  4RI1 A;  3RZA A;  3G8W A;  2ZW5 A;  4AG9 A;  1MJB A;  5I4M A;  3V8I A;  4U9Z A;  4QB9 A;  3BI0 A;  1YQE A; 
#chains in the Genus database with same CATH homology
 3CXS A;  4X5K A;  2J8M A;  4KUB A;  1NE9 A;  4KSF A;  4FD4 A;  4JXR A;  2X7B A;  2Q04 A;  3TO9 A;  2O28 A;  5J8C A;  1V0C A;  4JJX A;  4M3S A;  4KUA A;  2PC1 A;  1KZF A;  4QVT A;  3W6X A;  4NXY A;  3TOA A;  4UCN A;  4PK2 A;  3PZJ A;  1BO4 A;  4C2Z A;  4HNY B;  3D2M A;  1M44 A;  2ZW4 A;  4H6U A;  2OZU A;  1B87 A;  2Z3O A;  4BMH A;  5GCN A;  1M4G A;  4KOW A;  1S7L A;  2ZXV A;  5AG6 A;  2OU2 A;  2J8R A;  2DXQ A;  2FCK A;  3FRM A;  1I12 A;  2YNC A;  1UFH A;  4AG7 A;  1S60 A;  4F6A A;  5AG5 A;  2Z3P A;  1IB1 E;  4CGL A;  5IB0 A;  4MFZ A;  5E96 A;  2DPT A;  1TIQ A;  3DR8 A;  3FNC A;  3DNS A;  5ISV A;  1WWZ A;  2PRB A;  1MJA A;  4CAX A;  2B3V A;  3UY5 A;  1IIC A;  4A31 A;  2AE6 A;  3FYN A;  3P2H A;  4KOX A;  2YNC C;  3NE7 A;  4HNW B;  3DSB A;  4Y49 B;  1S5K A;  2PDO A;  5KTA A;  1YR0 A;  2YND A;  2Z0Z A;  1I1D A;  1FY7 A;  3BJ7 A;  5DWN A;  4C7I A;  1J4J A;  2Y0M A;  2PR8 A;  4F0Y A;  4A2Z A;  4R3L A;  4H89 A;  4L8A A;  4XPD B;  4AVB A;  4JD6 A;  3F8K A;  5AG4 A;  3JTK A;  1XMT A;  2FS5 A;  4HKF A;  4M85 A;  4AB7 A;  1VKC A;  4UFX A;  1Y9K A;  4KOT A;  4UBR A;  2HV2 A;  1GHE A;  4CAF A;  1Z9U A;  4MI4 A;  1N71 A;  4K30 A;  5BWA B;  1Y9W A;  4XPD C;  5AG7 A;  5A27 A;  2BEI A;  2P0W A;  3TO7 A;  4YGO A;  3TO6 A;  3ZZI A;  4CYN A;  3GYA A;  1M4D A;  2WUU A;  3G3S A;  3VWD A;  4Q38 A;  2WSA A;  3F0A A;  4H6Z A;  1B6B A;  2IL4 A;  3SXN A;  5G1Z A;  2I79 A;  1M4I A;  2K5T A;  4E2A A;  3JUW A;  4CGO A;  3WR7 A;  2AJ6 A;  4AVA A;  1PUA A;  4UWI A;  2JLM A;  4MY0 A;  1U6M A;  2R1I A;  3GY9 A;  2B5G A;  4CGN A;  4II9 A;  4FD5 A;  4KVO E;  4PV6 A;  2R98 A;  3PP9 A;  4OAE A;  4XNH B;  4F0X A;  2B58 A;  2OH1 A;  3LOD A;  5H86 A;  5HMN A;  4DNC A;  2YGW A;  3FBU A;  2B5G B;  2JDC A;  2VQY A;  3TOB A;  3CXP A;  2Z3N A;  2B4D A;  2FE7 A;  2Q44 A;  1Z4E A;  3IWG A;  4XNH C;  2J8N A;  2Z3M A;  4PK3 A;  2JEV A;  1XF8 A;  2Z3K A;  2VBQ A;  2OZH A;  4MFP A;  2OZG A;  4R9M A;  1QSN A;  2BUE A;  2Z10 A;  2VXK A;  3RYO A;  2B4D B;  3FB3 A;  3H5Z A;  3D2P A;  3DR6 A;  4KOY A;  4KLV A;  4QUS A;  5IV0 A;  4R87 A;  2JDD A;  2VEZ A;  4MFL A;  3R9E A;  1MJ9 A;  3N7Z A;  4XPK A;  4E0A A;  4CRZ B;  5C88 A;  4CAE A;  5F48 A;  1QSO A;  3IGR A;  1S3Z A;  4FD6 A;  1P0H A;  3FIX A;  4B5P A;  4QBJ A;  4KOV A;  5KTC A;  2G3T A;  4KSA A;  1KUY A;  2G3A A;  3IU2 A;  1YLE A;  2FL4 A;  2Q4Y A;  5A28 A;  2QML A;  2ZPA A;  1ON0 A;  2HUZ A;  3R9F A;  2CNM A;  3W6S A;  1R57 A;  4UFV A;  4YFJ A;  3E0K A;  2RC4 A;  4UWJ A;  4KZT A;  2Q7B A;  4B5P B;  5C82 A;  1K4J A;  5F49 A;  5JQ4 A;  4PSW A;  2FXF A;  1I21 A;  4KVX A;  2VZY A;  2YNE A;  3P2F A;  3OWC A;  4IUS A;  2CY2 A;  5G21 A;  4R57 A;  1IYL A;  4KVM E;  2B3U A;  4C7H A;  2FT0 A;  1NMT A;  3T9Y A;  3I9S A;  3BLN A;  2D4O A;  4A95 A;  1YX0 A;  4R3K A;  2BL1 A;  4LX9 A;  3VWE A;  4ONU A;  1XIX A;  1VHS A;  2G0B A;  4CS0 B;  2A4N A;  4EVY A;  1L0C A;  2QEC A;  2HQY A;  2Q0Y A;  3T90 A;  4CYP A;  1RO5 A;  4FD7 A;  1OZP A;  1KUX A;  4UCM A;  2BSW A;  2GIV A;  4PSX A;  4B10 A;  1XE4 A;  2KCW A;  4Q36 A;  4E8O A;  1KUV A;  4U9Y A;  3QB8 A;  2PR1 A;  3IWE A;  4BBH A;  1Q2C A;  2C27 A;  4A33 A;  2H5M A;  5J8F A;  4B11 A;  3DDD A;  1S7F A;  1XEB A;  4OLL A;  2GE3 A;  2Z11 A;  4IF5 A;  3KKW A;  2EVN A;  3EY5 A;  3S6F A;  4OAD A;  3QAH A;  3EO4 A;  4KOS A;  2FIA A;  1MK4 A;  3TE4 A;  3H4Q A;  2D4P A;  4JWP A;  4B14 A;  3D3S A;  2P6F A;  3TTH A;  2CNT A;  5EBV A;  2ARH A;  4HNX B;  3EFA A;  4KS9 A;  4MJ8 A;  5H84 A;  3D8P A;  1QST A;  2Z3L A;  3LD2 A;  1YK3 A;  5CNP A;  4C2Y A;  2GAN A;  1M1D A;  2REE A;  4CGP A;  4CYQ A;  1P4N A;  3SXO A;  4NCZ A;  1PU9 A;  4MFJ A;  1ZO0 A;  4CYO A;  5G22 A;  4UFW A;  2PQ8 A;  3MGD A;  5DWM A;  4B12 A;  2F5I A;  4MFQ A;  1Z4R A;  1Q2D A;  2DPS A;  4RS2 A;  4QC6 A;  1RXT A;  3R96 A;  2P6G A;  3F5B A;  3K9U A;  4GS4 A;  4AVC A;  4XPL A;  4CAW A;  1BOB A;  1CJW A;  1YVO A;  2WPW A;  4I49 A;  4JXQ A;  2B4B A;  4NEX A;  3JVN A;  4NSQ A;  4KLW A;  2FIW A;  5EC4 A;  1CM0 A;  4UA3 A;  2PSW A;  2I00 A;  4CAV A;  3TCV A;  1WK4 A;  1SQH A;  2Q4V A;  2EUI A;  2R8V A;  4CGM A;  2NMT A;  1QSR A;  5HH1 A;  4MBU A;  3TFY A;  4YRH A;  4L89 A;  2CXA A;  4B5O A;  5FVJ A;  5IX3 A;  3BJ8 A;  1S7K A;  2P6E A;  4U5Y A;  3TT2 A;  3A9L A;  4C68 A;  4B13 A;  3R9G A;  4LUA A;  3SHP A;  2FSR A;  4JLY A;  2VZZ A;  4ZGY B;  5AGE A;  1IID A;  5F47 A;  2ZW6 A;  2REF A;  1QSM A;  4C2X A;  4NF1 A;  4ORF A;  1YGH A;  1LRZ A;  2ATR A;  1IYK A;  4Y49 C;  2VI7 A;  2OB0 A;  4UCP A;  4A30 A;  5KTD A;  3GKR A;  2WPX A;  3W91 A;  3EC4 A;  4MY3 A;  2ZW7 A;  5I0C A;  3S6G A;  3S6H A;  3B8G A;  1NSL A;  4A32 A;  1S7N A;  2CNS A;  2QIR A;  3CXQ A;  4ZBG A;  4J3G A;  1Q2Y A;  1YRE A;  3PGP A;  1YVK A;  4MHD A;  3S6K A;  3C26 A;  3FXT A;  3R1K A;  3EXN A;  4MFK A;  2R7H A;  3I3G A;  4KOU A;  3R95 A;  5JPH A;  5G20 A;  3IU1 A;  1Y7R A;  4KOR A;  4CRY B;  5F46 A;  4RI1 A;  3G8W A;  2ZW5 A;  4AG9 A;  1MJB A;  3V8I A;  4U9Z A;  4QB9 A;  3ZJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...