2QVPA

Crystal structure of a putative metallopeptidase (sama_0725) from shewanella amazonensis sb2b at 2.00 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
266
structure length
266
Chain Sequence
QTFVWRSEIFECQSTDIQRFYSLLAIETERLGLGSKILGQAGHHPLYLLQSPGQKAGLPNLLISAGFHGEESAGPWGLLHFLSQLDGELFKRVNLSVLPLVNPTGFAKGHRFNELGENPNRGFFIENGKAKPGADTSAEGRILLEHAHLLQVASRDGILTCHEDVLMTDTYVYTFEPSQAPGRFSHSLRDALGQYFPIAADGDVDNCPVRSGVIFNHFDTSFESFLVRSGARVGCCSETPGQQPLDQRILANAAAMNTFVNMLAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_926603.1) from Shewanella amazonensis SB2B at 2.00 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Hydrolase
total genus 85
structure length 266
sequence length 266
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2qvpA00
2C1CA 2AFZA 3B3VA 5K8OA 4PPZA 2VL1A 2XEJA 1JQGA 3BI0A 4NGSA 1ZG8A 2CIJA 3FJUA 3FMCA 4FUUA 4UF4A 4NGRA 3FEEA 3WC7A 2AFXA 4NGTA 4WWVA 1IY7A 2IQ6A 3LWUA 4NFRA 3NH5A 1PYTB 4IHMA 3VH9A 2V8HA 1CP6A 2POKA 2ZOGA 1VHEA 4UEZA 1VGYA 4A37A 4DYOA 2WYRA 2V77A 2XEFA 3D4UA 2BOAA 4PXEA 1ELMP 2ZELA 3N5FA 1ZG7A 2AFMA 2GLFA 2F8HA 4WJBA 2HC9A 3PB9X 4ZY1A 3KL9A 1F2PA 1Z5RA 1ARMA 4UEFA 5CPAA 1OBRA 3B3SA 3KASA 4NJQA 2ZOFA 2Q4ZA 2GU2A 1XMBA 1Z8LA 1H8LA 2CF4A 4AXVA 1HDUA 4PXDA 4OC3A 1LFWA 4ZYQA 2FVGA 4TNUA 1IGBA 2PJBA 2GREA 1CPXA 3ISXA 3PB6X 5HVFA 1XJOA 3SJEA 2QYVA 3FH4A 2I3CA 3GUXA 5LYFA 1NSAA 4P4FA 5J1QA 4Q7AA 1GYTA 2ZEOA 1M4LA 5D29A 2JEWA 3B3CA 4OC0A 4FBEA 1XFOA 4FAIA 3CPXA 5K8NA 3PB8X 3PBEA 4F9VA 2ZEHA 4JYWA 1VIXA 4W9YA 3NFZA 2PJ3A 2V8GA 3VATA 2GLJA 3FEDA 3H8GA 5LYIA 3LMSA 4K3NA 5JM6A 5HXDA 3DLJA 3TX8A 4ONWA 3KR5A 1ELLP 3HLPA 5ELYA 2PIYA 1YW6A 1QMUA 1UWYA 1TXRA 1HDQA 2PJ1A 3B35A 5LRGA 2IJZA 1F57A 4OC1A 3KHXA 3CPAA 2RB7A 3KQZA 5LRKA 5F09A 4R76A 2J9AA 4RUHA 4NJRA 3SJFA 4O23A 2BO9A 4TWEA 4JZ0A 2PJ5A 1ARLA 1CP7A 1YSJA 1TKFA 3JRUA 5JH9A 4OMEA 4P44A 4OKOA 4NGPA 4P4JA 4UEEA 3IIBA 4MRIA 2BCOA 1ZLIA 4MXUA 3NH4A 4MCQA 4MCSA 5D8NA 3NH8A 2PJ0A 4IAVA 4P4BA 2ZEGA 3T8WA 1LAMA 1FT7A 2NSMA 2Q51A 2CTCA 3MN8A 2EK8A 1Y0RA 1LCPA 2XEIA 2ZEFA 1HEEA 3FX6A 3FECA 4YU9A 3FVLA 5LYLA 3MRUA 3D66A 3PFOA 3SI1A 1QQ9A 4IK2A 4OIWA 3NA6A 2QVPA 1ZG9A 3SI0A 2PVVA 1RTQA 4FWUA 5IB9A 4YWYA 5HVHA 4MMOA 3IJ3A 3B3TA 3IC1A 1ZLHA 2AFOA 2PCUA 3KI9A 3D7HA 3B7IA 2AFSA 2CTBA 3KGQA 2PJCA 1TF8A 3B2YA 4EMEA 4NGNA 4A39A 3D7GA 1Y0YA 3PB4X 1Q7LA 2O4HA 4MHZA 2IMOA 3K9TA 4Z65A 3S9LA 4NGMA 4ZX8A 4P10A 1CX8A 3H8FA 3V7ZA 5I4MA 1R3NA 3IO1A 1PCAA 4BD9A 1BAVA 3L2NA 1Z2LA 2PJ9A 2C6PA 4A38A 2PE3A 3H8EA 1CPSA 3PB7X 4OIDA 1LAPA 2F7VA 2PJ6A 4H2KA 4KSIA 2C6GA 1TKHA 3PFEA 4P4EA 4DUKA 4P45A 1AYEA 4UIAA 4OP4A 4F9UA 2ZEPA 3RAMA 3D7DA 4UIBA 3CDXA 4X8IA 1CG2A 3KHZA 4MHPA 1BLLE 1YLOA 3D67A 3IWWA 4R6TA 1AMPA 1BPMA 4P4DA 6CPAA 2WZNA 4NGQA 2HB6A 1DTDA 3BI1A 3GB0A 4MCRA 4EWTA 2XEGA 5LRJA 1YW4A 1TKJA 1LANA 3ISZA 3RBUA 4GM5A 2PVWA 3HUVA 3BHXA 5K8MA 2EWBA 2QJ8A 2V8VA 2AFWA 3VARA 4P4IA 3SI2A 4B6ZA 5JGFA 3PEIA 4A94A 5THWA 2JBKA 1CBXA 3D68A 3KZWA 2Q43A 2ZEMA 4DJLA 2G9DA 3WT4A 2OR4A 3S9MA 2RFHA 3CT9A 2JBJA 3SJXA 3V38A 4ZX9A 4ZY2A 3QNVA 1TF9A 3S9NA 1XRYA 3I1UA 4MHNA 2ZENA 1VHOA 3GLJA 4ZI6A 5K8PA 1DE4C 3B3WA 1Y7EA 1YMEA 3PRTA 2ZEEA 2PJAA 3K2KA 5CBMA 1EE3P 1FNOA 2PJ8A 5DS0A 3DGVA 4OC2A 4X3RA 2NYQA 4P6YA 4R8FA 1F2OA 3KR4A 3BXMA 3FF3A 2OOTA 4OC4A 2PIZA 3D7FA 4CPAA 3IEHA 4MCPA 3SJGA 4X2TA 8CPAA 1KWMA 2V8DA 4R7MA 2ZEDA 1LOKA 3WABA 2DEAA 3TC8A 2PJ2A 2ANPA 2PJ4A 4F8ZA 2ABZA 4ZY0A 4OC5A 4PQAA 2EK9A 4G1PA 5LYDA 7CPAA 2C6CA 3KQXA 5HVGA 2PJ7A 1XBUA 4PXCA 2O53A 3PBBA 2AFUA 4PXBA 4EFDA 1BPNA 2PRQA 3IFEA 4LQGA 1R43A 3RZAA 3WC5A 3WC6A 4MHYA
chains in the Genus database with same CATH superfamily
2P0WA 2C1CA 5GCNA 2AFZA 3B3VA 5K8OA 1A2ZA 4PPZA 3CXQA 2VL1A 4A32A 2XEJA 5F46A 3V8IA 4F6AA 1JQGA 4U9ZA 3NE8A 3VWEA 4KOUA 3BI0A 4NGSA 1M44A 1ZG8A 4FD4A 2CIJA 3RO0A 1M1DA 4CGOA 3FJUA 3ZZIA 2X7BA 3FMCA 3GY9A 1YQEA 4FUUA 5I0CA 4QBJA 4UF4A 4NGRA 4AG9A 1KUVA 2Q04A 2BSWA 3FEEA 3WC7A 1KUXA 1YGHA 4CYNA 2AFXA 4NGTA 4WWVA 3R96A 3B8GA 1IY7A 2IQ6A 3LWUA 2IL4A 4NFRA 3NH5A 3BJ7A 1X12A 4L89A 5IB0A 1PYTB 4LUAA 4IHMA 2ARHA 2V8HA 3VH9A 5FVJA 4F0YA 2PR1A 1CP6A 5CNPA 4UWIA 2NMTA 2ODFA 2POKA 2ZOGA 3QAHA 2DPSA 1ZO0A 5DWMA 1VHEA 1JWQA 3NE7A 4UEZA 1I1DA 2DPTA 4I49A 4A2ZA 2G3AA 5A27A 1VGYA 3EFAA 3P2FA 4A37A 1XE4A 1XEBA 2FT0A 1S7LA 2V77A 2WYRA 2XEFA 2EUIA 3D4UA 4R3LA 5EC4A 3TOBA 2BOAA 1YR0A 3UY5A 4PXEA 1ELMP 2ZELA 3N5FA 3VWDA 4C68A 1ZG7A 2AFMA 4KLVA 2GLFA 2HQYA 2G3TA 5A28A 3H5ZA 2F8HA 4AVAA 4MY0A 1IICA 2R8VA 4WJBA 2HC9A 4ZBGA 3PB9X 4ZY1A 4XPLA 3KL9A 5F48A 1F2PA 1Z5RA 1ARMA 4UEFA 1N71A 1VKCA 5CPAA 1OBRA 4OAEA 4XNHC 4RI1A 3B3SA 3IGRA 3KASA 1YX0A 5G1ZA 5C88A 4MHDA 4C7IA 4NJQA 1BO4A 2ZOFA 2Q4ZA 2GU2A 1QSTA 2C27A 1XMBA 1Z8LA 4M3SA 3R9GA 1Q2CA 1H8LA 2CF4A 4AXVA 3T90A 1HDUA 2P6FA 3G8WA 4PXDA 3LACA 4OC3A 3TCVA 1LFWA 4ZYQA 2FVGA 3CZXA 4B11A 4YGOA 4C2XA 4TNUA 1IGBA 2PC1A 2PJBA 3D2MA 2GREA 1CPXA 3ISXA 3PB6X 4JXRA 1XJOA 5HVFA 3SJEA 4UCMA 3CXSA 4KVME 1WK4A 5G20A 1P4NA 1J4JA 4H6ZA 3PP9A 2QYVA 2H5MA 3FH4A 1I21A 4AG7A 2I3CA 1PU9A 4X5KA 2CNSA 3GUXA 4A33A 5LYFA 1NSAA 4P4FA 5J1QA 4Q7AA 4B14A 1GYTA 1MJ9A 1M4LA 2PDOA 2ZEOA 3PZJA 5D29A 1IYKA 1K4JA 1Z8WA 2JEWA 4B10A 4E8OA 3K9UA 4B5OA 3B3CA 4OC0A 4FBEA 2ZW7A 3SHPA 1B87A 3I9SA 3LD2A 4L8AA 1XFOA 2B5GA 2DXQA 2EVNA 3CPXA 3R1KA 4UA3A 4FAIA 5K8NA 3PB8X 3PBEA 1M4DA 4U5YA 4MJ8A 4F9VA 2ZEHA 3W6SA 3TFYA 1NMTA 4JYWA 1S3ZA 4H6UA 1VIXA 4W9YA 3NFZA 3FYNA 2PJ3A 4XNHB 3SXNA 2JDCA 2V8GA 3VATA 2GLJA 3FEDA 3H8GA 2B58A 5LYIA 3BLNA 4M6IA 2Z11A 3LMSA 4K3NA 5JM6A 2GANA 5HXDA 3DLJA 4NEXA 4RN7A 3TX8A 4ONWA 4DYOA 3KR5A 4BINA 1ELLP 3HLPA 5ELYA 2PIYA 2ZW6A 2YNDA 2VZYA 2B3UA 2JEVA 1YW6A 1QMUA 1UWYA 1TXRA 4Q36A 4F0XA 4FD6A 4CS0B 1HDQA 1V0CA 2K5TA 2PJ1A 2VEZA 2ZW4A 3DR6A 2Q4YA 3B35A 4KUAA 1I12A 5LRGA 3EY5A 4B6ZA 2IJZA 1Z8TA 4JXQA 4R9MA 4B5PA 1F57A 2GIVA 4OC1A 3KHXA 4A30A 2B4BA 3CPAA 2RB7A 3KQZA 4BMHA 1UFHA 5LRKA 2Z3NA 5F09A 4R76A 2J9AA 4RUHA 3MGDA 2Q4VA 4NJRA 3TO9A 3SJFA 1KZFA 4KSAA 4O23A 2BO9A 3H4QA 4TWEA 1RXTA 4JZ0A 2PJ5A 1ARLA 4ONUA 1CP7A 2F5IA 1L0CA 3OWCA 3E0KA 3F8KA 4CGMA 1YSJA 1TKFA 2OH1A 4R57A 3JRUA 5JH9A 2BUEA 1Q2YA 1Y7RA 4OMEA 2HV2A 1XMTA 2WUUA 4CGPA 3BJ8A 3T9YA 1M4GA 4P44A 4CRZB 4OKOA 2PQ8A 4NGPA 2G0BA 2R7HA 3D3SA 1RO5A 4IF5A 4P4JA 4UCPA 2YGWA 4KUBA 4UEEA 5KTDA 3TT2A 4ORFA 2FSRA 3PGPA 3IIBA 2BCOA 4MRIA 1ZLIA 4MXUA 2Z3PA 3FXTA 3NH4A 4MCSA 4MCQA 2FIWA 1MJBA 3R9EA 1YREA 5D8NA 5J8CA 4UFXA 3NH8A 4CGNA 4A31A 2RC4A 2BL1A 3FIXA 4KOXA 2PJ0A 4IAVA 4P4BA 2EBJA 2ZW5A 3EC4A 2ZEGA 3F0AA 3W6XA 3T8WA 2FIAA 4KZTA 1LAMA 3JVNA 2ATRA 2Z0ZA 4MY3A 4CAVA 1FT7A 2NSMA 4E0AA 2Q51A 2JLMA 2CTCA 5AG4A 3MN8A 4JJXA 2I79A 2EK8A 1Y0RA 1LCPA 2XEIA 1S7FA 2P6EA 2ZEFA 4MFLA 5G21A 1HEEA 1IOIA 4CYQA 4DNCA 4JD6A 3FX6A 3FECA 4YU9A 2YNCA 4NSQA 5EMIA 2PRBA 3FVLA 5F47A 5LYLA 4U9YA 3G3SA 1IIDA 4Q38A 3MRUA 3D66A 3FBUA 3PFOA 4CGLA 3FB3A 3SI1A 1QQ9A 2FE7A 3DR8A 3GKRA 4C2ZA 4IK2A 2WPWA 2O28A 3EO4A 4OIWA 3NA6A 1QSRA 2QVPA 1ZG9A 2VXKA 1Y9WA 3SI0A 2PVVA 1RTQA 4FWUA 5IB9A 3IU1A 5G22A 4CAFA 1Z9UA 2OZGA 4YWYA 5HVHA 5BWAB 3SXOA 5KTAA 4AVCA 4MMOA 3IJ3A 1X10A 3B3TA 3IC1A 1CM0A 1ZLHA 2AFOA 2PCUA 3KI9A 5AGEA 3D7HA 3B7IA 4B12A 1S7KA 4KOWA 5AG6A 1Y9KA 2Q44A 2AFSA 2ZXVA 4CAXA 2CTBA 1Z4EA 1KUYA 2WPXA 3KGQA 2PJCA 4HKFA 4KS9A 1YVKA 1TF8A 2QIRA 3B2YA 3A9LA 4EMEA 4NGNA 2DF5A 1S5KA 1MK4A 4A39A 1QSOA 1MJAA 3D7GA 1Y0YA 3PB4X 3IWEA 1Q7LA 2O4HA 4MHZA 2IMOA 1NE9A 3K9TA 4PSXA 4Z65A 3S9LA 3GIUA 4HNYB 4NGMA 4ZX8A 5EBVA 4P10A 5H84A 2VI7A 2BEIA 1CX8A 2REEA 2PSWA 3H8FA 3QB8A 4FD7A 2QMLA 3V7ZA 4PK2A 1R3NA 5I4MA 3IO1A 1SQHA 2FL4A 1PCAA 3FNCA 5AG5A 4BD9A 1BAVA 1GHEA 2GFQA 3L2NA 4QUSA 1Z2LA 2PJ9A 2C6PA 4A38A 2PE3A 4MFKA 3H8EA 1CPSA 3PB7X 4OIDA 3S6FA 1LAPA 4KVXA 2F7VA 2PJ6A 4H2KA 5J8FA 1IYLA 1VHSA 4KSIA 2C6GA 5KTCA 1TKHA 3PFEA 5JGFA 3LODA 4P4EA 4DUKA 4P45A 1Q2DA 2R98A 2Z3MA 4J3GA 1AYEA 4UIAA 2Y0MA 2J8MA 3EXNA 4OP4A 1AUGA 2ZEPA 3RAMA 4F9UA 3D7DA 2ZPAA 4UIBA 3C26A 3CDXA 4II9A 4X8IA 1CG2A 2CY2A 4QVTA 4CAWA 3KHZA 2VBQA 1BLLE 1YLOA 3D67A 3IWWA 4MHPA 4R6TA 4KOVA 4YRHA 4UFWA 4C7HA 4K30A 4CYPA 1AMPA 1BPMA 4P4DA 6CPAA 2A4NA 2WZNA 1FY7A 3S6GA 5HH1A 4NGQA 4FD5A 3TE4A 3DNSA 3CXPA 1CJWA 1DTDA 2HB6A 4HNWB 2B4DB 3BI1A 3GB0A 4MCRA 5DWNA 4EWTA 2Z3KA 1PUAA 4GS4A 2XEGA 5LRJA 1YW4A 1TKJA 1WWZA 2AE6A 3RYOA 1LANA 3ISZA 3RBUA 2FCKA 4OADA 4H89A 4LQ6A 4GM5A 3R95A 2PVWA 3HUVA 1YVOA 3BHXA 5K8MA 2EWBA 2I00A 2QJ8A 2V8VA 3TO7A 2AFWA 3VARA 4P4IA 3D2PA 1XOVA 3SI2A 3F5BA 3TTHA 3PEIA 5AG7A 4Y49C 4A94A 2FXFA 2JBKA 3GYAA 1CBXA 5THWA 3D68A 3KZWA 4RS2A 2Z3LA 2P6GA 2Q43A 4XPDC 3TOAA 3W91A 4HNXB 2ZEMA 1YLEA 4QB9A 4ZGYB 4DJLA 2G9DA 3WT4A 3N7ZA 3TO6A 2OR4A 3S9MA 4JLYA 2HUZA 1NSLA 2RFHA 4PK3A 3CT9A 2JBJA 2OZHA 4LX9A 4KORA 2EO8A 3SJXA 4BBHA 2R1IA 2Q7SA 2PR8A 2D4PA 4OLLA 3V38A 4AVBA 4KLWA 3KKWA 4ZX9A 4ZY2A 2CNMA 2GE3A 3QNVA 1TF9A 2OB0A 3S9NA 4UCNA 1XRYA 3I1UA 4MHNA 1TIQA 2ZENA 1VHOA 2REFA 1M4IA 3GLJA 4KOYA 3WR7A 4ZI6A 1DE4C 5K8PA 3B3WA 1OZPA 1Y7EA 1YMEA 3FRMA 2B5GB 2Q0YA 3PRTA 4B13A 2ZEEA 4YFJA 2PJAA 3K2KA 5CBMA 1R57A 2Q7BA 1QSNA 4NXYA 1EE3P 2Z10A 4NF1A 1FNOA 2PJ8A 4C2YA 4MFJA 1QSMA 3IU2A 5DS0A 3DGVA 4OC2A 3S6KA 4KOSA 4X3RA 2VQYA 2B4DA 5IV0A 2NYQA 3I3GA 2KCWA 1Z8XA 4M6GA 4P6YA 4R8FA 3DDDA 1F2OA 3KR4A 3BXMA 3D8PA 3FF3A 1IOFA 4AB7A 4CRYB 2OU2A 1S60A 2QECA 2OOTA 3R9FA 2CNTA 5HMNA 4OC4A 2J8RA 2PIZA 1ON0A 1XIXA 3JTKA 4R87A 2Z3OA 3D7FA 4CPAA 5C82A 3IEHA 1LRZA 4MCPA 4R3KA 1Z4RA 4MFZA 3SJGA 5ISVA 4X2TA 4KSFA 1KWMA 8CPAA 2V8DA 4MI4A 3IWGA 4Y49B 4R7MA 4IUSA 2ZEDA 5IX3A 2YNCC 4XPDB 1LOKA 4UFVA 1YK3A 3WABA 4B5PB 2DEAA 4PSWA 2OZUA 3TC8A 2PJ2A 2ANPA 2PJ4A 4KOTA 4F8ZA 2ABZA 3DSBA 3JUWA 4OC5A 2D4OA 2YNEA 4ZY0A 4JWPA 4MFQA 1U6MA 1IU8A 4M85A 4PQAA 2FS5A 3RNZA 4CYOA 2EK9A 5F49A 4G1PA 5LYDA 7CPAA 1S7NA 2WSAA 2C6CA 3QAYA 4KVOE 2B3VA 3KQXA 5HVGA 5E96A 1B6BA 1XF8A 4XPKA 1BOBA 2PJ7A 4GXHA 4UBRA 4CAEA 4M6HA 4UWJA 2CXAA 1XBUA 2JDDA 2VZZA 4PXCA 2O53A 4EVYA 3PBBA 2AFUA 5JQ4A 4PXBA 3S6HA 1P0HA 4MFPA 2J8NA 4PV6A 4QC6A 2AJ6A 4MBUA 4EFDA 5JPHA 3ZJ0A 1IB1E 1BPNA 3P2HA 2PRQA 3IFEA 4E2AA 4HPSA 4A95A 4LQGA 1R43A 3RZAA 4NCZA 3WC5A 5H86A 3WC6A 4MHYA
chains in the Genus database with same CATH topology
2C1CA 2AFZA 3B3VA 5K8OA 4PPZA 2VL1A 2XEJA 1JQGA 3BI0A 4NGSA 1ZG8A 2CIJA 3FJUA 3FMCA 4FUUA 4UF4A 4NGRA 3FEEA 3WC7A 2AFXA 4NGTA 4WWVA 1IY7A 2IQ6A 3LWUA 4NFRA 3NH5A 1PYTB 4IHMA 3VH9A 2V8HA 1CP6A 2POKA 2ZOGA 1VHEA 4UEZA 1VGYA 4A37A 4DYOA 2WYRA 2V77A 2XEFA 3D4UA 2BOAA 4PXEA 1ELMP 2ZELA 3N5FA 1ZG7A 2AFMA 2GLFA 2F8HA 4WJBA 2HC9A 3PB9X 4ZY1A 3KL9A 1F2PA 1Z5RA 1ARMA 4UEFA 5CPAA 1OBRA 3B3SA 3KASA 4NJQA 2ZOFA 2Q4ZA 2GU2A 1XMBA 1Z8LA 1H8LA 2CF4A 4AXVA 1HDUA 4PXDA 4OC3A 1LFWA 4ZYQA 2FVGA 4TNUA 1IGBA 2PJBA 2GREA 1CPXA 3ISXA 3PB6X 5HVFA 1XJOA 3SJEA 2QYVA 3FH4A 2I3CA 3GUXA 5LYFA 1NSAA 4P4FA 5J1QA 4Q7AA 1GYTA 2ZEOA 1M4LA 5D29A 2JEWA 3B3CA 4OC0A 4FBEA 1XFOA 4FAIA 3CPXA 5K8NA 3PB8X 3PBEA 4F9VA 2ZEHA 4JYWA 1VIXA 4W9YA 3NFZA 2PJ3A 2V8GA 3VATA 2GLJA 3FEDA 3H8GA 5LYIA 3LMSA 4K3NA 5JM6A 5HXDA 3DLJA 3TX8A 4ONWA 3KR5A 1ELLP 3HLPA 5ELYA 2PIYA 1YW6A 1QMUA 1UWYA 1TXRA 1HDQA 2PJ1A 3B35A 5LRGA 2IJZA 1F57A 4OC1A 3KHXA 3CPAA 2RB7A 3KQZA 5LRKA 5F09A 4R76A 2J9AA 4RUHA 4NJRA 3SJFA 4O23A 2BO9A 4TWEA 4JZ0A 2PJ5A 1ARLA 1CP7A 1YSJA 1TKFA 3JRUA 5JH9A 4OMEA 4P44A 4OKOA 4NGPA 4P4JA 4UEEA 3IIBA 4MRIA 2BCOA 1ZLIA 4MXUA 3NH4A 4MCQA 4MCSA 5D8NA 3NH8A 2PJ0A 4IAVA 4P4BA 2ZEGA 3T8WA 1LAMA 1FT7A 2NSMA 2Q51A 2CTCA 3MN8A 2EK8A 1Y0RA 1LCPA 2XEIA 2ZEFA 1HEEA 3FX6A 3FECA 4YU9A 3FVLA 5LYLA 3MRUA 3D66A 3PFOA 3SI1A 1QQ9A 4IK2A 4OIWA 3NA6A 2QVPA 1ZG9A 3SI0A 2PVVA 1RTQA 4FWUA 5IB9A 4YWYA 5HVHA 4MMOA 3IJ3A 3B3TA 3IC1A 1ZLHA 2AFOA 2PCUA 3KI9A 3D7HA 3B7IA 2AFSA 2CTBA 3KGQA 2PJCA 1TF8A 3B2YA 4EMEA 4NGNA 4A39A 3D7GA 1Y0YA 3PB4X 1Q7LA 2O4HA 4MHZA 2IMOA 3K9TA 4Z65A 3S9LA 4NGMA 4ZX8A 4P10A 1CX8A 3H8FA 3V7ZA 5I4MA 1R3NA 3IO1A 1PCAA 4BD9A 1BAVA 3L2NA 1Z2LA 2PJ9A 2C6PA 4A38A 2PE3A 3H8EA 1CPSA 3PB7X 4OIDA 1LAPA 2F7VA 2PJ6A 4H2KA 4KSIA 2C6GA 1TKHA 3PFEA 4P4EA 4DUKA 4P45A 1AYEA 4UIAA 4OP4A 4F9UA 2ZEPA 3RAMA 3D7DA 4UIBA 3CDXA 4X8IA 1CG2A 3KHZA 4MHPA 1BLLE 1YLOA 3D67A 3IWWA 4R6TA 1AMPA 1BPMA 4P4DA 6CPAA 2WZNA 4NGQA 2HB6A 1DTDA 3BI1A 3GB0A 4MCRA 4EWTA 2XEGA 5LRJA 1YW4A 1TKJA 1LANA 3ISZA 3RBUA 4GM5A 2PVWA 3HUVA 3BHXA 5K8MA 2EWBA 2QJ8A 2V8VA 2AFWA 3VARA 4P4IA 3SI2A 4B6ZA 5JGFA 3PEIA 4A94A 5THWA 2JBKA 1CBXA 3D68A 3KZWA 2Q43A 2ZEMA 4DJLA 2G9DA 3WT4A 2OR4A 3S9MA 2RFHA 3CT9A 2JBJA 3SJXA 3V38A 4ZX9A 4ZY2A 3QNVA 1TF9A 3S9NA 1XRYA 3I1UA 4MHNA 2ZENA 1VHOA 3GLJA 4ZI6A 5K8PA 1DE4C 3B3WA 1Y7EA 1YMEA 3PRTA 2ZEEA 2PJAA 3K2KA 5CBMA 1EE3P 1FNOA 2PJ8A 5DS0A 3DGVA 4OC2A 4X3RA 2NYQA 4P6YA 4R8FA 1F2OA 3KR4A 3BXMA 3FF3A 2OOTA 4OC4A 2PIZA 3D7FA 4CPAA 3IEHA 4MCPA 3SJGA 4X2TA 8CPAA 1KWMA 2V8DA 4R7MA 2ZEDA 1LOKA 3WABA 2DEAA 3TC8A 2PJ2A 2ANPA 2PJ4A 4F8ZA 2ABZA 4ZY0A 4OC5A 4PQAA 2EK9A 4G1PA 5LYDA 7CPAA 2C6CA 3KQXA 5HVGA 2PJ7A 1XBUA 4PXCA 2O53A 3PBBA 2AFUA 4PXBA 4EFDA 1BPNA 2PRQA 3IFEA 4LQGA 1R43A 3RZAA 3WC5A 3WC6A 4MHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1C A;  2AFZ A;  3B3V A;  5K8O A;  4PPZ A;  2VL1 A;  2XEJ A;  1JQG A;  3BI0 A;  4NGS A;  1ZG8 A;  2CIJ A;  3FJU A;  3FMC A;  4FUU A;  4UF4 A;  4NGR A;  3FEE A;  3WC7 A;  2AFX A;  4NGT A;  4WWV A;  1IY7 A;  2IQ6 A;  3LWU A;  4NFR A;  3NH5 A;  1PYT B;  4IHM A;  3VH9 A;  2V8H A;  1CP6 A;  2POK A;  2ZOG A;  1VHE A;  4UEZ A;  1VGY A;  4A37 A;  4DYO A;  2WYR A;  2V77 A;  2XEF A;  3D4U A;  2BOA A;  4PXE A;  1ELM P;  2ZEL A;  3N5F A;  1ZG7 A;  2AFM A;  2GLF A;  2F8H A;  4WJB A;  2HC9 A;  3PB9 X;  4ZY1 A;  3KL9 A;  1F2P A;  1Z5R A;  1ARM A;  4UEF A;  5CPA A;  1OBR A;  3B3S A;  3KAS A;  4NJQ A;  2ZOF A;  2Q4Z A;  2GU2 A;  1XMB A;  1Z8L A;  1H8L A;  2CF4 A;  4AXV A;  1HDU A;  4PXD A;  4OC3 A;  1LFW A;  4ZYQ A;  2FVG A;  4TNU A;  1IGB A;  2PJB A;  2GRE A;  1CPX A;  3ISX A;  3PB6 X;  5HVF A;  1XJO A;  3SJE A;  2QYV A;  3FH4 A;  2I3C A;  3GUX A;  5LYF A;  1NSA A;  4P4F A;  5J1Q A;  4Q7A A;  1GYT A;  2ZEO A;  1M4L A;  5D29 A;  2JEW A;  3B3C A;  4OC0 A;  4FBE A;  1XFO A;  4FAI A;  3CPX A;  5K8N A;  3PB8 X;  3PBE A;  4F9V A;  2ZEH A;  4JYW A;  1VIX A;  4W9Y A;  3NFZ A;  2PJ3 A;  2V8G A;  3VAT A;  2GLJ A;  3FED A;  3H8G A;  5LYI A;  3LMS A;  4K3N A;  5JM6 A;  5HXD A;  3DLJ A;  3TX8 A;  4ONW A;  3KR5 A;  1ELL P;  3HLP A;  5ELY A;  2PIY A;  1YW6 A;  1QMU A;  1UWY A;  1TXR A;  1HDQ A;  2PJ1 A;  3B35 A;  5LRG A;  2IJZ A;  1F57 A;  4OC1 A;  3KHX A;  3CPA A;  2RB7 A;  3KQZ A;  5LRK A;  5F09 A;  4R76 A;  2J9A A;  4RUH A;  4NJR A;  3SJF A;  4O23 A;  2BO9 A;  4TWE A;  4JZ0 A;  2PJ5 A;  1ARL A;  1CP7 A;  1YSJ A;  1TKF A;  3JRU A;  5JH9 A;  4OME A;  4P44 A;  4OKO A;  4NGP A;  4P4J A;  4UEE A;  3IIB A;  4MRI A;  2BCO A;  1ZLI A;  4MXU A;  3NH4 A;  4MCQ A;  4MCS A;  5D8N A;  3NH8 A;  2PJ0 A;  4IAV A;  4P4B A;  2ZEG A;  3T8W A;  1LAM A;  1FT7 A;  2NSM A;  2Q51 A;  2CTC A;  3MN8 A;  2EK8 A;  1Y0R A;  1LCP A;  2XEI A;  2ZEF A;  1HEE A;  3FX6 A;  3FEC A;  4YU9 A;  3FVL A;  5LYL A;  3MRU A;  3D66 A;  3PFO A;  3SI1 A;  1QQ9 A;  4IK2 A;  4OIW A;  3NA6 A;  2QVP A;  1ZG9 A;  3SI0 A;  2PVV A;  1RTQ A;  4FWU A;  5IB9 A;  4YWY A;  5HVH A;  4MMO A;  3IJ3 A;  3B3T A;  3IC1 A;  1ZLH A;  2AFO A;  2PCU A;  3KI9 A;  3D7H A;  3B7I A;  2AFS A;  2CTB A;  3KGQ A;  2PJC A;  1TF8 A;  3B2Y A;  4EME A;  4NGN A;  4A39 A;  3D7G A;  1Y0Y A;  3PB4 X;  1Q7L A;  2O4H A;  4MHZ A;  2IMO A;  3K9T A;  4Z65 A;  3S9L A;  4NGM A;  4ZX8 A;  4P10 A;  1CX8 A;  3H8F A;  3V7Z A;  5I4M A;  1R3N A;  3IO1 A;  1PCA A;  4BD9 A;  1BAV A;  3L2N A;  1Z2L A;  2PJ9 A;  2C6P A;  4A38 A;  2PE3 A;  3H8E A;  1CPS A;  3PB7 X;  4OID A;  1LAP A;  2F7V A;  2PJ6 A;  4H2K A;  4KSI A;  2C6G A;  1TKH A;  3PFE A;  4P4E A;  4DUK A;  4P45 A;  1AYE A;  4UIA A;  4OP4 A;  4F9U A;  2ZEP A;  3RAM A;  3D7D A;  4UIB A;  3CDX A;  4X8I A;  1CG2 A;  3KHZ A;  4MHP A;  1BLL E;  1YLO A;  3D67 A;  3IWW A;  4R6T A;  1AMP A;  1BPM A;  4P4D A;  6CPA A;  2WZN A;  4NGQ A;  2HB6 A;  1DTD A;  3BI1 A;  3GB0 A;  4MCR A;  4EWT A;  2XEG A;  5LRJ A;  1YW4 A;  1TKJ A;  1LAN A;  3ISZ A;  3RBU A;  4GM5 A;  2PVW A;  3HUV A;  3BHX A;  5K8M A;  2EWB A;  2QJ8 A;  2V8V A;  2AFW A;  3VAR A;  4P4I A;  3SI2 A;  4B6Z A;  5JGF A;  3PEI A;  4A94 A;  5THW A;  2JBK A;  1CBX A;  3D68 A;  3KZW A;  2Q43 A;  2ZEM A;  4DJL A;  2G9D A;  3WT4 A;  2OR4 A;  3S9M A;  2RFH A;  3CT9 A;  2JBJ A;  3SJX A;  3V38 A;  4ZX9 A;  4ZY2 A;  3QNV A;  1TF9 A;  3S9N A;  1XRY A;  3I1U A;  4MHN A;  2ZEN A;  1VHO A;  3GLJ A;  4ZI6 A;  5K8P A;  1DE4 C;  3B3W A;  1Y7E A;  1YME A;  3PRT A;  2ZEE A;  2PJA A;  3K2K A;  5CBM A;  1EE3 P;  1FNO A;  2PJ8 A;  5DS0 A;  3DGV A;  4OC2 A;  4X3R A;  2NYQ A;  4P6Y A;  4R8F A;  1F2O A;  3KR4 A;  3BXM A;  3FF3 A;  2OOT A;  4OC4 A;  2PIZ A;  3D7F A;  4CPA A;  3IEH A;  4MCP A;  3SJG A;  4X2T A;  8CPA A;  1KWM A;  2V8D A;  4R7M A;  2ZED A;  1LOK A;  3WAB A;  2DEA A;  3TC8 A;  2PJ2 A;  2ANP A;  2PJ4 A;  4F8Z A;  2ABZ A;  4ZY0 A;  4OC5 A;  4PQA A;  2EK9 A;  4G1P A;  5LYD A;  7CPA A;  2C6C A;  3KQX A;  5HVG A;  2PJ7 A;  1XBU A;  4PXC A;  2O53 A;  3PBB A;  2AFU A;  4PXB A;  4EFD A;  1BPN A;  2PRQ A;  3IFE A;  4LQG A;  1R43 A;  3RZA A;  3WC5 A;  3WC6 A;  4MHY A; 
#chains in the Genus database with same CATH topology
 2P0W A;  2C1C A;  5GCN A;  2AFZ A;  3B3V A;  5K8O A;  1A2Z A;  4PPZ A;  3CXQ A;  2VL1 A;  4A32 A;  2XEJ A;  5F46 A;  3V8I A;  4F6A A;  1JQG A;  4U9Z A;  3NE8 A;  3VWE A;  4KOU A;  3BI0 A;  4NGS A;  1M44 A;  1ZG8 A;  4FD4 A;  2CIJ A;  3RO0 A;  1M1D A;  4CGO A;  3FJU A;  3ZZI A;  2X7B A;  3FMC A;  3GY9 A;  1YQE A;  4FUU A;  5I0C A;  4QBJ A;  4UF4 A;  4NGR A;  4AG9 A;  1KUV A;  2Q04 A;  2BSW A;  3FEE A;  3WC7 A;  1KUX A;  1YGH A;  4CYN A;  2AFX A;  4NGT A;  4WWV A;  3R96 A;  3B8G A;  1IY7 A;  2IQ6 A;  3LWU A;  2IL4 A;  4NFR A;  3NH5 A;  3BJ7 A;  1X12 A;  4L89 A;  5IB0 A;  1PYT B;  4LUA A;  4IHM A;  2ARH A;  2V8H A;  3VH9 A;  5FVJ A;  4F0Y A;  2PR1 A;  1CP6 A;  5CNP A;  4UWI A;  2NMT A;  2ODF A;  2POK A;  2ZOG A;  3QAH A;  2DPS A;  1ZO0 A;  5DWM A;  1VHE A;  1JWQ A;  3NE7 A;  4UEZ A;  1I1D A;  2DPT A;  4I49 A;  4A2Z A;  2G3A A;  5A27 A;  1VGY A;  3EFA A;  3P2F A;  4A37 A;  1XE4 A;  1XEB A;  2FT0 A;  1S7L A;  2V77 A;  2WYR A;  2XEF A;  2EUI A;  3D4U A;  4R3L A;  5EC4 A;  3TOB A;  2BOA A;  1YR0 A;  3UY5 A;  4PXE A;  1ELM P;  2ZEL A;  3N5F A;  3VWD A;  4C68 A;  1ZG7 A;  2AFM A;  4KLV A;  2GLF A;  2HQY A;  2G3T A;  5A28 A;  3H5Z A;  2F8H A;  4AVA A;  4MY0 A;  1IIC A;  2R8V A;  4WJB A;  2HC9 A;  4ZBG A;  3PB9 X;  4ZY1 A;  4XPL A;  3KL9 A;  5F48 A;  1F2P A;  1Z5R A;  1ARM A;  4UEF A;  1N71 A;  1VKC A;  5CPA A;  1OBR A;  4OAE A;  4XNH C;  4RI1 A;  3B3S A;  3IGR A;  3KAS A;  1YX0 A;  5G1Z A;  5C88 A;  4MHD A;  4C7I A;  4NJQ A;  1BO4 A;  2ZOF A;  2Q4Z A;  2GU2 A;  1QST A;  2C27 A;  1XMB A;  1Z8L A;  4M3S A;  3R9G A;  1Q2C A;  1H8L A;  2CF4 A;  4AXV A;  3T90 A;  1HDU A;  2P6F A;  3G8W A;  4PXD A;  3LAC A;  4OC3 A;  3TCV A;  1LFW A;  4ZYQ A;  2FVG A;  3CZX A;  4B11 A;  4YGO A;  4C2X A;  4TNU A;  1IGB A;  2PC1 A;  2PJB A;  3D2M A;  2GRE A;  1CPX A;  3ISX A;  3PB6 X;  4JXR A;  1XJO A;  5HVF A;  3SJE A;  4UCM A;  3CXS A;  4KVM E;  1WK4 A;  5G20 A;  1P4N A;  1J4J A;  4H6Z A;  3PP9 A;  2QYV A;  2H5M A;  3FH4 A;  1I21 A;  4AG7 A;  2I3C A;  1PU9 A;  4X5K A;  2CNS A;  3GUX A;  4A33 A;  5LYF A;  1NSA A;  4P4F A;  5J1Q A;  4Q7A A;  4B14 A;  1GYT A;  1MJ9 A;  1M4L A;  2PDO A;  2ZEO A;  3PZJ A;  5D29 A;  1IYK A;  1K4J A;  1Z8W A;  2JEW A;  4B10 A;  4E8O A;  3K9U A;  4B5O A;  3B3C A;  4OC0 A;  4FBE A;  2ZW7 A;  3SHP A;  1B87 A;  3I9S A;  3LD2 A;  4L8A A;  1XFO A;  2B5G A;  2DXQ A;  2EVN A;  3CPX A;  3R1K A;  4UA3 A;  4FAI A;  5K8N A;  3PB8 X;  3PBE A;  1M4D A;  4U5Y A;  4MJ8 A;  4F9V A;  2ZEH A;  3W6S A;  3TFY A;  1NMT A;  4JYW A;  1S3Z A;  4H6U A;  1VIX A;  4W9Y A;  3NFZ A;  3FYN A;  2PJ3 A;  4XNH B;  3SXN A;  2JDC A;  2V8G A;  3VAT A;  2GLJ A;  3FED A;  3H8G A;  2B58 A;  5LYI A;  3BLN A;  4M6I A;  2Z11 A;  3LMS A;  4K3N A;  5JM6 A;  2GAN A;  5HXD A;  3DLJ A;  4NEX A;  4RN7 A;  3TX8 A;  4ONW A;  4DYO A;  3KR5 A;  4BIN A;  1ELL P;  3HLP A;  5ELY A;  2PIY A;  2ZW6 A;  2YND A;  2VZY A;  2B3U A;  2JEV A;  1YW6 A;  1QMU A;  1UWY A;  1TXR A;  4Q36 A;  4F0X A;  4FD6 A;  4CS0 B;  1HDQ A;  1V0C A;  2K5T A;  2PJ1 A;  2VEZ A;  2ZW4 A;  3DR6 A;  2Q4Y A;  3B35 A;  4KUA A;  1I12 A;  5LRG A;  3EY5 A;  4B6Z A;  2IJZ A;  1Z8T A;  4JXQ A;  4R9M A;  4B5P A;  1F57 A;  2GIV A;  4OC1 A;  3KHX A;  4A30 A;  2B4B A;  3CPA A;  2RB7 A;  3KQZ A;  4BMH A;  1UFH A;  5LRK A;  2Z3N A;  5F09 A;  4R76 A;  2J9A A;  4RUH A;  3MGD A;  2Q4V A;  4NJR A;  3TO9 A;  3SJF A;  1KZF A;  4KSA A;  4O23 A;  2BO9 A;  3H4Q A;  4TWE A;  1RXT A;  4JZ0 A;  2PJ5 A;  1ARL A;  4ONU A;  1CP7 A;  2F5I A;  1L0C A;  3OWC A;  3E0K A;  3F8K A;  4CGM A;  1YSJ A;  1TKF A;  2OH1 A;  4R57 A;  3JRU A;  5JH9 A;  2BUE A;  1Q2Y A;  1Y7R A;  4OME A;  2HV2 A;  1XMT A;  2WUU A;  4CGP A;  3BJ8 A;  3T9Y A;  1M4G A;  4P44 A;  4CRZ B;  4OKO A;  2PQ8 A;  4NGP A;  2G0B A;  2R7H A;  3D3S A;  1RO5 A;  4IF5 A;  4P4J A;  4UCP A;  2YGW A;  4KUB A;  4UEE A;  5KTD A;  3TT2 A;  4ORF A;  2FSR A;  3PGP A;  3IIB A;  2BCO A;  4MRI A;  1ZLI A;  4MXU A;  2Z3P A;  3FXT A;  3NH4 A;  4MCS A;  4MCQ A;  2FIW A;  1MJB A;  3R9E A;  1YRE A;  5D8N A;  5J8C A;  4UFX A;  3NH8 A;  4CGN A;  4A31 A;  2RC4 A;  2BL1 A;  3FIX A;  4KOX A;  2PJ0 A;  4IAV A;  4P4B A;  2EBJ A;  2ZW5 A;  3EC4 A;  2ZEG A;  3F0A A;  3W6X A;  3T8W A;  2FIA A;  4KZT A;  1LAM A;  3JVN A;  2ATR A;  2Z0Z A;  4MY3 A;  4CAV A;  1FT7 A;  2NSM A;  4E0A A;  2Q51 A;  2JLM A;  2CTC A;  5AG4 A;  3MN8 A;  4JJX A;  2I79 A;  2EK8 A;  1Y0R A;  1LCP A;  2XEI A;  1S7F A;  2P6E A;  2ZEF A;  4MFL A;  5G21 A;  1HEE A;  1IOI A;  4CYQ A;  4DNC A;  4JD6 A;  3FX6 A;  3FEC A;  4YU9 A;  2YNC A;  4NSQ A;  5EMI A;  2PRB A;  3FVL A;  5F47 A;  5LYL A;  4U9Y A;  3G3S A;  1IID A;  4Q38 A;  3MRU A;  3D66 A;  3FBU A;  3PFO A;  4CGL A;  3FB3 A;  3SI1 A;  1QQ9 A;  2FE7 A;  3DR8 A;  3GKR A;  4C2Z A;  4IK2 A;  2WPW A;  2O28 A;  3EO4 A;  4OIW A;  3NA6 A;  1QSR A;  2QVP A;  1ZG9 A;  2VXK A;  1Y9W A;  3SI0 A;  2PVV A;  1RTQ A;  4FWU A;  5IB9 A;  3IU1 A;  5G22 A;  4CAF A;  1Z9U A;  2OZG A;  4YWY A;  5HVH A;  5BWA B;  3SXO A;  5KTA A;  4AVC A;  4MMO A;  3IJ3 A;  1X10 A;  3B3T A;  3IC1 A;  1CM0 A;  1ZLH A;  2AFO A;  2PCU A;  3KI9 A;  5AGE A;  3D7H A;  3B7I A;  4B12 A;  1S7K A;  4KOW A;  5AG6 A;  1Y9K A;  2Q44 A;  2AFS A;  2ZXV A;  4CAX A;  2CTB A;  1Z4E A;  1KUY A;  2WPX A;  3KGQ A;  2PJC A;  4HKF A;  4KS9 A;  1YVK A;  1TF8 A;  2QIR A;  3B2Y A;  3A9L A;  4EME A;  4NGN A;  2DF5 A;  1S5K A;  1MK4 A;  4A39 A;  1QSO A;  1MJA A;  3D7G A;  1Y0Y A;  3PB4 X;  3IWE A;  1Q7L A;  2O4H A;  4MHZ A;  2IMO A;  1NE9 A;  3K9T A;  4PSX A;  4Z65 A;  3S9L A;  3GIU A;  4HNY B;  4NGM A;  4ZX8 A;  5EBV A;  4P10 A;  5H84 A;  2VI7 A;  2BEI A;  1CX8 A;  2REE A;  2PSW A;  3H8F A;  3QB8 A;  4FD7 A;  2QML A;  3V7Z A;  4PK2 A;  1R3N A;  5I4M A;  3IO1 A;  1SQH A;  2FL4 A;  1PCA A;  3FNC A;  5AG5 A;  4BD9 A;  1BAV A;  1GHE A;  2GFQ A;  3L2N A;  4QUS A;  1Z2L A;  2PJ9 A;  2C6P A;  4A38 A;  2PE3 A;  4MFK A;  3H8E A;  1CPS A;  3PB7 X;  4OID A;  3S6F A;  1LAP A;  4KVX A;  2F7V A;  2PJ6 A;  4H2K A;  5J8F A;  1IYL A;  1VHS A;  4KSI A;  2C6G A;  5KTC A;  1TKH A;  3PFE A;  5JGF A;  3LOD A;  4P4E A;  4DUK A;  4P45 A;  1Q2D A;  2R98 A;  2Z3M A;  4J3G A;  1AYE A;  4UIA A;  2Y0M A;  2J8M A;  3EXN A;  4OP4 A;  1AUG A;  2ZEP A;  3RAM A;  4F9U A;  3D7D A;  2ZPA A;  4UIB A;  3C26 A;  3CDX A;  4II9 A;  4X8I A;  1CG2 A;  2CY2 A;  4QVT A;  4CAW A;  3KHZ A;  2VBQ A;  1BLL E;  1YLO A;  3D67 A;  3IWW A;  4MHP A;  4R6T A;  4KOV A;  4YRH A;  4UFW A;  4C7H A;  4K30 A;  4CYP A;  1AMP A;  1BPM A;  4P4D A;  6CPA A;  2A4N A;  2WZN A;  1FY7 A;  3S6G A;  5HH1 A;  4NGQ A;  4FD5 A;  3TE4 A;  3DNS A;  3CXP A;  1CJW A;  1DTD A;  2HB6 A;  4HNW B;  2B4D B;  3BI1 A;  3GB0 A;  4MCR A;  5DWN A;  4EWT A;  2Z3K A;  1PUA A;  4GS4 A;  2XEG A;  5LRJ A;  1YW4 A;  1TKJ A;  1WWZ A;  2AE6 A;  3RYO A;  1LAN A;  3ISZ A;  3RBU A;  2FCK A;  4OAD A;  4H89 A;  4LQ6 A;  4GM5 A;  3R95 A;  2PVW A;  3HUV A;  1YVO A;  3BHX A;  5K8M A;  2EWB A;  2I00 A;  2QJ8 A;  2V8V A;  3TO7 A;  2AFW A;  3VAR A;  4P4I A;  3D2P A;  1XOV A;  3SI2 A;  3F5B A;  3TTH A;  3PEI A;  5AG7 A;  4Y49 C;  4A94 A;  2FXF A;  2JBK A;  3GYA A;  1CBX A;  5THW A;  3D68 A;  3KZW A;  4RS2 A;  2Z3L A;  2P6G A;  2Q43 A;  4XPD C;  3TOA A;  3W91 A;  4HNX B;  2ZEM A;  1YLE A;  4QB9 A;  4ZGY B;  4DJL A;  2G9D A;  3WT4 A;  3N7Z A;  3TO6 A;  2OR4 A;  3S9M A;  4JLY A;  2HUZ A;  1NSL A;  2RFH A;  4PK3 A;  3CT9 A;  2JBJ A;  2OZH A;  4LX9 A;  4KOR A;  2EO8 A;  3SJX A;  4BBH A;  2R1I A;  2Q7S A;  2PR8 A;  2D4P A;  4OLL A;  3V38 A;  4AVB A;  4KLW A;  3KKW A;  4ZX9 A;  4ZY2 A;  2CNM A;  2GE3 A;  3QNV A;  1TF9 A;  2OB0 A;  3S9N A;  4UCN A;  1XRY A;  3I1U A;  4MHN A;  1TIQ A;  2ZEN A;  1VHO A;  2REF A;  1M4I A;  3GLJ A;  4KOY A;  3WR7 A;  4ZI6 A;  1DE4 C;  5K8P A;  3B3W A;  1OZP A;  1Y7E A;  1YME A;  3FRM A;  2B5G B;  2Q0Y A;  3PRT A;  4B13 A;  2ZEE A;  4YFJ A;  2PJA A;  3K2K A;  5CBM A;  1R57 A;  2Q7B A;  1QSN A;  4NXY A;  1EE3 P;  2Z10 A;  4NF1 A;  1FNO A;  2PJ8 A;  4C2Y A;  4MFJ A;  1QSM A;  3IU2 A;  5DS0 A;  3DGV A;  4OC2 A;  3S6K A;  4KOS A;  4X3R A;  2VQY A;  2B4D A;  5IV0 A;  2NYQ A;  3I3G A;  2KCW A;  1Z8X A;  4M6G A;  4P6Y A;  4R8F A;  3DDD A;  1F2O A;  3KR4 A;  3BXM A;  3D8P A;  3FF3 A;  1IOF A;  4AB7 A;  4CRY B;  2OU2 A;  1S60 A;  2QEC A;  2OOT A;  3R9F A;  2CNT A;  5HMN A;  4OC4 A;  2J8R A;  2PIZ A;  1ON0 A;  1XIX A;  3JTK A;  4R87 A;  2Z3O A;  3D7F A;  4CPA A;  5C82 A;  3IEH A;  1LRZ A;  4MCP A;  4R3K A;  1Z4R A;  4MFZ A;  3SJG A;  5ISV A;  4X2T A;  4KSF A;  1KWM A;  8CPA A;  2V8D A;  4MI4 A;  3IWG A;  4Y49 B;  4R7M A;  4IUS A;  2ZED A;  5IX3 A;  2YNC C;  4XPD B;  1LOK A;  4UFV A;  1YK3 A;  3WAB A;  4B5P B;  2DEA A;  4PSW A;  2OZU A;  3TC8 A;  2PJ2 A;  2ANP A;  2PJ4 A;  4KOT A;  4F8Z A;  2ABZ A;  3DSB A;  3JUW A;  4OC5 A;  2D4O A;  2YNE A;  4ZY0 A;  4JWP A;  4MFQ A;  1U6M A;  1IU8 A;  4M85 A;  4PQA A;  2FS5 A;  3RNZ A;  4CYO A;  2EK9 A;  5F49 A;  4G1P A;  5LYD A;  7CPA A;  1S7N A;  2WSA A;  2C6C A;  3QAY A;  4KVO E;  2B3V A;  3KQX A;  5HVG A;  5E96 A;  1B6B A;  1XF8 A;  4XPK A;  1BOB A;  2PJ7 A;  4GXH A;  4UBR A;  4CAE A;  4M6H A;  4UWJ A;  2CXA A;  1XBU A;  2JDD A;  2VZZ A;  4PXC A;  2O53 A;  4EVY A;  3PBB A;  2AFU A;  5JQ4 A;  4PXB A;  3S6H A;  1P0H A;  4MFP A;  2J8N A;  4PV6 A;  4QC6 A;  2AJ6 A;  4MBU A;  4EFD A;  5JPH A;  3ZJ0 A;  1IB1 E;  1BPN A;  3P2H A;  2PRQ A;  3IFE A;  4E2A A;  4HPS A;  4A95 A;  4LQG A;  1R43 A;  3RZA A;  4NCZ A;  3WC5 A;  5H86 A;  3WC6 A;  4MHY A; 
#chains in the Genus database with same CATH homology
 2C1C A;  2AFZ A;  3B3V A;  5K8O A;  4PPZ A;  2VL1 A;  2XEJ A;  1JQG A;  3BI0 A;  4NGS A;  1ZG8 A;  2CIJ A;  3FJU A;  3FMC A;  4FUU A;  4UF4 A;  4NGR A;  3FEE A;  3WC7 A;  2AFX A;  4NGT A;  4WWV A;  1IY7 A;  2IQ6 A;  3LWU A;  4NFR A;  3NH5 A;  1PYT B;  4IHM A;  3VH9 A;  2V8H A;  1CP6 A;  2POK A;  2ZOG A;  1VHE A;  4UEZ A;  1VGY A;  4A37 A;  4DYO A;  2WYR A;  2V77 A;  2XEF A;  3D4U A;  2BOA A;  4PXE A;  1ELM P;  2ZEL A;  3N5F A;  1ZG7 A;  2AFM A;  2GLF A;  2F8H A;  4WJB A;  2HC9 A;  3PB9 X;  4ZY1 A;  3KL9 A;  1F2P A;  1Z5R A;  1ARM A;  4UEF A;  5CPA A;  1OBR A;  3B3S A;  3KAS A;  4NJQ A;  2ZOF A;  2Q4Z A;  2GU2 A;  1XMB A;  1Z8L A;  1H8L A;  2CF4 A;  4AXV A;  1HDU A;  4PXD A;  4OC3 A;  1LFW A;  4ZYQ A;  2FVG A;  4TNU A;  1IGB A;  2PJB A;  2GRE A;  1CPX A;  3ISX A;  3PB6 X;  5HVF A;  1XJO A;  3SJE A;  2QYV A;  3FH4 A;  2I3C A;  3GUX A;  5LYF A;  1NSA A;  4P4F A;  5J1Q A;  4Q7A A;  1GYT A;  2ZEO A;  1M4L A;  5D29 A;  2JEW A;  3B3C A;  4OC0 A;  4FBE A;  1XFO A;  4FAI A;  3CPX A;  5K8N A;  3PB8 X;  3PBE A;  4F9V A;  2ZEH A;  4JYW A;  1VIX A;  4W9Y A;  3NFZ A;  2PJ3 A;  2V8G A;  3VAT A;  2GLJ A;  3FED A;  3H8G A;  5LYI A;  3LMS A;  4K3N A;  5JM6 A;  5HXD A;  3DLJ A;  3TX8 A;  4ONW A;  3KR5 A;  1ELL P;  3HLP A;  5ELY A;  2PIY A;  1YW6 A;  1QMU A;  1UWY A;  1TXR A;  1HDQ A;  2PJ1 A;  3B35 A;  5LRG A;  2IJZ A;  1F57 A;  4OC1 A;  3KHX A;  3CPA A;  2RB7 A;  3KQZ A;  5LRK A;  5F09 A;  4R76 A;  2J9A A;  4RUH A;  4NJR A;  3SJF A;  4O23 A;  2BO9 A;  4TWE A;  4JZ0 A;  2PJ5 A;  1ARL A;  1CP7 A;  1YSJ A;  1TKF A;  3JRU A;  5JH9 A;  4OME A;  4P44 A;  4OKO A;  4NGP A;  4P4J A;  4UEE A;  3IIB A;  4MRI A;  2BCO A;  1ZLI A;  4MXU A;  3NH4 A;  4MCQ A;  4MCS A;  5D8N A;  3NH8 A;  2PJ0 A;  4IAV A;  4P4B A;  2ZEG A;  3T8W A;  1LAM A;  1FT7 A;  2NSM A;  2Q51 A;  2CTC A;  3MN8 A;  2EK8 A;  1Y0R A;  1LCP A;  2XEI A;  2ZEF A;  1HEE A;  3FX6 A;  3FEC A;  4YU9 A;  3FVL A;  5LYL A;  3MRU A;  3D66 A;  3PFO A;  3SI1 A;  1QQ9 A;  4IK2 A;  4OIW A;  3NA6 A;  2QVP A;  1ZG9 A;  3SI0 A;  2PVV A;  1RTQ A;  4FWU A;  5IB9 A;  4YWY A;  5HVH A;  4MMO A;  3IJ3 A;  3B3T A;  3IC1 A;  1ZLH A;  2AFO A;  2PCU A;  3KI9 A;  3D7H A;  3B7I A;  2AFS A;  2CTB A;  3KGQ A;  2PJC A;  1TF8 A;  3B2Y A;  4EME A;  4NGN A;  4A39 A;  3D7G A;  1Y0Y A;  3PB4 X;  1Q7L A;  2O4H A;  4MHZ A;  2IMO A;  3K9T A;  4Z65 A;  3S9L A;  4NGM A;  4ZX8 A;  4P10 A;  1CX8 A;  3H8F A;  3V7Z A;  5I4M A;  1R3N A;  3IO1 A;  1PCA A;  4BD9 A;  1BAV A;  3L2N A;  1Z2L A;  2PJ9 A;  2C6P A;  4A38 A;  2PE3 A;  3H8E A;  1CPS A;  3PB7 X;  4OID A;  1LAP A;  2F7V A;  2PJ6 A;  4H2K A;  4KSI A;  2C6G A;  1TKH A;  3PFE A;  4P4E A;  4DUK A;  4P45 A;  1AYE A;  4UIA A;  4OP4 A;  4F9U A;  2ZEP A;  3RAM A;  3D7D A;  4UIB A;  3CDX A;  4X8I A;  1CG2 A;  3KHZ A;  4MHP A;  1BLL E;  1YLO A;  3D67 A;  3IWW A;  4R6T A;  1AMP A;  1BPM A;  4P4D A;  6CPA A;  2WZN A;  4NGQ A;  2HB6 A;  1DTD A;  3BI1 A;  3GB0 A;  4MCR A;  4EWT A;  2XEG A;  5LRJ A;  1YW4 A;  1TKJ A;  1LAN A;  3ISZ A;  3RBU A;  4GM5 A;  2PVW A;  3HUV A;  3BHX A;  5K8M A;  2EWB A;  2QJ8 A;  2V8V A;  2AFW A;  3VAR A;  4P4I A;  3SI2 A;  4B6Z A;  5JGF A;  3PEI A;  4A94 A;  5THW A;  2JBK A;  1CBX A;  3D68 A;  3KZW A;  2Q43 A;  2ZEM A;  4DJL A;  2G9D A;  3WT4 A;  2OR4 A;  3S9M A;  2RFH A;  3CT9 A;  2JBJ A;  3SJX A;  3V38 A;  4ZX9 A;  4ZY2 A;  3QNV A;  1TF9 A;  3S9N A;  1XRY A;  3I1U A;  4MHN A;  2ZEN A;  1VHO A;  3GLJ A;  4ZI6 A;  5K8P A;  1DE4 C;  3B3W A;  1Y7E A;  1YME A;  3PRT A;  2ZEE A;  2PJA A;  3K2K A;  5CBM A;  1EE3 P;  1FNO A;  2PJ8 A;  5DS0 A;  3DGV A;  4OC2 A;  4X3R A;  2NYQ A;  4P6Y A;  4R8F A;  1F2O A;  3KR4 A;  3BXM A;  3FF3 A;  2OOT A;  4OC4 A;  2PIZ A;  3D7F A;  4CPA A;  3IEH A;  4MCP A;  3SJG A;  4X2T A;  8CPA A;  1KWM A;  2V8D A;  4R7M A;  2ZED A;  1LOK A;  3WAB A;  2DEA A;  3TC8 A;  2PJ2 A;  2ANP A;  2PJ4 A;  4F8Z A;  2ABZ A;  4ZY0 A;  4OC5 A;  4PQA A;  2EK9 A;  4G1P A;  5LYD A;  7CPA A;  2C6C A;  3KQX A;  5HVG A;  2PJ7 A;  1XBU A;  4PXC A;  2O53 A;  3PBB A;  2AFU A;  4PXB A;  4EFD A;  1BPN A;  2PRQ A;  3IFE A;  4LQG A;  1R43 A;  3RZA A;  3WC5 A;  3WC6 A;  4MHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...