2QVPA

Crystal structure of a putative metallopeptidase (sama_0725) from shewanella amazonensis sb2b at 2.00 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
266
structure length
266
Chain Sequence
QTFVWRSEIFECQSTDIQRFYSLLAIETERLGLGSKILGQAGHHPLYLLQSPGQKAGLPNLLISAGFHGEESAGPWGLLHFLSQLDGELFKRVNLSVLPLVNPTGFAKGHRFNELGENPNRGFFIENGKAKPGADTSAEGRILLEHAHLLQVASRDGILTCHEDVLMTDTYVYTFEPSQAPGRFSHSLRDALGQYFPIAADGDVDNCPVRSGVIFNHFDTSFESFLVRSGARVGCCSETPGQQPLDQRILANAAAMNTFVNMLAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_926603.1) from Shewanella amazonensis SB2B at 2.00 A resolution
rcsb
source organism Shewanella amazonensis
total genus 85
structure length 266
sequence length 266
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2qvpA00
1H8LA 2ZEEA 4P4DA 4IHMA 2XEGA 3K9TA 1CP7A 3B3VA 1HDUA 1Z2LA 2V8DA 1TKHA 2PCUA 4P4BA 1Q7LA 1Y7EA 1BAVA 4GM5A 4UEZA 4P10A 2F8HA 2NYQA 4R76A 3IJ3A 1OBRA 4NGQA 4NGSA 4PXDA 2G9DA 1ELLP 3PRTA 4NGPA 4P44A 2JBJA 4NJQA 3SJFA 3HLPA 3FMCA 3VARA 4A38A 2V8VA 5LYFA 4G1PA 4MCRA 1PYTB 4NGNA 2ZEHA 1XJOA 1YLOA 4UEEA 2ZEOA 5JH9A 2EK9A 2Q4ZA 1F2OA 3QNVA 3PB4X 3NFZA 3DLJA 3BXMA 3B7IA 4ZY1A 1IY7A 4ZY0A 3KZWA 3LMSA 2ZELA 2OR4A 3RBUA 4OC2A 3L2NA 4JYWA 5CPAA 2ANPA 1LCPA 4OC3A 3KGQA 3PB8X 2PJ9A 1QMUA 5CBMA 4F9VA 1FT7A 3KHZA 1TF9A 3SJEA 3K2KA 3KQZA 4PXBA 1CX8A 4BD9A 1ARMA 4ZX8A 1XRYA 2J9AA 3I1UA 2V77A 3WABA 4FWUA 3SI0A 2BOAA 4PXCA 4P4IA 3KL9A 4ZI6A 1Y0RA 4IAVA 2PJBA 4NGTA 5LRKA 2PJ5A 5LYIA 2QJ8A 1CBXA 3V7ZA 1F57A 2F7VA 3PFOA 3NH5A 3SI1A 1HEEA 3PEIA 4OP4A 3BI1A 1TF8A 2XEIA 7CPAA 4DJLA 3PB6X 3WC6A 1CP6A 2PJAA 2CTBA 2AFWA 2ZEPA 3B3CA 5HVGA 4A39A 5J1QA 4PQAA 3IO1A 4P4FA 5K8OA 2AFSA 1YW6A 3HUVA 2AFMA 4FUUA 5HVHA 3RAMA 3RZAA 4JZ0A 3KI9A 1CG2A 1AMPA 3PBEA 3T8WA 2PRQA 2V8GA 1AYEA 3D4UA 2PVWA 4LQGA 2I3CA 1IGBA 4K3NA 4P4EA 2QVPA 3ISXA 2GLFA 2WYRA 3D66A 2ZEMA 4UEFA 3ISZA 4IK2A 3SI2A 2BO9A 4P6YA 5D8NA 1LANA 1ZG9A 3TX8A 2PJCA 4NGMA 3PFEA 5I4MA 1ZLHA 3IEHA 3MN8A 5HXDA 4YU9A 3CDXA 4OC5A 4OKOA 3PBBA 2IJZA 2PE3A 1TXRA 1CPSA 2ZEFA 1ZG7A 1TKFA 3D7HA 2AFZA 2ABZA 3TC8A 3S9MA 2PJ4A 2PJ3A 4WJBA 2JBKA 3FVLA 3D7FA 3B2YA 2HB6A 4TWEA 4UIBA 2GU2A 1XBUA 1TKJA 3S9LA 4P45A 4F8ZA 2OOTA 2PJ8A 2O4HA 2RFHA 3CT9A 4PPZA 1LOKA 3FX6A 1CPXA 2QYVA 3FECA 4X3RA 2C1CA 1YMEA 2CIJA 2POKA 2WZNA 4EMEA 4YWYA 1HDQA 4TNUA 4OC1A 3H8EA 3KR4A 4P4JA 2GLJA 1ELMP 1RTQA 1M4LA 4EFDA 2VL1A 5LRGA 4R8FA 5LYLA 5IB9A 2AFUA 2NSMA 1BPMA 3H8GA 3PB9X 1VGYA 3IC1A 2CTCA 4OC0A 3D7DA 2PJ6A 5DS0A 3VH9A 4EWTA 4A37A 3WC5A 3IIBA 6CPAA 2PVVA 3IWWA 2ZENA 2CF4A 3FEEA 3D7GA 2IQ6A 2EWBA 4H2KA 3IFEA 1Y0YA 2IMOA 3NA6A 4UIAA 3B3SA 4NJRA 3NH4A 3D67A 4ZX9A 2PIYA 4R7MA 3VATA 2V8HA 3LWUA 4UF4A 2ZOGA 1Z8LA 1UWYA 4MCSA 2PJ7A 5F09A 1LAPA 5K8PA 8CPAA 1FNOA 4FAIA 3D68A 3FH4A 5K8NA 1XMBA 4WWVA 1PCAA 3GUXA 4W9YA 4PXEA 4MCPA 4OC4A 2PJ2A 4X8IA 2JEWA 1GYTA 3N5FA 1BLLE 2EK8A 3KQXA 4FBEA 3FJUA 5THWA 2AFXA 1LAMA 1R3NA 3KR5A 1R43A 4CPAA 3CPXA 2RB7A 4ZY2A 3SJGA 2ZOFA 1ARLA 3B3TA 3BI0A 2AFOA 1XFOA 4RUHA 2XEFA 1VHOA 3MRUA 2FVGA 1VIXA 4OIDA 3GB0A 5K8MA 2ZEGA 1F2PA 1DE4C 4Q7AA 1ZG8A 1Z5RA 4O23A 4MHZA 1DTDA 3CPAA 1YW4A 2PIZA 2XEJA 2C6GA 4NGRA 3B3WA 3GLJA 4NFRA 3WT4A 2ZEDA 4ONWA 5JM6A 3NH8A 4MXUA 4Z65A 3H8FA 1EE3P 1LFWA 4MHPA 1ZLIA 2O53A 2GREA 1KWMA 3DGVA 1VHEA 4R6TA 1JQGA 3V38A 1NSAA 4ZYQA 2C6CA 3PB7X 4OMEA 2Q51A 4DYOA 5D29A 3BHXA 3KASA 4X2TA 1YSJA 5ELYA 3B35A 4F9UA 3JRUA 4MHYA 5LRJA 2DEAA 3WC7A 3FF3A 2HC9A 2BCOA 4MRIA 3SJXA 4MMOA 5LYDA 5JGFA 4A94A 1QQ9A 3KHXA 4B6ZA 2C6PA 4MHNA 4OIWA 2Q43A 2PJ0A 5HVFA 4MCQA 1BPNA 3FEDA 4DUKA 4AXVA 4KSIA 2PJ1A 3S9NA
chains in the Genus database with same CATH superfamily
1H8LA 2ZEEA 4P4DA 4IHMA 5DWMA 4C2XA 1FY7A 4EVYA 5J8FA 4H6ZA 4NF1A 2FIWA 2XEGA 1Y7RA 3K9TA 3ZZIA 4UCPA 1CP7A 3B3VA 1HDUA 2Q7SA 4A33A 1Z2LA 2V8DA 1TKHA 1Y9WA 2PCUA 2PSWA 1Q7LA 1Y7EA 1YQEA 4HNWB 4P4BA 4Y49B 4CRYB 1BAVA 4J3GA 1S7NA 4KVME 4UBRA 4PK2A 4KSAA 4GM5A 4UEZA 2CNMA 4P10A 4MJ8A 2F8HA 5KTCA 5EMIA 4AG7A 2NYQA 3C26A 5ISVA 4R76A 5CNPA 2OZHA 3EO4A 3IJ3A 4L8AA 1OBRA 4NGQA 4NGSA 4PXDA 2G9DA 1ELLP 3DDDA 4R3KA 3PRTA 4NGPA 1PU9A 4KLVA 4P44A 2JBJA 2P0WA 4NJQA 4ORFA 3SJFA 4CGMA 4KS9A 3HLPA 3A9LA 1JWQA 3FMCA 3VARA 4A38A 2V8VA 1Z8XA 4M6HA 5LYFA 4G1PA 1YK3A 3EY5A 4MCRA 1PYTB 4NGNA 4CYNA 4FD5A 2ZEHA 2GANA 1XJOA 2CY2A 4R3LA 1KUXA 1YLOA 4UEEA 2ZEOA 3R9FA 1S7FA 2IL4A 2EK9A 5JH9A 2Q4ZA 1A2ZA 1F2OA 3QNVA 5IV0A 4UFVA 2ZW6A 3PB4X 3T9YA 2VBQA 3NFZA 3DLJA 3BXMA 4ZGYB 2B3UA 3R9EA 3B7IA 4E8OA 5JPHA 4AVCA 1K4JA 4ZY1A 1IY7A 2X7BA 4ZY0A 3KZWA 3LMSA 2Y0MA 2ZELA 2EUIA 2OR4A 4MI4A 4E0AA 2FCKA 3G3SA 3RBUA 1Z8WA 4OC2A 4LX9A 3L2NA 3S6GA 4JYWA 2K5TA 4XNHC 2Z3NA 4UFWA 2ANPA 5CPAA 1LCPA 4OC3A 3KGQA 5E96A 3PB8X 1Z9UA 2PJ9A 2Q04A 1QMUA 4X5KA 5CBMA 5H84A 1X10A 1FT7A 4F9VA 4JWPA 3KHZA 3BLNA 4L89A 1TF9A 3SJEA 3K2KA 4B13A 3CXPA 2ZW4A 3KQZA 4PXBA 1CX8A 4BD9A 1BO4A 5HMNA 4M3SA 1L0CA 4U5YA 1ARMA 4ZX8A 2YNEA 4MFKA 4K30A 4A2ZA 1XRYA 4RI1A 2J9AA 3I1UA 3TE4A 1I1DA 3TO6A 2V77A 1P4NA 3WABA 4MY0A 4FWUA 5AGEA 1SQHA 3BJ7A 3SI0A 2BOAA 2H5MA 2QIRA 3FIXA 4PXCA 4A32A 2FE7A 3EFAA 4P4IA 3KL9A 4ZI6A 1RXTA 1M1DA 2HUZA 2Q7BA 1Y0RA 2Z3OA 4IAVA 1YLEA 4A95A 2PJBA 3R96A 4NGTA 5LRKA 1CM0A 2PJ5A 1YREA 1X12A 5LYIA 2QJ8A 2I00A 1NE9A 2FL4A 2DPTA 4AVAA 1CBXA 3V7ZA 1B87A 1F57A 2CXAA 2F7VA 3PFOA 3GIUA 5KTAA 3NH5A 5KTDA 3SI1A 1HEEA 2Z3MA 3OWCA 3PEIA 4F0XA 2GFQA 4OP4A 3BI1A 4RN7A 4Q36A 3V8IA 1XEBA 2VZZA 1TF8A 4XNHB 2XEIA 3VWEA 7CPAA 4DJLA 3PB6X 4QBJA 3B8GA 4QUSA 3WC6A 1CP6A 2PJAA 3S6FA 2C27A 1QSRA 2AFWA 2CTBA 2ZEPA 3IGRA 4KZTA 2DF5A 3B3CA 3FNCA 5HVGA 3ZJ0A 4B12A 4A39A 5J1QA 5A27A 5AG6A 1YVKA 3DSBA 2G0BA 2VZYA 3IO1A 3LD2A 4NCZA 4P4FA 4PQAA 4DNCA 5IX3A 5IB0A 4C7IA 5K8OA 2Z0ZA 1ZO0A 2AFSA 1IIDA 3NE8A 4KOXA 1N71A 1YW6A 3HUVA 1IU8A 2AFMA 3D2PA 1V0CA 4JXQA 2NMTA 5G21A 5GCNA 4FUUA 2QECA 4I49A 5HVHA 4UA3A 3I9SA 3RAMA 4KOSA 4JZ0A 3RZAA 3KI9A 3SXOA 1Z8TA 1CG2A 1AMPA 4YGOA 1NMTA 3TCVA 1WK4A 2J8MA 3PBEA 2WPXA 1VKCA 4H89A 3T8WA 2D4OA 3TO7A 2PRQA 2V8GA 2OZGA 1AYEA 2CNSA 3D4UA 1Z4RA 1NSLA 4E2AA 3F8KA 2R1IA 2PVWA 4LQGA 2I79A 3D3SA 5A28A 4OADA 1U6MA 2I3CA 1IGBA 2J8RA 4K3NA 4B10A 4JXRA 4P4EA 2QVPA 4NXYA 3EC4A 2WSAA 3ISXA 4C2YA 4YFJA 3NE7A 4LUAA 2EVNA 4M85A 5HH1A 3R95A 2GLFA 2WYRA 2B4DA 3FB3A 3D66A 4PK3A 2ZEMA 4KOYA 1S7KA 3ISZA 4IK2A 4UEFA 3SI2A 2PC1A 1IICA 1ON0A 2B5GA 3TOBA 2BO9A 1KUYA 4P6YA 5D8NA 1LANA 1ZG9A 2Q0YA 2OU2A 2YGWA 3WR7A 3TX8A 2PJCA 4KVOE 2FS5A 1KUVA 4NGMA 3PFEA 3KKWA 4JJXA 5I4MA 1ZLHA 4CRZB 2PQ8A 2G3TA 3G8WA 3IEHA 3MN8A 5HXDA 4YU9A 3IWEA 4MFLA 1IB1E 1LRZA 5J8CA 1IYLA 1KZFA 3CDXA 3W6XA 4OC5A 2BUEA 2PR8A 3S6HA 4R87A 5G20A 4A30A 1MJBA 5F49A 4QVTA 4OKOA 3UY5A 3IWGA 3PBBA 4XPLA 4BBHA 2IJZA 2PE3A 2Z10A 4KOWA 1TXRA 4KORA 3H5ZA 1CPSA 2ZEFA 1XF8A 1ZG7A 2VEZA 5I0CA 1TKFA 2JLMA 3D7HA 4ZBGA 4CGOA 4KUBA 2AFZA 4CYOA 3FRMA 2ABZA 2BL1A 3PZJA 3TC8A 3S9MA 5G1ZA 2PJ4A 2PJ3A 4H6UA 4U9ZA 4WJBA 2JBKA 3FVLA 4F6AA 3D7FA 2YNCA 2HB6A 3B2YA 3DNSA 2GU2A 4UIBA 4TWEA 4B11A 1XBUA 2EBJA 2YNCC 3N7ZA 2R98A 1IOIA 1TKJA 3S9LA 2YNDA 3LACA 2FXFA 2FT0A 3JVNA 4IUSA 4P45A 4F8ZA 4OLLA 3FBUA 2OOTA 2PJ8A 4B5PA 2A4NA 2O4HA 3CXSA 2BEIA 2FIAA 2RFHA 3CT9A 4PPZA 1LOKA 4Q38A 2F5IA 3FX6A 4U9YA 4ONUA 3GKRA 1CPXA 4BINA 2QYVA 3FECA 5AG4A 4X3RA 2C1CA 2Q4YA 1YX0A 2ZPAA 1YMEA 2KCWA 3F0AA 2CIJA 2POKA 2AJ6A 1XE4A 2FSRA 2WZNA 3RO0A 2HQYA 2OH1A 2ATRA 2QMLA 4YWYA 4EMEA 1HDQA 4GXHA 4RS2A 4CAFA 2VI7A 3QAYA 4TNUA 4OC1A 3H8EA 1S7LA 1R57A 2REEA 2ZW5A 3KR4A 1WWZA 2GLJA 1ELMP 1Q2DA 1RTQA 2VXKA 4P4JA 3TFYA 1M4LA 2R7HA 1M4IA 3TOAA 2VL1A 4EFDA 5LRGA 4R8FA 5G22A 3D2MA 2GE3A 2P6EA 5LYLA 4UWJA 3SXNA 4HKFA 2R8VA 3LODA 2B4BA 3CXQA 5IB9A 2AFUA 2NSMA 2OZUA 1BPMA 3H8GA 3PB9X 1VGYA 3IC1A 2CTCA 4HPSA 4OC0A 3D7DA 4C68A 3K9UA 2PJ6A 3QAHA 5DS0A 3SHPA 3VH9A 4EWTA 4A37A 3WC5A 2PRBA 3IIBA 6CPAA 2PVVA 3IWWA 4MFJA 1B6BA 2B3VA 2ZENA 2CF4A 5AG7A 3FEEA 2O28A 3D7GA 2IQ6A 4R57A 3R9GA 4B5PB 2EWBA 5H86A 4H2KA 5BWAB 5C88A 4QB9A 3IFEA 2Q4VA 2GIVA 4NSQA 1Y0YA 2IMOA 3NA6A 1MK4A 1XMTA 1VHSA 3GY9A 3B3SA 4UCMA 4UIAA 4NJRA 3NH4A 4C7HA 5F46A 4AG9A 3D67A 4JD6A 4ZX9A 2PIYA 4R7MA 3VATA 2V8HA 3EXNA 2DPSA 3LWUA 4UF4A 3E0KA 2ZOGA 1XIXA 4XPDC 2ZXVA 1Z8LA 4CGLA 1UWYA 4AB7A 1IOFA 1M4DA 4MFQA 4MCSA 2P6GA 2Q44A 2PJ7A 3S6KA 5AG5A 5F09A 1LAPA 1M44A 5K8PA 3P2FA 1P0HA 2WUUA 8CPAA 1QSNA 1FNOA 4MFPA 4FAIA 3D68A 1Q2YA 3FH4A 1XMBA 5K8NA 4WWVA 1PCAA 2CNTA 3GUXA 5DWNA 3JUWA 4W9YA 2J8NA 4PXEA 4MCPA 4OC4A 2PJ2A 4X8IA 2JEWA 1OZPA 4UCNA 1GYTA 2D4PA 3N5FA 4XPKA 1BLLE 4FD7A 1S5KA 2EK8A 3KQXA 4FBEA 3FJUA 3FXTA 5THWA 2AFXA 1LAMA 1R3NA 2REFA 3KR5A 1RO5A 1R43A 4MBUA 4KOUA 4KOVA 4M6IA 1YGHA 3CPXA 4CPAA 2RB7A 4ZY2A 4GS4A 3PP9A 1QSTA 4UFXA 3SJGA 3W6SA 1S60A 2ZOFA 4KOTA 1ARLA 1Y9KA 3B3TA 3BI0A 5C82A 1BOBA 2AFOA 2B58A 4CGPA 3BJ8A 4C2ZA 2AE6A 4CAVA 4CAWA 1GHEA 1XFOA 4RUHA 5JQ4A 1CJWA 2DXQA 4KUAA 4MHDA 4PSWA 1MJAA 2XEFA 1VHOA 3MRUA 1TIQA 4JLYA 1YR0A 2FVGA 3I3GA 3QB8A 1VIXA 4OIDA 2ARHA 3GB0A 5K8MA 2EO8A 2ZEGA 4XPDB 1F2PA 1DE4C 4Q7AA 4HNXB 3RYOA 4AVBA 3FYNA 4KVXA 4MY3A 4CYQA 1ZG8A 1S3ZA 1Z5RA 4MHZA 4O23A 2RC4A 2Z11A 1DTDA 4B5OA 2Z3KA 3CPAA 4CAEA 1YW4A 2JDCA 2PIZA 2XEJA 2C6GA 4UWIA 3MGDA 4NGRA 3TT2A 3B3WA 3DR8A 4NEXA 2B4DB 3GLJA 4NFRA 3JTKA 3WT4A 2B5GB 2ZEDA 3IU2A 4HNYB 1PUAA 4R9MA 5EC4A 4B14A 1XOVA 4ONWA 3CZXA 3NH8A 2VQYA 5JM6A 4MXUA 4Z65A 3H8FA 1EE3P 4QC6A 1LFWA 3D8PA 4MHPA 5EBVA 3TO9A 2P6FA 1ZLIA 2O53A 4FD4A 4KSFA 2Z3PA 2GREA 1KWMA 1QSMA 1VHEA 3DGVA 4R6TA 4CYPA 1JQGA 3V38A 2PR1A 1NSAA 4ZYQA 2C6CA 4CGNA 4Y49C 1QSOA 3PB7X 2Q51A 1YVOA 3IU1A 3P2HA 4OMEA 5D29A 4DYOA 3BHXA 1AUGA 2G3AA 4IF5A 4OAEA 3KASA 4CAXA 3TTHA 4X2TA 4FD6A 1YSJA 5ELYA 1MJ9A 1Q2CA 1UFHA 2ZW7A 3B35A 4KLWA 4F9UA 3JRUA 3DR6A 4LQ6A 4MHYA 5LRJA 3RNZA 2JEVA 2DEAA 3VWDA 1J4JA 4PSXA 5F47A 3WC7A 4A31A 2ODFA 3FF3A 4YRHA 3W91A 3GYAA 4MFZA 3F5BA 2HC9A 4BMHA 1I21A 1IYKA 2BCOA 4MRIA 4II9A 2HV2A 4MMOA 1I12A 2Z3LA 4PV6A 3SJXA 5LYDA 4CS0B 2BSWA 4F0YA 2JDDA 5JGFA 4A94A 1QQ9A 3KHXA 2OB0A 1Z4EA 2C6PA 2WPWA 4M6GA 5F48A 4B6ZA 4MHNA 3R1KA 4OIWA 2Q43A 3T90A 2PJ0A 5HVFA 4MCQA 2PDOA 5FVJA 1BPNA 3FEDA 4DUKA 3H4QA 1M4GA 4AXVA 4KSIA 3PGPA 2PJ1A 3S9NA
chains in the Genus database with same CATH topology
1H8LA 2ZEEA 4P4DA 4IHMA 2XEGA 3K9TA 1CP7A 3B3VA 1HDUA 1Z2LA 2V8DA 1TKHA 2PCUA 4P4BA 1Q7LA 1Y7EA 1BAVA 4GM5A 4UEZA 4P10A 2F8HA 2NYQA 4R76A 3IJ3A 1OBRA 4NGQA 4NGSA 4PXDA 2G9DA 1ELLP 3PRTA 4NGPA 4P44A 2JBJA 4NJQA 3SJFA 3HLPA 3FMCA 3VARA 4A38A 2V8VA 5LYFA 4G1PA 4MCRA 1PYTB 4NGNA 2ZEHA 1XJOA 1YLOA 4UEEA 2ZEOA 5JH9A 2EK9A 2Q4ZA 1F2OA 3QNVA 3PB4X 3NFZA 3DLJA 3BXMA 3B7IA 4ZY1A 1IY7A 4ZY0A 3KZWA 3LMSA 2ZELA 2OR4A 3RBUA 4OC2A 3L2NA 4JYWA 5CPAA 2ANPA 1LCPA 4OC3A 3KGQA 3PB8X 2PJ9A 1QMUA 5CBMA 4F9VA 1FT7A 3KHZA 1TF9A 3SJEA 3K2KA 3KQZA 4PXBA 1CX8A 4BD9A 1ARMA 4ZX8A 1XRYA 2J9AA 3I1UA 2V77A 3WABA 4FWUA 3SI0A 2BOAA 4PXCA 4P4IA 3KL9A 4ZI6A 1Y0RA 4IAVA 2PJBA 4NGTA 5LRKA 2PJ5A 5LYIA 2QJ8A 1CBXA 3V7ZA 1F57A 2F7VA 3PFOA 3NH5A 3SI1A 1HEEA 3PEIA 4OP4A 3BI1A 1TF8A 2XEIA 7CPAA 4DJLA 3PB6X 3WC6A 1CP6A 2PJAA 2CTBA 2AFWA 2ZEPA 3B3CA 5HVGA 4A39A 5J1QA 4PQAA 3IO1A 4P4FA 5K8OA 2AFSA 1YW6A 3HUVA 2AFMA 4FUUA 5HVHA 3RAMA 3RZAA 4JZ0A 3KI9A 1CG2A 1AMPA 3PBEA 3T8WA 2PRQA 2V8GA 1AYEA 3D4UA 2PVWA 4LQGA 2I3CA 1IGBA 4K3NA 4P4EA 2QVPA 3ISXA 2GLFA 2WYRA 3D66A 2ZEMA 4UEFA 3ISZA 4IK2A 3SI2A 2BO9A 4P6YA 5D8NA 1LANA 1ZG9A 3TX8A 2PJCA 4NGMA 3PFEA 5I4MA 1ZLHA 3IEHA 3MN8A 5HXDA 4YU9A 3CDXA 4OC5A 4OKOA 3PBBA 2IJZA 2PE3A 1TXRA 1CPSA 2ZEFA 1ZG7A 1TKFA 3D7HA 2AFZA 2ABZA 3TC8A 3S9MA 2PJ4A 2PJ3A 4WJBA 2JBKA 3FVLA 3D7FA 3B2YA 2HB6A 4TWEA 4UIBA 2GU2A 1XBUA 1TKJA 3S9LA 4P45A 4F8ZA 2OOTA 2PJ8A 2O4HA 2RFHA 3CT9A 4PPZA 1LOKA 3FX6A 1CPXA 2QYVA 3FECA 4X3RA 2C1CA 1YMEA 2CIJA 2POKA 2WZNA 4EMEA 4YWYA 1HDQA 4TNUA 4OC1A 3H8EA 3KR4A 4P4JA 2GLJA 1ELMP 1RTQA 1M4LA 4EFDA 2VL1A 5LRGA 4R8FA 5LYLA 5IB9A 2AFUA 2NSMA 1BPMA 3H8GA 3PB9X 1VGYA 3IC1A 2CTCA 4OC0A 3D7DA 2PJ6A 5DS0A 3VH9A 4EWTA 4A37A 3WC5A 3IIBA 6CPAA 2PVVA 3IWWA 2ZENA 2CF4A 3FEEA 3D7GA 2IQ6A 2EWBA 4H2KA 3IFEA 1Y0YA 2IMOA 3NA6A 4UIAA 3B3SA 4NJRA 3NH4A 3D67A 4ZX9A 2PIYA 4R7MA 3VATA 2V8HA 3LWUA 4UF4A 2ZOGA 1Z8LA 1UWYA 4MCSA 2PJ7A 5F09A 1LAPA 5K8PA 8CPAA 1FNOA 4FAIA 3D68A 3FH4A 5K8NA 1XMBA 4WWVA 1PCAA 3GUXA 4W9YA 4PXEA 4MCPA 4OC4A 2PJ2A 4X8IA 2JEWA 1GYTA 3N5FA 1BLLE 2EK8A 3KQXA 4FBEA 3FJUA 5THWA 2AFXA 1LAMA 1R3NA 3KR5A 1R43A 4CPAA 3CPXA 2RB7A 4ZY2A 3SJGA 2ZOFA 1ARLA 3B3TA 3BI0A 2AFOA 1XFOA 4RUHA 2XEFA 1VHOA 3MRUA 2FVGA 1VIXA 4OIDA 3GB0A 5K8MA 2ZEGA 1F2PA 1DE4C 4Q7AA 1ZG8A 1Z5RA 4O23A 4MHZA 1DTDA 3CPAA 1YW4A 2PIZA 2XEJA 2C6GA 4NGRA 3B3WA 3GLJA 4NFRA 3WT4A 2ZEDA 4ONWA 5JM6A 3NH8A 4MXUA 4Z65A 3H8FA 1EE3P 1LFWA 4MHPA 1ZLIA 2O53A 2GREA 1KWMA 3DGVA 1VHEA 4R6TA 1JQGA 3V38A 1NSAA 4ZYQA 2C6CA 3PB7X 4OMEA 2Q51A 4DYOA 5D29A 3BHXA 3KASA 4X2TA 1YSJA 5ELYA 3B35A 4F9UA 3JRUA 4MHYA 5LRJA 2DEAA 3WC7A 3FF3A 2HC9A 2BCOA 4MRIA 3SJXA 4MMOA 5LYDA 5JGFA 4A94A 1QQ9A 3KHXA 4B6ZA 2C6PA 4MHNA 4OIWA 2Q43A 2PJ0A 5HVFA 4MCQA 1BPNA 3FEDA 4DUKA 4AXVA 4KSIA 2PJ1A 3S9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8L A;  2ZEE A;  4P4D A;  4IHM A;  2XEG A;  3K9T A;  1CP7 A;  3B3V A;  1HDU A;  1Z2L A;  2V8D A;  1TKH A;  2PCU A;  4P4B A;  1Q7L A;  1Y7E A;  1BAV A;  4GM5 A;  4UEZ A;  4P10 A;  2F8H A;  2NYQ A;  4R76 A;  3IJ3 A;  1OBR A;  4NGQ A;  4NGS A;  4PXD A;  2G9D A;  1ELL P;  3PRT A;  4NGP A;  4P44 A;  2JBJ A;  4NJQ A;  3SJF A;  3HLP A;  3FMC A;  3VAR A;  4A38 A;  2V8V A;  5LYF A;  4G1P A;  4MCR A;  1PYT B;  4NGN A;  2ZEH A;  1XJO A;  1YLO A;  4UEE A;  2ZEO A;  5JH9 A;  2EK9 A;  2Q4Z A;  1F2O A;  3QNV A;  3PB4 X;  3NFZ A;  3DLJ A;  3BXM A;  3B7I A;  4ZY1 A;  1IY7 A;  4ZY0 A;  3KZW A;  3LMS A;  2ZEL A;  2OR4 A;  3RBU A;  4OC2 A;  3L2N A;  4JYW A;  5CPA A;  2ANP A;  1LCP A;  4OC3 A;  3KGQ A;  3PB8 X;  2PJ9 A;  1QMU A;  5CBM A;  4F9V A;  1FT7 A;  3KHZ A;  1TF9 A;  3SJE A;  3K2K A;  3KQZ A;  4PXB A;  1CX8 A;  4BD9 A;  1ARM A;  4ZX8 A;  1XRY A;  2J9A A;  3I1U A;  2V77 A;  3WAB A;  4FWU A;  3SI0 A;  2BOA A;  4PXC A;  4P4I A;  3KL9 A;  4ZI6 A;  1Y0R A;  4IAV A;  2PJB A;  4NGT A;  5LRK A;  2PJ5 A;  5LYI A;  2QJ8 A;  1CBX A;  3V7Z A;  1F57 A;  2F7V A;  3PFO A;  3NH5 A;  3SI1 A;  1HEE A;  3PEI A;  4OP4 A;  3BI1 A;  1TF8 A;  2XEI A;  7CPA A;  4DJL A;  3PB6 X;  3WC6 A;  1CP6 A;  2PJA A;  2CTB A;  2AFW A;  2ZEP A;  3B3C A;  5HVG A;  4A39 A;  5J1Q A;  4PQA A;  3IO1 A;  4P4F A;  5K8O A;  2AFS A;  1YW6 A;  3HUV A;  2AFM A;  4FUU A;  5HVH A;  3RAM A;  3RZA A;  4JZ0 A;  3KI9 A;  1CG2 A;  1AMP A;  3PBE A;  3T8W A;  2PRQ A;  2V8G A;  1AYE A;  3D4U A;  2PVW A;  4LQG A;  2I3C A;  1IGB A;  4K3N A;  4P4E A;  2QVP A;  3ISX A;  2GLF A;  2WYR A;  3D66 A;  2ZEM A;  4UEF A;  3ISZ A;  4IK2 A;  3SI2 A;  2BO9 A;  4P6Y A;  5D8N A;  1LAN A;  1ZG9 A;  3TX8 A;  2PJC A;  4NGM A;  3PFE A;  5I4M A;  1ZLH A;  3IEH A;  3MN8 A;  5HXD A;  4YU9 A;  3CDX A;  4OC5 A;  4OKO A;  3PBB A;  2IJZ A;  2PE3 A;  1TXR A;  1CPS A;  2ZEF A;  1ZG7 A;  1TKF A;  3D7H A;  2AFZ A;  2ABZ A;  3TC8 A;  3S9M A;  2PJ4 A;  2PJ3 A;  4WJB A;  2JBK A;  3FVL A;  3D7F A;  3B2Y A;  2HB6 A;  4TWE A;  4UIB A;  2GU2 A;  1XBU A;  1TKJ A;  3S9L A;  4P45 A;  4F8Z A;  2OOT A;  2PJ8 A;  2O4H A;  2RFH A;  3CT9 A;  4PPZ A;  1LOK A;  3FX6 A;  1CPX A;  2QYV A;  3FEC A;  4X3R A;  2C1C A;  1YME A;  2CIJ A;  2POK A;  2WZN A;  4EME A;  4YWY A;  1HDQ A;  4TNU A;  4OC1 A;  3H8E A;  3KR4 A;  4P4J A;  2GLJ A;  1ELM P;  1RTQ A;  1M4L A;  4EFD A;  2VL1 A;  5LRG A;  4R8F A;  5LYL A;  5IB9 A;  2AFU A;  2NSM A;  1BPM A;  3H8G A;  3PB9 X;  1VGY A;  3IC1 A;  2CTC A;  4OC0 A;  3D7D A;  2PJ6 A;  5DS0 A;  3VH9 A;  4EWT A;  4A37 A;  3WC5 A;  3IIB A;  6CPA A;  2PVV A;  3IWW A;  2ZEN A;  2CF4 A;  3FEE A;  3D7G A;  2IQ6 A;  2EWB A;  4H2K A;  3IFE A;  1Y0Y A;  2IMO A;  3NA6 A;  4UIA A;  3B3S A;  4NJR A;  3NH4 A;  3D67 A;  4ZX9 A;  2PIY A;  4R7M A;  3VAT A;  2V8H A;  3LWU A;  4UF4 A;  2ZOG A;  1Z8L A;  1UWY A;  4MCS A;  2PJ7 A;  5F09 A;  1LAP A;  5K8P A;  8CPA A;  1FNO A;  4FAI A;  3D68 A;  3FH4 A;  5K8N A;  1XMB A;  4WWV A;  1PCA A;  3GUX A;  4W9Y A;  4PXE A;  4MCP A;  4OC4 A;  2PJ2 A;  4X8I A;  2JEW A;  1GYT A;  3N5F A;  1BLL E;  2EK8 A;  3KQX A;  4FBE A;  3FJU A;  5THW A;  2AFX A;  1LAM A;  1R3N A;  3KR5 A;  1R43 A;  4CPA A;  3CPX A;  2RB7 A;  4ZY2 A;  3SJG A;  2ZOF A;  1ARL A;  3B3T A;  3BI0 A;  2AFO A;  1XFO A;  4RUH A;  2XEF A;  1VHO A;  3MRU A;  2FVG A;  1VIX A;  4OID A;  3GB0 A;  5K8M A;  2ZEG A;  1F2P A;  1DE4 C;  4Q7A A;  1ZG8 A;  1Z5R A;  4O23 A;  4MHZ A;  1DTD A;  3CPA A;  1YW4 A;  2PIZ A;  2XEJ A;  2C6G A;  4NGR A;  3B3W A;  3GLJ A;  4NFR A;  3WT4 A;  2ZED A;  4ONW A;  5JM6 A;  3NH8 A;  4MXU A;  4Z65 A;  3H8F A;  1EE3 P;  1LFW A;  4MHP A;  1ZLI A;  2O53 A;  2GRE A;  1KWM A;  3DGV A;  1VHE A;  4R6T A;  1JQG A;  3V38 A;  1NSA A;  4ZYQ A;  2C6C A;  3PB7 X;  4OME A;  2Q51 A;  4DYO A;  5D29 A;  3BHX A;  3KAS A;  4X2T A;  1YSJ A;  5ELY A;  3B35 A;  4F9U A;  3JRU A;  4MHY A;  5LRJ A;  2DEA A;  3WC7 A;  3FF3 A;  2HC9 A;  2BCO A;  4MRI A;  3SJX A;  4MMO A;  5LYD A;  5JGF A;  4A94 A;  1QQ9 A;  3KHX A;  4B6Z A;  2C6P A;  4MHN A;  4OIW A;  2Q43 A;  2PJ0 A;  5HVF A;  4MCQ A;  1BPN A;  3FED A;  4DUK A;  4AXV A;  4KSI A;  2PJ1 A;  3S9N A; 
#chains in the Genus database with same CATH topology
 1H8L A;  2ZEE A;  4P4D A;  4IHM A;  5DWM A;  4C2X A;  1FY7 A;  4EVY A;  5J8F A;  4H6Z A;  4NF1 A;  2FIW A;  2XEG A;  1Y7R A;  3K9T A;  3ZZI A;  4UCP A;  1CP7 A;  3B3V A;  1HDU A;  2Q7S A;  4A33 A;  1Z2L A;  2V8D A;  1TKH A;  1Y9W A;  2PCU A;  2PSW A;  1Q7L A;  1Y7E A;  1YQE A;  4HNW B;  4P4B A;  4Y49 B;  4CRY B;  1BAV A;  4J3G A;  1S7N A;  4KVM E;  4UBR A;  4PK2 A;  4KSA A;  4GM5 A;  4UEZ A;  2CNM A;  4P10 A;  4MJ8 A;  2F8H A;  5KTC A;  5EMI A;  4AG7 A;  2NYQ A;  3C26 A;  5ISV A;  4R76 A;  5CNP A;  2OZH A;  3EO4 A;  3IJ3 A;  4L8A A;  1OBR A;  4NGQ A;  4NGS A;  4PXD A;  2G9D A;  1ELL P;  3DDD A;  4R3K A;  3PRT A;  4NGP A;  1PU9 A;  4KLV A;  4P44 A;  2JBJ A;  2P0W A;  4NJQ A;  4ORF A;  3SJF A;  4CGM A;  4KS9 A;  3HLP A;  3A9L A;  1JWQ A;  3FMC A;  3VAR A;  4A38 A;  2V8V A;  1Z8X A;  4M6H A;  5LYF A;  4G1P A;  1YK3 A;  3EY5 A;  4MCR A;  1PYT B;  4NGN A;  4CYN A;  4FD5 A;  2ZEH A;  2GAN A;  1XJO A;  2CY2 A;  4R3L A;  1KUX A;  1YLO A;  4UEE A;  2ZEO A;  3R9F A;  1S7F A;  2IL4 A;  2EK9 A;  5JH9 A;  2Q4Z A;  1A2Z A;  1F2O A;  3QNV A;  5IV0 A;  4UFV A;  2ZW6 A;  3PB4 X;  3T9Y A;  2VBQ A;  3NFZ A;  3DLJ A;  3BXM A;  4ZGY B;  2B3U A;  3R9E A;  3B7I A;  4E8O A;  5JPH A;  4AVC A;  1K4J A;  4ZY1 A;  1IY7 A;  2X7B A;  4ZY0 A;  3KZW A;  3LMS A;  2Y0M A;  2ZEL A;  2EUI A;  2OR4 A;  4MI4 A;  4E0A A;  2FCK A;  3G3S A;  3RBU A;  1Z8W A;  4OC2 A;  4LX9 A;  3L2N A;  3S6G A;  4JYW A;  2K5T A;  4XNH C;  2Z3N A;  4UFW A;  2ANP A;  5CPA A;  1LCP A;  4OC3 A;  3KGQ A;  5E96 A;  3PB8 X;  1Z9U A;  2PJ9 A;  2Q04 A;  1QMU A;  4X5K A;  5CBM A;  5H84 A;  1X10 A;  1FT7 A;  4F9V A;  4JWP A;  3KHZ A;  3BLN A;  4L89 A;  1TF9 A;  3SJE A;  3K2K A;  4B13 A;  3CXP A;  2ZW4 A;  3KQZ A;  4PXB A;  1CX8 A;  4BD9 A;  1BO4 A;  5HMN A;  4M3S A;  1L0C A;  4U5Y A;  1ARM A;  4ZX8 A;  2YNE A;  4MFK A;  4K30 A;  4A2Z A;  1XRY A;  4RI1 A;  2J9A A;  3I1U A;  3TE4 A;  1I1D A;  3TO6 A;  2V77 A;  1P4N A;  3WAB A;  4MY0 A;  4FWU A;  5AGE A;  1SQH A;  3BJ7 A;  3SI0 A;  2BOA A;  2H5M A;  2QIR A;  3FIX A;  4PXC A;  4A32 A;  2FE7 A;  3EFA A;  4P4I A;  3KL9 A;  4ZI6 A;  1RXT A;  1M1D A;  2HUZ A;  2Q7B A;  1Y0R A;  2Z3O A;  4IAV A;  1YLE A;  4A95 A;  2PJB A;  3R96 A;  4NGT A;  5LRK A;  1CM0 A;  2PJ5 A;  1YRE A;  1X12 A;  5LYI A;  2QJ8 A;  2I00 A;  1NE9 A;  2FL4 A;  2DPT A;  4AVA A;  1CBX A;  3V7Z A;  1B87 A;  1F57 A;  2CXA A;  2F7V A;  3PFO A;  3GIU A;  5KTA A;  3NH5 A;  5KTD A;  3SI1 A;  1HEE A;  2Z3M A;  3OWC A;  3PEI A;  4F0X A;  2GFQ A;  4OP4 A;  3BI1 A;  4RN7 A;  4Q36 A;  3V8I A;  1XEB A;  2VZZ A;  1TF8 A;  4XNH B;  2XEI A;  3VWE A;  7CPA A;  4DJL A;  3PB6 X;  4QBJ A;  3B8G A;  4QUS A;  3WC6 A;  1CP6 A;  2PJA A;  3S6F A;  2C27 A;  1QSR A;  2AFW A;  2CTB A;  2ZEP A;  3IGR A;  4KZT A;  2DF5 A;  3B3C A;  3FNC A;  5HVG A;  3ZJ0 A;  4B12 A;  4A39 A;  5J1Q A;  5A27 A;  5AG6 A;  1YVK A;  3DSB A;  2G0B A;  2VZY A;  3IO1 A;  3LD2 A;  4NCZ A;  4P4F A;  4PQA A;  4DNC A;  5IX3 A;  5IB0 A;  4C7I A;  5K8O A;  2Z0Z A;  1ZO0 A;  2AFS A;  1IID A;  3NE8 A;  4KOX A;  1N71 A;  1YW6 A;  3HUV A;  1IU8 A;  2AFM A;  3D2P A;  1V0C A;  4JXQ A;  2NMT A;  5G21 A;  5GCN A;  4FUU A;  2QEC A;  4I49 A;  5HVH A;  4UA3 A;  3I9S A;  3RAM A;  4KOS A;  4JZ0 A;  3RZA A;  3KI9 A;  3SXO A;  1Z8T A;  1CG2 A;  1AMP A;  4YGO A;  1NMT A;  3TCV A;  1WK4 A;  2J8M A;  3PBE A;  2WPX A;  1VKC A;  4H89 A;  3T8W A;  2D4O A;  3TO7 A;  2PRQ A;  2V8G A;  2OZG A;  1AYE A;  2CNS A;  3D4U A;  1Z4R A;  1NSL A;  4E2A A;  3F8K A;  2R1I A;  2PVW A;  4LQG A;  2I79 A;  3D3S A;  5A28 A;  4OAD A;  1U6M A;  2I3C A;  1IGB A;  2J8R A;  4K3N A;  4B10 A;  4JXR A;  4P4E A;  2QVP A;  4NXY A;  3EC4 A;  2WSA A;  3ISX A;  4C2Y A;  4YFJ A;  3NE7 A;  4LUA A;  2EVN A;  4M85 A;  5HH1 A;  3R95 A;  2GLF A;  2WYR A;  2B4D A;  3FB3 A;  3D66 A;  4PK3 A;  2ZEM A;  4KOY A;  1S7K A;  3ISZ A;  4IK2 A;  4UEF A;  3SI2 A;  2PC1 A;  1IIC A;  1ON0 A;  2B5G A;  3TOB A;  2BO9 A;  1KUY A;  4P6Y A;  5D8N A;  1LAN A;  1ZG9 A;  2Q0Y A;  2OU2 A;  2YGW A;  3WR7 A;  3TX8 A;  2PJC A;  4KVO E;  2FS5 A;  1KUV A;  4NGM A;  3PFE A;  3KKW A;  4JJX A;  5I4M A;  1ZLH A;  4CRZ B;  2PQ8 A;  2G3T A;  3G8W A;  3IEH A;  3MN8 A;  5HXD A;  4YU9 A;  3IWE A;  4MFL A;  1IB1 E;  1LRZ A;  5J8C A;  1IYL A;  1KZF A;  3CDX A;  3W6X A;  4OC5 A;  2BUE A;  2PR8 A;  3S6H A;  4R87 A;  5G20 A;  4A30 A;  1MJB A;  5F49 A;  4QVT A;  4OKO A;  3UY5 A;  3IWG A;  3PBB A;  4XPL A;  4BBH A;  2IJZ A;  2PE3 A;  2Z10 A;  4KOW A;  1TXR A;  4KOR A;  3H5Z A;  1CPS A;  2ZEF A;  1XF8 A;  1ZG7 A;  2VEZ A;  5I0C A;  1TKF A;  2JLM A;  3D7H A;  4ZBG A;  4CGO A;  4KUB A;  2AFZ A;  4CYO A;  3FRM A;  2ABZ A;  2BL1 A;  3PZJ A;  3TC8 A;  3S9M A;  5G1Z A;  2PJ4 A;  2PJ3 A;  4H6U A;  4U9Z A;  4WJB A;  2JBK A;  3FVL A;  4F6A A;  3D7F A;  2YNC A;  2HB6 A;  3B2Y A;  3DNS A;  2GU2 A;  4UIB A;  4TWE A;  4B11 A;  1XBU A;  2EBJ A;  2YNC C;  3N7Z A;  2R98 A;  1IOI A;  1TKJ A;  3S9L A;  2YND A;  3LAC A;  2FXF A;  2FT0 A;  3JVN A;  4IUS A;  4P45 A;  4F8Z A;  4OLL A;  3FBU A;  2OOT A;  2PJ8 A;  4B5P A;  2A4N A;  2O4H A;  3CXS A;  2BEI A;  2FIA A;  2RFH A;  3CT9 A;  4PPZ A;  1LOK A;  4Q38 A;  2F5I A;  3FX6 A;  4U9Y A;  4ONU A;  3GKR A;  1CPX A;  4BIN A;  2QYV A;  3FEC A;  5AG4 A;  4X3R A;  2C1C A;  2Q4Y A;  1YX0 A;  2ZPA A;  1YME A;  2KCW A;  3F0A A;  2CIJ A;  2POK A;  2AJ6 A;  1XE4 A;  2FSR A;  2WZN A;  3RO0 A;  2HQY A;  2OH1 A;  2ATR A;  2QML A;  4YWY A;  4EME A;  1HDQ A;  4GXH A;  4RS2 A;  4CAF A;  2VI7 A;  3QAY A;  4TNU A;  4OC1 A;  3H8E A;  1S7L A;  1R57 A;  2REE A;  2ZW5 A;  3KR4 A;  1WWZ A;  2GLJ A;  1ELM P;  1Q2D A;  1RTQ A;  2VXK A;  4P4J A;  3TFY A;  1M4L A;  2R7H A;  1M4I A;  3TOA A;  2VL1 A;  4EFD A;  5LRG A;  4R8F A;  5G22 A;  3D2M A;  2GE3 A;  2P6E A;  5LYL A;  4UWJ A;  3SXN A;  4HKF A;  2R8V A;  3LOD A;  2B4B A;  3CXQ A;  5IB9 A;  2AFU A;  2NSM A;  2OZU A;  1BPM A;  3H8G A;  3PB9 X;  1VGY A;  3IC1 A;  2CTC A;  4HPS A;  4OC0 A;  3D7D A;  4C68 A;  3K9U A;  2PJ6 A;  3QAH A;  5DS0 A;  3SHP A;  3VH9 A;  4EWT A;  4A37 A;  3WC5 A;  2PRB A;  3IIB A;  6CPA A;  2PVV A;  3IWW A;  4MFJ A;  1B6B A;  2B3V A;  2ZEN A;  2CF4 A;  5AG7 A;  3FEE A;  2O28 A;  3D7G A;  2IQ6 A;  4R57 A;  3R9G A;  4B5P B;  2EWB A;  5H86 A;  4H2K A;  5BWA B;  5C88 A;  4QB9 A;  3IFE A;  2Q4V A;  2GIV A;  4NSQ A;  1Y0Y A;  2IMO A;  3NA6 A;  1MK4 A;  1XMT A;  1VHS A;  3GY9 A;  3B3S A;  4UCM A;  4UIA A;  4NJR A;  3NH4 A;  4C7H A;  5F46 A;  4AG9 A;  3D67 A;  4JD6 A;  4ZX9 A;  2PIY A;  4R7M A;  3VAT A;  2V8H A;  3EXN A;  2DPS A;  3LWU A;  4UF4 A;  3E0K A;  2ZOG A;  1XIX A;  4XPD C;  2ZXV A;  1Z8L A;  4CGL A;  1UWY A;  4AB7 A;  1IOF A;  1M4D A;  4MFQ A;  4MCS A;  2P6G A;  2Q44 A;  2PJ7 A;  3S6K A;  5AG5 A;  5F09 A;  1LAP A;  1M44 A;  5K8P A;  3P2F A;  1P0H A;  2WUU A;  8CPA A;  1QSN A;  1FNO A;  4MFP A;  4FAI A;  3D68 A;  1Q2Y A;  3FH4 A;  1XMB A;  5K8N A;  4WWV A;  1PCA A;  2CNT A;  3GUX A;  5DWN A;  3JUW A;  4W9Y A;  2J8N A;  4PXE A;  4MCP A;  4OC4 A;  2PJ2 A;  4X8I A;  2JEW A;  1OZP A;  4UCN A;  1GYT A;  2D4P A;  3N5F A;  4XPK A;  1BLL E;  4FD7 A;  1S5K A;  2EK8 A;  3KQX A;  4FBE A;  3FJU A;  3FXT A;  5THW A;  2AFX A;  1LAM A;  1R3N A;  2REF A;  3KR5 A;  1RO5 A;  1R43 A;  4MBU A;  4KOU A;  4KOV A;  4M6I A;  1YGH A;  3CPX A;  4CPA A;  2RB7 A;  4ZY2 A;  4GS4 A;  3PP9 A;  1QST A;  4UFX A;  3SJG A;  3W6S A;  1S60 A;  2ZOF A;  4KOT A;  1ARL A;  1Y9K A;  3B3T A;  3BI0 A;  5C82 A;  1BOB A;  2AFO A;  2B58 A;  4CGP A;  3BJ8 A;  4C2Z A;  2AE6 A;  4CAV A;  4CAW A;  1GHE A;  1XFO A;  4RUH A;  5JQ4 A;  1CJW A;  2DXQ A;  4KUA A;  4MHD A;  4PSW A;  1MJA A;  2XEF A;  1VHO A;  3MRU A;  1TIQ A;  4JLY A;  1YR0 A;  2FVG A;  3I3G A;  3QB8 A;  1VIX A;  4OID A;  2ARH A;  3GB0 A;  5K8M A;  2EO8 A;  2ZEG A;  4XPD B;  1F2P A;  1DE4 C;  4Q7A A;  4HNX B;  3RYO A;  4AVB A;  3FYN A;  4KVX A;  4MY3 A;  4CYQ A;  1ZG8 A;  1S3Z A;  1Z5R A;  4MHZ A;  4O23 A;  2RC4 A;  2Z11 A;  1DTD A;  4B5O A;  2Z3K A;  3CPA A;  4CAE A;  1YW4 A;  2JDC A;  2PIZ A;  2XEJ A;  2C6G A;  4UWI A;  3MGD A;  4NGR A;  3TT2 A;  3B3W A;  3DR8 A;  4NEX A;  2B4D B;  3GLJ A;  4NFR A;  3JTK A;  3WT4 A;  2B5G B;  2ZED A;  3IU2 A;  4HNY B;  1PUA A;  4R9M A;  5EC4 A;  4B14 A;  1XOV A;  4ONW A;  3CZX A;  3NH8 A;  2VQY A;  5JM6 A;  4MXU A;  4Z65 A;  3H8F A;  1EE3 P;  4QC6 A;  1LFW A;  3D8P A;  4MHP A;  5EBV A;  3TO9 A;  2P6F A;  1ZLI A;  2O53 A;  4FD4 A;  4KSF A;  2Z3P A;  2GRE A;  1KWM A;  1QSM A;  1VHE A;  3DGV A;  4R6T A;  4CYP A;  1JQG A;  3V38 A;  2PR1 A;  1NSA A;  4ZYQ A;  2C6C A;  4CGN A;  4Y49 C;  1QSO A;  3PB7 X;  2Q51 A;  1YVO A;  3IU1 A;  3P2H A;  4OME A;  5D29 A;  4DYO A;  3BHX A;  1AUG A;  2G3A A;  4IF5 A;  4OAE A;  3KAS A;  4CAX A;  3TTH A;  4X2T A;  4FD6 A;  1YSJ A;  5ELY A;  1MJ9 A;  1Q2C A;  1UFH A;  2ZW7 A;  3B35 A;  4KLW A;  4F9U A;  3JRU A;  3DR6 A;  4LQ6 A;  4MHY A;  5LRJ A;  3RNZ A;  2JEV A;  2DEA A;  3VWD A;  1J4J A;  4PSX A;  5F47 A;  3WC7 A;  4A31 A;  2ODF A;  3FF3 A;  4YRH A;  3W91 A;  3GYA A;  4MFZ A;  3F5B A;  2HC9 A;  4BMH A;  1I21 A;  1IYK A;  2BCO A;  4MRI A;  4II9 A;  2HV2 A;  4MMO A;  1I12 A;  2Z3L A;  4PV6 A;  3SJX A;  5LYD A;  4CS0 B;  2BSW A;  4F0Y A;  2JDD A;  5JGF A;  4A94 A;  1QQ9 A;  3KHX A;  2OB0 A;  1Z4E A;  2C6P A;  2WPW A;  4M6G A;  5F48 A;  4B6Z A;  4MHN A;  3R1K A;  4OIW A;  2Q43 A;  3T90 A;  2PJ0 A;  5HVF A;  4MCQ A;  2PDO A;  5FVJ A;  1BPN A;  3FED A;  4DUK A;  3H4Q A;  1M4G A;  4AXV A;  4KSI A;  3PGP A;  2PJ1 A;  3S9N A; 
#chains in the Genus database with same CATH homology
 1H8L A;  2ZEE A;  4P4D A;  4IHM A;  2XEG A;  3K9T A;  1CP7 A;  3B3V A;  1HDU A;  1Z2L A;  2V8D A;  1TKH A;  2PCU A;  4P4B A;  1Q7L A;  1Y7E A;  1BAV A;  4GM5 A;  4UEZ A;  4P10 A;  2F8H A;  2NYQ A;  4R76 A;  3IJ3 A;  1OBR A;  4NGQ A;  4NGS A;  4PXD A;  2G9D A;  1ELL P;  3PRT A;  4NGP A;  4P44 A;  2JBJ A;  4NJQ A;  3SJF A;  3HLP A;  3FMC A;  3VAR A;  4A38 A;  2V8V A;  5LYF A;  4G1P A;  4MCR A;  1PYT B;  4NGN A;  2ZEH A;  1XJO A;  1YLO A;  4UEE A;  2ZEO A;  5JH9 A;  2EK9 A;  2Q4Z A;  1F2O A;  3QNV A;  3PB4 X;  3NFZ A;  3DLJ A;  3BXM A;  3B7I A;  4ZY1 A;  1IY7 A;  4ZY0 A;  3KZW A;  3LMS A;  2ZEL A;  2OR4 A;  3RBU A;  4OC2 A;  3L2N A;  4JYW A;  5CPA A;  2ANP A;  1LCP A;  4OC3 A;  3KGQ A;  3PB8 X;  2PJ9 A;  1QMU A;  5CBM A;  4F9V A;  1FT7 A;  3KHZ A;  1TF9 A;  3SJE A;  3K2K A;  3KQZ A;  4PXB A;  1CX8 A;  4BD9 A;  1ARM A;  4ZX8 A;  1XRY A;  2J9A A;  3I1U A;  2V77 A;  3WAB A;  4FWU A;  3SI0 A;  2BOA A;  4PXC A;  4P4I A;  3KL9 A;  4ZI6 A;  1Y0R A;  4IAV A;  2PJB A;  4NGT A;  5LRK A;  2PJ5 A;  5LYI A;  2QJ8 A;  1CBX A;  3V7Z A;  1F57 A;  2F7V A;  3PFO A;  3NH5 A;  3SI1 A;  1HEE A;  3PEI A;  4OP4 A;  3BI1 A;  1TF8 A;  2XEI A;  7CPA A;  4DJL A;  3PB6 X;  3WC6 A;  1CP6 A;  2PJA A;  2CTB A;  2AFW A;  2ZEP A;  3B3C A;  5HVG A;  4A39 A;  5J1Q A;  4PQA A;  3IO1 A;  4P4F A;  5K8O A;  2AFS A;  1YW6 A;  3HUV A;  2AFM A;  4FUU A;  5HVH A;  3RAM A;  3RZA A;  4JZ0 A;  3KI9 A;  1CG2 A;  1AMP A;  3PBE A;  3T8W A;  2PRQ A;  2V8G A;  1AYE A;  3D4U A;  2PVW A;  4LQG A;  2I3C A;  1IGB A;  4K3N A;  4P4E A;  2QVP A;  3ISX A;  2GLF A;  2WYR A;  3D66 A;  2ZEM A;  4UEF A;  3ISZ A;  4IK2 A;  3SI2 A;  2BO9 A;  4P6Y A;  5D8N A;  1LAN A;  1ZG9 A;  3TX8 A;  2PJC A;  4NGM A;  3PFE A;  5I4M A;  1ZLH A;  3IEH A;  3MN8 A;  5HXD A;  4YU9 A;  3CDX A;  4OC5 A;  4OKO A;  3PBB A;  2IJZ A;  2PE3 A;  1TXR A;  1CPS A;  2ZEF A;  1ZG7 A;  1TKF A;  3D7H A;  2AFZ A;  2ABZ A;  3TC8 A;  3S9M A;  2PJ4 A;  2PJ3 A;  4WJB A;  2JBK A;  3FVL A;  3D7F A;  3B2Y A;  2HB6 A;  4TWE A;  4UIB A;  2GU2 A;  1XBU A;  1TKJ A;  3S9L A;  4P45 A;  4F8Z A;  2OOT A;  2PJ8 A;  2O4H A;  2RFH A;  3CT9 A;  4PPZ A;  1LOK A;  3FX6 A;  1CPX A;  2QYV A;  3FEC A;  4X3R A;  2C1C A;  1YME A;  2CIJ A;  2POK A;  2WZN A;  4EME A;  4YWY A;  1HDQ A;  4TNU A;  4OC1 A;  3H8E A;  3KR4 A;  4P4J A;  2GLJ A;  1ELM P;  1RTQ A;  1M4L A;  4EFD A;  2VL1 A;  5LRG A;  4R8F A;  5LYL A;  5IB9 A;  2AFU A;  2NSM A;  1BPM A;  3H8G A;  3PB9 X;  1VGY A;  3IC1 A;  2CTC A;  4OC0 A;  3D7D A;  2PJ6 A;  5DS0 A;  3VH9 A;  4EWT A;  4A37 A;  3WC5 A;  3IIB A;  6CPA A;  2PVV A;  3IWW A;  2ZEN A;  2CF4 A;  3FEE A;  3D7G A;  2IQ6 A;  2EWB A;  4H2K A;  3IFE A;  1Y0Y A;  2IMO A;  3NA6 A;  4UIA A;  3B3S A;  4NJR A;  3NH4 A;  3D67 A;  4ZX9 A;  2PIY A;  4R7M A;  3VAT A;  2V8H A;  3LWU A;  4UF4 A;  2ZOG A;  1Z8L A;  1UWY A;  4MCS A;  2PJ7 A;  5F09 A;  1LAP A;  5K8P A;  8CPA A;  1FNO A;  4FAI A;  3D68 A;  3FH4 A;  5K8N A;  1XMB A;  4WWV A;  1PCA A;  3GUX A;  4W9Y A;  4PXE A;  4MCP A;  4OC4 A;  2PJ2 A;  4X8I A;  2JEW A;  1GYT A;  3N5F A;  1BLL E;  2EK8 A;  3KQX A;  4FBE A;  3FJU A;  5THW A;  2AFX A;  1LAM A;  1R3N A;  3KR5 A;  1R43 A;  4CPA A;  3CPX A;  2RB7 A;  4ZY2 A;  3SJG A;  2ZOF A;  1ARL A;  3B3T A;  3BI0 A;  2AFO A;  1XFO A;  4RUH A;  2XEF A;  1VHO A;  3MRU A;  2FVG A;  1VIX A;  4OID A;  3GB0 A;  5K8M A;  2ZEG A;  1F2P A;  1DE4 C;  4Q7A A;  1ZG8 A;  1Z5R A;  4O23 A;  4MHZ A;  1DTD A;  3CPA A;  1YW4 A;  2PIZ A;  2XEJ A;  2C6G A;  4NGR A;  3B3W A;  3GLJ A;  4NFR A;  3WT4 A;  2ZED A;  4ONW A;  5JM6 A;  3NH8 A;  4MXU A;  4Z65 A;  3H8F A;  1EE3 P;  1LFW A;  4MHP A;  1ZLI A;  2O53 A;  2GRE A;  1KWM A;  3DGV A;  1VHE A;  4R6T A;  1JQG A;  3V38 A;  1NSA A;  4ZYQ A;  2C6C A;  3PB7 X;  4OME A;  2Q51 A;  4DYO A;  5D29 A;  3BHX A;  3KAS A;  4X2T A;  1YSJ A;  5ELY A;  3B35 A;  4F9U A;  3JRU A;  4MHY A;  5LRJ A;  2DEA A;  3WC7 A;  3FF3 A;  2HC9 A;  2BCO A;  4MRI A;  3SJX A;  4MMO A;  5LYD A;  5JGF A;  4A94 A;  1QQ9 A;  3KHX A;  4B6Z A;  2C6P A;  4MHN A;  4OIW A;  2Q43 A;  2PJ0 A;  5HVF A;  4MCQ A;  1BPN A;  3FED A;  4DUK A;  4AXV A;  4KSI A;  2PJ1 A;  3S9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...