2QVPA

Crystal structure of a putative metallopeptidase (sama_0725) from shewanella amazonensis sb2b at 2.00 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
266
structure length
266
Chain Sequence
QTFVWRSEIFECQSTDIQRFYSLLAIETERLGLGSKILGQAGHHPLYLLQSPGQKAGLPNLLISAGFHGEESAGPWGLLHFLSQLDGELFKRVNLSVLPLVNPTGFAKGHRFNELGENPNRGFFIENGKAKPGADTSAEGRILLEHAHLLQVASRDGILTCHEDVLMTDTYVYTFEPSQAPGRFSHSLRDALGQYFPIAADGDVDNCPVRSGVIFNHFDTSFESFLVRSGARVGCCSETPGQQPLDQRILANAAAMNTFVNMLAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_926603.1) from Shewanella amazonensis SB2B at 2.00 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Hydrolase
total genus 85
structure length 266
sequence length 266
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2qvpA00
1M4LA 4NFRA 1Z5RA 5CBMA 5I4MA 3IFEA 2AFWA 4OC2A 5K8NA 3PBEA 4FAIA 5HVHA 2PJBA 1FNOA 5ELYA 1YW4A 4UIAA 1F57A 1TKFA 3KQZA 1DE4C 4P4JA 2C1CA 2ABZA 4JYWA 4ZY1A 2NSMA 5D29A 1LAPA 2ZOFA 4DYOA 5HXDA 2AFXA 2RB7A 2IMOA 2V8HA 4R7MA 2ANPA 2ZELA 3IO1A 3RZAA 4P6YA 2FVGA 5K8OA 4PXDA 3B35A 2PRQA 1QMUA 2PJ7A 3GLJA 4MXUA 2O4HA 2RFHA 3TC8A 4NGRA 4UIBA 4PPZA 2AFMA 2AFUA 4YWYA 8CPAA 1Y0YA 1TKHA 2QVPA 2ZEPA 4ONWA 4OC1A 4MCSA 3TX8A 3B3TA 3B2YA 4PXBA 1TXRA 2GREA 2ZEFA 3JRUA 4X2TA 3K9TA 4RUHA 2XEGA 1IGBA 2G9DA 2AFOA 3SJGA 2GLFA 3IWWA 3D68A 1BLLE 2PIYA 1YW6A 3WC6A 4MCQA 2XEIA 1HDUA 4EWTA 2QYVA 2CTBA 3KHZA 3KI9A 3PRTA 1R43A 5LYDA 2EK9A 5DS0A 3CDXA 3H8GA 2C6PA 2JBJA 2O53A 3D7FA 4ZI6A 5HVGA 2Q43A 3D67A 4DJLA 1IY7A 4F9UA 3VATA 4NJQA 1NSAA 1VIXA 6CPAA 2EWBA 2F8HA 2XEJA 3KASA 1LANA 3H8FA 4Q7AA 5K8MA 5LYLA 4NJRA 4UF4A 4P10A 1ZLIA 3LMSA 3SI1A 3ISXA 3FEEA 4NGNA 4P4FA 4ZX9A 4NGTA 1BAVA 4PXCA 3NFZA 4MHPA 1H8LA 3SJEA 3BHXA 3D66A 4WJBA 2WZNA 4FBEA 3PB7X 4OC5A 4MCRA 4R76A 4IK2A 2Q4ZA 1R3NA 3SJXA 3FVLA 4MCPA 4O23A 1HDQA 5JM6A 4A39A 1Y7EA 4AXVA 1CPSA 3ISZA 4P4EA 4OP4A 7CPAA 4BD9A 3T8WA 3FX6A 4X8IA 5LYIA 3NH4A 1LOKA 5CPAA 4Z65A 3KQXA 1CX8A 3B7IA 2ZEEA 4IAVA 3PB8X 4A38A 1LAMA 4IHMA 3PFOA 2IQ6A 3D7DA 3N5FA 5JH9A 4R8FA 3IIBA 3LWUA 3BI1A 1XBUA 2V8GA 2DEAA 1LCPA 2Q51A 1CG2A 4P4IA 3QNVA 3SJFA 4TNUA 4MMOA 2AFSA 3RAMA 3V7ZA 3PFEA 2CIJA 1Z2LA 4OKOA 3FECA 1ZG7A 3D7GA 3D7HA 4YU9A 1ZG9A 1GYTA 2C6GA 4UEZA 4DUKA 2PJ5A 4H2KA 1CPXA 1XRYA 2ZOGA 4TWEA 2V8DA 3DLJA 1LFWA 3B3SA 1DTDA 1Y0RA 4EMEA 2V77A 2GLJA 3CPXA 4OMEA 2WYRA 3BXMA 3B3VA 3GB0A 3KR5A 3HUVA 4K3NA 1BPMA 1ARMA 1AYEA 3IJ3A 3PEIA 2NYQA 3KGQA 4B6ZA 1VGYA 3MRUA 1Q7LA 2PE3A 4F9VA 3KHXA 3H8EA 3MN8A 2HB6A 1XFOA 4W9YA 3FMCA 2PJ8A 5F09A 2XEFA 1F2PA 2HC9A 3GUXA 2ZEDA 1YLOA 2OOTA 4FUUA 4P45A 1PYTB 3S9LA 2PIZA 4OC3A 3PB9X 5LRJA 1UWYA 4ZY2A 1ELLP 2F7VA 4MRIA 1XMBA 2EK8A 4F8ZA 5THWA 3WC7A 3FJUA 5LYFA 1OBRA 3WABA 4FWUA 2ZENA 4PQAA 4NGQA 4R6TA 3L2NA 4ZYQA 4P4DA 5D8NA 2VL1A 4NGSA 3B3CA 5J1QA 2PJ1A 1CP7A 1YSJA 3KZWA 3CT9A 3PB4X 3B3WA 5JGFA 3VARA 2PJ9A 3RBUA 2QJ8A 4A94A 3PB6X 2J9AA 4X3RA 1CBXA 3V38A 2PJ0A 1VHOA 3S9NA 4LQGA 2PJCA 3D4UA 1Z8LA 4MHNA 1TKJA 1ZG8A 2ZEOA 4NGPA 2CF4A 1XJOA 3NH8A 1ELMP 1TF8A 3FF3A 4MHZA 4EFDA 1QQ9A 3SI2A 2PVVA 2JBKA 2POKA 2BO9A 3S9MA 3FH4A 4A37A 2ZEGA 1VHEA 2OR4A 4ZY0A 4ZX8A 1YMEA 4OC4A 3K2KA 1BPNA 2BCOA 3KL9A 4JZ0A 3BI0A 3IC1A 3VH9A 1JQGA 1FT7A 4KSIA 2PVWA 5IB9A 4P4BA 3KR4A 1ARLA 1AMPA 5LRGA 2PJ3A 3I1UA 1CP6A 4P44A 5LRKA 2PJ6A 3CPAA 4PXEA 3IEHA 1ZLHA 2PJ4A 1KWMA 2ZEMA 2BOAA 4GM5A 3SI0A 1PCAA 4OIDA 4NGMA 4WWVA 5K8PA 3HLPA 1HEEA 2JEWA 2PJAA 2ZEHA 1EE3P 4G1PA 4UEFA 1RTQA 3FEDA 2V8VA 2IJZA 4MHYA 3WC5A 2PJ2A 3WT4A 5HVFA 1F2OA 4CPAA 2C6CA 2CTCA 2GU2A 2PCUA 4OIWA 3DGVA 4OC0A 3NA6A 3PBBA 1TF9A 4UEEA 2I3CA 3NH5A 2AFZA
chains in the Genus database with same CATH superfamily
3TOBA 4KZTA 1M4LA 2Q44A 4NFRA 2WUUA 2B4DB 1L0CA 1Z5RA 5CBMA 5I4MA 3IFEA 2AFWA 4NCZA 2DPSA 4OC2A 4KOSA 1PUAA 4ZGYB 5K8NA 5EMIA 1VKCA 3PBEA 2R7HA 1M44A 4FAIA 2PJBA 1Z8WA 1FNOA 1YR0A 4KVOE 1M4DA 5ELYA 5HVHA 1YW4A 1K4JA 4UIAA 3R96A 1F57A 4DNCA 1TKFA 4GS4A 4R87A 3KQZA 1DE4C 5IB0A 4XPDB 3RO0A 5I0CA 4P4JA 2OU2A 2C1CA 5AGEA 4PV6A 2ABZA 4JYWA 1Y9WA 4CRYB 4ZY1A 2NSMA 5D29A 4UFVA 3V8IA 1LAPA 2IL4A 2ZOFA 4DYOA 1S3ZA 3H4QA 1RXTA 4ORFA 5HXDA 2AFXA 2RB7A 2IMOA 4KOXA 2V8HA 4KS9A 4R7MA 2ANPA 2ZELA 4PSXA 5F48A 2EUIA 3IO1A 2Z10A 4IUSA 3RZAA 4P6YA 1YREA 3FRMA 2FVGA 5K8OA 4PXDA 3I9SA 1IOIA 1S7LA 4AVBA 2CNTA 4R3LA 3B35A 2PRQA 3PGPA 1QMUA 2PJ7A 1XOVA 2G3AA 3GLJA 4MXUA 2CNMA 2O4HA 2RFHA 1IB1E 1QSTA 3TC8A 4MFLA 3TOAA 1Z8XA 4Q36A 4AVAA 1Z8TA 4YFJA 4NGRA 4UIBA 4PPZA 2AFMA 2AFUA 4YWYA 8CPAA 1Y0YA 1TKHA 2OH1A 2QVPA 1P4NA 2ZEPA 4H6ZA 4ONWA 2OZGA 2OZUA 4OC1A 5EBVA 1M4IA 1PU9A 2GE3A 5H86A 4KOTA 3F8KA 4MFQA 4MCSA 3TX8A 3W6XA 3FXTA 3A9LA 3B3TA 4XNHB 5EC4A 2GANA 3B2YA 4UWJA 4PXBA 1TXRA 2J8RA 2GREA 2ZEFA 3JRUA 4X2TA 3K9TA 4RUHA 2XEGA 3QB8A 1IGBA 2G9DA 2ARHA 2YNDA 2J8MA 3IWEA 2WSAA 2AFOA 4YGOA 1Q2CA 4KVME 3SJGA 2GLFA 3IWWA 3D68A 4QUSA 1BLLE 3IU1A 4L89A 2PIYA 2ODFA 1YW6A 3WC6A 4AG9A 4MCQA 4C2XA 2XEIA 3D2PA 4C7HA 1HDUA 2PQ8A 3FBUA 5J8FA 3D8PA 3D3SA 4EWTA 2QYVA 2CTBA 1BOBA 3KHZA 3KI9A 5JPHA 3PRTA 1R43A 5LYDA 2EK9A 5DS0A 3CDXA 3H8GA 2C6PA 2JBJA 2O53A 3D7FA 4UCNA 4UBRA 4ZI6A 2Q43A 3D67A 5HH1A 1WWZA 3TO7A 5HVGA 4ONUA 4DJLA 4B11A 2B4DA 4GXHA 3BJ7A 1IY7A 2B3VA 2FE7A 2ZW4A 4F9UA 3VATA 4NJQA 1VIXA 1NSAA 4JWPA 4NXYA 6CPAA 2EBJA 1GHEA 4UCMA 5G20A 4HNWB 5F46A 2EWBA 2F8HA 4B5PB 2PRBA 2XEJA 2I79A 3KASA 5DWMA 2VEZA 3SHPA 4AVCA 1LANA 3WR7A 4CAWA 1P0HA 3CXQA 3H8FA 4Q7AA 5K8MA 1VHSA 4KSFA 4NJRA 5LYLA 1I21A 4UF4A 3R9EA 3OWCA 4P10A 4R3KA 5E96A 1ZLIA 3LMSA 3SI1A 3GKRA 2FCKA 2P6EA 3ISXA 3FEEA 4NGNA 4P4FA 4KSAA 3FYNA 4ZX9A 4NGTA 3ZJ0A 4B10A 4KOVA 1BAVA 4PXCA 3NFZA 3EO4A 4MHPA 1H8LA 2Q0YA 5G21A 3SJEA 3BHXA 2VXKA 3FB3A 3D66A 1IYKA 4WJBA 1B6BA 2DPTA 2WZNA 4MBUA 4FBEA 1Z4EA 3PB7X 1Z4RA 2FSRA 4OC5A 3VWDA 2H5MA 1CM0A 3BJ8A 4MCRA 4LUAA 1YGHA 2D4OA 4R76A 2DF5A 5F49A 4IK2A 2ATRA 2Q4ZA 1R3NA 3SJXA 3EXNA 3FVLA 4OLLA 4MCPA 3EFAA 4O23A 4A2ZA 1HDQA 4KOUA 2CXAA 3NE8A 3SXOA 5JM6A 3FNCA 4A39A 4Q38A 4C68A 1Y7EA 4XPKA 1IIDA 4AXVA 5BWAB 4MI4A 4BINA 1CPSA 2GIVA 2KCWA 3ISZA 4P4EA 2B5GA 2Z3OA 4OP4A 7CPAA 4X5KA 4BD9A 3T8WA 1OZPA 1V0CA 3FX6A 2Z3NA 4X8IA 4B5OA 2WPXA 5LYIA 3P2FA 3NH4A 2HV2A 2BSWA 3H5ZA 2OB0A 2PC1A 1LOKA 5KTCA 5CPAA 1XF8A 4Z65A 3KQXA 1CX8A 4JXQA 3B7IA 1JWQA 1IU8A 1R57A 2FIAA 2ZEEA 3S6HA 2FS5A 4IAVA 3S6GA 3CXSA 1U6MA 3GY9A 3PB8X 2YNCA 4R57A 4A38A 3QAYA 5AG7A 1LAMA 1M1DA 2X7BA 3PFOA 4IHMA 2I00A 4H6UA 2IQ6A 3TO6A 1TIQA 3D7DA 4U5YA 3CXPA 3N5FA 4ZBGA 4RN7A 5JH9A 4R8FA 1ZO0A 4CYQA 2QECA 2REFA 5JQ4A 2R1IA 5IV0A 3IIBA 3LWUA 4A31A 3G3SA 3BI1A 1XBUA 2V8GA 2DEAA 1LCPA 2Q51A 3TCVA 1CG2A 3F5BA 3QNVA 1MJ9A 4P4IA 2JLMA 2WPWA 4TNUA 3SJFA 3DR6A 4MMOA 4CAVA 2AFSA 3RAMA 3TO9A 3V7ZA 3PFEA 1B87A 2EO8A 4BMHA 4QB9A 2CIJA 1Z2LA 4OKOA 2AJ6A 3FECA 1ZG7A 4YRHA 3D7GA 3D7HA 2A4NA 4MFPA 1WK4A 2PR8A 1ZG9A 3DR8A 1GYTA 2C6GA 4KVXA 4QC6A 4UEZA 4YU9A 2PJ5A 4DUKA 4B5PA 4H2KA 1CPXA 1XRYA 4J3GA 2ZOGA 4TWEA 3R1KA 2FL4A 2V8DA 3DLJA 1S7KA 3BLNA 1LFWA 2BUEA 3G8WA 4CYNA 5ISVA 2HQYA 3B3SA 1DTDA 5DWNA 1Y0RA 4EMEA 2V77A 4CS0B 2GLJA 1M4GA 3CPXA 4OMEA 4Y49C 4CAEA 2ZW6A 2WYRA 3BXMA 3B3VA 3GB0A 3N7ZA 4JLYA 3KR5A 3HUVA 4F0XA 4K3NA 1BPMA 1XE4A 1ARMA 4EVYA 1AYEA 4UFWA 4JJXA 3IJ3A 3PEIA 3E0KA 2NYQA 4CYPA 1KUYA 1SQHA 3GIUA 1RO5A 3KGQA 4B6ZA 4H89A 1VGYA 1IOFA 3R9GA 3MRUA 4E0AA 4KORA 4M6HA 1Q7LA 2PE3A 4HNXB 4UFXA 3KHXA 4F9VA 2FXFA 3H8EA 4MFJA 3MN8A 4R9MA 2RC4A 2HB6A 5HMNA 1KUXA 2FT0A 1XFOA 4W9YA 1N71A 2REEA 2Y0MA 2PJ8A 3FMCA 5F09A 5H84A 2AE6A 3I3GA 2CNSA 4A95A 4M85A 2VZYA 2XEFA 1X10A 3PP9A 1F2PA 2Z3PA 3D2MA 2HC9A 5KTAA 4M6IA 4FD4A 3GUXA 1LRZA 1X12A 4UCPA 4B12A 2ZEDA 1YLOA 1AUGA 3PZJA 1J4JA 2OOTA 3JUWA 4FUUA 1S7FA 4M3SA 4P45A 1PYTB 3S9LA 2PIZA 4OC3A 3PB9X 4XPDC 5LRJA 1UWYA 3DSBA 4JD6A 4ZY2A 1ELLP 2F7VA 2JDDA 3F0AA 4MFZA 5AG6A 4MRIA 1XMBA 4KUBA 2EK8A 4F8ZA 5THWA 3WC7A 4BBHA 4CGMA 1I1DA 1YQEA 3FJUA 5LYFA 1BO4A 2PR1A 4CGNA 1OBRA 3WABA 1I12A 4FWUA 4KOWA 3P2HA 1NMTA 2QMLA 2ZENA 4PQAA 4NGQA 4R6TA 3L2NA 4ZYQA 4CRZB 1YVOA 4P4DA 5D8NA 2VL1A 2B58A 4NGSA 3ZZIA 1FY7A 2R8VA 3B3CA 1IICA 4IF5A 5J1QA 4E8OA 3T9YA 5G1ZA 2PJ1A 4L8AA 3RNZA 1Q2YA 1CP7A 1YSJA 3KZWA 3CT9A 3W6SA 1KZFA 1Y9KA 3PB4X 4F0YA 2JDCA 2GFQA 3B3WA 4HKFA 2K5TA 1S5KA 3LODA 5JGFA 3VARA 4PK3A 4CGOA 3KKWA 2PJ9A 3RBUA 2QJ8A 4A94A 3PB6X 4MY3A 2J9AA 4X3RA 1CBXA 3V38A 4FD6A 4XNHC 2HUZA 2PJ0A 1QSNA 1VHOA 2Z3LA 3NE7A 2Z0ZA 4QBJA 5A27A 2G0BA 2P6GA 4FD5A 4LQGA 4A32A 3S9NA 1IYLA 2PJCA 2Q4YA 3D4UA 3GYAA 3W91A 2VI7A 2PDOA 1Z8LA 4M6GA 2YNEA 2CY2A 4MHNA 3R95A 1MJBA 1TKJA 2YNCC 4KOYA 1ZG8A 3MGDA 4MJ8A 4U9YA 3FIXA 5CNPA 4XPLA 2ZEOA 1A2ZA 1YLEA 2ZXVA 4NGPA 2CF4A 1QSMA 1XJOA 3EC4A 4MFKA 4RI1A 2FIWA 4CGLA 5C88A 3NH8A 1ELMP 4UA3A 1TF8A 1Q2DA 3FF3A 4JXRA 4MHZA 4EFDA 3C26A 1CJWA 4U9ZA 4C7IA 2Q04A 1QQ9A 3SI2A 2Q7BA 2PVVA 1Z9UA 2JBKA 5AG5A 3JTKA 5IX3A 2EVNA 3UY5A 3SXNA 2QIRA 2POKA 2BO9A 4CAXA 3S9MA 4E2AA 5J8CA 2BL1A 3FH4A 4LQ6A 4KLWA 2VQYA 2PSWA 4HNYB 2R98A 4A37A 4KLVA 2Q7SA 4QVTA 2VBQA 2ZEGA 1VHEA 2OR4A 4AG7A 4F6AA 4C2ZA 4ZX8A 4ZY0A 1YMEA 1Y7RA 4OC4A 3K2KA 4II9A 1BPNA 4PSWA 2J8NA 4MY0A 3TTHA 2BCOA 3DDDA 3LD2A 2B5GB 1YK3A 4CAFA 2Q4VA 3KL9A 2NMTA 2P0WA 3EY5A 4JZ0A 3BI0A 3IC1A 3S6FA 5GCNA 3VH9A 1JQGA 1FT7A 1NE9A 4KSIA 3IU2A 4A33A 2PVWA 5IB9A 1ON0A 3LACA 3KR4A 4KUAA 4P4BA 1ARLA 1YX0A 2YGWA 2OZHA 3TFYA 1AMPA 1XEBA 3DNSA 4RS2A 5LRGA 2PJ3A 3I1UA 1CP6A 4B13A 4P44A 5LRKA 2PJ6A 3CPAA 5G22A 4C2YA 2P6FA 3IEHA 4PXEA 3VWEA 1UFHA 2D4PA 3QAHA 5KTDA 1ZLHA 2PJ4A 1KWMA 1QSOA 4OAEA 2ZEMA 4HPSA 2BOAA 4GM5A 4NF1A 3SI0A 1PCAA 4OIDA 4NGMA 4UWIA 4WWVA 2O28A 5K8PA 4PK2A 3HLPA 4FD7A 5AG4A 2DXQA 4MHDA 1HEEA 4CYOA 1XIXA 2JEWA 2JEVA 2PJAA 2Z11A 2B3UA 2F5IA 1XMTA 3B8GA 3S6KA 2ZEHA 3TE4A 1EE3P 4AB7A 3RYOA 4G1PA 3IWGA 2Z3MA 4UEFA 1RTQA 2G3TA 3FEDA 1YVKA 4CGPA 2V8VA 2VZZA 3IGRA 2IJZA 4MHYA 3R9FA 3T90A 5F47A 3WC5A 2PJ2A 3K9UA 2B4BA 1KUVA 1S7NA 4Y49B 5A28A 1MJAA 4B14A 3WT4A 5C82A 3TT2A 2ZW5A 4I49A 5HVFA 4A30A 1F2OA 2C27A 2ZW7A 4CPAA 3JVNA 4LX9A 2C6CA 5FVJA 2CTCA 2GU2A 2BEIA 2PCUA 4K30A 4NSQA 1S60A 4OIWA 1MK4A 1NSLA 3DGVA 2ZPAA 4OC0A 3NA6A 3CZXA 1QSRA 3PBBA 1TF9A 4OADA 4UEEA 2I3CA 2Z3KA 4NEXA 3NH5A 2AFZA
chains in the Genus database with same CATH topology
1M4LA 4NFRA 1Z5RA 5CBMA 5I4MA 3IFEA 2AFWA 4OC2A 5K8NA 3PBEA 4FAIA 5HVHA 2PJBA 1FNOA 5ELYA 1YW4A 4UIAA 1F57A 1TKFA 3KQZA 1DE4C 4P4JA 2C1CA 2ABZA 4JYWA 4ZY1A 2NSMA 5D29A 1LAPA 2ZOFA 4DYOA 5HXDA 2AFXA 2RB7A 2IMOA 2V8HA 4R7MA 2ANPA 2ZELA 3IO1A 3RZAA 4P6YA 2FVGA 5K8OA 4PXDA 3B35A 2PRQA 1QMUA 2PJ7A 3GLJA 4MXUA 2O4HA 2RFHA 3TC8A 4NGRA 4UIBA 4PPZA 2AFMA 2AFUA 4YWYA 8CPAA 1Y0YA 1TKHA 2QVPA 2ZEPA 4ONWA 4OC1A 4MCSA 3TX8A 3B3TA 3B2YA 4PXBA 1TXRA 2GREA 2ZEFA 3JRUA 4X2TA 3K9TA 4RUHA 2XEGA 1IGBA 2G9DA 2AFOA 3SJGA 2GLFA 3IWWA 3D68A 1BLLE 2PIYA 1YW6A 3WC6A 4MCQA 2XEIA 1HDUA 4EWTA 2QYVA 2CTBA 3KHZA 3KI9A 3PRTA 1R43A 5LYDA 2EK9A 5DS0A 3CDXA 3H8GA 2C6PA 2JBJA 2O53A 3D7FA 4ZI6A 5HVGA 2Q43A 3D67A 4DJLA 1IY7A 4F9UA 3VATA 4NJQA 1NSAA 1VIXA 6CPAA 2EWBA 2F8HA 2XEJA 3KASA 1LANA 3H8FA 4Q7AA 5K8MA 5LYLA 4NJRA 4UF4A 4P10A 1ZLIA 3LMSA 3SI1A 3ISXA 3FEEA 4NGNA 4P4FA 4ZX9A 4NGTA 1BAVA 4PXCA 3NFZA 4MHPA 1H8LA 3SJEA 3BHXA 3D66A 4WJBA 2WZNA 4FBEA 3PB7X 4OC5A 4MCRA 4R76A 4IK2A 2Q4ZA 1R3NA 3SJXA 3FVLA 4MCPA 4O23A 1HDQA 5JM6A 4A39A 1Y7EA 4AXVA 1CPSA 3ISZA 4P4EA 4OP4A 7CPAA 4BD9A 3T8WA 3FX6A 4X8IA 5LYIA 3NH4A 1LOKA 5CPAA 4Z65A 3KQXA 1CX8A 3B7IA 2ZEEA 4IAVA 3PB8X 4A38A 1LAMA 4IHMA 3PFOA 2IQ6A 3D7DA 3N5FA 5JH9A 4R8FA 3IIBA 3LWUA 3BI1A 1XBUA 2V8GA 2DEAA 1LCPA 2Q51A 1CG2A 4P4IA 3QNVA 3SJFA 4TNUA 4MMOA 2AFSA 3RAMA 3V7ZA 3PFEA 2CIJA 1Z2LA 4OKOA 3FECA 1ZG7A 3D7GA 3D7HA 4YU9A 1ZG9A 1GYTA 2C6GA 4UEZA 4DUKA 2PJ5A 4H2KA 1CPXA 1XRYA 2ZOGA 4TWEA 2V8DA 3DLJA 1LFWA 3B3SA 1DTDA 1Y0RA 4EMEA 2V77A 2GLJA 3CPXA 4OMEA 2WYRA 3BXMA 3B3VA 3GB0A 3KR5A 3HUVA 4K3NA 1BPMA 1ARMA 1AYEA 3IJ3A 3PEIA 2NYQA 3KGQA 4B6ZA 1VGYA 3MRUA 1Q7LA 2PE3A 4F9VA 3KHXA 3H8EA 3MN8A 2HB6A 1XFOA 4W9YA 3FMCA 2PJ8A 5F09A 2XEFA 1F2PA 2HC9A 3GUXA 2ZEDA 1YLOA 2OOTA 4FUUA 4P45A 1PYTB 3S9LA 2PIZA 4OC3A 3PB9X 5LRJA 1UWYA 4ZY2A 1ELLP 2F7VA 4MRIA 1XMBA 2EK8A 4F8ZA 5THWA 3WC7A 3FJUA 5LYFA 1OBRA 3WABA 4FWUA 2ZENA 4PQAA 4NGQA 4R6TA 3L2NA 4ZYQA 4P4DA 5D8NA 2VL1A 4NGSA 3B3CA 5J1QA 2PJ1A 1CP7A 1YSJA 3KZWA 3CT9A 3PB4X 3B3WA 5JGFA 3VARA 2PJ9A 3RBUA 2QJ8A 4A94A 3PB6X 2J9AA 4X3RA 1CBXA 3V38A 2PJ0A 1VHOA 3S9NA 4LQGA 2PJCA 3D4UA 1Z8LA 4MHNA 1TKJA 1ZG8A 2ZEOA 4NGPA 2CF4A 1XJOA 3NH8A 1ELMP 1TF8A 3FF3A 4MHZA 4EFDA 1QQ9A 3SI2A 2PVVA 2JBKA 2POKA 2BO9A 3S9MA 3FH4A 4A37A 2ZEGA 1VHEA 2OR4A 4ZY0A 4ZX8A 1YMEA 4OC4A 3K2KA 1BPNA 2BCOA 3KL9A 4JZ0A 3BI0A 3IC1A 3VH9A 1JQGA 1FT7A 4KSIA 2PVWA 5IB9A 4P4BA 3KR4A 1ARLA 1AMPA 5LRGA 2PJ3A 3I1UA 1CP6A 4P44A 5LRKA 2PJ6A 3CPAA 4PXEA 3IEHA 1ZLHA 2PJ4A 1KWMA 2ZEMA 2BOAA 4GM5A 3SI0A 1PCAA 4OIDA 4NGMA 4WWVA 5K8PA 3HLPA 1HEEA 2JEWA 2PJAA 2ZEHA 1EE3P 4G1PA 4UEFA 1RTQA 3FEDA 2V8VA 2IJZA 4MHYA 3WC5A 2PJ2A 3WT4A 5HVFA 1F2OA 4CPAA 2C6CA 2CTCA 2GU2A 2PCUA 4OIWA 3DGVA 4OC0A 3NA6A 3PBBA 1TF9A 4UEEA 2I3CA 3NH5A 2AFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4L A;  4NFR A;  1Z5R A;  5CBM A;  5I4M A;  3IFE A;  2AFW A;  4OC2 A;  5K8N A;  3PBE A;  4FAI A;  5HVH A;  2PJB A;  1FNO A;  5ELY A;  1YW4 A;  4UIA A;  1F57 A;  1TKF A;  3KQZ A;  1DE4 C;  4P4J A;  2C1C A;  2ABZ A;  4JYW A;  4ZY1 A;  2NSM A;  5D29 A;  1LAP A;  2ZOF A;  4DYO A;  5HXD A;  2AFX A;  2RB7 A;  2IMO A;  2V8H A;  4R7M A;  2ANP A;  2ZEL A;  3IO1 A;  3RZA A;  4P6Y A;  2FVG A;  5K8O A;  4PXD A;  3B35 A;  2PRQ A;  1QMU A;  2PJ7 A;  3GLJ A;  4MXU A;  2O4H A;  2RFH A;  3TC8 A;  4NGR A;  4UIB A;  4PPZ A;  2AFM A;  2AFU A;  4YWY A;  8CPA A;  1Y0Y A;  1TKH A;  2QVP A;  2ZEP A;  4ONW A;  4OC1 A;  4MCS A;  3TX8 A;  3B3T A;  3B2Y A;  4PXB A;  1TXR A;  2GRE A;  2ZEF A;  3JRU A;  4X2T A;  3K9T A;  4RUH A;  2XEG A;  1IGB A;  2G9D A;  2AFO A;  3SJG A;  2GLF A;  3IWW A;  3D68 A;  1BLL E;  2PIY A;  1YW6 A;  3WC6 A;  4MCQ A;  2XEI A;  1HDU A;  4EWT A;  2QYV A;  2CTB A;  3KHZ A;  3KI9 A;  3PRT A;  1R43 A;  5LYD A;  2EK9 A;  5DS0 A;  3CDX A;  3H8G A;  2C6P A;  2JBJ A;  2O53 A;  3D7F A;  4ZI6 A;  5HVG A;  2Q43 A;  3D67 A;  4DJL A;  1IY7 A;  4F9U A;  3VAT A;  4NJQ A;  1NSA A;  1VIX A;  6CPA A;  2EWB A;  2F8H A;  2XEJ A;  3KAS A;  1LAN A;  3H8F A;  4Q7A A;  5K8M A;  5LYL A;  4NJR A;  4UF4 A;  4P10 A;  1ZLI A;  3LMS A;  3SI1 A;  3ISX A;  3FEE A;  4NGN A;  4P4F A;  4ZX9 A;  4NGT A;  1BAV A;  4PXC A;  3NFZ A;  4MHP A;  1H8L A;  3SJE A;  3BHX A;  3D66 A;  4WJB A;  2WZN A;  4FBE A;  3PB7 X;  4OC5 A;  4MCR A;  4R76 A;  4IK2 A;  2Q4Z A;  1R3N A;  3SJX A;  3FVL A;  4MCP A;  4O23 A;  1HDQ A;  5JM6 A;  4A39 A;  1Y7E A;  4AXV A;  1CPS A;  3ISZ A;  4P4E A;  4OP4 A;  7CPA A;  4BD9 A;  3T8W A;  3FX6 A;  4X8I A;  5LYI A;  3NH4 A;  1LOK A;  5CPA A;  4Z65 A;  3KQX A;  1CX8 A;  3B7I A;  2ZEE A;  4IAV A;  3PB8 X;  4A38 A;  1LAM A;  4IHM A;  3PFO A;  2IQ6 A;  3D7D A;  3N5F A;  5JH9 A;  4R8F A;  3IIB A;  3LWU A;  3BI1 A;  1XBU A;  2V8G A;  2DEA A;  1LCP A;  2Q51 A;  1CG2 A;  4P4I A;  3QNV A;  3SJF A;  4TNU A;  4MMO A;  2AFS A;  3RAM A;  3V7Z A;  3PFE A;  2CIJ A;  1Z2L A;  4OKO A;  3FEC A;  1ZG7 A;  3D7G A;  3D7H A;  4YU9 A;  1ZG9 A;  1GYT A;  2C6G A;  4UEZ A;  4DUK A;  2PJ5 A;  4H2K A;  1CPX A;  1XRY A;  2ZOG A;  4TWE A;  2V8D A;  3DLJ A;  1LFW A;  3B3S A;  1DTD A;  1Y0R A;  4EME A;  2V77 A;  2GLJ A;  3CPX A;  4OME A;  2WYR A;  3BXM A;  3B3V A;  3GB0 A;  3KR5 A;  3HUV A;  4K3N A;  1BPM A;  1ARM A;  1AYE A;  3IJ3 A;  3PEI A;  2NYQ A;  3KGQ A;  4B6Z A;  1VGY A;  3MRU A;  1Q7L A;  2PE3 A;  4F9V A;  3KHX A;  3H8E A;  3MN8 A;  2HB6 A;  1XFO A;  4W9Y A;  3FMC A;  2PJ8 A;  5F09 A;  2XEF A;  1F2P A;  2HC9 A;  3GUX A;  2ZED A;  1YLO A;  2OOT A;  4FUU A;  4P45 A;  1PYT B;  3S9L A;  2PIZ A;  4OC3 A;  3PB9 X;  5LRJ A;  1UWY A;  4ZY2 A;  1ELL P;  2F7V A;  4MRI A;  1XMB A;  2EK8 A;  4F8Z A;  5THW A;  3WC7 A;  3FJU A;  5LYF A;  1OBR A;  3WAB A;  4FWU A;  2ZEN A;  4PQA A;  4NGQ A;  4R6T A;  3L2N A;  4ZYQ A;  4P4D A;  5D8N A;  2VL1 A;  4NGS A;  3B3C A;  5J1Q A;  2PJ1 A;  1CP7 A;  1YSJ A;  3KZW A;  3CT9 A;  3PB4 X;  3B3W A;  5JGF A;  3VAR A;  2PJ9 A;  3RBU A;  2QJ8 A;  4A94 A;  3PB6 X;  2J9A A;  4X3R A;  1CBX A;  3V38 A;  2PJ0 A;  1VHO A;  3S9N A;  4LQG A;  2PJC A;  3D4U A;  1Z8L A;  4MHN A;  1TKJ A;  1ZG8 A;  2ZEO A;  4NGP A;  2CF4 A;  1XJO A;  3NH8 A;  1ELM P;  1TF8 A;  3FF3 A;  4MHZ A;  4EFD A;  1QQ9 A;  3SI2 A;  2PVV A;  2JBK A;  2POK A;  2BO9 A;  3S9M A;  3FH4 A;  4A37 A;  2ZEG A;  1VHE A;  2OR4 A;  4ZY0 A;  4ZX8 A;  1YME A;  4OC4 A;  3K2K A;  1BPN A;  2BCO A;  3KL9 A;  4JZ0 A;  3BI0 A;  3IC1 A;  3VH9 A;  1JQG A;  1FT7 A;  4KSI A;  2PVW A;  5IB9 A;  4P4B A;  3KR4 A;  1ARL A;  1AMP A;  5LRG A;  2PJ3 A;  3I1U A;  1CP6 A;  4P44 A;  5LRK A;  2PJ6 A;  3CPA A;  4PXE A;  3IEH A;  1ZLH A;  2PJ4 A;  1KWM A;  2ZEM A;  2BOA A;  4GM5 A;  3SI0 A;  1PCA A;  4OID A;  4NGM A;  4WWV A;  5K8P A;  3HLP A;  1HEE A;  2JEW A;  2PJA A;  2ZEH A;  1EE3 P;  4G1P A;  4UEF A;  1RTQ A;  3FED A;  2V8V A;  2IJZ A;  4MHY A;  3WC5 A;  2PJ2 A;  3WT4 A;  5HVF A;  1F2O A;  4CPA A;  2C6C A;  2CTC A;  2GU2 A;  2PCU A;  4OIW A;  3DGV A;  4OC0 A;  3NA6 A;  3PBB A;  1TF9 A;  4UEE A;  2I3C A;  3NH5 A;  2AFZ A; 
#chains in the Genus database with same CATH topology
 3TOB A;  4KZT A;  1M4L A;  2Q44 A;  4NFR A;  2WUU A;  2B4D B;  1L0C A;  1Z5R A;  5CBM A;  5I4M A;  3IFE A;  2AFW A;  4NCZ A;  2DPS A;  4OC2 A;  4KOS A;  1PUA A;  4ZGY B;  5K8N A;  5EMI A;  1VKC A;  3PBE A;  2R7H A;  1M44 A;  4FAI A;  2PJB A;  1Z8W A;  1FNO A;  1YR0 A;  4KVO E;  1M4D A;  5ELY A;  5HVH A;  1YW4 A;  1K4J A;  4UIA A;  3R96 A;  1F57 A;  4DNC A;  1TKF A;  4GS4 A;  4R87 A;  3KQZ A;  1DE4 C;  5IB0 A;  4XPD B;  3RO0 A;  5I0C A;  4P4J A;  2OU2 A;  2C1C A;  5AGE A;  4PV6 A;  2ABZ A;  4JYW A;  1Y9W A;  4CRY B;  4ZY1 A;  2NSM A;  5D29 A;  4UFV A;  3V8I A;  1LAP A;  2IL4 A;  2ZOF A;  4DYO A;  1S3Z A;  3H4Q A;  1RXT A;  4ORF A;  5HXD A;  2AFX A;  2RB7 A;  2IMO A;  4KOX A;  2V8H A;  4KS9 A;  4R7M A;  2ANP A;  2ZEL A;  4PSX A;  5F48 A;  2EUI A;  3IO1 A;  2Z10 A;  4IUS A;  3RZA A;  4P6Y A;  1YRE A;  3FRM A;  2FVG A;  5K8O A;  4PXD A;  3I9S A;  1IOI A;  1S7L A;  4AVB A;  2CNT A;  4R3L A;  3B35 A;  2PRQ A;  3PGP A;  1QMU A;  2PJ7 A;  1XOV A;  2G3A A;  3GLJ A;  4MXU A;  2CNM A;  2O4H A;  2RFH A;  1IB1 E;  1QST A;  3TC8 A;  4MFL A;  3TOA A;  1Z8X A;  4Q36 A;  4AVA A;  1Z8T A;  4YFJ A;  4NGR A;  4UIB A;  4PPZ A;  2AFM A;  2AFU A;  4YWY A;  8CPA A;  1Y0Y A;  1TKH A;  2OH1 A;  2QVP A;  1P4N A;  2ZEP A;  4H6Z A;  4ONW A;  2OZG A;  2OZU A;  4OC1 A;  5EBV A;  1M4I A;  1PU9 A;  2GE3 A;  5H86 A;  4KOT A;  3F8K A;  4MFQ A;  4MCS A;  3TX8 A;  3W6X A;  3FXT A;  3A9L A;  3B3T A;  4XNH B;  5EC4 A;  2GAN A;  3B2Y A;  4UWJ A;  4PXB A;  1TXR A;  2J8R A;  2GRE A;  2ZEF A;  3JRU A;  4X2T A;  3K9T A;  4RUH A;  2XEG A;  3QB8 A;  1IGB A;  2G9D A;  2ARH A;  2YND A;  2J8M A;  3IWE A;  2WSA A;  2AFO A;  4YGO A;  1Q2C A;  4KVM E;  3SJG A;  2GLF A;  3IWW A;  3D68 A;  4QUS A;  1BLL E;  3IU1 A;  4L89 A;  2PIY A;  2ODF A;  1YW6 A;  3WC6 A;  4AG9 A;  4MCQ A;  4C2X A;  2XEI A;  3D2P A;  4C7H A;  1HDU A;  2PQ8 A;  3FBU A;  5J8F A;  3D8P A;  3D3S A;  4EWT A;  2QYV A;  2CTB A;  1BOB A;  3KHZ A;  3KI9 A;  5JPH A;  3PRT A;  1R43 A;  5LYD A;  2EK9 A;  5DS0 A;  3CDX A;  3H8G A;  2C6P A;  2JBJ A;  2O53 A;  3D7F A;  4UCN A;  4UBR A;  4ZI6 A;  2Q43 A;  3D67 A;  5HH1 A;  1WWZ A;  3TO7 A;  5HVG A;  4ONU A;  4DJL A;  4B11 A;  2B4D A;  4GXH A;  3BJ7 A;  1IY7 A;  2B3V A;  2FE7 A;  2ZW4 A;  4F9U A;  3VAT A;  4NJQ A;  1VIX A;  1NSA A;  4JWP A;  4NXY A;  6CPA A;  2EBJ A;  1GHE A;  4UCM A;  5G20 A;  4HNW B;  5F46 A;  2EWB A;  2F8H A;  4B5P B;  2PRB A;  2XEJ A;  2I79 A;  3KAS A;  5DWM A;  2VEZ A;  3SHP A;  4AVC A;  1LAN A;  3WR7 A;  4CAW A;  1P0H A;  3CXQ A;  3H8F A;  4Q7A A;  5K8M A;  1VHS A;  4KSF A;  4NJR A;  5LYL A;  1I21 A;  4UF4 A;  3R9E A;  3OWC A;  4P10 A;  4R3K A;  5E96 A;  1ZLI A;  3LMS A;  3SI1 A;  3GKR A;  2FCK A;  2P6E A;  3ISX A;  3FEE A;  4NGN A;  4P4F A;  4KSA A;  3FYN A;  4ZX9 A;  4NGT A;  3ZJ0 A;  4B10 A;  4KOV A;  1BAV A;  4PXC A;  3NFZ A;  3EO4 A;  4MHP A;  1H8L A;  2Q0Y A;  5G21 A;  3SJE A;  3BHX A;  2VXK A;  3FB3 A;  3D66 A;  1IYK A;  4WJB A;  1B6B A;  2DPT A;  2WZN A;  4MBU A;  4FBE A;  1Z4E A;  3PB7 X;  1Z4R A;  2FSR A;  4OC5 A;  3VWD A;  2H5M A;  1CM0 A;  3BJ8 A;  4MCR A;  4LUA A;  1YGH A;  2D4O A;  4R76 A;  2DF5 A;  5F49 A;  4IK2 A;  2ATR A;  2Q4Z A;  1R3N A;  3SJX A;  3EXN A;  3FVL A;  4OLL A;  4MCP A;  3EFA A;  4O23 A;  4A2Z A;  1HDQ A;  4KOU A;  2CXA A;  3NE8 A;  3SXO A;  5JM6 A;  3FNC A;  4A39 A;  4Q38 A;  4C68 A;  1Y7E A;  4XPK A;  1IID A;  4AXV A;  5BWA B;  4MI4 A;  4BIN A;  1CPS A;  2GIV A;  2KCW A;  3ISZ A;  4P4E A;  2B5G A;  2Z3O A;  4OP4 A;  7CPA A;  4X5K A;  4BD9 A;  3T8W A;  1OZP A;  1V0C A;  3FX6 A;  2Z3N A;  4X8I A;  4B5O A;  2WPX A;  5LYI A;  3P2F A;  3NH4 A;  2HV2 A;  2BSW A;  3H5Z A;  2OB0 A;  2PC1 A;  1LOK A;  5KTC A;  5CPA A;  1XF8 A;  4Z65 A;  3KQX A;  1CX8 A;  4JXQ A;  3B7I A;  1JWQ A;  1IU8 A;  1R57 A;  2FIA A;  2ZEE A;  3S6H A;  2FS5 A;  4IAV A;  3S6G A;  3CXS A;  1U6M A;  3GY9 A;  3PB8 X;  2YNC A;  4R57 A;  4A38 A;  3QAY A;  5AG7 A;  1LAM A;  1M1D A;  2X7B A;  3PFO A;  4IHM A;  2I00 A;  4H6U A;  2IQ6 A;  3TO6 A;  1TIQ A;  3D7D A;  4U5Y A;  3CXP A;  3N5F A;  4ZBG A;  4RN7 A;  5JH9 A;  4R8F A;  1ZO0 A;  4CYQ A;  2QEC A;  2REF A;  5JQ4 A;  2R1I A;  5IV0 A;  3IIB A;  3LWU A;  4A31 A;  3G3S A;  3BI1 A;  1XBU A;  2V8G A;  2DEA A;  1LCP A;  2Q51 A;  3TCV A;  1CG2 A;  3F5B A;  3QNV A;  1MJ9 A;  4P4I A;  2JLM A;  2WPW A;  4TNU A;  3SJF A;  3DR6 A;  4MMO A;  4CAV A;  2AFS A;  3RAM A;  3TO9 A;  3V7Z A;  3PFE A;  1B87 A;  2EO8 A;  4BMH A;  4QB9 A;  2CIJ A;  1Z2L A;  4OKO A;  2AJ6 A;  3FEC A;  1ZG7 A;  4YRH A;  3D7G A;  3D7H A;  2A4N A;  4MFP A;  1WK4 A;  2PR8 A;  1ZG9 A;  3DR8 A;  1GYT A;  2C6G A;  4KVX A;  4QC6 A;  4UEZ A;  4YU9 A;  2PJ5 A;  4DUK A;  4B5P A;  4H2K A;  1CPX A;  1XRY A;  4J3G A;  2ZOG A;  4TWE A;  3R1K A;  2FL4 A;  2V8D A;  3DLJ A;  1S7K A;  3BLN A;  1LFW A;  2BUE A;  3G8W A;  4CYN A;  5ISV A;  2HQY A;  3B3S A;  1DTD A;  5DWN A;  1Y0R A;  4EME A;  2V77 A;  4CS0 B;  2GLJ A;  1M4G A;  3CPX A;  4OME A;  4Y49 C;  4CAE A;  2ZW6 A;  2WYR A;  3BXM A;  3B3V A;  3GB0 A;  3N7Z A;  4JLY A;  3KR5 A;  3HUV A;  4F0X A;  4K3N A;  1BPM A;  1XE4 A;  1ARM A;  4EVY A;  1AYE A;  4UFW A;  4JJX A;  3IJ3 A;  3PEI A;  3E0K A;  2NYQ A;  4CYP A;  1KUY A;  1SQH A;  3GIU A;  1RO5 A;  3KGQ A;  4B6Z A;  4H89 A;  1VGY A;  1IOF A;  3R9G A;  3MRU A;  4E0A A;  4KOR A;  4M6H A;  1Q7L A;  2PE3 A;  4HNX B;  4UFX A;  3KHX A;  4F9V A;  2FXF A;  3H8E A;  4MFJ A;  3MN8 A;  4R9M A;  2RC4 A;  2HB6 A;  5HMN A;  1KUX A;  2FT0 A;  1XFO A;  4W9Y A;  1N71 A;  2REE A;  2Y0M A;  2PJ8 A;  3FMC A;  5F09 A;  5H84 A;  2AE6 A;  3I3G A;  2CNS A;  4A95 A;  4M85 A;  2VZY A;  2XEF A;  1X10 A;  3PP9 A;  1F2P A;  2Z3P A;  3D2M A;  2HC9 A;  5KTA A;  4M6I A;  4FD4 A;  3GUX A;  1LRZ A;  1X12 A;  4UCP A;  4B12 A;  2ZED A;  1YLO A;  1AUG A;  3PZJ A;  1J4J A;  2OOT A;  3JUW A;  4FUU A;  1S7F A;  4M3S A;  4P45 A;  1PYT B;  3S9L A;  2PIZ A;  4OC3 A;  3PB9 X;  4XPD C;  5LRJ A;  1UWY A;  3DSB A;  4JD6 A;  4ZY2 A;  1ELL P;  2F7V A;  2JDD A;  3F0A A;  4MFZ A;  5AG6 A;  4MRI A;  1XMB A;  4KUB A;  2EK8 A;  4F8Z A;  5THW A;  3WC7 A;  4BBH A;  4CGM A;  1I1D A;  1YQE A;  3FJU A;  5LYF A;  1BO4 A;  2PR1 A;  4CGN A;  1OBR A;  3WAB A;  1I12 A;  4FWU A;  4KOW A;  3P2H A;  1NMT A;  2QML A;  2ZEN A;  4PQA A;  4NGQ A;  4R6T A;  3L2N A;  4ZYQ A;  4CRZ B;  1YVO A;  4P4D A;  5D8N A;  2VL1 A;  2B58 A;  4NGS A;  3ZZI A;  1FY7 A;  2R8V A;  3B3C A;  1IIC A;  4IF5 A;  5J1Q A;  4E8O A;  3T9Y A;  5G1Z A;  2PJ1 A;  4L8A A;  3RNZ A;  1Q2Y A;  1CP7 A;  1YSJ A;  3KZW A;  3CT9 A;  3W6S A;  1KZF A;  1Y9K A;  3PB4 X;  4F0Y A;  2JDC A;  2GFQ A;  3B3W A;  4HKF A;  2K5T A;  1S5K A;  3LOD A;  5JGF A;  3VAR A;  4PK3 A;  4CGO A;  3KKW A;  2PJ9 A;  3RBU A;  2QJ8 A;  4A94 A;  3PB6 X;  4MY3 A;  2J9A A;  4X3R A;  1CBX A;  3V38 A;  4FD6 A;  4XNH C;  2HUZ A;  2PJ0 A;  1QSN A;  1VHO A;  2Z3L A;  3NE7 A;  2Z0Z A;  4QBJ A;  5A27 A;  2G0B A;  2P6G A;  4FD5 A;  4LQG A;  4A32 A;  3S9N A;  1IYL A;  2PJC A;  2Q4Y A;  3D4U A;  3GYA A;  3W91 A;  2VI7 A;  2PDO A;  1Z8L A;  4M6G A;  2YNE A;  2CY2 A;  4MHN A;  3R95 A;  1MJB A;  1TKJ A;  2YNC C;  4KOY A;  1ZG8 A;  3MGD A;  4MJ8 A;  4U9Y A;  3FIX A;  5CNP A;  4XPL A;  2ZEO A;  1A2Z A;  1YLE A;  2ZXV A;  4NGP A;  2CF4 A;  1QSM A;  1XJO A;  3EC4 A;  4MFK A;  4RI1 A;  2FIW A;  4CGL A;  5C88 A;  3NH8 A;  1ELM P;  4UA3 A;  1TF8 A;  1Q2D A;  3FF3 A;  4JXR A;  4MHZ A;  4EFD A;  3C26 A;  1CJW A;  4U9Z A;  4C7I A;  2Q04 A;  1QQ9 A;  3SI2 A;  2Q7B A;  2PVV A;  1Z9U A;  2JBK A;  5AG5 A;  3JTK A;  5IX3 A;  2EVN A;  3UY5 A;  3SXN A;  2QIR A;  2POK A;  2BO9 A;  4CAX A;  3S9M A;  4E2A A;  5J8C A;  2BL1 A;  3FH4 A;  4LQ6 A;  4KLW A;  2VQY A;  2PSW A;  4HNY B;  2R98 A;  4A37 A;  4KLV A;  2Q7S A;  4QVT A;  2VBQ A;  2ZEG A;  1VHE A;  2OR4 A;  4AG7 A;  4F6A A;  4C2Z A;  4ZX8 A;  4ZY0 A;  1YME A;  1Y7R A;  4OC4 A;  3K2K A;  4II9 A;  1BPN A;  4PSW A;  2J8N A;  4MY0 A;  3TTH A;  2BCO A;  3DDD A;  3LD2 A;  2B5G B;  1YK3 A;  4CAF A;  2Q4V A;  3KL9 A;  2NMT A;  2P0W A;  3EY5 A;  4JZ0 A;  3BI0 A;  3IC1 A;  3S6F A;  5GCN A;  3VH9 A;  1JQG A;  1FT7 A;  1NE9 A;  4KSI A;  3IU2 A;  4A33 A;  2PVW A;  5IB9 A;  1ON0 A;  3LAC A;  3KR4 A;  4KUA A;  4P4B A;  1ARL A;  1YX0 A;  2YGW A;  2OZH A;  3TFY A;  1AMP A;  1XEB A;  3DNS A;  4RS2 A;  5LRG A;  2PJ3 A;  3I1U A;  1CP6 A;  4B13 A;  4P44 A;  5LRK A;  2PJ6 A;  3CPA A;  5G22 A;  4C2Y A;  2P6F A;  3IEH A;  4PXE A;  3VWE A;  1UFH A;  2D4P A;  3QAH A;  5KTD A;  1ZLH A;  2PJ4 A;  1KWM A;  1QSO A;  4OAE A;  2ZEM A;  4HPS A;  2BOA A;  4GM5 A;  4NF1 A;  3SI0 A;  1PCA A;  4OID A;  4NGM A;  4UWI A;  4WWV A;  2O28 A;  5K8P A;  4PK2 A;  3HLP A;  4FD7 A;  5AG4 A;  2DXQ A;  4MHD A;  1HEE A;  4CYO A;  1XIX A;  2JEW A;  2JEV A;  2PJA A;  2Z11 A;  2B3U A;  2F5I A;  1XMT A;  3B8G A;  3S6K A;  2ZEH A;  3TE4 A;  1EE3 P;  4AB7 A;  3RYO A;  4G1P A;  3IWG A;  2Z3M A;  4UEF A;  1RTQ A;  2G3T A;  3FED A;  1YVK A;  4CGP A;  2V8V A;  2VZZ A;  3IGR A;  2IJZ A;  4MHY A;  3R9F A;  3T90 A;  5F47 A;  3WC5 A;  2PJ2 A;  3K9U A;  2B4B A;  1KUV A;  1S7N A;  4Y49 B;  5A28 A;  1MJA A;  4B14 A;  3WT4 A;  5C82 A;  3TT2 A;  2ZW5 A;  4I49 A;  5HVF A;  4A30 A;  1F2O A;  2C27 A;  2ZW7 A;  4CPA A;  3JVN A;  4LX9 A;  2C6C A;  5FVJ A;  2CTC A;  2GU2 A;  2BEI A;  2PCU A;  4K30 A;  4NSQ A;  1S60 A;  4OIW A;  1MK4 A;  1NSL A;  3DGV A;  2ZPA A;  4OC0 A;  3NA6 A;  3CZX A;  1QSR A;  3PBB A;  1TF9 A;  4OAD A;  4UEE A;  2I3C A;  2Z3K A;  4NEX A;  3NH5 A;  2AFZ A; 
#chains in the Genus database with same CATH homology
 1M4L A;  4NFR A;  1Z5R A;  5CBM A;  5I4M A;  3IFE A;  2AFW A;  4OC2 A;  5K8N A;  3PBE A;  4FAI A;  5HVH A;  2PJB A;  1FNO A;  5ELY A;  1YW4 A;  4UIA A;  1F57 A;  1TKF A;  3KQZ A;  1DE4 C;  4P4J A;  2C1C A;  2ABZ A;  4JYW A;  4ZY1 A;  2NSM A;  5D29 A;  1LAP A;  2ZOF A;  4DYO A;  5HXD A;  2AFX A;  2RB7 A;  2IMO A;  2V8H A;  4R7M A;  2ANP A;  2ZEL A;  3IO1 A;  3RZA A;  4P6Y A;  2FVG A;  5K8O A;  4PXD A;  3B35 A;  2PRQ A;  1QMU A;  2PJ7 A;  3GLJ A;  4MXU A;  2O4H A;  2RFH A;  3TC8 A;  4NGR A;  4UIB A;  4PPZ A;  2AFM A;  2AFU A;  4YWY A;  8CPA A;  1Y0Y A;  1TKH A;  2QVP A;  2ZEP A;  4ONW A;  4OC1 A;  4MCS A;  3TX8 A;  3B3T A;  3B2Y A;  4PXB A;  1TXR A;  2GRE A;  2ZEF A;  3JRU A;  4X2T A;  3K9T A;  4RUH A;  2XEG A;  1IGB A;  2G9D A;  2AFO A;  3SJG A;  2GLF A;  3IWW A;  3D68 A;  1BLL E;  2PIY A;  1YW6 A;  3WC6 A;  4MCQ A;  2XEI A;  1HDU A;  4EWT A;  2QYV A;  2CTB A;  3KHZ A;  3KI9 A;  3PRT A;  1R43 A;  5LYD A;  2EK9 A;  5DS0 A;  3CDX A;  3H8G A;  2C6P A;  2JBJ A;  2O53 A;  3D7F A;  4ZI6 A;  5HVG A;  2Q43 A;  3D67 A;  4DJL A;  1IY7 A;  4F9U A;  3VAT A;  4NJQ A;  1NSA A;  1VIX A;  6CPA A;  2EWB A;  2F8H A;  2XEJ A;  3KAS A;  1LAN A;  3H8F A;  4Q7A A;  5K8M A;  5LYL A;  4NJR A;  4UF4 A;  4P10 A;  1ZLI A;  3LMS A;  3SI1 A;  3ISX A;  3FEE A;  4NGN A;  4P4F A;  4ZX9 A;  4NGT A;  1BAV A;  4PXC A;  3NFZ A;  4MHP A;  1H8L A;  3SJE A;  3BHX A;  3D66 A;  4WJB A;  2WZN A;  4FBE A;  3PB7 X;  4OC5 A;  4MCR A;  4R76 A;  4IK2 A;  2Q4Z A;  1R3N A;  3SJX A;  3FVL A;  4MCP A;  4O23 A;  1HDQ A;  5JM6 A;  4A39 A;  1Y7E A;  4AXV A;  1CPS A;  3ISZ A;  4P4E A;  4OP4 A;  7CPA A;  4BD9 A;  3T8W A;  3FX6 A;  4X8I A;  5LYI A;  3NH4 A;  1LOK A;  5CPA A;  4Z65 A;  3KQX A;  1CX8 A;  3B7I A;  2ZEE A;  4IAV A;  3PB8 X;  4A38 A;  1LAM A;  4IHM A;  3PFO A;  2IQ6 A;  3D7D A;  3N5F A;  5JH9 A;  4R8F A;  3IIB A;  3LWU A;  3BI1 A;  1XBU A;  2V8G A;  2DEA A;  1LCP A;  2Q51 A;  1CG2 A;  4P4I A;  3QNV A;  3SJF A;  4TNU A;  4MMO A;  2AFS A;  3RAM A;  3V7Z A;  3PFE A;  2CIJ A;  1Z2L A;  4OKO A;  3FEC A;  1ZG7 A;  3D7G A;  3D7H A;  4YU9 A;  1ZG9 A;  1GYT A;  2C6G A;  4UEZ A;  4DUK A;  2PJ5 A;  4H2K A;  1CPX A;  1XRY A;  2ZOG A;  4TWE A;  2V8D A;  3DLJ A;  1LFW A;  3B3S A;  1DTD A;  1Y0R A;  4EME A;  2V77 A;  2GLJ A;  3CPX A;  4OME A;  2WYR A;  3BXM A;  3B3V A;  3GB0 A;  3KR5 A;  3HUV A;  4K3N A;  1BPM A;  1ARM A;  1AYE A;  3IJ3 A;  3PEI A;  2NYQ A;  3KGQ A;  4B6Z A;  1VGY A;  3MRU A;  1Q7L A;  2PE3 A;  4F9V A;  3KHX A;  3H8E A;  3MN8 A;  2HB6 A;  1XFO A;  4W9Y A;  3FMC A;  2PJ8 A;  5F09 A;  2XEF A;  1F2P A;  2HC9 A;  3GUX A;  2ZED A;  1YLO A;  2OOT A;  4FUU A;  4P45 A;  1PYT B;  3S9L A;  2PIZ A;  4OC3 A;  3PB9 X;  5LRJ A;  1UWY A;  4ZY2 A;  1ELL P;  2F7V A;  4MRI A;  1XMB A;  2EK8 A;  4F8Z A;  5THW A;  3WC7 A;  3FJU A;  5LYF A;  1OBR A;  3WAB A;  4FWU A;  2ZEN A;  4PQA A;  4NGQ A;  4R6T A;  3L2N A;  4ZYQ A;  4P4D A;  5D8N A;  2VL1 A;  4NGS A;  3B3C A;  5J1Q A;  2PJ1 A;  1CP7 A;  1YSJ A;  3KZW A;  3CT9 A;  3PB4 X;  3B3W A;  5JGF A;  3VAR A;  2PJ9 A;  3RBU A;  2QJ8 A;  4A94 A;  3PB6 X;  2J9A A;  4X3R A;  1CBX A;  3V38 A;  2PJ0 A;  1VHO A;  3S9N A;  4LQG A;  2PJC A;  3D4U A;  1Z8L A;  4MHN A;  1TKJ A;  1ZG8 A;  2ZEO A;  4NGP A;  2CF4 A;  1XJO A;  3NH8 A;  1ELM P;  1TF8 A;  3FF3 A;  4MHZ A;  4EFD A;  1QQ9 A;  3SI2 A;  2PVV A;  2JBK A;  2POK A;  2BO9 A;  3S9M A;  3FH4 A;  4A37 A;  2ZEG A;  1VHE A;  2OR4 A;  4ZY0 A;  4ZX8 A;  1YME A;  4OC4 A;  3K2K A;  1BPN A;  2BCO A;  3KL9 A;  4JZ0 A;  3BI0 A;  3IC1 A;  3VH9 A;  1JQG A;  1FT7 A;  4KSI A;  2PVW A;  5IB9 A;  4P4B A;  3KR4 A;  1ARL A;  1AMP A;  5LRG A;  2PJ3 A;  3I1U A;  1CP6 A;  4P44 A;  5LRK A;  2PJ6 A;  3CPA A;  4PXE A;  3IEH A;  1ZLH A;  2PJ4 A;  1KWM A;  2ZEM A;  2BOA A;  4GM5 A;  3SI0 A;  1PCA A;  4OID A;  4NGM A;  4WWV A;  5K8P A;  3HLP A;  1HEE A;  2JEW A;  2PJA A;  2ZEH A;  1EE3 P;  4G1P A;  4UEF A;  1RTQ A;  3FED A;  2V8V A;  2IJZ A;  4MHY A;  3WC5 A;  2PJ2 A;  3WT4 A;  5HVF A;  1F2O A;  4CPA A;  2C6C A;  2CTC A;  2GU2 A;  2PCU A;  4OIW A;  3DGV A;  4OC0 A;  3NA6 A;  3PBB A;  1TF9 A;  4UEE A;  2I3C A;  3NH5 A;  2AFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...