1TF8A

Streptomyces griseus aminopeptidase complexed with l-tryptophan
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
277
structure length
273
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Binding of inhibitory aromatic amino acids to Streptomyces griseus aminopeptidase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 106
structure length 273
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tf8A00
3B3WA 4Z65A 3KR4A 2PJ2A 1LFWA 2PJAA 1VHEA 1BAVA 5LYFA 3FH4A 4KSIA 1TF9A 2Q43A 3BHXA 4IHMA 4NGSA 4R76A 2AFZA 3KL9A 2CF4A 4PXEA 4AXVA 3B3CA 4PPZA 3NH8A 3B7IA 4DYOA 2CTCA 4PXCA 4JYWA 2PJCA 3NFZA 3D7GA 5THWA 4NJRA 1ZG7A 1KWMA 4P4IA 3B3TA 1DE4C 3IO1A 5F09A 3D7DA 2ZEFA 1ELMP 4P4EA 5CBMA 2IMOA 1ELLP 2JBKA 2PJ4A 2V8HA 3SJFA 4OC0A 3PB4X 3FX6A 3VATA 2IJZA 4MHYA 1DTDA 3HLPA 5LYIA 3K2KA 3V7ZA 4A37A 3SI2A 3KZWA 3IJ3A 4A39A 5HXDA 1NSAA 4EMEA 3B2YA 2IQ6A 5JGFA 1YSJA 1CX8A 1LANA 2Q51A 2PJ7A 3FECA 1XJOA 1AYEA 2PCUA 4NGNA 1ZG9A 1Y0RA 3FF3A 4NGRA 2AFSA 2ZENA 2AFMA 3S9MA 4ZI6A 4P4BA 2PJ0A 3H8FA 1XMBA 3KR5A 3L2NA 1Y7EA 2C6PA 8CPAA 4UF4A 2QVPA 4B6ZA 5LYLA 2PVWA 5LRGA 3NH4A 5DS0A 3IIBA 4F9VA 4ZY1A 3PB6X 4YWYA 1Q7LA 1TKFA 1VIXA 1CPXA 2ABZA 3SI1A 2ZELA 5IB9A 4NGTA 3D66A 5K8NA 1F2PA 1R43A 4P4DA 4WWVA 2ZOGA 4TWEA 3WT4A 4OIWA 3DGVA 2G9DA 2OR4A 4ZYQA 4P6YA 2NYQA 3CPAA 2GU2A 3IC1A 2C6CA 4TNUA 4YU9A 2PIZA 3PFEA 4NJQA 4Q7AA 1CBXA 1F57A 3SJGA 3FEDA 2PE3A 4PQAA 1AMPA 1RTQA 4MCPA 2RB7A 1CP7A 3DLJA 2HC9A 2BCOA 4OC2A 2GLJA 3V38A 3BI0A 3S9NA 1XBUA 4EWTA 2CTBA 1Z2LA 4K3NA 5J1QA 2ZEEA 4A38A 2OOTA 2WYRA 4PXDA 1FNOA 2C6GA 3PB8X 3CDXA 2PJBA 3WC7A 3HUVA 3D4UA 2FVGA 2PJ9A 4MHPA 7CPAA 4MXUA 2POKA 1ZLHA 3CT9A 3WC6A 4R7MA 3B3SA 4NFRA 3GLJA 4DJLA 1XRYA 4UIBA 2BO9A 5JM6A 4X2TA 5D29A 3KQZA 4O23A 2AFWA 1VHOA 3N5FA 4MCSA 4UIAA 2GREA 2RFHA 2AFXA 1IY7A 3GUXA 4OC5A 2ZEPA 1M4LA 5K8MA 3VH9A 1H8LA 1GYTA 1CP6A 4DUKA 2EWBA 3FEEA 4FWUA 4ONWA 4NGPA 4MMOA 4FBEA 4PXBA 3KQXA 1CG2A 3LMSA 1YW4A 3PEIA 3I1UA 4BD9A 3FVLA 4ZY0A 2V77A 2O53A 1LAPA 2J9AA 2HB6A 2JEWA 1TF8A 5CPAA 3WC5A 3JRUA 1BPNA 2EK8A 3BXMA 3D7FA 3SJEA 4NGMA 5LRJA 4OC1A 4UEZA 5ELYA 4G1PA 2XEFA 3KGQA 2ZEGA 3NA6A 1VGYA 2QYVA 2AFUA 2V8VA 1TXRA 4UEEA 3TX8A 1YMEA 3KHXA 2AFOA 1BLLE 3PB9X 4X8IA 3QNVA 3GB0A 3LWUA 1ZLIA 4MRIA 2I3CA 5HVGA 2ZEDA 3D7HA 5K8PA 3H8GA 2PRQA 5K8OA 2BOAA 2C1CA 3IWWA 4MHZA 2XEJA 3PFOA 1BPMA 4OC4A 1FT7A 2Q4ZA 3BI1A 4CPAA 4EFDA 1HEEA 1OBRA 5LRKA 1ARLA 4P4FA 4WJBA 2O4HA 1TKHA 1F2OA 1HDQA 1Z5RA 4MCRA 3PRTA 4P44A 4IK2A 4R8FA 4FAIA 3CPXA 2ZEHA 2PVVA 3FJUA 4ZY2A 3T8WA 3IEHA 5I4MA 3PB7X 1PYTB 2QJ8A 4MHNA 4ZX9A 4X3RA 3PBEA 4R6TA 2PJ1A 3D68A 4GM5A 4P10A 1Y0YA 4OC3A 5HVFA 3ISXA 3ISZA 2PJ5A 1QQ9A 2VL1A 3B35A 3RBUA 1ARMA 2DEAA 4MCQA 3VARA 4P4JA 1ZG8A 1EE3P 4OP4A 1IGBA 2PJ3A 2V8DA 4FUUA 1QMUA 3IFEA 2ZOFA 5HVHA 1LOKA 2PJ8A 3H8EA 1Z8LA 1LCPA 3PBBA 2F8HA 3FMCA 1UWYA 1YW6A 4ZX8A 2GLFA 3K9TA 4P45A 3S9LA 4F9UA 3NH5A 3KHZA 3MN8A 1LAMA 4OIDA 4NGQA 4IAVA 5D8NA 1TKJA 1PCAA 1YLOA 4OKOA 2NSMA 3SJXA 4LQGA 4OMEA 3B3VA 3SI0A 4A94A 1HDUA 4W9YA 2EK9A 1CPSA 5JH9A 3RAMA 3KI9A 2V8GA 4H2KA 6CPAA 2PIYA 1XFOA 1JQGA 3RZAA 1R3NA 2CIJA 2ZEMA 2JBJA 3WABA 3TC8A 3D67A 5LYDA 2XEGA 2PJ6A 2XEIA 2ANPA 2F7VA 4F8ZA 3KASA 2WZNA 2ZEOA 4UEFA 4JZ0A 3MRUA 4RUHA
chains in the Genus database with same CATH superfamily
2CNSA 3B3WA 4Z65A 3KR4A 2ZW6A 4UA3A 1OZPA 2PJ2A 3IGRA 4U9YA 5F47A 2PR8A 1LFWA 3JUWA 4JXQA 4A30A 2PJAA 1VHEA 4PSWA 1BAVA 5LYFA 3FH4A 4Q36A 4KSIA 1TF9A 4XPDB 4CRYB 1KUVA 2G0BA 1KUYA 3GIUA 2Q43A 4GS4A 4KOTA 4KSFA 3LD2A 4JLYA 3BHXA 3D2PA 3EY5A 1Z4EA 4OADA 5AG4A 2FT0A 4IHMA 3NE8A 4NGSA 1LRZA 1S7LA 2VZZA 4HKFA 3DR6A 3TT2A 1NE9A 2AFZA 3KL9A 2CF4A 4R76A 4XPDC 4PXEA 2REEA 4ZBGA 4AXVA 4BBHA 3B3CA 4PPZA 5HMNA 4XPKA 3NH8A 4UFVA 3B7IA 4HNXB 2GIVA 4BMHA 4CAVA 4M6GA 4DYOA 2CTCA 4PXCA 4HPSA 4JYWA 4QBJA 2PJCA 4KORA 4KVXA 3BLNA 3NFZA 3D7GA 1QSRA 5THWA 4M3SA 4NJRA 1ZG7A 2OZGA 1KWMA 2ZW7A 4B5OA 2Z3PA 4P4IA 4HNWB 1XE4A 1DE4C 3B3TA 3GKRA 3IO1A 4LUAA 5H86A 5F09A 5IB0A 2BL1A 3D7DA 2ZEFA 1ELMP 4P4EA 5CBMA 2B4BA 2OZHA 2IMOA 1ELLP 2JBKA 2PJ4A 4A32A 2D4OA 2V8HA 4KOXA 3SJFA 4AVCA 2G3AA 4OC0A 3PB4X 3FX6A 3VATA 2IJZA 1WWZA 4CYPA 3D3SA 4MHYA 2DPTA 3P2FA 2VI7A 1DTDA 2D4PA 3HLPA 4F0YA 3F0AA 5LYIA 3I3GA 5F49A 3K2KA 3V7ZA 4A37A 3SI2A 4AVAA 2Y0MA 4NSQA 2JEVA 3KZWA 3IJ3A 5J8CA 2Q04A 5EC4A 3S6HA 4A39A 5C82A 1M4DA 3K9UA 1Q2DA 5G22A 2Q7SA 4E2AA 5A27A 2B5GA 2I00A 3BJ8A 5HXDA 2P0WA 1NSAA 4EMEA 3B2YA 2IQ6A 4KVOE 5JGFA 4QB9A 3CXQA 2B5GB 1YSJA 1CX8A 4DNCA 2CNMA 1LANA 2QIRA 2Q51A 5AG6A 1M4IA 4CYQA 5JQ4A 1Y9WA 2DF5A 1SQHA 2PJ7A 4UWIA 4CRZB 4KOVA 1MJAA 1XJOA 1AYEA 2PCUA 3FECA 2ZW5A 3FIXA 4NGNA 1ZG9A 3W91A 2B4DA 1Y0RA 3FF3A 4NGRA 2AFSA 2ZENA 2AFMA 2X7BA 1GHEA 3S9MA 2Z3KA 4A2ZA 4ZI6A 4CAEA 2B4DB 1Z8XA 1XEBA 1J4JA 4P4BA 2PJ0A 3H8FA 3EO4A 3EXNA 1XMBA 3FBUA 1V0CA 3GY9A 2BEIA 2CNTA 3KR5A 4C2YA 1IYKA 3L2NA 1Y7EA 2C6PA 8CPAA 5KTCA 3F5BA 4UF4A 2B3UA 2PRBA 2QVPA 4B6ZA 2P6FA 5LYLA 2EUIA 4CGMA 4MFKA 2PVWA 5LRGA 3NH4A 3EC4A 5DS0A 4YFJA 1S7KA 3IU1A 3RYOA 1IYLA 3IIBA 4F9VA 2JDCA 3PB6X 1NMTA 3QB8A 4ZY1A 4H6UA 4YWYA 2FSRA 2R8VA 4B12A 1Q7LA 1TKFA 2OB0A 1VIXA 1CPXA 2ABZA 4UCNA 1M44A 2PDOA 4KOSA 2ZELA 3SI1A 5IB9A 4QC6A 4NGTA 3D66A 4QUSA 5EBVA 1S5KA 1YK3A 3CZXA 4X5KA 5K8NA 1F2PA 1R43A 1I1DA 4P4DA 4PV6A 5F48A 5A28A 2IL4A 5KTAA 4KLWA 4WWVA 2ZOGA 4TWEA 4MI4A 3WT4A 3D8PA 4OIWA 3S6GA 3WR7A 3DGVA 5AG5A 2VQYA 1MJ9A 3TO9A 2G9DA 2WUUA 2OR4A 4KLVA 3VWDA 4ZYQA 3IWGA 4P6YA 3R9EA 2NYQA 3CPAA 2GU2A 3IC1A 2C6CA 1YVOA 4TNUA 4YU9A 1Z9UA 2AJ6A 2PIZA 1ON0A 1QSOA 3PFEA 5F46A 4IF5A 4NJQA 4Q7AA 1K4JA 1CBXA 1F57A 4C2ZA 2VBQA 3FEDA 3SJGA 2YNEA 2AE6A 3G3SA 2PE3A 1BOBA 1Z4RA 4PQAA 2Q44A 3DSBA 3PP9A 4M6IA 4II9A 2PSWA 1IB1E 1AMPA 3CXSA 4FD4A 2EBJA 1RTQA 2HQYA 2HUZA 4MCPA 1KZFA 2B58A 2Z11A 2RB7A 4IUSA 4AB7A 1XMTA 4C7IA 5CNPA 1IOIA 1CP7A 2HC9A 2BCOA 3DLJA 2GLJA 4KZTA 3BI0A 4OC2A 3V38A 1XBUA 4UFXA 3S9NA 4EWTA 2QMLA 2KCWA 2CTBA 3GYAA 1MJBA 2DPSA 4MY0A 2ATRA 1Z2LA 4K3NA 4B11A 5J1QA 2ZEEA 4XNHB 5G20A 2ARHA 2OOTA 2Z3LA 2WYRA 4PXDA 4A33A 4A38A 3R95A 1U6MA 1FNOA 2R7HA 2BSWA 2C6GA 2FE7A 3PB8X 2Z0ZA 2WPWA 4F0XA 1WK4A 3LACA 3CDXA 1N71A 2PJBA 3WC7A 2ZXVA 4CAFA 3HUVA 4GXHA 3D4UA 1Z8TA 2FVGA 1A2ZA 2HV2A 3P2HA 4H89A 4ONUA 1YX0A 2PJ9A 2YNDA 4L8AA 4NCZA 3SXOA 1VHSA 1IU8A 4MHPA 4CYNA 4YGOA 4MXUA 2POKA 1ZLHA 3ZJ0A 2J8RA 4FD5A 7CPAA 3CT9A 3BJ7A 4R3KA 4R7MA 3WC6A 3TTHA 3R9GA 4C2XA 3B3SA 4NFRA 3GLJA 4CS0B 4DJLA 1XRYA 4UIBA 2BO9A 4ZGYB 2NMTA 3ZZIA 4E0AA 3N7ZA 4KSAA 2REFA 1YGHA 3S6KA 5JM6A 1QSMA 4UCPA 4X2TA 5D29A 4BINA 4CAWA 3KQZA 3TOBA 4O23A 2B3VA 2AFWA 5G21A 1VHOA 4JWPA 4NEXA 3N5FA 3B8GA 1XIXA 2R98A 3TO7A 3DNSA 4MCSA 1ZO0A 5G1ZA 4UIAA 2GREA 1B87A 2RFHA 2AFXA 1IY7A 2QECA 3GUXA 5AGEA 3W6XA 3C26A 2ZPAA 3I9SA 4OC5A 2ZEPA 1M4LA 2CY2A 3F8KA 1YVKA 4R9MA 5K8MA 3VH9A 4RI1A 3VWEA 1H8LA 1GYTA 1CP6A 1FY7A 1CJWA 2OZUA 1R57A 4M85A 4DUKA 3R1KA 3SHPA 2EWBA 3FEEA 2Z3OA 2OH1A 4FWUA 2F5IA 4ONWA 4B5PA 1P0HA 3FB3A 4NGPA 4MMOA 4FBEA 4PXBA 1IIDA 3KQXA 4MY3A 1CG2A 3LMSA 3RO0A 2BUEA 4MFJA 2R1IA 4B5PB 1YW4A 3PEIA 1QSNA 3I1UA 4BD9A 3FVLA 1XF8A 4ZY0A 2VEZA 2G3TA 2V77A 4R57A 2O53A 4B14A 5C88A 1LAPA 2J9AA 4XPLA 3R9FA 2ODFA 1S3ZA 2HB6A 2JEWA 2JDDA 4MFPA 4CAXA 1TF8A 5CPAA 4CGLA 1BO4A 4KVME 2EVNA 3WC5A 3JRUA 4U5YA 4MHDA 1BPNA 3CXPA 1IOFA 2EK8A 3BXMA 3D7FA 3SJEA 4NGMA 3FNCA 4K30A 2WSAA 5LRJA 4OC1A 2YNCA 4UEZA 5ELYA 2FIAA 4G1PA 2XEFA 1KUXA 2FL4A 3KGQA 2ZEGA 3NA6A 3W6SA 1M4GA 1JWQA 1VGYA 3TE4A 3G8WA 2QYVA 4C68A 3QAHA 5H84A 2AFUA 2V8VA 1S7FA 3TCVA 1TXRA 2CXAA 4UEEA 4OLLA 1YR0A 3E0KA 1IICA 3TX8A 1YMEA 1UFHA 3KHXA 4UFWA 2AFOA 1BLLE 3PB9X 4AG7A 4X8IA 4KOWA 2YNCC 3QNVA 3T90A 3GB0A 3LWUA 5FVJA 1ZLIA 4KOYA 4MRIA 4L89A 2I3CA 5DWNA 5HVGA 5J8FA 2ZEDA 2P6EA 3D7HA 5K8PA 2PC1A 2PRQA 3H8GA 3OWCA 3PZJA 5K8OA 1M1DA 2BOAA 2C1CA 4JJXA 1NSLA 3IWWA 2FIWA 4MHZA 1S7NA 4MFQA 4CGNA 2XEJA 2Z10A 3PFOA 1BPMA 4LX9A 3RNZA 4OC4A 3EFAA 2EO8A 1FT7A 3DR8A 3IU2A 5E96A 1PU9A 2Q4ZA 3BI1A 4NF1A 4PK2A 4CPAA 2WPXA 4EFDA 1HEEA 4AVBA 2VXKA 1OBRA 3T9YA 5BWAB 1Q2YA 1TIQA 4UBRA 4LQ6A 5IV0A 5LRKA 1ARLA 4P4FA 4WJBA 4MFZA 2O4HA 4CGOA 1QSTA 1CM0A 3TO6A 2PR1A 4CGPA 1TKHA 4KOUA 2GE3A 1F2OA 1HDQA 1Z5RA 4MCRA 1P4NA 2O28A 3PRTA 4H6ZA 4P44A 4HNYB 3SXNA 4ORFA 4IK2A 4EVYA 4R8FA 4FAIA 3CPXA 2OU2A 2J8MA 2ZEHA 2JLMA 2PVVA 2Q4VA 3FJUA 4ZY2A 4AG9A 3T8WA 3IEHA 2H5MA 5KTDA 5I4MA 3PB7X 1PYTB 1Y7RA 3A9LA 2QJ8A 4MHNA 2Q4YA 4ZX9A 4QVTA 5GCNA 3H5ZA 4X3RA 3FRMA 1Y9KA 3PBEA 4R6TA 2PJ1A 1X10A 3D68A 4GM5A 4B13A 2FXFA 1Z8WA 1Y0YA 4OC3A 4P10A 4FD7A 4R3LA 4XNHC 5DWMA 5HVFA 4Q38A 3S6FA 5EMIA 3ISXA 2DXQA 4A31A 3ISZA 1AUGA 2PJ5A 4E8OA 1QQ9A 2VL1A 4UWJA 3B35A 3RBUA 3D2MA 4F6AA 1ARMA 2DEAA 4MCQA 5AG7A 3VARA 4P4JA 3JTKA 1L0CA 1VKCA 1ZG8A 1EE3P 3IWEA 4MBUA 4FD6A 4OP4A 1IGBA 4Y49B 2PJ3A 2V8DA 4FUUA 1QMUA 3IFEA 5HH1A 2ZOFA 5HVHA 2J8NA 1LOKA 4RN7A 3R96A 2PJ8A 5JPHA 4RS2A 3H8EA 4R87A 1Z8LA 1LCPA 1RO5A 1Q2CA 3FXTA 3PBBA 4JXRA 5ISVA 4MJ8A 2F8HA 3FMCA 1UWYA 1YW6A 4OAEA 2VZYA 3FYNA 4ZX8A 2GLFA 1YQEA 3K9TA 1I21A 3JVNA 3DDDA 4P45A 4Y49C 4UCMA 1S60A 2GFQA 4F9UA 3S9LA 3NH5A 1MK4A 1YLEA 3KHZA 1RXTA 1YREA 4KS9A 2K5TA 4A95A 4B10A 3MN8A 5I0CA 4KUAA 2Q7BA 1LAMA 3TOAA 2YGWA 4OIDA 4NGQA 4JD6A 4C7HA 4YRHA 4IAVA 3NE7A 3V8IA 2C27A 3LODA 5D8NA 4NXYA 1TKJA 1PCAA 1YLOA 4OKOA 2NSMA 2FCKA 3KKWA 3SJXA 4I49A 4LQGA 4OMEA 3B3VA 1X12A 1I12A 3SI0A 4A94A 1HDUA 2ZW4A 4PK3A 4W9YA 5IX3A 2EK9A 3PGPA 1CPSA 2Z3NA 5JH9A 3RAMA 3KI9A 1B6BA 4KUBA 4MFLA 3TFYA 2V8GA 4H2KA 6CPAA 2PIYA 1XFOA 1JQGA 4J3GA 3RZAA 1R3NA 2CIJA 2ZEMA 2Z3MA 4M6HA 4CYOA 2JBJA 3QAYA 3MGDA 3WABA 3TC8A 2P6GA 2FS5A 3D67A 3H4QA 4PSXA 5LYDA 2PQ8A 2XEGA 2GANA 2PJ6A 2XEIA 3UY5A 2A4NA 2ANPA 1PUAA 2F7VA 4U9ZA 4F8ZA 3KASA 2WZNA 2I79A 1XOVA 2RC4A 2ZEOA 4UEFA 4JZ0A 3MRUA 2Q0YA 4RUHA
chains in the Genus database with same CATH topology
3B3WA 4Z65A 3KR4A 2PJ2A 1LFWA 2PJAA 1VHEA 1BAVA 5LYFA 3FH4A 4KSIA 1TF9A 2Q43A 3BHXA 4IHMA 4NGSA 4R76A 2AFZA 3KL9A 2CF4A 4PXEA 4AXVA 3B3CA 4PPZA 3NH8A 3B7IA 4DYOA 2CTCA 4PXCA 4JYWA 2PJCA 3NFZA 3D7GA 5THWA 4NJRA 1ZG7A 1KWMA 4P4IA 3B3TA 1DE4C 3IO1A 5F09A 3D7DA 2ZEFA 1ELMP 4P4EA 5CBMA 2IMOA 1ELLP 2JBKA 2PJ4A 2V8HA 3SJFA 4OC0A 3PB4X 3FX6A 3VATA 2IJZA 4MHYA 1DTDA 3HLPA 5LYIA 3K2KA 3V7ZA 4A37A 3SI2A 3KZWA 3IJ3A 4A39A 5HXDA 1NSAA 4EMEA 3B2YA 2IQ6A 5JGFA 1YSJA 1CX8A 1LANA 2Q51A 2PJ7A 3FECA 1XJOA 1AYEA 2PCUA 4NGNA 1ZG9A 1Y0RA 3FF3A 4NGRA 2AFSA 2ZENA 2AFMA 3S9MA 4ZI6A 4P4BA 2PJ0A 3H8FA 1XMBA 3KR5A 3L2NA 1Y7EA 2C6PA 8CPAA 4UF4A 2QVPA 4B6ZA 5LYLA 2PVWA 5LRGA 3NH4A 5DS0A 3IIBA 4F9VA 4ZY1A 3PB6X 4YWYA 1Q7LA 1TKFA 1VIXA 1CPXA 2ABZA 3SI1A 2ZELA 5IB9A 4NGTA 3D66A 5K8NA 1F2PA 1R43A 4P4DA 4WWVA 2ZOGA 4TWEA 3WT4A 4OIWA 3DGVA 2G9DA 2OR4A 4ZYQA 4P6YA 2NYQA 3CPAA 2GU2A 3IC1A 2C6CA 4TNUA 4YU9A 2PIZA 3PFEA 4NJQA 4Q7AA 1CBXA 1F57A 3SJGA 3FEDA 2PE3A 4PQAA 1AMPA 1RTQA 4MCPA 2RB7A 1CP7A 3DLJA 2HC9A 2BCOA 4OC2A 2GLJA 3V38A 3BI0A 3S9NA 1XBUA 4EWTA 2CTBA 1Z2LA 4K3NA 5J1QA 2ZEEA 4A38A 2OOTA 2WYRA 4PXDA 1FNOA 2C6GA 3PB8X 3CDXA 2PJBA 3WC7A 3HUVA 3D4UA 2FVGA 2PJ9A 4MHPA 7CPAA 4MXUA 2POKA 1ZLHA 3CT9A 3WC6A 4R7MA 3B3SA 4NFRA 3GLJA 4DJLA 1XRYA 4UIBA 2BO9A 5JM6A 4X2TA 5D29A 3KQZA 4O23A 2AFWA 1VHOA 3N5FA 4MCSA 4UIAA 2GREA 2RFHA 2AFXA 1IY7A 3GUXA 4OC5A 2ZEPA 1M4LA 5K8MA 3VH9A 1H8LA 1GYTA 1CP6A 4DUKA 2EWBA 3FEEA 4FWUA 4ONWA 4NGPA 4MMOA 4FBEA 4PXBA 3KQXA 1CG2A 3LMSA 1YW4A 3PEIA 3I1UA 4BD9A 3FVLA 4ZY0A 2V77A 2O53A 1LAPA 2J9AA 2HB6A 2JEWA 1TF8A 5CPAA 3WC5A 3JRUA 1BPNA 2EK8A 3BXMA 3D7FA 3SJEA 4NGMA 5LRJA 4OC1A 4UEZA 5ELYA 4G1PA 2XEFA 3KGQA 2ZEGA 3NA6A 1VGYA 2QYVA 2AFUA 2V8VA 1TXRA 4UEEA 3TX8A 1YMEA 3KHXA 2AFOA 1BLLE 3PB9X 4X8IA 3QNVA 3GB0A 3LWUA 1ZLIA 4MRIA 2I3CA 5HVGA 2ZEDA 3D7HA 5K8PA 3H8GA 2PRQA 5K8OA 2BOAA 2C1CA 3IWWA 4MHZA 2XEJA 3PFOA 1BPMA 4OC4A 1FT7A 2Q4ZA 3BI1A 4CPAA 4EFDA 1HEEA 1OBRA 5LRKA 1ARLA 4P4FA 4WJBA 2O4HA 1TKHA 1F2OA 1HDQA 1Z5RA 4MCRA 3PRTA 4P44A 4IK2A 4R8FA 4FAIA 3CPXA 2ZEHA 2PVVA 3FJUA 4ZY2A 3T8WA 3IEHA 5I4MA 3PB7X 1PYTB 2QJ8A 4MHNA 4ZX9A 4X3RA 3PBEA 4R6TA 2PJ1A 3D68A 4GM5A 4P10A 1Y0YA 4OC3A 5HVFA 3ISXA 3ISZA 2PJ5A 1QQ9A 2VL1A 3B35A 3RBUA 1ARMA 2DEAA 4MCQA 3VARA 4P4JA 1ZG8A 1EE3P 4OP4A 1IGBA 2PJ3A 2V8DA 4FUUA 1QMUA 3IFEA 2ZOFA 5HVHA 1LOKA 2PJ8A 3H8EA 1Z8LA 1LCPA 3PBBA 2F8HA 3FMCA 1UWYA 1YW6A 4ZX8A 2GLFA 3K9TA 4P45A 3S9LA 4F9UA 3NH5A 3KHZA 3MN8A 1LAMA 4OIDA 4NGQA 4IAVA 5D8NA 1TKJA 1PCAA 1YLOA 4OKOA 2NSMA 3SJXA 4LQGA 4OMEA 3B3VA 3SI0A 4A94A 1HDUA 4W9YA 2EK9A 1CPSA 5JH9A 3RAMA 3KI9A 2V8GA 4H2KA 6CPAA 2PIYA 1XFOA 1JQGA 3RZAA 1R3NA 2CIJA 2ZEMA 2JBJA 3WABA 3TC8A 3D67A 5LYDA 2XEGA 2PJ6A 2XEIA 2ANPA 2F7VA 4F8ZA 3KASA 2WZNA 2ZEOA 4UEFA 4JZ0A 3MRUA 4RUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3W A;  4Z65 A;  3KR4 A;  2PJ2 A;  1LFW A;  2PJA A;  1VHE A;  1BAV A;  5LYF A;  3FH4 A;  4KSI A;  1TF9 A;  2Q43 A;  3BHX A;  4IHM A;  4NGS A;  4R76 A;  2AFZ A;  3KL9 A;  2CF4 A;  4PXE A;  4AXV A;  3B3C A;  4PPZ A;  3NH8 A;  3B7I A;  4DYO A;  2CTC A;  4PXC A;  4JYW A;  2PJC A;  3NFZ A;  3D7G A;  5THW A;  4NJR A;  1ZG7 A;  1KWM A;  4P4I A;  3B3T A;  1DE4 C;  3IO1 A;  5F09 A;  3D7D A;  2ZEF A;  1ELM P;  4P4E A;  5CBM A;  2IMO A;  1ELL P;  2JBK A;  2PJ4 A;  2V8H A;  3SJF A;  4OC0 A;  3PB4 X;  3FX6 A;  3VAT A;  2IJZ A;  4MHY A;  1DTD A;  3HLP A;  5LYI A;  3K2K A;  3V7Z A;  4A37 A;  3SI2 A;  3KZW A;  3IJ3 A;  4A39 A;  5HXD A;  1NSA A;  4EME A;  3B2Y A;  2IQ6 A;  5JGF A;  1YSJ A;  1CX8 A;  1LAN A;  2Q51 A;  2PJ7 A;  3FEC A;  1XJO A;  1AYE A;  2PCU A;  4NGN A;  1ZG9 A;  1Y0R A;  3FF3 A;  4NGR A;  2AFS A;  2ZEN A;  2AFM A;  3S9M A;  4ZI6 A;  4P4B A;  2PJ0 A;  3H8F A;  1XMB A;  3KR5 A;  3L2N A;  1Y7E A;  2C6P A;  8CPA A;  4UF4 A;  2QVP A;  4B6Z A;  5LYL A;  2PVW A;  5LRG A;  3NH4 A;  5DS0 A;  3IIB A;  4F9V A;  4ZY1 A;  3PB6 X;  4YWY A;  1Q7L A;  1TKF A;  1VIX A;  1CPX A;  2ABZ A;  3SI1 A;  2ZEL A;  5IB9 A;  4NGT A;  3D66 A;  5K8N A;  1F2P A;  1R43 A;  4P4D A;  4WWV A;  2ZOG A;  4TWE A;  3WT4 A;  4OIW A;  3DGV A;  2G9D A;  2OR4 A;  4ZYQ A;  4P6Y A;  2NYQ A;  3CPA A;  2GU2 A;  3IC1 A;  2C6C A;  4TNU A;  4YU9 A;  2PIZ A;  3PFE A;  4NJQ A;  4Q7A A;  1CBX A;  1F57 A;  3SJG A;  3FED A;  2PE3 A;  4PQA A;  1AMP A;  1RTQ A;  4MCP A;  2RB7 A;  1CP7 A;  3DLJ A;  2HC9 A;  2BCO A;  4OC2 A;  2GLJ A;  3V38 A;  3BI0 A;  3S9N A;  1XBU A;  4EWT A;  2CTB A;  1Z2L A;  4K3N A;  5J1Q A;  2ZEE A;  4A38 A;  2OOT A;  2WYR A;  4PXD A;  1FNO A;  2C6G A;  3PB8 X;  3CDX A;  2PJB A;  3WC7 A;  3HUV A;  3D4U A;  2FVG A;  2PJ9 A;  4MHP A;  7CPA A;  4MXU A;  2POK A;  1ZLH A;  3CT9 A;  3WC6 A;  4R7M A;  3B3S A;  4NFR A;  3GLJ A;  4DJL A;  1XRY A;  4UIB A;  2BO9 A;  5JM6 A;  4X2T A;  5D29 A;  3KQZ A;  4O23 A;  2AFW A;  1VHO A;  3N5F A;  4MCS A;  4UIA A;  2GRE A;  2RFH A;  2AFX A;  1IY7 A;  3GUX A;  4OC5 A;  2ZEP A;  1M4L A;  5K8M A;  3VH9 A;  1H8L A;  1GYT A;  1CP6 A;  4DUK A;  2EWB A;  3FEE A;  4FWU A;  4ONW A;  4NGP A;  4MMO A;  4FBE A;  4PXB A;  3KQX A;  1CG2 A;  3LMS A;  1YW4 A;  3PEI A;  3I1U A;  4BD9 A;  3FVL A;  4ZY0 A;  2V77 A;  2O53 A;  1LAP A;  2J9A A;  2HB6 A;  2JEW A;  1TF8 A;  5CPA A;  3WC5 A;  3JRU A;  1BPN A;  2EK8 A;  3BXM A;  3D7F A;  3SJE A;  4NGM A;  5LRJ A;  4OC1 A;  4UEZ A;  5ELY A;  4G1P A;  2XEF A;  3KGQ A;  2ZEG A;  3NA6 A;  1VGY A;  2QYV A;  2AFU A;  2V8V A;  1TXR A;  4UEE A;  3TX8 A;  1YME A;  3KHX A;  2AFO A;  1BLL E;  3PB9 X;  4X8I A;  3QNV A;  3GB0 A;  3LWU A;  1ZLI A;  4MRI A;  2I3C A;  5HVG A;  2ZED A;  3D7H A;  5K8P A;  3H8G A;  2PRQ A;  5K8O A;  2BOA A;  2C1C A;  3IWW A;  4MHZ A;  2XEJ A;  3PFO A;  1BPM A;  4OC4 A;  1FT7 A;  2Q4Z A;  3BI1 A;  4CPA A;  4EFD A;  1HEE A;  1OBR A;  5LRK A;  1ARL A;  4P4F A;  4WJB A;  2O4H A;  1TKH A;  1F2O A;  1HDQ A;  1Z5R A;  4MCR A;  3PRT A;  4P44 A;  4IK2 A;  4R8F A;  4FAI A;  3CPX A;  2ZEH A;  2PVV A;  3FJU A;  4ZY2 A;  3T8W A;  3IEH A;  5I4M A;  3PB7 X;  1PYT B;  2QJ8 A;  4MHN A;  4ZX9 A;  4X3R A;  3PBE A;  4R6T A;  2PJ1 A;  3D68 A;  4GM5 A;  4P10 A;  1Y0Y A;  4OC3 A;  5HVF A;  3ISX A;  3ISZ A;  2PJ5 A;  1QQ9 A;  2VL1 A;  3B35 A;  3RBU A;  1ARM A;  2DEA A;  4MCQ A;  3VAR A;  4P4J A;  1ZG8 A;  1EE3 P;  4OP4 A;  1IGB A;  2PJ3 A;  2V8D A;  4FUU A;  1QMU A;  3IFE A;  2ZOF A;  5HVH A;  1LOK A;  2PJ8 A;  3H8E A;  1Z8L A;  1LCP A;  3PBB A;  2F8H A;  3FMC A;  1UWY A;  1YW6 A;  4ZX8 A;  2GLF A;  3K9T A;  4P45 A;  3S9L A;  4F9U A;  3NH5 A;  3KHZ A;  3MN8 A;  1LAM A;  4OID A;  4NGQ A;  4IAV A;  5D8N A;  1TKJ A;  1PCA A;  1YLO A;  4OKO A;  2NSM A;  3SJX A;  4LQG A;  4OME A;  3B3V A;  3SI0 A;  4A94 A;  1HDU A;  4W9Y A;  2EK9 A;  1CPS A;  5JH9 A;  3RAM A;  3KI9 A;  2V8G A;  4H2K A;  6CPA A;  2PIY A;  1XFO A;  1JQG A;  3RZA A;  1R3N A;  2CIJ A;  2ZEM A;  2JBJ A;  3WAB A;  3TC8 A;  3D67 A;  5LYD A;  2XEG A;  2PJ6 A;  2XEI A;  2ANP A;  2F7V A;  4F8Z A;  3KAS A;  2WZN A;  2ZEO A;  4UEF A;  4JZ0 A;  3MRU A;  4RUH A; 
#chains in the Genus database with same CATH topology
 2CNS A;  3B3W A;  4Z65 A;  3KR4 A;  2ZW6 A;  4UA3 A;  1OZP A;  2PJ2 A;  3IGR A;  4U9Y A;  5F47 A;  2PR8 A;  1LFW A;  3JUW A;  4JXQ A;  4A30 A;  2PJA A;  1VHE A;  4PSW A;  1BAV A;  5LYF A;  3FH4 A;  4Q36 A;  4KSI A;  1TF9 A;  4XPD B;  4CRY B;  1KUV A;  2G0B A;  1KUY A;  3GIU A;  2Q43 A;  4GS4 A;  4KOT A;  4KSF A;  3LD2 A;  4JLY A;  3BHX A;  3D2P A;  3EY5 A;  1Z4E A;  4OAD A;  5AG4 A;  2FT0 A;  4IHM A;  3NE8 A;  4NGS A;  1LRZ A;  1S7L A;  2VZZ A;  4HKF A;  3DR6 A;  3TT2 A;  1NE9 A;  2AFZ A;  3KL9 A;  2CF4 A;  4R76 A;  4XPD C;  4PXE A;  2REE A;  4ZBG A;  4AXV A;  4BBH A;  3B3C A;  4PPZ A;  5HMN A;  4XPK A;  3NH8 A;  4UFV A;  3B7I A;  4HNX B;  2GIV A;  4BMH A;  4CAV A;  4M6G A;  4DYO A;  2CTC A;  4PXC A;  4HPS A;  4JYW A;  4QBJ A;  2PJC A;  4KOR A;  4KVX A;  3BLN A;  3NFZ A;  3D7G A;  1QSR A;  5THW A;  4M3S A;  4NJR A;  1ZG7 A;  2OZG A;  1KWM A;  2ZW7 A;  4B5O A;  2Z3P A;  4P4I A;  4HNW B;  1XE4 A;  1DE4 C;  3B3T A;  3GKR A;  3IO1 A;  4LUA A;  5H86 A;  5F09 A;  5IB0 A;  2BL1 A;  3D7D A;  2ZEF A;  1ELM P;  4P4E A;  5CBM A;  2B4B A;  2OZH A;  2IMO A;  1ELL P;  2JBK A;  2PJ4 A;  4A32 A;  2D4O A;  2V8H A;  4KOX A;  3SJF A;  4AVC A;  2G3A A;  4OC0 A;  3PB4 X;  3FX6 A;  3VAT A;  2IJZ A;  1WWZ A;  4CYP A;  3D3S A;  4MHY A;  2DPT A;  3P2F A;  2VI7 A;  1DTD A;  2D4P A;  3HLP A;  4F0Y A;  3F0A A;  5LYI A;  3I3G A;  5F49 A;  3K2K A;  3V7Z A;  4A37 A;  3SI2 A;  4AVA A;  2Y0M A;  4NSQ A;  2JEV A;  3KZW A;  3IJ3 A;  5J8C A;  2Q04 A;  5EC4 A;  3S6H A;  4A39 A;  5C82 A;  1M4D A;  3K9U A;  1Q2D A;  5G22 A;  2Q7S A;  4E2A A;  5A27 A;  2B5G A;  2I00 A;  3BJ8 A;  5HXD A;  2P0W A;  1NSA A;  4EME A;  3B2Y A;  2IQ6 A;  4KVO E;  5JGF A;  4QB9 A;  3CXQ A;  2B5G B;  1YSJ A;  1CX8 A;  4DNC A;  2CNM A;  1LAN A;  2QIR A;  2Q51 A;  5AG6 A;  1M4I A;  4CYQ A;  5JQ4 A;  1Y9W A;  2DF5 A;  1SQH A;  2PJ7 A;  4UWI A;  4CRZ B;  4KOV A;  1MJA A;  1XJO A;  1AYE A;  2PCU A;  3FEC A;  2ZW5 A;  3FIX A;  4NGN A;  1ZG9 A;  3W91 A;  2B4D A;  1Y0R A;  3FF3 A;  4NGR A;  2AFS A;  2ZEN A;  2AFM A;  2X7B A;  1GHE A;  3S9M A;  2Z3K A;  4A2Z A;  4ZI6 A;  4CAE A;  2B4D B;  1Z8X A;  1XEB A;  1J4J A;  4P4B A;  2PJ0 A;  3H8F A;  3EO4 A;  3EXN A;  1XMB A;  3FBU A;  1V0C A;  3GY9 A;  2BEI A;  2CNT A;  3KR5 A;  4C2Y A;  1IYK A;  3L2N A;  1Y7E A;  2C6P A;  8CPA A;  5KTC A;  3F5B A;  4UF4 A;  2B3U A;  2PRB A;  2QVP A;  4B6Z A;  2P6F A;  5LYL A;  2EUI A;  4CGM A;  4MFK A;  2PVW A;  5LRG A;  3NH4 A;  3EC4 A;  5DS0 A;  4YFJ A;  1S7K A;  3IU1 A;  3RYO A;  1IYL A;  3IIB A;  4F9V A;  2JDC A;  3PB6 X;  1NMT A;  3QB8 A;  4ZY1 A;  4H6U A;  4YWY A;  2FSR A;  2R8V A;  4B12 A;  1Q7L A;  1TKF A;  2OB0 A;  1VIX A;  1CPX A;  2ABZ A;  4UCN A;  1M44 A;  2PDO A;  4KOS A;  2ZEL A;  3SI1 A;  5IB9 A;  4QC6 A;  4NGT A;  3D66 A;  4QUS A;  5EBV A;  1S5K A;  1YK3 A;  3CZX A;  4X5K A;  5K8N A;  1F2P A;  1R43 A;  1I1D A;  4P4D A;  4PV6 A;  5F48 A;  5A28 A;  2IL4 A;  5KTA A;  4KLW A;  4WWV A;  2ZOG A;  4TWE A;  4MI4 A;  3WT4 A;  3D8P A;  4OIW A;  3S6G A;  3WR7 A;  3DGV A;  5AG5 A;  2VQY A;  1MJ9 A;  3TO9 A;  2G9D A;  2WUU A;  2OR4 A;  4KLV A;  3VWD A;  4ZYQ A;  3IWG A;  4P6Y A;  3R9E A;  2NYQ A;  3CPA A;  2GU2 A;  3IC1 A;  2C6C A;  1YVO A;  4TNU A;  4YU9 A;  1Z9U A;  2AJ6 A;  2PIZ A;  1ON0 A;  1QSO A;  3PFE A;  5F46 A;  4IF5 A;  4NJQ A;  4Q7A A;  1K4J A;  1CBX A;  1F57 A;  4C2Z A;  2VBQ A;  3FED A;  3SJG A;  2YNE A;  2AE6 A;  3G3S A;  2PE3 A;  1BOB A;  1Z4R A;  4PQA A;  2Q44 A;  3DSB A;  3PP9 A;  4M6I A;  4II9 A;  2PSW A;  1IB1 E;  1AMP A;  3CXS A;  4FD4 A;  2EBJ A;  1RTQ A;  2HQY A;  2HUZ A;  4MCP A;  1KZF A;  2B58 A;  2Z11 A;  2RB7 A;  4IUS A;  4AB7 A;  1XMT A;  4C7I A;  5CNP A;  1IOI A;  1CP7 A;  2HC9 A;  2BCO A;  3DLJ A;  2GLJ A;  4KZT A;  3BI0 A;  4OC2 A;  3V38 A;  1XBU A;  4UFX A;  3S9N A;  4EWT A;  2QML A;  2KCW A;  2CTB A;  3GYA A;  1MJB A;  2DPS A;  4MY0 A;  2ATR A;  1Z2L A;  4K3N A;  4B11 A;  5J1Q A;  2ZEE A;  4XNH B;  5G20 A;  2ARH A;  2OOT A;  2Z3L A;  2WYR A;  4PXD A;  4A33 A;  4A38 A;  3R95 A;  1U6M A;  1FNO A;  2R7H A;  2BSW A;  2C6G A;  2FE7 A;  3PB8 X;  2Z0Z A;  2WPW A;  4F0X A;  1WK4 A;  3LAC A;  3CDX A;  1N71 A;  2PJB A;  3WC7 A;  2ZXV A;  4CAF A;  3HUV A;  4GXH A;  3D4U A;  1Z8T A;  2FVG A;  1A2Z A;  2HV2 A;  3P2H A;  4H89 A;  4ONU A;  1YX0 A;  2PJ9 A;  2YND A;  4L8A A;  4NCZ A;  3SXO A;  1VHS A;  1IU8 A;  4MHP A;  4CYN A;  4YGO A;  4MXU A;  2POK A;  1ZLH A;  3ZJ0 A;  2J8R A;  4FD5 A;  7CPA A;  3CT9 A;  3BJ7 A;  4R3K A;  4R7M A;  3WC6 A;  3TTH A;  3R9G A;  4C2X A;  3B3S A;  4NFR A;  3GLJ A;  4CS0 B;  4DJL A;  1XRY A;  4UIB A;  2BO9 A;  4ZGY B;  2NMT A;  3ZZI A;  4E0A A;  3N7Z A;  4KSA A;  2REF A;  1YGH A;  3S6K A;  5JM6 A;  1QSM A;  4UCP A;  4X2T A;  5D29 A;  4BIN A;  4CAW A;  3KQZ A;  3TOB A;  4O23 A;  2B3V A;  2AFW A;  5G21 A;  1VHO A;  4JWP A;  4NEX A;  3N5F A;  3B8G A;  1XIX A;  2R98 A;  3TO7 A;  3DNS A;  4MCS A;  1ZO0 A;  5G1Z A;  4UIA A;  2GRE A;  1B87 A;  2RFH A;  2AFX A;  1IY7 A;  2QEC A;  3GUX A;  5AGE A;  3W6X A;  3C26 A;  2ZPA A;  3I9S A;  4OC5 A;  2ZEP A;  1M4L A;  2CY2 A;  3F8K A;  1YVK A;  4R9M A;  5K8M A;  3VH9 A;  4RI1 A;  3VWE A;  1H8L A;  1GYT A;  1CP6 A;  1FY7 A;  1CJW A;  2OZU A;  1R57 A;  4M85 A;  4DUK A;  3R1K A;  3SHP A;  2EWB A;  3FEE A;  2Z3O A;  2OH1 A;  4FWU A;  2F5I A;  4ONW A;  4B5P A;  1P0H A;  3FB3 A;  4NGP A;  4MMO A;  4FBE A;  4PXB A;  1IID A;  3KQX A;  4MY3 A;  1CG2 A;  3LMS A;  3RO0 A;  2BUE A;  4MFJ A;  2R1I A;  4B5P B;  1YW4 A;  3PEI A;  1QSN A;  3I1U A;  4BD9 A;  3FVL A;  1XF8 A;  4ZY0 A;  2VEZ A;  2G3T A;  2V77 A;  4R57 A;  2O53 A;  4B14 A;  5C88 A;  1LAP A;  2J9A A;  4XPL A;  3R9F A;  2ODF A;  1S3Z A;  2HB6 A;  2JEW A;  2JDD A;  4MFP A;  4CAX A;  1TF8 A;  5CPA A;  4CGL A;  1BO4 A;  4KVM E;  2EVN A;  3WC5 A;  3JRU A;  4U5Y A;  4MHD A;  1BPN A;  3CXP A;  1IOF A;  2EK8 A;  3BXM A;  3D7F A;  3SJE A;  4NGM A;  3FNC A;  4K30 A;  2WSA A;  5LRJ A;  4OC1 A;  2YNC A;  4UEZ A;  5ELY A;  2FIA A;  4G1P A;  2XEF A;  1KUX A;  2FL4 A;  3KGQ A;  2ZEG A;  3NA6 A;  3W6S A;  1M4G A;  1JWQ A;  1VGY A;  3TE4 A;  3G8W A;  2QYV A;  4C68 A;  3QAH A;  5H84 A;  2AFU A;  2V8V A;  1S7F A;  3TCV A;  1TXR A;  2CXA A;  4UEE A;  4OLL A;  1YR0 A;  3E0K A;  1IIC A;  3TX8 A;  1YME A;  1UFH A;  3KHX A;  4UFW A;  2AFO A;  1BLL E;  3PB9 X;  4AG7 A;  4X8I A;  4KOW A;  2YNC C;  3QNV A;  3T90 A;  3GB0 A;  3LWU A;  5FVJ A;  1ZLI A;  4KOY A;  4MRI A;  4L89 A;  2I3C A;  5DWN A;  5HVG A;  5J8F A;  2ZED A;  2P6E A;  3D7H A;  5K8P A;  2PC1 A;  2PRQ A;  3H8G A;  3OWC A;  3PZJ A;  5K8O A;  1M1D A;  2BOA A;  2C1C A;  4JJX A;  1NSL A;  3IWW A;  2FIW A;  4MHZ A;  1S7N A;  4MFQ A;  4CGN A;  2XEJ A;  2Z10 A;  3PFO A;  1BPM A;  4LX9 A;  3RNZ A;  4OC4 A;  3EFA A;  2EO8 A;  1FT7 A;  3DR8 A;  3IU2 A;  5E96 A;  1PU9 A;  2Q4Z A;  3BI1 A;  4NF1 A;  4PK2 A;  4CPA A;  2WPX A;  4EFD A;  1HEE A;  4AVB A;  2VXK A;  1OBR A;  3T9Y A;  5BWA B;  1Q2Y A;  1TIQ A;  4UBR A;  4LQ6 A;  5IV0 A;  5LRK A;  1ARL A;  4P4F A;  4WJB A;  4MFZ A;  2O4H A;  4CGO A;  1QST A;  1CM0 A;  3TO6 A;  2PR1 A;  4CGP A;  1TKH A;  4KOU A;  2GE3 A;  1F2O A;  1HDQ A;  1Z5R A;  4MCR A;  1P4N A;  2O28 A;  3PRT A;  4H6Z A;  4P44 A;  4HNY B;  3SXN A;  4ORF A;  4IK2 A;  4EVY A;  4R8F A;  4FAI A;  3CPX A;  2OU2 A;  2J8M A;  2ZEH A;  2JLM A;  2PVV A;  2Q4V A;  3FJU A;  4ZY2 A;  4AG9 A;  3T8W A;  3IEH A;  2H5M A;  5KTD A;  5I4M A;  3PB7 X;  1PYT B;  1Y7R A;  3A9L A;  2QJ8 A;  4MHN A;  2Q4Y A;  4ZX9 A;  4QVT A;  5GCN A;  3H5Z A;  4X3R A;  3FRM A;  1Y9K A;  3PBE A;  4R6T A;  2PJ1 A;  1X10 A;  3D68 A;  4GM5 A;  4B13 A;  2FXF A;  1Z8W A;  1Y0Y A;  4OC3 A;  4P10 A;  4FD7 A;  4R3L A;  4XNH C;  5DWM A;  5HVF A;  4Q38 A;  3S6F A;  5EMI A;  3ISX A;  2DXQ A;  4A31 A;  3ISZ A;  1AUG A;  2PJ5 A;  4E8O A;  1QQ9 A;  2VL1 A;  4UWJ A;  3B35 A;  3RBU A;  3D2M A;  4F6A A;  1ARM A;  2DEA A;  4MCQ A;  5AG7 A;  3VAR A;  4P4J A;  3JTK A;  1L0C A;  1VKC A;  1ZG8 A;  1EE3 P;  3IWE A;  4MBU A;  4FD6 A;  4OP4 A;  1IGB A;  4Y49 B;  2PJ3 A;  2V8D A;  4FUU A;  1QMU A;  3IFE A;  5HH1 A;  2ZOF A;  5HVH A;  2J8N A;  1LOK A;  4RN7 A;  3R96 A;  2PJ8 A;  5JPH A;  4RS2 A;  3H8E A;  4R87 A;  1Z8L A;  1LCP A;  1RO5 A;  1Q2C A;  3FXT A;  3PBB A;  4JXR A;  5ISV A;  4MJ8 A;  2F8H A;  3FMC A;  1UWY A;  1YW6 A;  4OAE A;  2VZY A;  3FYN A;  4ZX8 A;  2GLF A;  1YQE A;  3K9T A;  1I21 A;  3JVN A;  3DDD A;  4P45 A;  4Y49 C;  4UCM A;  1S60 A;  2GFQ A;  4F9U A;  3S9L A;  3NH5 A;  1MK4 A;  1YLE A;  3KHZ A;  1RXT A;  1YRE A;  4KS9 A;  2K5T A;  4A95 A;  4B10 A;  3MN8 A;  5I0C A;  4KUA A;  2Q7B A;  1LAM A;  3TOA A;  2YGW A;  4OID A;  4NGQ A;  4JD6 A;  4C7H A;  4YRH A;  4IAV A;  3NE7 A;  3V8I A;  2C27 A;  3LOD A;  5D8N A;  4NXY A;  1TKJ A;  1PCA A;  1YLO A;  4OKO A;  2NSM A;  2FCK A;  3KKW A;  3SJX A;  4I49 A;  4LQG A;  4OME A;  3B3V A;  1X12 A;  1I12 A;  3SI0 A;  4A94 A;  1HDU A;  2ZW4 A;  4PK3 A;  4W9Y A;  5IX3 A;  2EK9 A;  3PGP A;  1CPS A;  2Z3N A;  5JH9 A;  3RAM A;  3KI9 A;  1B6B A;  4KUB A;  4MFL A;  3TFY A;  2V8G A;  4H2K A;  6CPA A;  2PIY A;  1XFO A;  1JQG A;  4J3G A;  3RZA A;  1R3N A;  2CIJ A;  2ZEM A;  2Z3M A;  4M6H A;  4CYO A;  2JBJ A;  3QAY A;  3MGD A;  3WAB A;  3TC8 A;  2P6G A;  2FS5 A;  3D67 A;  3H4Q A;  4PSX A;  5LYD A;  2PQ8 A;  2XEG A;  2GAN A;  2PJ6 A;  2XEI A;  3UY5 A;  2A4N A;  2ANP A;  1PUA A;  2F7V A;  4U9Z A;  4F8Z A;  3KAS A;  2WZN A;  2I79 A;  1XOV A;  2RC4 A;  2ZEO A;  4UEF A;  4JZ0 A;  3MRU A;  2Q0Y A;  4RUH A; 
#chains in the Genus database with same CATH homology
 3B3W A;  4Z65 A;  3KR4 A;  2PJ2 A;  1LFW A;  2PJA A;  1VHE A;  1BAV A;  5LYF A;  3FH4 A;  4KSI A;  1TF9 A;  2Q43 A;  3BHX A;  4IHM A;  4NGS A;  4R76 A;  2AFZ A;  3KL9 A;  2CF4 A;  4PXE A;  4AXV A;  3B3C A;  4PPZ A;  3NH8 A;  3B7I A;  4DYO A;  2CTC A;  4PXC A;  4JYW A;  2PJC A;  3NFZ A;  3D7G A;  5THW A;  4NJR A;  1ZG7 A;  1KWM A;  4P4I A;  3B3T A;  1DE4 C;  3IO1 A;  5F09 A;  3D7D A;  2ZEF A;  1ELM P;  4P4E A;  5CBM A;  2IMO A;  1ELL P;  2JBK A;  2PJ4 A;  2V8H A;  3SJF A;  4OC0 A;  3PB4 X;  3FX6 A;  3VAT A;  2IJZ A;  4MHY A;  1DTD A;  3HLP A;  5LYI A;  3K2K A;  3V7Z A;  4A37 A;  3SI2 A;  3KZW A;  3IJ3 A;  4A39 A;  5HXD A;  1NSA A;  4EME A;  3B2Y A;  2IQ6 A;  5JGF A;  1YSJ A;  1CX8 A;  1LAN A;  2Q51 A;  2PJ7 A;  3FEC A;  1XJO A;  1AYE A;  2PCU A;  4NGN A;  1ZG9 A;  1Y0R A;  3FF3 A;  4NGR A;  2AFS A;  2ZEN A;  2AFM A;  3S9M A;  4ZI6 A;  4P4B A;  2PJ0 A;  3H8F A;  1XMB A;  3KR5 A;  3L2N A;  1Y7E A;  2C6P A;  8CPA A;  4UF4 A;  2QVP A;  4B6Z A;  5LYL A;  2PVW A;  5LRG A;  3NH4 A;  5DS0 A;  3IIB A;  4F9V A;  4ZY1 A;  3PB6 X;  4YWY A;  1Q7L A;  1TKF A;  1VIX A;  1CPX A;  2ABZ A;  3SI1 A;  2ZEL A;  5IB9 A;  4NGT A;  3D66 A;  5K8N A;  1F2P A;  1R43 A;  4P4D A;  4WWV A;  2ZOG A;  4TWE A;  3WT4 A;  4OIW A;  3DGV A;  2G9D A;  2OR4 A;  4ZYQ A;  4P6Y A;  2NYQ A;  3CPA A;  2GU2 A;  3IC1 A;  2C6C A;  4TNU A;  4YU9 A;  2PIZ A;  3PFE A;  4NJQ A;  4Q7A A;  1CBX A;  1F57 A;  3SJG A;  3FED A;  2PE3 A;  4PQA A;  1AMP A;  1RTQ A;  4MCP A;  2RB7 A;  1CP7 A;  3DLJ A;  2HC9 A;  2BCO A;  4OC2 A;  2GLJ A;  3V38 A;  3BI0 A;  3S9N A;  1XBU A;  4EWT A;  2CTB A;  1Z2L A;  4K3N A;  5J1Q A;  2ZEE A;  4A38 A;  2OOT A;  2WYR A;  4PXD A;  1FNO A;  2C6G A;  3PB8 X;  3CDX A;  2PJB A;  3WC7 A;  3HUV A;  3D4U A;  2FVG A;  2PJ9 A;  4MHP A;  7CPA A;  4MXU A;  2POK A;  1ZLH A;  3CT9 A;  3WC6 A;  4R7M A;  3B3S A;  4NFR A;  3GLJ A;  4DJL A;  1XRY A;  4UIB A;  2BO9 A;  5JM6 A;  4X2T A;  5D29 A;  3KQZ A;  4O23 A;  2AFW A;  1VHO A;  3N5F A;  4MCS A;  4UIA A;  2GRE A;  2RFH A;  2AFX A;  1IY7 A;  3GUX A;  4OC5 A;  2ZEP A;  1M4L A;  5K8M A;  3VH9 A;  1H8L A;  1GYT A;  1CP6 A;  4DUK A;  2EWB A;  3FEE A;  4FWU A;  4ONW A;  4NGP A;  4MMO A;  4FBE A;  4PXB A;  3KQX A;  1CG2 A;  3LMS A;  1YW4 A;  3PEI A;  3I1U A;  4BD9 A;  3FVL A;  4ZY0 A;  2V77 A;  2O53 A;  1LAP A;  2J9A A;  2HB6 A;  2JEW A;  1TF8 A;  5CPA A;  3WC5 A;  3JRU A;  1BPN A;  2EK8 A;  3BXM A;  3D7F A;  3SJE A;  4NGM A;  5LRJ A;  4OC1 A;  4UEZ A;  5ELY A;  4G1P A;  2XEF A;  3KGQ A;  2ZEG A;  3NA6 A;  1VGY A;  2QYV A;  2AFU A;  2V8V A;  1TXR A;  4UEE A;  3TX8 A;  1YME A;  3KHX A;  2AFO A;  1BLL E;  3PB9 X;  4X8I A;  3QNV A;  3GB0 A;  3LWU A;  1ZLI A;  4MRI A;  2I3C A;  5HVG A;  2ZED A;  3D7H A;  5K8P A;  3H8G A;  2PRQ A;  5K8O A;  2BOA A;  2C1C A;  3IWW A;  4MHZ A;  2XEJ A;  3PFO A;  1BPM A;  4OC4 A;  1FT7 A;  2Q4Z A;  3BI1 A;  4CPA A;  4EFD A;  1HEE A;  1OBR A;  5LRK A;  1ARL A;  4P4F A;  4WJB A;  2O4H A;  1TKH A;  1F2O A;  1HDQ A;  1Z5R A;  4MCR A;  3PRT A;  4P44 A;  4IK2 A;  4R8F A;  4FAI A;  3CPX A;  2ZEH A;  2PVV A;  3FJU A;  4ZY2 A;  3T8W A;  3IEH A;  5I4M A;  3PB7 X;  1PYT B;  2QJ8 A;  4MHN A;  4ZX9 A;  4X3R A;  3PBE A;  4R6T A;  2PJ1 A;  3D68 A;  4GM5 A;  4P10 A;  1Y0Y A;  4OC3 A;  5HVF A;  3ISX A;  3ISZ A;  2PJ5 A;  1QQ9 A;  2VL1 A;  3B35 A;  3RBU A;  1ARM A;  2DEA A;  4MCQ A;  3VAR A;  4P4J A;  1ZG8 A;  1EE3 P;  4OP4 A;  1IGB A;  2PJ3 A;  2V8D A;  4FUU A;  1QMU A;  3IFE A;  2ZOF A;  5HVH A;  1LOK A;  2PJ8 A;  3H8E A;  1Z8L A;  1LCP A;  3PBB A;  2F8H A;  3FMC A;  1UWY A;  1YW6 A;  4ZX8 A;  2GLF A;  3K9T A;  4P45 A;  3S9L A;  4F9U A;  3NH5 A;  3KHZ A;  3MN8 A;  1LAM A;  4OID A;  4NGQ A;  4IAV A;  5D8N A;  1TKJ A;  1PCA A;  1YLO A;  4OKO A;  2NSM A;  3SJX A;  4LQG A;  4OME A;  3B3V A;  3SI0 A;  4A94 A;  1HDU A;  4W9Y A;  2EK9 A;  1CPS A;  5JH9 A;  3RAM A;  3KI9 A;  2V8G A;  4H2K A;  6CPA A;  2PIY A;  1XFO A;  1JQG A;  3RZA A;  1R3N A;  2CIJ A;  2ZEM A;  2JBJ A;  3WAB A;  3TC8 A;  3D67 A;  5LYD A;  2XEG A;  2PJ6 A;  2XEI A;  2ANP A;  2F7V A;  4F8Z A;  3KAS A;  2WZN A;  2ZEO A;  4UEF A;  4JZ0 A;  3MRU A;  4RUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...