1TF8A

Streptomyces griseus aminopeptidase complexed with l-tryptophan
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
277
structure length
273
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Binding of inhibitory aromatic amino acids to Streptomyces griseus aminopeptidase.
pubmed doi rcsb
total genus 106
structure length 273
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tf8A00
1ELLP 3PBEA 3K9TA 4FAIA 4MXUA 2XEJA 2F8HA 1TKFA 3PBBA 2PJ6A 4NGPA 4R76A 1ZLHA 3FF3A 4R6TA 1BLLE 3RBUA 2PJ8A 2PVVA 3V7ZA 1GYTA 2CTBA 3KASA 2NYQA 1DE4C 2G9DA 2ZEHA 2NSMA 5K8PA 3PEIA 4OC5A 4X3RA 1CP6A 4ZX8A 3PB7X 3D7GA 1LFWA 1NSAA 2PE3A 3WC7A 2C1CA 1AMPA 1Y7EA 3FMCA 1FT7A 2WZNA 3RZAA 1Q7LA 2PVWA 4YU9A 4R8FA 4Q7AA 3D7DA 5ELYA 2GREA 3D66A 3NFZA 1YW6A 1YSJA 3WC5A 2PJ4A 2ZEMA 4UF4A 4OC4A 4NJRA 3L2NA 4X2TA 2O4HA 3KI9A 4PXEA 4DYOA 2PIYA 3SI0A 1HDUA 4P4BA 5D8NA 1TKJA 4ZY1A 3SJXA 5LRJA 1ARLA 4NFRA 3ISZA 1QQ9A 3V38A 2ZEGA 3IC1A 4F9UA 4H2KA 1IY7A 2PJ5A 4A39A 4X8IA 2V8VA 3DGVA 3PB8X 2PJBA 2ZEPA 4TNUA 5I4MA 2ZENA 2I3CA 1ZLIA 1ZG7A 1AYEA 3B3TA 2POKA 3H8EA 4P4JA 1HDQA 2PIZA 2OR4A 2F7VA 4UEFA 3SI1A 4ZI6A 2EWBA 1ZG8A 2AFWA 2EK9A 3B7IA 3B3CA 1JQGA 2ZELA 1F2OA 4P4EA 4DJLA 2XEIA 3CPAA 4P45A 2GU2A 2Q43A 4UEZA 3MN8A 3FEEA 3IIBA 4MCRA 3K2KA 2V77A 2AFOA 3D67A 3FVLA 3IFEA 2ANPA 3I1UA 4LQGA 4NGQA 1CBXA 4MCPA 1IGBA 1Y0YA 1QMUA 1DTDA 3NA6A 1CPSA 1M4LA 3KQZA 3NH4A 1VHEA 3PB9X 5JGFA 1RTQA 1CP7A 1LANA 3B3VA 3TX8A 4NGMA 5DS0A 3D4UA 3CT9A 4W9YA 4UEEA 2PJAA 2PJCA 3PB4X 2RFHA 4MHNA 4K3NA 4NGNA 2ZOGA 4JYWA 4P6YA 1Y0RA 5HXDA 2QYVA 1VIXA 3H8GA 4DUKA 4UIBA 4ZYQA 5LYLA 2PRQA 4ZY0A 2JBKA 4OIDA 4OP4A 1XMBA 1CG2A 1XRYA 3FH4A 4F9VA 4CPAA 1Z8LA 1TKHA 4MRIA 3CPXA 1PYTB 1F2PA 3PFEA 5HVFA 2ZEDA 3D7HA 3D68A 2J9AA 2BO9A 3SJGA 1BPNA 3NH5A 4OMEA 2IMOA 2QVPA 1R3NA 2O53A 2ZEOA 4FBEA 3FECA 5HVHA 4OC1A 4NGSA 2PJ3A 1ZG9A 3S9NA 3SJFA 1ARMA 3VH9A 1LAPA 2Q51A 3KZWA 4OC0A 3IEHA 1PCAA 5K8MA 4OC3A 8CPAA 4WJBA 2WYRA 4IAVA 1TF8A 4FWUA 4FUUA 1CPXA 2RB7A 2V8HA 4F8ZA 2JEWA 3N5FA 3JRUA 1UWYA 3QNVA 4A38A 2AFXA 4NGRA 2CF4A 1KWMA 3SJEA 3HUVA 6CPAA 4YWYA 4JZ0A 3LWUA 2JBJA 5HVGA 2BCOA 4EMEA 5K8OA 2PJ0A 4EWTA 2IQ6A 4GM5A 1LAMA 1VGYA 3SI2A 4O23A 4P10A 3B2YA 1BPMA 1FNOA 2XEGA 2ZEFA 4OKOA 2IJZA 3T8WA 5D29A 1Z5RA 5JH9A 1H8LA 3PRTA 4A94A 4ZY2A 3NH8A 2C6CA 3MRUA 2AFZA 4NJQA 2GLJA 1R43A 1EE3P 4OC2A 1XBUA 4UIAA 4IK2A 3B3SA 4Z65A 3LMSA 3GLJA 5CPAA 2AFUA 2HC9A 3KR4A 2FVGA 4B6ZA 2PJ7A 1HEEA 5JM6A 2AFMA 4TWEA 2BOAA 3IO1A 4P4IA 2PJ1A 3PB6X 5J1QA 3HLPA 4G1PA 1LCPA 1TXRA 4EFDA 4PXDA 3CDXA 2C6PA 3S9MA 4AXVA 4ZX9A 3ISXA 2PCUA 4MCSA 1F57A 2CTCA 4ONWA 3KHXA 5IB9A 3S9LA 3WT4A 2V8DA 3VATA 5LRKA 5LYIA 2PJ9A 3FJUA 3GUXA 3H8FA 3BXMA 1CX8A 1ELMP 3WABA 2OOTA 2ABZA 2EK8A 3DLJA 4P4FA 1XJOA 4P4DA 4R7MA 4PXCA 1VHOA 1Z2LA 3KL9A 1LOKA 4MCQA 3KGQA 4PQAA 2C6GA 7CPAA 2GLFA 5LYFA 5THWA 3BI0A 4PPZA 2V8GA 2AFSA 4RUHA 3IJ3A 4A37A 3BHXA 1OBRA 1BAVA 2Q4ZA 2ZEEA 5K8NA 3IWWA 5LYDA 3D7FA 2VL1A 3B35A 4MMOA 3GB0A 3TC8A 3WC6A 1TF9A 5F09A 2QJ8A 1XFOA 4NGTA 3VARA 3FEDA 1YLOA 2CIJA 2XEFA 3KHZA 4WWVA 4IHMA 3KR5A 2HB6A 3KQXA 3RAMA 4MHZA 4BD9A 4OIWA 3PFOA 2DEAA 3BI1A 4MHPA 2PJ2A 4P44A 1YW4A 4KSIA 3FX6A 5CBMA 4MHYA 1YMEA 4PXBA 3B3WA 2ZOFA 5LRGA
chains in the Genus database with same CATH superfamily
2J8RA 1ELLP 3PBEA 4U5YA 1GHEA 3K9TA 4FAIA 3BJ8A 4MXUA 2XEJA 4UFVA 2F8HA 3FB3A 1TKFA 2K5TA 3RNZA 3PBBA 2PJ6A 1QSTA 4NGPA 3DR6A 5HVFA 2BL1A 3DNSA 4CAXA 4RN7A 5I0CA 2YNCA 1XMTA 2D4PA 4R76A 1ZLHA 4MFJA 3FF3A 4R6TA 1BLLE 3RBUA 1PU9A 4XPDB 2CNSA 2PJ8A 2PVVA 1GYTA 3V7ZA 2CTBA 2NYQA 1DE4C 2G9DA 2ZEHA 3KASA 2NSMA 5K8PA 4KOTA 3ZZIA 3PEIA 1Z4RA 2Z3LA 4OC5A 4X3RA 1CP6A 4ZX8A 3VWEA 3PB7X 3D7GA 2RC4A 1LFWA 1NSAA 2PE3A 3WC7A 4EFDA 4KOVA 2C1CA 2G3TA 2KCWA 1X10A 1AMPA 3EXNA 1Y7EA 3FMCA 4OAEA 1FT7A 2WZNA 1BOBA 3RZAA 1BO4A 1Q7LA 4C7HA 1Y7RA 2PVWA 4YU9A 4A95A 4R8FA 2J8NA 3D7DA 4Q7AA 5ELYA 2GREA 3TTHA 3D66A 4KSFA 3NFZA 5C82A 1YW6A 1YSJA 3QB8A 3UY5A 2ARHA 3WC5A 4F6AA 2PJ4A 4MFPA 2ZEMA 3A9LA 4UF4A 4XPKA 3TO7A 4OC4A 3H4QA 4NJRA 3L2NA 4X2TA 1FY7A 1QSRA 2O4HA 3KI9A 4PXEA 2PIYA 4DYOA 3TOBA 4XPDC 3SI0A 2CY2A 2P0WA 4MFKA 1HDUA 4A31A 2B5GA 4P4BA 3W91A 5D8NA 1Z9UA 1Y9WA 1M4DA 3SXNA 4UFWA 2EVNA 1TKJA 3T9YA 5H84A 4ZY1A 3P2FA 3SJXA 4F0YA 5LRJA 1WWZA 1JWQA 2BSWA 1ARLA 2FIAA 4RI1A 4NFRA 3ISZA 1QQ9A 3FIXA 2G0BA 2G3AA 4MJ8A 3V38A 3NE7A 2ZEGA 3IC1A 4F9UA 4Y49B 2CXAA 2GIVA 3C26A 4H2KA 1Z8XA 2R98A 4UCNA 1IY7A 3QAYA 2PJ5A 4A39A 3ZJ0A 5IX3A 4X8IA 2V8VA 3DGVA 4R9MA 2OZGA 3PB8X 2PJBA 1KUXA 2ZEPA 4TNUA 5I4MA 2ZENA 2I3CA 3F0AA 2GANA 2QECA 1ZLIA 4PSXA 4B5OA 1IIDA 4E8OA 4UCPA 4U9YA 4F0XA 5ISVA 1A2ZA 1ZG7A 2JEVA 5EBVA 4AG9A 1AYEA 3B3TA 2POKA 3H8EA 1S7KA 4P4JA 4QB9A 3CXQA 1HDQA 2PQ8A 5A27A 2PIZA 1PUAA 2Q7SA 2OR4A 3OWCA 4AVAA 2AE6A 2IL4A 2F7VA 2VZZA 4L89A 4UEFA 4PK3A 3SI1A 4ZI6A 2ATRA 2GE3A 3W6SA 2EWBA 2BUEA 1IICA 4FD6A 4C68A 1ZG8A 2JDCA 2AFWA 2CNTA 2Q0YA 2ZPAA 4PV6A 2EK9A 3B7IA 3B3CA 4JLYA 1JQGA 5FVJA 2ZELA 4Y49C 1F2OA 4P4EA 1IYLA 4CAWA 1NSLA 2B3UA 4DJLA 2XEIA 4KOXA 3CPAA 4C2YA 4P45A 2GU2A 2Q43A 3PP9A 3R9FA 4UEZA 4MHDA 1IYKA 3MN8A 3FEEA 4M6GA 4PSWA 3IIBA 3DDDA 2D4OA 1R57A 4KVOE 1CJWA 4MCRA 4XPLA 4GXHA 1I21A 3GY9A 5DWMA 3LODA 3K2KA 4KOYA 2V77A 2AFOA 3S6GA 3D67A 3FVLA 3IFEA 2J8MA 4UBRA 4JD6A 4AVCA 2ANPA 4CRZB 1IU8A 3I1UA 3R1KA 4LQGA 4NGQA 1NMTA 3W6XA 4NEXA 2OZUA 2YGWA 3EFAA 1CBXA 2FSRA 1MJBA 2FCKA 2FIWA 4MCPA 2PR1A 1IGBA 1Y0YA 2I00A 2YNDA 2OU2A 1QMUA 1B87A 1DTDA 4KVXA 3NA6A 1CPSA 1M4LA 3KQZA 3NH4A 4CYOA 4JJXA 4UCMA 2B5GB 1VHEA 3PB9X 4R3KA 5JGFA 1RTQA 5G21A 4KLVA 4KS9A 3IWGA 1S7FA 4EVYA 4II9A 2DPSA 1CP7A 1YX0A 2EO8A 1LANA 3B3VA 3TX8A 3B8GA 4NGMA 1M4IA 5F48A 2Q04A 2FE7A 2Z0ZA 2WPXA 2VI7A 3LD2A 5DS0A 3D4UA 1VHSA 5KTDA 3CT9A 4W9YA 4UEEA 1YLEA 2DPTA 4BBHA 5AGEA 2PJAA 2PJCA 3PB4X 4KOSA 2RFHA 4MHNA 2YNEA 4R87A 3CXSA 4K3NA 4NGNA 4QC6A 3MGDA 1YR0A 2ZOGA 4KSAA 4JYWA 4P6YA 3IGRA 1Y0RA 5HXDA 4MFQA 4CGMA 4FD4A 4QUSA 2WSAA 3F8KA 3JTKA 2VEZA 1XEBA 1B6BA 2QYVA 2AJ6A 1L0CA 1Z8WA 2R7HA 3FNCA 1S7NA 1VIXA 1CM0A 3H8GA 4DUKA 4UIBA 4ZYQA 5LYLA 2O28A 2PRQA 2ZW7A 4ZY0A 2JBKA 2Z3PA 4OIDA 4PK2A 3V8IA 4OP4A 1XMBA 1XOVA 3I3GA 3R96A 4B12A 1IOIA 2FL4A 2FXFA 1CG2A 1XRYA 4HNXB 1YREA 3FH4A 4F9VA 2H5MA 4CPAA 1Z8LA 2Z3KA 4YGOA 1RO5A 4I49A 3IU1A 1MK4A 2VXKA 1TKHA 5C88A 4MRIA 5JPHA 3CPXA 1PYTB 1F2PA 3TO9A 2P6GA 4M3SA 1S3ZA 2ZW6A 1S5KA 2A4NA 2VZYA 2ZEDA 3PFEA 4JWPA 3D7HA 2P6FA 2J9AA 2BO9A 1KUYA 3D68A 1BPNA 3SJGA 1YGHA 4HNWB 3NH5A 4OMEA 1MJAA 2FT0A 2IMOA 1X12A 3H5ZA 2QVPA 4CGLA 1R3NA 4NF1A 1AUGA 2O53A 3DSBA 2ZEOA 4FBEA 3FECA 2HQYA 5HVHA 4BMHA 4OC1A 4CGPA 4NGSA 2PJ3A 4A2ZA 3D2MA 1ZG9A 3R9EA 5F46A 4QVTA 2ZW5A 3S9NA 3SJFA 4A30A 4CYPA 4M6IA 2PC1A 1ARMA 3VH9A 1P4NA 4Q36A 1XIXA 1LAPA 2Q51A 3KZWA 4OC0A 3IEHA 1PCAA 5K8MA 2PSWA 2Q4YA 1OZPA 4B11A 4OC3A 3TCVA 1XF8A 2R8VA 8CPAA 3EC4A 4WJBA 4ZBGA 5G22A 2OB0A 2WYRA 5G20A 1M4GA 1TF8A 4IAVA 3FYNA 2ODFA 5BWAB 4FWUA 1TIQA 2HV2A 4FUUA 4L8AA 1S60A 1CPXA 3KKWA 2RB7A 2V8HA 4H89A 4AB7A 4F8ZA 2JEWA 3IU2A 4B14A 1Q2YA 3N5FA 4CYQA 2PDOA 5AG7A 1XE4A 5HH1A 3G8WA 5IB0A 2EUIA 3JRUA 1UWYA 1N71A 4CYNA 2REEA 2I79A 1IOFA 3VWDA 2JLMA 3QNVA 4HNYB 2AFXA 3EO4A 2CF4A 1KWMA 4NGRA 4UA3A 1LRZA 3SJEA 3HUVA 4XNHB 4A33A 6CPAA 4YWYA 4B10A 4MFZA 4JZ0A 3WR7A 3LWUA 2JBJA 5HVGA 2BCOA 4EMEA 1YK3A 5J8CA 5K8OA 2PJ0A 4EWTA 2IQ6A 4GM5A 1LAMA 1VGYA 3GIUA 2QIRA 2YNCC 3SI2A 4B13A 4ZGYB 3FRMA 3PZJA 4O23A 4MI4A 2DXQA 4FD7A 3S6FA 2B4DA 2B3VA 2Y0MA 4P10A 3B2YA 1YQEA 1BPMA 1FNOA 2XEGA 2ZEFA 4OKOA 2IJZA 4CAEA 3T8WA 5D29A 1Z5RA 4J3GA 1NE9A 4KOWA 3JVNA 4OADA 3I9SA 2Q44A 3TT2A 5JH9A 1H8LA 3PRTA 5DWNA 4A94A 4ONUA 4BINA 5GCNA 2Q7BA 2Z3MA 2ZXVA 1J4JA 3NH8A 1IB1E 2C6CA 3MRUA 4ZY2A 2AFZA 3CZXA 4DNCA 3GKRA 2EBJA 4NJQA 2GLJA 4A32A 4E2AA 1R43A 1EE3P 2HUZA 4Q38A 4KZTA 4OC2A 1XBUA 4YFJA 4UIAA 4IK2A 3B3SA 4Z65A 4GS4A 3LMSA 4IF5A 4E0AA 5HMNA 1QSOA 3E0KA 2CNMA 3GLJA 5CPAA 3EY5A 4LQ6A 2AFUA 3SXOA 4FD5A 3GYAA 4MFLA 2HC9A 2Z3NA 1ON0A 3KR4A 2FVGA 4B6ZA 2PJ7A 5G1ZA 2GFQA 1HEEA 5JM6A 2AFMA 4M6HA 4NXYA 4X5KA 4TWEA 2BOAA 2BEIA 3IO1A 1K4JA 4P4IA 5H86A 4KORA 2PJ1A 3PB6X 5J1QA 4KUBA 3HLPA 4G1PA 2B58A 1LCPA 1TXRA 4CAFA 4NSQA 5EC4A 4PXDA 3CDXA 2C6PA 3S9MA 4CAVA 4B5PA 4KUAA 4AXVA 4ZX9A 3ISXA 1YVOA 2JDDA 2Z10A 4YRHA 1Y9KA 2PCUA 1I1DA 2VQYA 2P6EA 4MY0A 4MCSA 5F47A 1QSMA 2F5IA 1F57A 2CTCA 2WUUA 2Z3OA 3KHXA 4ONWA 4CGNA 3RYOA 5IB9A 4C7IA 3S9LA 3WT4A 4KLWA 2V8DA 4UWJA 3VATA 1M1DA 3G3SA 4CS0B 3FXTA 3CXPA 3S6HA 5LRKA 2PR8A 4JXQA 4R57A 1Q2CA 5KTCA 5LYIA 2WPWA 1V0CA 2PJ9A 2X7BA 4A38A 3SHPA 3FJUA 2B4BA 3P2HA 3GUXA 3H8FA 3BXMA 2R1IA 1CX8A 1ELMP 3WABA 2REFA 2OOTA 3BLNA 2ABZA 2EK8A 1Z4EA 5AG6A 4QBJA 3DLJA 4NCZA 4MY3A 1UFHA 4P4FA 4AG7A 4U9ZA 1XJOA 2NMTA 4P4DA 4R3LA 2Z11A 3K9UA 3TO6A 4AVBA 4CGOA 4R7MA 3IWEA 4PXCA 1VHOA 1Z2LA 3KL9A 1LOKA 5J8FA 2C27A 5KTAA 2B4DB 3QAHA 4C2ZA 4KOUA 4IUSA 4MCQA 3KGQA 3R9GA 1SQHA 4PQAA 2C6GA 1QSNA 3D3SA 7CPAA 2GLFA 5LYFA 3PGPA 5THWA 3BI0A 4PPZA 3TE4A 1KUVA 3N7ZA 3D8PA 2V8GA 1S7LA 3LACA 2AFSA 1WK4A 2DF5A 3IJ3A 4A37A 4RUHA 3BHXA 5A28A 3T90A 1OBRA 4CRYB 1BAVA 1YVKA 2Q4ZA 2ZEEA 5K8NA 3IWWA 5LYDA 4UFXA 3D2PA 3D7FA 2VL1A 3JUWA 4K30A 4H6ZA 5EMIA 4UWIA 3B35A 4JXRA 4ORFA 1ZO0A 1I12A 4MMOA 3GB0A 3R95A 3TC8A 3WC6A 1VKCA 4RS2A 2VBQA 1TF9A 1P0HA 3FBUA 5F09A 2QJ8A 1XFOA 4NGTA 3BJ7A 5JQ4A 3VARA 1U6MA 3FEDA 5AG4A 1YLOA 4KVME 4M85A 4C2XA 2CIJA 1Z8TA 2PRBA 2XEFA 3KHZA 4LUAA 3TFYA 4H6UA 3TOAA 4B5PB 4WWVA 4IHMA 3KR5A 4LX9A 5CNPA 2HB6A 2Q4VA 3KQXA 3RAMA 1M44A 4OLLA 2ZW4A 4MHZA 4BD9A 4OIWA 3PFOA 5AG5A 2DEAA 3BI1A 3RO0A 4MHPA 5F49A 2PJ2A 1KZFA 4P44A 3S6KA 1YW4A 4KSIA 1MJ9A 1Q2DA 3FX6A 2OZHA 2FS5A 5E96A 5IV0A 5CBMA 4HKFA 4MHYA 4XNHC 2QMLA 1YMEA 4HPSA 4MBUA 4PXBA 3F5BA 3B3WA 2ZOFA 1RXTA 3DR8A 2OH1A 3NE8A 5LRGA
chains in the Genus database with same CATH topology
1ELLP 3PBEA 3K9TA 4FAIA 4MXUA 2XEJA 2F8HA 1TKFA 3PBBA 2PJ6A 4NGPA 4R76A 1ZLHA 3FF3A 4R6TA 1BLLE 3RBUA 2PJ8A 2PVVA 3V7ZA 1GYTA 2CTBA 3KASA 2NYQA 1DE4C 2G9DA 2ZEHA 2NSMA 5K8PA 3PEIA 4OC5A 4X3RA 1CP6A 4ZX8A 3PB7X 3D7GA 1LFWA 1NSAA 2PE3A 3WC7A 2C1CA 1AMPA 1Y7EA 3FMCA 1FT7A 2WZNA 3RZAA 1Q7LA 2PVWA 4YU9A 4R8FA 4Q7AA 3D7DA 5ELYA 2GREA 3D66A 3NFZA 1YW6A 1YSJA 3WC5A 2PJ4A 2ZEMA 4UF4A 4OC4A 4NJRA 3L2NA 4X2TA 2O4HA 3KI9A 4PXEA 4DYOA 2PIYA 3SI0A 1HDUA 4P4BA 5D8NA 1TKJA 4ZY1A 3SJXA 5LRJA 1ARLA 4NFRA 3ISZA 1QQ9A 3V38A 2ZEGA 3IC1A 4F9UA 4H2KA 1IY7A 2PJ5A 4A39A 4X8IA 2V8VA 3DGVA 3PB8X 2PJBA 2ZEPA 4TNUA 5I4MA 2ZENA 2I3CA 1ZLIA 1ZG7A 1AYEA 3B3TA 2POKA 3H8EA 4P4JA 1HDQA 2PIZA 2OR4A 2F7VA 4UEFA 3SI1A 4ZI6A 2EWBA 1ZG8A 2AFWA 2EK9A 3B7IA 3B3CA 1JQGA 2ZELA 1F2OA 4P4EA 4DJLA 2XEIA 3CPAA 4P45A 2GU2A 2Q43A 4UEZA 3MN8A 3FEEA 3IIBA 4MCRA 3K2KA 2V77A 2AFOA 3D67A 3FVLA 3IFEA 2ANPA 3I1UA 4LQGA 4NGQA 1CBXA 4MCPA 1IGBA 1Y0YA 1QMUA 1DTDA 3NA6A 1CPSA 1M4LA 3KQZA 3NH4A 1VHEA 3PB9X 5JGFA 1RTQA 1CP7A 1LANA 3B3VA 3TX8A 4NGMA 5DS0A 3D4UA 3CT9A 4W9YA 4UEEA 2PJAA 2PJCA 3PB4X 2RFHA 4MHNA 4K3NA 4NGNA 2ZOGA 4JYWA 4P6YA 1Y0RA 5HXDA 2QYVA 1VIXA 3H8GA 4DUKA 4UIBA 4ZYQA 5LYLA 2PRQA 4ZY0A 2JBKA 4OIDA 4OP4A 1XMBA 1CG2A 1XRYA 3FH4A 4F9VA 4CPAA 1Z8LA 1TKHA 4MRIA 3CPXA 1PYTB 1F2PA 3PFEA 5HVFA 2ZEDA 3D7HA 3D68A 2J9AA 2BO9A 3SJGA 1BPNA 3NH5A 4OMEA 2IMOA 2QVPA 1R3NA 2O53A 2ZEOA 4FBEA 3FECA 5HVHA 4OC1A 4NGSA 2PJ3A 1ZG9A 3S9NA 3SJFA 1ARMA 3VH9A 1LAPA 2Q51A 3KZWA 4OC0A 3IEHA 1PCAA 5K8MA 4OC3A 8CPAA 4WJBA 2WYRA 4IAVA 1TF8A 4FWUA 4FUUA 1CPXA 2RB7A 2V8HA 4F8ZA 2JEWA 3N5FA 3JRUA 1UWYA 3QNVA 4A38A 2AFXA 4NGRA 2CF4A 1KWMA 3SJEA 3HUVA 6CPAA 4YWYA 4JZ0A 3LWUA 2JBJA 5HVGA 2BCOA 4EMEA 5K8OA 2PJ0A 4EWTA 2IQ6A 4GM5A 1LAMA 1VGYA 3SI2A 4O23A 4P10A 3B2YA 1BPMA 1FNOA 2XEGA 2ZEFA 4OKOA 2IJZA 3T8WA 5D29A 1Z5RA 5JH9A 1H8LA 3PRTA 4A94A 4ZY2A 3NH8A 2C6CA 3MRUA 2AFZA 4NJQA 2GLJA 1R43A 1EE3P 4OC2A 1XBUA 4UIAA 4IK2A 3B3SA 4Z65A 3LMSA 3GLJA 5CPAA 2AFUA 2HC9A 3KR4A 2FVGA 4B6ZA 2PJ7A 1HEEA 5JM6A 2AFMA 4TWEA 2BOAA 3IO1A 4P4IA 2PJ1A 3PB6X 5J1QA 3HLPA 4G1PA 1LCPA 1TXRA 4EFDA 4PXDA 3CDXA 2C6PA 3S9MA 4AXVA 4ZX9A 3ISXA 2PCUA 4MCSA 1F57A 2CTCA 4ONWA 3KHXA 5IB9A 3S9LA 3WT4A 2V8DA 3VATA 5LRKA 5LYIA 2PJ9A 3FJUA 3GUXA 3H8FA 3BXMA 1CX8A 1ELMP 3WABA 2OOTA 2ABZA 2EK8A 3DLJA 4P4FA 1XJOA 4P4DA 4R7MA 4PXCA 1VHOA 1Z2LA 3KL9A 1LOKA 4MCQA 3KGQA 4PQAA 2C6GA 7CPAA 2GLFA 5LYFA 5THWA 3BI0A 4PPZA 2V8GA 2AFSA 4RUHA 3IJ3A 4A37A 3BHXA 1OBRA 1BAVA 2Q4ZA 2ZEEA 5K8NA 3IWWA 5LYDA 3D7FA 2VL1A 3B35A 4MMOA 3GB0A 3TC8A 3WC6A 1TF9A 5F09A 2QJ8A 1XFOA 4NGTA 3VARA 3FEDA 1YLOA 2CIJA 2XEFA 3KHZA 4WWVA 4IHMA 3KR5A 2HB6A 3KQXA 3RAMA 4MHZA 4BD9A 4OIWA 3PFOA 2DEAA 3BI1A 4MHPA 2PJ2A 4P44A 1YW4A 4KSIA 3FX6A 5CBMA 4MHYA 1YMEA 4PXBA 3B3WA 2ZOFA 5LRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELL P;  3PBE A;  3K9T A;  4FAI A;  4MXU A;  2XEJ A;  2F8H A;  1TKF A;  3PBB A;  2PJ6 A;  4NGP A;  4R76 A;  1ZLH A;  3FF3 A;  4R6T A;  1BLL E;  3RBU A;  2PJ8 A;  2PVV A;  3V7Z A;  1GYT A;  2CTB A;  3KAS A;  2NYQ A;  1DE4 C;  2G9D A;  2ZEH A;  2NSM A;  5K8P A;  3PEI A;  4OC5 A;  4X3R A;  1CP6 A;  4ZX8 A;  3PB7 X;  3D7G A;  1LFW A;  1NSA A;  2PE3 A;  3WC7 A;  2C1C A;  1AMP A;  1Y7E A;  3FMC A;  1FT7 A;  2WZN A;  3RZA A;  1Q7L A;  2PVW A;  4YU9 A;  4R8F A;  4Q7A A;  3D7D A;  5ELY A;  2GRE A;  3D66 A;  3NFZ A;  1YW6 A;  1YSJ A;  3WC5 A;  2PJ4 A;  2ZEM A;  4UF4 A;  4OC4 A;  4NJR A;  3L2N A;  4X2T A;  2O4H A;  3KI9 A;  4PXE A;  4DYO A;  2PIY A;  3SI0 A;  1HDU A;  4P4B A;  5D8N A;  1TKJ A;  4ZY1 A;  3SJX A;  5LRJ A;  1ARL A;  4NFR A;  3ISZ A;  1QQ9 A;  3V38 A;  2ZEG A;  3IC1 A;  4F9U A;  4H2K A;  1IY7 A;  2PJ5 A;  4A39 A;  4X8I A;  2V8V A;  3DGV A;  3PB8 X;  2PJB A;  2ZEP A;  4TNU A;  5I4M A;  2ZEN A;  2I3C A;  1ZLI A;  1ZG7 A;  1AYE A;  3B3T A;  2POK A;  3H8E A;  4P4J A;  1HDQ A;  2PIZ A;  2OR4 A;  2F7V A;  4UEF A;  3SI1 A;  4ZI6 A;  2EWB A;  1ZG8 A;  2AFW A;  2EK9 A;  3B7I A;  3B3C A;  1JQG A;  2ZEL A;  1F2O A;  4P4E A;  4DJL A;  2XEI A;  3CPA A;  4P45 A;  2GU2 A;  2Q43 A;  4UEZ A;  3MN8 A;  3FEE A;  3IIB A;  4MCR A;  3K2K A;  2V77 A;  2AFO A;  3D67 A;  3FVL A;  3IFE A;  2ANP A;  3I1U A;  4LQG A;  4NGQ A;  1CBX A;  4MCP A;  1IGB A;  1Y0Y A;  1QMU A;  1DTD A;  3NA6 A;  1CPS A;  1M4L A;  3KQZ A;  3NH4 A;  1VHE A;  3PB9 X;  5JGF A;  1RTQ A;  1CP7 A;  1LAN A;  3B3V A;  3TX8 A;  4NGM A;  5DS0 A;  3D4U A;  3CT9 A;  4W9Y A;  4UEE A;  2PJA A;  2PJC A;  3PB4 X;  2RFH A;  4MHN A;  4K3N A;  4NGN A;  2ZOG A;  4JYW A;  4P6Y A;  1Y0R A;  5HXD A;  2QYV A;  1VIX A;  3H8G A;  4DUK A;  4UIB A;  4ZYQ A;  5LYL A;  2PRQ A;  4ZY0 A;  2JBK A;  4OID A;  4OP4 A;  1XMB A;  1CG2 A;  1XRY A;  3FH4 A;  4F9V A;  4CPA A;  1Z8L A;  1TKH A;  4MRI A;  3CPX A;  1PYT B;  1F2P A;  3PFE A;  5HVF A;  2ZED A;  3D7H A;  3D68 A;  2J9A A;  2BO9 A;  3SJG A;  1BPN A;  3NH5 A;  4OME A;  2IMO A;  2QVP A;  1R3N A;  2O53 A;  2ZEO A;  4FBE A;  3FEC A;  5HVH A;  4OC1 A;  4NGS A;  2PJ3 A;  1ZG9 A;  3S9N A;  3SJF A;  1ARM A;  3VH9 A;  1LAP A;  2Q51 A;  3KZW A;  4OC0 A;  3IEH A;  1PCA A;  5K8M A;  4OC3 A;  8CPA A;  4WJB A;  2WYR A;  4IAV A;  1TF8 A;  4FWU A;  4FUU A;  1CPX A;  2RB7 A;  2V8H A;  4F8Z A;  2JEW A;  3N5F A;  3JRU A;  1UWY A;  3QNV A;  4A38 A;  2AFX A;  4NGR A;  2CF4 A;  1KWM A;  3SJE A;  3HUV A;  6CPA A;  4YWY A;  4JZ0 A;  3LWU A;  2JBJ A;  5HVG A;  2BCO A;  4EME A;  5K8O A;  2PJ0 A;  4EWT A;  2IQ6 A;  4GM5 A;  1LAM A;  1VGY A;  3SI2 A;  4O23 A;  4P10 A;  3B2Y A;  1BPM A;  1FNO A;  2XEG A;  2ZEF A;  4OKO A;  2IJZ A;  3T8W A;  5D29 A;  1Z5R A;  5JH9 A;  1H8L A;  3PRT A;  4A94 A;  4ZY2 A;  3NH8 A;  2C6C A;  3MRU A;  2AFZ A;  4NJQ A;  2GLJ A;  1R43 A;  1EE3 P;  4OC2 A;  1XBU A;  4UIA A;  4IK2 A;  3B3S A;  4Z65 A;  3LMS A;  3GLJ A;  5CPA A;  2AFU A;  2HC9 A;  3KR4 A;  2FVG A;  4B6Z A;  2PJ7 A;  1HEE A;  5JM6 A;  2AFM A;  4TWE A;  2BOA A;  3IO1 A;  4P4I A;  2PJ1 A;  3PB6 X;  5J1Q A;  3HLP A;  4G1P A;  1LCP A;  1TXR A;  4EFD A;  4PXD A;  3CDX A;  2C6P A;  3S9M A;  4AXV A;  4ZX9 A;  3ISX A;  2PCU A;  4MCS A;  1F57 A;  2CTC A;  4ONW A;  3KHX A;  5IB9 A;  3S9L A;  3WT4 A;  2V8D A;  3VAT A;  5LRK A;  5LYI A;  2PJ9 A;  3FJU A;  3GUX A;  3H8F A;  3BXM A;  1CX8 A;  1ELM P;  3WAB A;  2OOT A;  2ABZ A;  2EK8 A;  3DLJ A;  4P4F A;  1XJO A;  4P4D A;  4R7M A;  4PXC A;  1VHO A;  1Z2L A;  3KL9 A;  1LOK A;  4MCQ A;  3KGQ A;  4PQA A;  2C6G A;  7CPA A;  2GLF A;  5LYF A;  5THW A;  3BI0 A;  4PPZ A;  2V8G A;  2AFS A;  4RUH A;  3IJ3 A;  4A37 A;  3BHX A;  1OBR A;  1BAV A;  2Q4Z A;  2ZEE A;  5K8N A;  3IWW A;  5LYD A;  3D7F A;  2VL1 A;  3B35 A;  4MMO A;  3GB0 A;  3TC8 A;  3WC6 A;  1TF9 A;  5F09 A;  2QJ8 A;  1XFO A;  4NGT A;  3VAR A;  3FED A;  1YLO A;  2CIJ A;  2XEF A;  3KHZ A;  4WWV A;  4IHM A;  3KR5 A;  2HB6 A;  3KQX A;  3RAM A;  4MHZ A;  4BD9 A;  4OIW A;  3PFO A;  2DEA A;  3BI1 A;  4MHP A;  2PJ2 A;  4P44 A;  1YW4 A;  4KSI A;  3FX6 A;  5CBM A;  4MHY A;  1YME A;  4PXB A;  3B3W A;  2ZOF A;  5LRG A; 
#chains in the Genus database with same CATH topology
 2J8R A;  1ELL P;  3PBE A;  4U5Y A;  1GHE A;  3K9T A;  4FAI A;  3BJ8 A;  4MXU A;  2XEJ A;  4UFV A;  2F8H A;  3FB3 A;  1TKF A;  2K5T A;  3RNZ A;  3PBB A;  2PJ6 A;  1QST A;  4NGP A;  3DR6 A;  5HVF A;  2BL1 A;  3DNS A;  4CAX A;  4RN7 A;  5I0C A;  2YNC A;  1XMT A;  2D4P A;  4R76 A;  1ZLH A;  4MFJ A;  3FF3 A;  4R6T A;  1BLL E;  3RBU A;  1PU9 A;  4XPD B;  2CNS A;  2PJ8 A;  2PVV A;  1GYT A;  3V7Z A;  2CTB A;  2NYQ A;  1DE4 C;  2G9D A;  2ZEH A;  3KAS A;  2NSM A;  5K8P A;  4KOT A;  3ZZI A;  3PEI A;  1Z4R A;  2Z3L A;  4OC5 A;  4X3R A;  1CP6 A;  4ZX8 A;  3VWE A;  3PB7 X;  3D7G A;  2RC4 A;  1LFW A;  1NSA A;  2PE3 A;  3WC7 A;  4EFD A;  4KOV A;  2C1C A;  2G3T A;  2KCW A;  1X10 A;  1AMP A;  3EXN A;  1Y7E A;  3FMC A;  4OAE A;  1FT7 A;  2WZN A;  1BOB A;  3RZA A;  1BO4 A;  1Q7L A;  4C7H A;  1Y7R A;  2PVW A;  4YU9 A;  4A95 A;  4R8F A;  2J8N A;  3D7D A;  4Q7A A;  5ELY A;  2GRE A;  3TTH A;  3D66 A;  4KSF A;  3NFZ A;  5C82 A;  1YW6 A;  1YSJ A;  3QB8 A;  3UY5 A;  2ARH A;  3WC5 A;  4F6A A;  2PJ4 A;  4MFP A;  2ZEM A;  3A9L A;  4UF4 A;  4XPK A;  3TO7 A;  4OC4 A;  3H4Q A;  4NJR A;  3L2N A;  4X2T A;  1FY7 A;  1QSR A;  2O4H A;  3KI9 A;  4PXE A;  2PIY A;  4DYO A;  3TOB A;  4XPD C;  3SI0 A;  2CY2 A;  2P0W A;  4MFK A;  1HDU A;  4A31 A;  2B5G A;  4P4B A;  3W91 A;  5D8N A;  1Z9U A;  1Y9W A;  1M4D A;  3SXN A;  4UFW A;  2EVN A;  1TKJ A;  3T9Y A;  5H84 A;  4ZY1 A;  3P2F A;  3SJX A;  4F0Y A;  5LRJ A;  1WWZ A;  1JWQ A;  2BSW A;  1ARL A;  2FIA A;  4RI1 A;  4NFR A;  3ISZ A;  1QQ9 A;  3FIX A;  2G0B A;  2G3A A;  4MJ8 A;  3V38 A;  3NE7 A;  2ZEG A;  3IC1 A;  4F9U A;  4Y49 B;  2CXA A;  2GIV A;  3C26 A;  4H2K A;  1Z8X A;  2R98 A;  4UCN A;  1IY7 A;  3QAY A;  2PJ5 A;  4A39 A;  3ZJ0 A;  5IX3 A;  4X8I A;  2V8V A;  3DGV A;  4R9M A;  2OZG A;  3PB8 X;  2PJB A;  1KUX A;  2ZEP A;  4TNU A;  5I4M A;  2ZEN A;  2I3C A;  3F0A A;  2GAN A;  2QEC A;  1ZLI A;  4PSX A;  4B5O A;  1IID A;  4E8O A;  4UCP A;  4U9Y A;  4F0X A;  5ISV A;  1A2Z A;  1ZG7 A;  2JEV A;  5EBV A;  4AG9 A;  1AYE A;  3B3T A;  2POK A;  3H8E A;  1S7K A;  4P4J A;  4QB9 A;  3CXQ A;  1HDQ A;  2PQ8 A;  5A27 A;  2PIZ A;  1PUA A;  2Q7S A;  2OR4 A;  3OWC A;  4AVA A;  2AE6 A;  2IL4 A;  2F7V A;  2VZZ A;  4L89 A;  4UEF A;  4PK3 A;  3SI1 A;  4ZI6 A;  2ATR A;  2GE3 A;  3W6S A;  2EWB A;  2BUE A;  1IIC A;  4FD6 A;  4C68 A;  1ZG8 A;  2JDC A;  2AFW A;  2CNT A;  2Q0Y A;  2ZPA A;  4PV6 A;  2EK9 A;  3B7I A;  3B3C A;  4JLY A;  1JQG A;  5FVJ A;  2ZEL A;  4Y49 C;  1F2O A;  4P4E A;  1IYL A;  4CAW A;  1NSL A;  2B3U A;  4DJL A;  2XEI A;  4KOX A;  3CPA A;  4C2Y A;  4P45 A;  2GU2 A;  2Q43 A;  3PP9 A;  3R9F A;  4UEZ A;  4MHD A;  1IYK A;  3MN8 A;  3FEE A;  4M6G A;  4PSW A;  3IIB A;  3DDD A;  2D4O A;  1R57 A;  4KVO E;  1CJW A;  4MCR A;  4XPL A;  4GXH A;  1I21 A;  3GY9 A;  5DWM A;  3LOD A;  3K2K A;  4KOY A;  2V77 A;  2AFO A;  3S6G A;  3D67 A;  3FVL A;  3IFE A;  2J8M A;  4UBR A;  4JD6 A;  4AVC A;  2ANP A;  4CRZ B;  1IU8 A;  3I1U A;  3R1K A;  4LQG A;  4NGQ A;  1NMT A;  3W6X A;  4NEX A;  2OZU A;  2YGW A;  3EFA A;  1CBX A;  2FSR A;  1MJB A;  2FCK A;  2FIW A;  4MCP A;  2PR1 A;  1IGB A;  1Y0Y A;  2I00 A;  2YND A;  2OU2 A;  1QMU A;  1B87 A;  1DTD A;  4KVX A;  3NA6 A;  1CPS A;  1M4L A;  3KQZ A;  3NH4 A;  4CYO A;  4JJX A;  4UCM A;  2B5G B;  1VHE A;  3PB9 X;  4R3K A;  5JGF A;  1RTQ A;  5G21 A;  4KLV A;  4KS9 A;  3IWG A;  1S7F A;  4EVY A;  4II9 A;  2DPS A;  1CP7 A;  1YX0 A;  2EO8 A;  1LAN A;  3B3V A;  3TX8 A;  3B8G A;  4NGM A;  1M4I A;  5F48 A;  2Q04 A;  2FE7 A;  2Z0Z A;  2WPX A;  2VI7 A;  3LD2 A;  5DS0 A;  3D4U A;  1VHS A;  5KTD A;  3CT9 A;  4W9Y A;  4UEE A;  1YLE A;  2DPT A;  4BBH A;  5AGE A;  2PJA A;  2PJC A;  3PB4 X;  4KOS A;  2RFH A;  4MHN A;  2YNE A;  4R87 A;  3CXS A;  4K3N A;  4NGN A;  4QC6 A;  3MGD A;  1YR0 A;  2ZOG A;  4KSA A;  4JYW A;  4P6Y A;  3IGR A;  1Y0R A;  5HXD A;  4MFQ A;  4CGM A;  4FD4 A;  4QUS A;  2WSA A;  3F8K A;  3JTK A;  2VEZ A;  1XEB A;  1B6B A;  2QYV A;  2AJ6 A;  1L0C A;  1Z8W A;  2R7H A;  3FNC A;  1S7N A;  1VIX A;  1CM0 A;  3H8G A;  4DUK A;  4UIB A;  4ZYQ A;  5LYL A;  2O28 A;  2PRQ A;  2ZW7 A;  4ZY0 A;  2JBK A;  2Z3P A;  4OID A;  4PK2 A;  3V8I A;  4OP4 A;  1XMB A;  1XOV A;  3I3G A;  3R96 A;  4B12 A;  1IOI A;  2FL4 A;  2FXF A;  1CG2 A;  1XRY A;  4HNX B;  1YRE A;  3FH4 A;  4F9V A;  2H5M A;  4CPA A;  1Z8L A;  2Z3K A;  4YGO A;  1RO5 A;  4I49 A;  3IU1 A;  1MK4 A;  2VXK A;  1TKH A;  5C88 A;  4MRI A;  5JPH A;  3CPX A;  1PYT B;  1F2P A;  3TO9 A;  2P6G A;  4M3S A;  1S3Z A;  2ZW6 A;  1S5K A;  2A4N A;  2VZY A;  2ZED A;  3PFE A;  4JWP A;  3D7H A;  2P6F A;  2J9A A;  2BO9 A;  1KUY A;  3D68 A;  1BPN A;  3SJG A;  1YGH A;  4HNW B;  3NH5 A;  4OME A;  1MJA A;  2FT0 A;  2IMO A;  1X12 A;  3H5Z A;  2QVP A;  4CGL A;  1R3N A;  4NF1 A;  1AUG A;  2O53 A;  3DSB A;  2ZEO A;  4FBE A;  3FEC A;  2HQY A;  5HVH A;  4BMH A;  4OC1 A;  4CGP A;  4NGS A;  2PJ3 A;  4A2Z A;  3D2M A;  1ZG9 A;  3R9E A;  5F46 A;  4QVT A;  2ZW5 A;  3S9N A;  3SJF A;  4A30 A;  4CYP A;  4M6I A;  2PC1 A;  1ARM A;  3VH9 A;  1P4N A;  4Q36 A;  1XIX A;  1LAP A;  2Q51 A;  3KZW A;  4OC0 A;  3IEH A;  1PCA A;  5K8M A;  2PSW A;  2Q4Y A;  1OZP A;  4B11 A;  4OC3 A;  3TCV A;  1XF8 A;  2R8V A;  8CPA A;  3EC4 A;  4WJB A;  4ZBG A;  5G22 A;  2OB0 A;  2WYR A;  5G20 A;  1M4G A;  1TF8 A;  4IAV A;  3FYN A;  2ODF A;  5BWA B;  4FWU A;  1TIQ A;  2HV2 A;  4FUU A;  4L8A A;  1S60 A;  1CPX A;  3KKW A;  2RB7 A;  2V8H A;  4H89 A;  4AB7 A;  4F8Z A;  2JEW A;  3IU2 A;  4B14 A;  1Q2Y A;  3N5F A;  4CYQ A;  2PDO A;  5AG7 A;  1XE4 A;  5HH1 A;  3G8W A;  5IB0 A;  2EUI A;  3JRU A;  1UWY A;  1N71 A;  4CYN A;  2REE A;  2I79 A;  1IOF A;  3VWD A;  2JLM A;  3QNV A;  4HNY B;  2AFX A;  3EO4 A;  2CF4 A;  1KWM A;  4NGR A;  4UA3 A;  1LRZ A;  3SJE A;  3HUV A;  4XNH B;  4A33 A;  6CPA A;  4YWY A;  4B10 A;  4MFZ A;  4JZ0 A;  3WR7 A;  3LWU A;  2JBJ A;  5HVG A;  2BCO A;  4EME A;  1YK3 A;  5J8C A;  5K8O A;  2PJ0 A;  4EWT A;  2IQ6 A;  4GM5 A;  1LAM A;  1VGY A;  3GIU A;  2QIR A;  2YNC C;  3SI2 A;  4B13 A;  4ZGY B;  3FRM A;  3PZJ A;  4O23 A;  4MI4 A;  2DXQ A;  4FD7 A;  3S6F A;  2B4D A;  2B3V A;  2Y0M A;  4P10 A;  3B2Y A;  1YQE A;  1BPM A;  1FNO A;  2XEG A;  2ZEF A;  4OKO A;  2IJZ A;  4CAE A;  3T8W A;  5D29 A;  1Z5R A;  4J3G A;  1NE9 A;  4KOW A;  3JVN A;  4OAD A;  3I9S A;  2Q44 A;  3TT2 A;  5JH9 A;  1H8L A;  3PRT A;  5DWN A;  4A94 A;  4ONU A;  4BIN A;  5GCN A;  2Q7B A;  2Z3M A;  2ZXV A;  1J4J A;  3NH8 A;  1IB1 E;  2C6C A;  3MRU A;  4ZY2 A;  2AFZ A;  3CZX A;  4DNC A;  3GKR A;  2EBJ A;  4NJQ A;  2GLJ A;  4A32 A;  4E2A A;  1R43 A;  1EE3 P;  2HUZ A;  4Q38 A;  4KZT A;  4OC2 A;  1XBU A;  4YFJ A;  4UIA A;  4IK2 A;  3B3S A;  4Z65 A;  4GS4 A;  3LMS A;  4IF5 A;  4E0A A;  5HMN A;  1QSO A;  3E0K A;  2CNM A;  3GLJ A;  5CPA A;  3EY5 A;  4LQ6 A;  2AFU A;  3SXO A;  4FD5 A;  3GYA A;  4MFL A;  2HC9 A;  2Z3N A;  1ON0 A;  3KR4 A;  2FVG A;  4B6Z A;  2PJ7 A;  5G1Z A;  2GFQ A;  1HEE A;  5JM6 A;  2AFM A;  4M6H A;  4NXY A;  4X5K A;  4TWE A;  2BOA A;  2BEI A;  3IO1 A;  1K4J A;  4P4I A;  5H86 A;  4KOR A;  2PJ1 A;  3PB6 X;  5J1Q A;  4KUB A;  3HLP A;  4G1P A;  2B58 A;  1LCP A;  1TXR A;  4CAF A;  4NSQ A;  5EC4 A;  4PXD A;  3CDX A;  2C6P A;  3S9M A;  4CAV A;  4B5P A;  4KUA A;  4AXV A;  4ZX9 A;  3ISX A;  1YVO A;  2JDD A;  2Z10 A;  4YRH A;  1Y9K A;  2PCU A;  1I1D A;  2VQY A;  2P6E A;  4MY0 A;  4MCS A;  5F47 A;  1QSM A;  2F5I A;  1F57 A;  2CTC A;  2WUU A;  2Z3O A;  3KHX A;  4ONW A;  4CGN A;  3RYO A;  5IB9 A;  4C7I A;  3S9L A;  3WT4 A;  4KLW A;  2V8D A;  4UWJ A;  3VAT A;  1M1D A;  3G3S A;  4CS0 B;  3FXT A;  3CXP A;  3S6H A;  5LRK A;  2PR8 A;  4JXQ A;  4R57 A;  1Q2C A;  5KTC A;  5LYI A;  2WPW A;  1V0C A;  2PJ9 A;  2X7B A;  4A38 A;  3SHP A;  3FJU A;  2B4B A;  3P2H A;  3GUX A;  3H8F A;  3BXM A;  2R1I A;  1CX8 A;  1ELM P;  3WAB A;  2REF A;  2OOT A;  3BLN A;  2ABZ A;  2EK8 A;  1Z4E A;  5AG6 A;  4QBJ A;  3DLJ A;  4NCZ A;  4MY3 A;  1UFH A;  4P4F A;  4AG7 A;  4U9Z A;  1XJO A;  2NMT A;  4P4D A;  4R3L A;  2Z11 A;  3K9U A;  3TO6 A;  4AVB A;  4CGO A;  4R7M A;  3IWE A;  4PXC A;  1VHO A;  1Z2L A;  3KL9 A;  1LOK A;  5J8F A;  2C27 A;  5KTA A;  2B4D B;  3QAH A;  4C2Z A;  4KOU A;  4IUS A;  4MCQ A;  3KGQ A;  3R9G A;  1SQH A;  4PQA A;  2C6G A;  1QSN A;  3D3S A;  7CPA A;  2GLF A;  5LYF A;  3PGP A;  5THW A;  3BI0 A;  4PPZ A;  3TE4 A;  1KUV A;  3N7Z A;  3D8P A;  2V8G A;  1S7L A;  3LAC A;  2AFS A;  1WK4 A;  2DF5 A;  3IJ3 A;  4A37 A;  4RUH A;  3BHX A;  5A28 A;  3T90 A;  1OBR A;  4CRY B;  1BAV A;  1YVK A;  2Q4Z A;  2ZEE A;  5K8N A;  3IWW A;  5LYD A;  4UFX A;  3D2P A;  3D7F A;  2VL1 A;  3JUW A;  4K30 A;  4H6Z A;  5EMI A;  4UWI A;  3B35 A;  4JXR A;  4ORF A;  1ZO0 A;  1I12 A;  4MMO A;  3GB0 A;  3R95 A;  3TC8 A;  3WC6 A;  1VKC A;  4RS2 A;  2VBQ A;  1TF9 A;  1P0H A;  3FBU A;  5F09 A;  2QJ8 A;  1XFO A;  4NGT A;  3BJ7 A;  5JQ4 A;  3VAR A;  1U6M A;  3FED A;  5AG4 A;  1YLO A;  4KVM E;  4M85 A;  4C2X A;  2CIJ A;  1Z8T A;  2PRB A;  2XEF A;  3KHZ A;  4LUA A;  3TFY A;  4H6U A;  3TOA A;  4B5P B;  4WWV A;  4IHM A;  3KR5 A;  4LX9 A;  5CNP A;  2HB6 A;  2Q4V A;  3KQX A;  3RAM A;  1M44 A;  4OLL A;  2ZW4 A;  4MHZ A;  4BD9 A;  4OIW A;  3PFO A;  5AG5 A;  2DEA A;  3BI1 A;  3RO0 A;  4MHP A;  5F49 A;  2PJ2 A;  1KZF A;  4P44 A;  3S6K A;  1YW4 A;  4KSI A;  1MJ9 A;  1Q2D A;  3FX6 A;  2OZH A;  2FS5 A;  5E96 A;  5IV0 A;  5CBM A;  4HKF A;  4MHY A;  4XNH C;  2QML A;  1YME A;  4HPS A;  4MBU A;  4PXB A;  3F5B A;  3B3W A;  2ZOF A;  1RXT A;  3DR8 A;  2OH1 A;  3NE8 A;  5LRG A; 
#chains in the Genus database with same CATH homology
 1ELL P;  3PBE A;  3K9T A;  4FAI A;  4MXU A;  2XEJ A;  2F8H A;  1TKF A;  3PBB A;  2PJ6 A;  4NGP A;  4R76 A;  1ZLH A;  3FF3 A;  4R6T A;  1BLL E;  3RBU A;  2PJ8 A;  2PVV A;  3V7Z A;  1GYT A;  2CTB A;  3KAS A;  2NYQ A;  1DE4 C;  2G9D A;  2ZEH A;  2NSM A;  5K8P A;  3PEI A;  4OC5 A;  4X3R A;  1CP6 A;  4ZX8 A;  3PB7 X;  3D7G A;  1LFW A;  1NSA A;  2PE3 A;  3WC7 A;  2C1C A;  1AMP A;  1Y7E A;  3FMC A;  1FT7 A;  2WZN A;  3RZA A;  1Q7L A;  2PVW A;  4YU9 A;  4R8F A;  4Q7A A;  3D7D A;  5ELY A;  2GRE A;  3D66 A;  3NFZ A;  1YW6 A;  1YSJ A;  3WC5 A;  2PJ4 A;  2ZEM A;  4UF4 A;  4OC4 A;  4NJR A;  3L2N A;  4X2T A;  2O4H A;  3KI9 A;  4PXE A;  4DYO A;  2PIY A;  3SI0 A;  1HDU A;  4P4B A;  5D8N A;  1TKJ A;  4ZY1 A;  3SJX A;  5LRJ A;  1ARL A;  4NFR A;  3ISZ A;  1QQ9 A;  3V38 A;  2ZEG A;  3IC1 A;  4F9U A;  4H2K A;  1IY7 A;  2PJ5 A;  4A39 A;  4X8I A;  2V8V A;  3DGV A;  3PB8 X;  2PJB A;  2ZEP A;  4TNU A;  5I4M A;  2ZEN A;  2I3C A;  1ZLI A;  1ZG7 A;  1AYE A;  3B3T A;  2POK A;  3H8E A;  4P4J A;  1HDQ A;  2PIZ A;  2OR4 A;  2F7V A;  4UEF A;  3SI1 A;  4ZI6 A;  2EWB A;  1ZG8 A;  2AFW A;  2EK9 A;  3B7I A;  3B3C A;  1JQG A;  2ZEL A;  1F2O A;  4P4E A;  4DJL A;  2XEI A;  3CPA A;  4P45 A;  2GU2 A;  2Q43 A;  4UEZ A;  3MN8 A;  3FEE A;  3IIB A;  4MCR A;  3K2K A;  2V77 A;  2AFO A;  3D67 A;  3FVL A;  3IFE A;  2ANP A;  3I1U A;  4LQG A;  4NGQ A;  1CBX A;  4MCP A;  1IGB A;  1Y0Y A;  1QMU A;  1DTD A;  3NA6 A;  1CPS A;  1M4L A;  3KQZ A;  3NH4 A;  1VHE A;  3PB9 X;  5JGF A;  1RTQ A;  1CP7 A;  1LAN A;  3B3V A;  3TX8 A;  4NGM A;  5DS0 A;  3D4U A;  3CT9 A;  4W9Y A;  4UEE A;  2PJA A;  2PJC A;  3PB4 X;  2RFH A;  4MHN A;  4K3N A;  4NGN A;  2ZOG A;  4JYW A;  4P6Y A;  1Y0R A;  5HXD A;  2QYV A;  1VIX A;  3H8G A;  4DUK A;  4UIB A;  4ZYQ A;  5LYL A;  2PRQ A;  4ZY0 A;  2JBK A;  4OID A;  4OP4 A;  1XMB A;  1CG2 A;  1XRY A;  3FH4 A;  4F9V A;  4CPA A;  1Z8L A;  1TKH A;  4MRI A;  3CPX A;  1PYT B;  1F2P A;  3PFE A;  5HVF A;  2ZED A;  3D7H A;  3D68 A;  2J9A A;  2BO9 A;  3SJG A;  1BPN A;  3NH5 A;  4OME A;  2IMO A;  2QVP A;  1R3N A;  2O53 A;  2ZEO A;  4FBE A;  3FEC A;  5HVH A;  4OC1 A;  4NGS A;  2PJ3 A;  1ZG9 A;  3S9N A;  3SJF A;  1ARM A;  3VH9 A;  1LAP A;  2Q51 A;  3KZW A;  4OC0 A;  3IEH A;  1PCA A;  5K8M A;  4OC3 A;  8CPA A;  4WJB A;  2WYR A;  4IAV A;  1TF8 A;  4FWU A;  4FUU A;  1CPX A;  2RB7 A;  2V8H A;  4F8Z A;  2JEW A;  3N5F A;  3JRU A;  1UWY A;  3QNV A;  4A38 A;  2AFX A;  4NGR A;  2CF4 A;  1KWM A;  3SJE A;  3HUV A;  6CPA A;  4YWY A;  4JZ0 A;  3LWU A;  2JBJ A;  5HVG A;  2BCO A;  4EME A;  5K8O A;  2PJ0 A;  4EWT A;  2IQ6 A;  4GM5 A;  1LAM A;  1VGY A;  3SI2 A;  4O23 A;  4P10 A;  3B2Y A;  1BPM A;  1FNO A;  2XEG A;  2ZEF A;  4OKO A;  2IJZ A;  3T8W A;  5D29 A;  1Z5R A;  5JH9 A;  1H8L A;  3PRT A;  4A94 A;  4ZY2 A;  3NH8 A;  2C6C A;  3MRU A;  2AFZ A;  4NJQ A;  2GLJ A;  1R43 A;  1EE3 P;  4OC2 A;  1XBU A;  4UIA A;  4IK2 A;  3B3S A;  4Z65 A;  3LMS A;  3GLJ A;  5CPA A;  2AFU A;  2HC9 A;  3KR4 A;  2FVG A;  4B6Z A;  2PJ7 A;  1HEE A;  5JM6 A;  2AFM A;  4TWE A;  2BOA A;  3IO1 A;  4P4I A;  2PJ1 A;  3PB6 X;  5J1Q A;  3HLP A;  4G1P A;  1LCP A;  1TXR A;  4EFD A;  4PXD A;  3CDX A;  2C6P A;  3S9M A;  4AXV A;  4ZX9 A;  3ISX A;  2PCU A;  4MCS A;  1F57 A;  2CTC A;  4ONW A;  3KHX A;  5IB9 A;  3S9L A;  3WT4 A;  2V8D A;  3VAT A;  5LRK A;  5LYI A;  2PJ9 A;  3FJU A;  3GUX A;  3H8F A;  3BXM A;  1CX8 A;  1ELM P;  3WAB A;  2OOT A;  2ABZ A;  2EK8 A;  3DLJ A;  4P4F A;  1XJO A;  4P4D A;  4R7M A;  4PXC A;  1VHO A;  1Z2L A;  3KL9 A;  1LOK A;  4MCQ A;  3KGQ A;  4PQA A;  2C6G A;  7CPA A;  2GLF A;  5LYF A;  5THW A;  3BI0 A;  4PPZ A;  2V8G A;  2AFS A;  4RUH A;  3IJ3 A;  4A37 A;  3BHX A;  1OBR A;  1BAV A;  2Q4Z A;  2ZEE A;  5K8N A;  3IWW A;  5LYD A;  3D7F A;  2VL1 A;  3B35 A;  4MMO A;  3GB0 A;  3TC8 A;  3WC6 A;  1TF9 A;  5F09 A;  2QJ8 A;  1XFO A;  4NGT A;  3VAR A;  3FED A;  1YLO A;  2CIJ A;  2XEF A;  3KHZ A;  4WWV A;  4IHM A;  3KR5 A;  2HB6 A;  3KQX A;  3RAM A;  4MHZ A;  4BD9 A;  4OIW A;  3PFO A;  2DEA A;  3BI1 A;  4MHP A;  2PJ2 A;  4P44 A;  1YW4 A;  4KSI A;  3FX6 A;  5CBM A;  4MHY A;  1YME A;  4PXB A;  3B3W A;  2ZOF A;  5LRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...