1YVKA

Crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
152
structure length
152
Chain Sequence
KLRIELGEETNDELYDLLLLADPSKDIVDEYLERGECYTAWAGDELAGVYVLLKTRPQTVEIVNIAVKESLQKKGFGKQLVLDAIEKAKKLGADTIEIGTGNSSIHQLSLYQKCGFRIQAIDHDFFLRHYDEDIFENGIQCRDMVRLYLDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BSU33890
publication title Crystal Structure of the Bacillis subtilis Acetyltransferase in complex with CoA, Northeast Structural Genomics Target SR237.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Transferase
total genus 39
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yvkA00
2IL4A 2EUIA 2FXFA 3OWCA 2B5GB 4JXQA 4NEXA 2BSWA 1V0CA 5F49A 3GKRA 3SXOA 4L8AA 2OU2A 4QVTA 2D4PA 2CNTA 4ORFA 4OLLA 3S6FA 4JD6A 2J8NA 5FVJA 1KUXA 2HUZA 2KCWA 2P6FA 4KVME 5F47A 4BMHA 5IV0A 4KVXA 4MHDA 1NMTA 2HV2A 1YVKA 4KOSA 4PK2A 1P4NA 4KLVA 1M4IA 1I1DA 4L89A 1KUVA 5E96A 4M85A 2ZW7A 3DSBA 3FIXA 2PSWA 2R1IA 3TCVA 4KLWA 4ZBGA 3D2MA 3QB8A 3G3SA 3ZJ0A 1XEBA 2PC1A 3TO7A 2Q0YA 5GCNA 2ZW6A 1Z4RA 3CXSA 4QB9A 3FB3A 3F5BA 4AVBA 2OH1A 4KUBA 5J8CA 2H5MA 4KUAA 5EC4A 5F46A 5DWMA 2B4DB 3MGDA 4KOTA 2VBQA 2JDDA 3D2PA 4PK3A 4CRZB 3ZZIA 3B8GA 1M4GA 3DR8A 3FRMA 3IWGA 4H6ZA 4U5YA 1ON0A 1WK4A 1YVOA 4H89A 3TO6A 2REFA 1Z9UA 1QSTA 4QC6A 4HNWB 5H84A 3SHPA 5KTDA 1M1DA 4UA3A 3BJ7A 4II9A 5KTCA 4NXYA 1OZPA 2VXKA 3RYOA 2R98A 1S7KA 4KOWA 2G0BA 4I49A 4CAVA 2B4DA 2Q7BA 3TO9A 1LRZA 3F0AA 3S6GA 4MY0A 2I79A 2P6EA 4J3GA 4KVOE 3F8KA 4KOYA 1IICA 3D8PA 4B5PB 3DNSA 4XNHB 1IYLA 3K9UA 5IB0A 5CNPA 1S5KA 1VHSA 3TE4A 4Y49C 5C88A 4NSQA 5I0CA 1P0HA 2D4OA 4EVYA 1YLEA 2FCKA 3DR6A 2J8MA 4JLYA 4AG9A 1FY7A 2JDCA 1B6BA 2AJ6A 2OZHA 3QAHA 1S3ZA 3GY9A 4IUSA 1M4DA 3I3GA 3TTHA 4NF1A 4R3LA 2AE6A 2B4BA 4GS4A 4DNCA 2Q04A 1MJBA 1BO4A 4FD4A 2PRBA 3D3SA 4FD7A 2DXQA 4XPLA 3C26A 1R57A 2BEIA 1N71A 4OAEA 4XPDB 4K30A 1WWZA 2J8RA 4B5PA 1CM0A 3PGPA 2ZPAA 2PQ8A 4B5OA 3SXNA 4R87A 3LD2A 2Z10A 4YGOA 4RI1A 4KOUA 1KZFA 1MJ9A 1Y7RA 4PV6A 3W91A 3NE7A 2P6GA 2OB0A 4ONUA 4LUAA 3BLNA 1YR0A 2P0WA 4E2AA 2FSRA 2Q4YA 3E0KA 2FIWA 4E0AA 1IIDA 2F5IA 1QSNA 4XPKA 2EVNA 3R9EA 3BJ8A 2CNMA 4U9ZA 1QSRA 1S7FA 4KOXA 2Q4VA 3R9FA 3TT2A 4E8OA 1XE4A 3IGRA 1Y9KA 3EC4A 2O28A 4AVAA 4KORA 4JJXA 4MY3A 2G3TA 4CRYB 4M3SA 5KTAA 5EBVA 4X5KA 1U6MA 2VI7A 3TOBA 5JPHA 3TFYA 4YRHA 4FD5A 1Z4EA 3R96A 3I9SA 4H6UA 2GE3A 3S6HA 1CJWA 2ZW5A 3V8IA 1GHEA 2QECA 2WPXA 4CAXA 1J4JA 4Y49B 4RS2A 2GANA 1S7LA 4YFJA 2FT0A 2GIVA 2R8VA 3FBUA 2G3AA 3R9GA 4FD6A 3R95A 1XIXA 2FS5A 1NE9A 2PR1A 3KKWA 4MBUA 1BOBA 1XF8A 1QSOA 3W6XA 1K4JA 2B3VA 4HKFA 5IX3A 1B87A 3VWDA 3PP9A 3PZJA 1IYKA 3UY5A 2Z11A 3EXNA 3W6SA 5HH1A 1SQHA 3S6KA 4MI4A 4PSWA 2QIRA 2X7BA 3FNCA 2R7HA 5HMNA 4XNHC 3H4QA 2A4NA 1Y9WA 4HNYB 4F6AA 3WR7A 1XMTA 2FL4A 4R3KA 2VZYA 1QSMA 2JLMA 3TOAA 2RC4A 4R9MA 4AG7A 2ZW4A 2Z0ZA 2BL1A 3FXTA 1L0CA 4QUSA 1MK4A 2Q44A 3T90A 3N7ZA 2K5TA 3G8WA 4F0YA 2OZUA 2PDOA 1YK3A 2B5GA 1Q2CA 3P2FA 4PSXA 2Y0MA 1YGHA 1Q2DA 2C27A 2ATRA 3DDDA 1S60A 3JUWA 4UWJA 2NMTA 4QBJA 4LX9A 5ISVA 5J8FA 1I21A 1RO5A 4UBRA 1MJAA 4KOVA 4NCZA 2I00A 1KUYA 2FE7A 4XPDC 1IB1E 5H86A 1PU9A 1YX0A 4JXRA 4IF5A 2VEZA 3P2HA 3R1KA 3GYAA 2CNSA 4KZTA 1VKCA 2BUEA 3CXPA 1S7NA 1TIQA 4CS0B 3FYNA 2JEVA 2PR8A 4HNXB 3EO4A 5F48A 4AB7A 3CXQA 2B58A 4CAWA 4MJ8A 2ZXVA 2ARHA 4JWPA 2VZZA 2OZGA 1I12A 4UWIA 2HQYA 5DWNA 2QMLA 1YREA 2B3UA 1PUAA 2WPWA 4AVCA 1NSLA 4R57A 1UFHA 2FIAA 4OADA 3EY5A 3JVNA 2REEA 3T9YA 3VWEA 4U9YA 1Q2YA 5C82A 3EFAA 2CY2A 2VQYA 1M44A 1RXTA 3LODA 5JQ4A
chains in the Genus database with same CATH superfamily
1YW6A 2DF5A 2EUIA 2FXFA 2HB6A 2IL4A 4MHNA 3HUVA 4F9UA 3OWCA 2B5GB 4JXQA 2CIJA 4NEXA 2BSWA 1V0CA 4NJQA 5F49A 5LRJA 5D8NA 3GKRA 4AXVA 2ZEFA 4KS9A 3SXOA 3IU1A 4L8AA 2OU2A 1XMBA 3B3WA 4QVTA 2PJ2A 2D4PA 4PXEA 2CNTA 4P10A 4CAEA 1CP6A 4ORFA 2ZEMA 1CPXA 4OLLA 2WZNA 4NGNA 3BI1A 3S6FA 4JD6A 5K8PA 2J8NA 5FVJA 2BCOA 3B35A 1KUXA 2HUZA 2KCWA 2P6FA 4UFXA 3D67A 4KVME 5F47A 1Q7LA 4BMHA 2G9DA 4KSIA 4NGMA 5IV0A 3B7IA 4KVXA 4MHDA 1NMTA 4ZY1A 4C7HA 4CYPA 4CGNA 4NFRA 2EK8A 4BD9A 2HV2A 1YSJA 1YVKA 2RFHA 3B2YA 4KOSA 2BO9A 1JQGA 4P4IA 3FF3A 1P4NA 4PK2A 4KLVA 3MRUA 1M4IA 1I1DA 2AFWA 4L89A 4TNUA 1IY7A 1KUVA 4UFVA 4ZI6A 2JEWA 5E96A 2AFZA 2YNEA 4M85A 2WUUA 2ZW7A 3DSBA 3KL9A 2C1CA 3FIXA 2PSWA 5EMIA 2R1IA 4UIBA 1FNOA 3TCVA 4MFZA 1LAPA 4A33A 1AMPA 1HDUA 4OC1A 1TKHA 4KLWA 4B10A 4FUUA 1IU8A 3CDXA 4ZBGA 3D2MA 4NGSA 4ZY2A 3QB8A 3G3SA 3ISXA 3ZJ0A 2O4HA 3FX6A 3D4UA 5G22A 4KSAA 1XEBA 2PC1A 3TO7A 2QVPA 5JH9A 2Q0YA 5GCNA 5ELYA 3JTKA 2ZW6A 3FH4A 1OBRA 2Z3OA 4LQ6A 4P4EA 3H8FA 1Z4RA 4PQAA 3CXSA 4QB9A 3IFEA 3FB3A 3F5BA 3HLPA 3CT9A 4AVBA 2OH1A 2V8DA 4A95A 2GU2A 1FT7A 4KUBA 4GXHA 5J8CA 2H5MA 4KUAA 5EC4A 4A31A 5F46A 5DWMA 4ZYQA 2B4DB 2CTBA 3MGDA 4KOTA 5G1ZA 4A2ZA 4A32A 2VBQA 2JDDA 3ISZA 3D2PA 2PJAA 4PK3A 2PJ0A 2Z3KA 4CRZB 4M6GA 3ZZIA 2V8GA 2V8VA 3B8GA 4CGLA 1M4GA 3DR8A 5AGEA 3WC7A 4H2KA 3BHXA 3FVLA 3NH4A 4K3NA 2Q43A 4OC0A 3SI1A 4F9VA 5G20A 2AFXA 3FRMA 3IWGA 4H6ZA 4R7MA 3SI0A 4U5YA 4C2YA 3KR5A 4CGPA 4B13A 1ON0A 1WK4A 1YVOA 3B3CA 3JRUA 4H89A 4MFJA 3TO6A 3H5ZA 2REFA 1F57A 1LOKA 1Z9UA 5A27A 1TXRA 1QSTA 1A2ZA 4QC6A 3SJGA 4A37A 4F8ZA 2PVWA 4UF4A 4HNWB 1NSAA 5H84A 3SHPA 1XJOA 2POKA 4UCPA 4X8IA 5KTDA 1M1DA 4MCQA 4UA3A 5BWAB 3BJ7A 1BPNA 4GM5A 4II9A 5KTCA 4NXYA 1OZPA 2VXKA 2AFSA 4WJBA 3RYOA 1VHOA 4P45A 2R98A 1S7KA 4KOWA 7CPAA 2G0BA 2PJ1A 4I49A 4CAVA 3LACA 2B4DA 3BXMA 4EMEA 5LYLA 3QAYA 2Q7BA 3IC1A 4BBHA 3TO9A 1LRZA 3F0AA 3S6GA 2Q7SA 4MY0A 4FAIA 2I79A 4R76A 2P6EA 1H8LA 1M4LA 4J3GA 4KVOE 4C2XA 3F8KA 4OIWA 4KOYA 3PBEA 4P44A 3NA6A 1IICA 3D8PA 3MN8A 3DNSA 4B5PB 4XNHB 1IYLA 3K9UA 5IB0A 2PJ6A 5CBMA 2PIZA 2PVVA 5CNPA 1S5KA 1VHSA 4DYOA 3IWEA 3TE4A 4Y49C 4CYOA 5C88A 4NSQA 8CPAA 1ZG7A 5I0CA 1P0HA 4B11A 2Z3NA 4CYQA 2D4OA 2EK9A 4EVYA 1YLEA 2FCKA 3DR6A 5LYDA 1XFOA 2J8MA 3LMSA 3LWUA 4JLYA 2Q51A 3PB4X 3PFOA 4P4BA 4AG9A 2ZEOA 4UCNA 1FY7A 3GB0A 4CAFA 2JDCA 1B6BA 2XEJA 2AJ6A 2OZHA 1XOVA 1S3ZA 3GY9A 3QAHA 2ZEDA 1Z2LA 4IUSA 1M4DA 4MFPA 4W9YA 2ZEEA 4P4FA 3B3VA 3L2NA 3I3GA 3TTHA 2ZOGA 4NF1A 1Y0YA 2JBKA 4R3LA 4R6TA 2AE6A 2ZEPA 3H8GA 4WWVA 2B4BA 4GS4A 3DGVA 4DNCA 2Q04A 5HVGA 1MJBA 1BO4A 4FD4A 1TKJA 2PRBA 3D3SA 4FD7A 2DXQA 4B12A 4XPLA 3C26A 2PJ8A 1R57A 2BEIA 5DS0A 1N71A 4OAEA 4ONWA 3KGQA 4K30A 1WWZA 4XPDB 4MCRA 2J8RA 4B5PA 1CM0A 2C6PA 3PGPA 2ABZA 2ZPAA 5IB9A 2GLJA 1UWYA 4EFDA 3I1UA 3S9NA 2PQ8A 2PJ4A 2ZOFA 4BINA 4B5OA 3FJUA 2YGWA 1ELLP 3SXNA 2GLFA 4DJLA 1YW4A 4R87A 3PB7X 3LD2A 4MFKA 1CG2A 2V8HA 2Z10A 3IEHA 2PJBA 4YGOA 5THWA 4RI1A 4RUHA 4Q38A 2J9AA 4KOUA 4B6ZA 1KZFA 1MJ9A 2WYRA 2AFOA 1Y7RA 2O53A 4PV6A 3W91A 5HVHA 3KR4A 4JYWA 3NE7A 2RB7A 2P6GA 3KQZA 4OC3A 1ELMP 2GFQA 4C68A 1BLLE 4MMOA 2OB0A 4MFQA 4ONUA 4LUAA 3BLNA 5HVFA 3PEIA 1R43A 3CZXA 5AG6A 1YR0A 2P0WA 5AG7A 4E2AA 2FSRA 2Q4YA 4LQGA 3E0KA 2FIWA 4E0AA 3PFEA 2VL1A 1IIDA 3CPAA 2F5IA 1QSNA 3NFZA 2CTCA 3S9MA 1YMEA 1KWMA 3FECA 4XPKA 3SJEA 2EVNA 5A28A 3WC6A 3R9EA 4A30A 3BJ8A 4R8FA 1F2OA 2CNMA 4M6HA 4MXUA 4U9ZA 3B3TA 1QSRA 1S7FA 2PJ9A 2V77A 4KOXA 4C2ZA 2Q4VA 2DEAA 3IIBA 3R9FA 1VGYA 3D68A 3TT2A 4E8OA 5K8OA 1AYEA 1XE4A 2XEIA 3IGRA 1Y9KA 3EC4A 2O28A 4F0XA 3SJFA 3K2KA 3K9TA 4AVAA 4JJXA 1TF9A 4KORA 2G3TA 4MY3A 4OC5A 4CRYB 1EE3P 4M3SA 5KTAA 5EBVA 1VHEA 2YNCC 4OMEA 1U6MA 2BOAA 2VI7A 4X5KA 3TOBA 2IMOA 5JPHA 3TFYA 4YRHA 1YLOA 4FD5A 4P4JA 3GUXA 4B14A 1Z4EA 4CPAA 3R96A 1Z5RA 1CP7A 1XRYA 1X12A 3N5FA 3I9SA 4G1PA 4H6UA 5F09A 2GE3A 2IQ6A 1TF8A 1CJWA 4FWUA 2ZW5A 4OKOA 3S6HA 3TX8A 3V8IA 3WC5A 1GHEA 2QECA 2WPXA 2Z3LA 4FBEA 1IGBA 1QQ9A 4CAXA 1J4JA 4Y49B 3PB6X 4RS2A 1TKFA 4ZX8A 1QMUA 4A39A 2C6GA 2C6CA 4C7IA 4P6YA 3KHXA 2GANA 4EWTA 4MCSA 1CBXA 1S7LA 4MHYA 4P4DA 3TC8A 2WSAA 4YFJA 2FT0A 2GIVA 1CPSA 2R8VA 3FBUA 4ZX9A 3WABA 3KZWA 2G3AA 4A38A 4NGPA 3R9GA 6CPAA 3KI9A 5LRGA 2EWBA 2QJ8A 4PPZA 3SI2A 4FD6A 3R95A 1XIXA 2FS5A 4YWYA 1NE9A 2PR1A 2F8HA 2ZEGA 3NH8A 4PXBA 3KKWA 4IAVA 4IHMA 1ZG9A 4MBUA 1BOBA 4UEFA 5AG4A 1XF8A 1QSOA 2GREA 3D7DA 2ANPA 3W6XA 4CGMA 2DPTA 2PIYA 1K4JA 2B3VA 4ZY0A 4HKFA 1BPMA 1B87A 4OIDA 5IX3A 3RNZA 3VWDA 5LRKA 3PP9A 3PZJA 1IYKA 5CPAA 2JBJA 2FVGA 4MCPA 2PJ7A 4OC4A 3UY5A 3PB9X 3QNVA 2Z11A 3EXNA 3IU2A 4X2TA 2OOTA 3W6SA 1LFWA 4JZ0A 3FEEA 3SJXA 5HH1A 3H8EA 1SQHA 3S6KA 3KQXA 5LYIA 1PCAA 4NGRA 4MI4A 4PSWA 4M6IA 2QIRA 3NE8A 4NJRA 2X7BA 5K8NA 3FNCA 2R7HA 5HMNA 1CX8A 3DLJA 4UEEA 4XNHC 2NSMA 2QYVA 3RAMA 3WT4A 1ZLIA 3H4QA 4MHPA 2A4NA 1IOIA 1Y9WA 2F7VA 4HNYB 3WR7A 4F6AA 1AUGA 5I4MA 1XMTA 3KASA 4OP4A 2FL4A 4RN7A 4PXCA 2VZYA 1QSMA 2JLMA 2NYQA 4R3KA 4Q7AA 1VIXA 1Z8TA 3TOAA 1RTQA 2RC4A 4TWEA 4R9MA 4HPSA 4A94A 4CYNA 4AG7A 2ZW4A 3D7GA 1F2PA 2Z0ZA 2BL1A 3FXTA 3GLJA 4UCMA 1L0CA 1ZLHA 4QUSA 4Z65A 1MK4A 1DTDA 2Q44A 3T90A 4Q36A 4YU9A 3N7ZA 2K5TA 3G8WA 4F0YA 1IOFA 2OZUA 1ZO0A 2PDOA 1YK3A 3B3SA 2B5GA 1Q2CA 2EO8A 3CPXA 3D7HA 3P2FA 4PSXA 2Y0MA 1YGHA 4NGQA 3D66A 1Q2DA 1ARMA 2C27A 2ATRA 3DDDA 1S60A 1HEEA 3JUWA 4PXDA 1GYTA 4UWJA 4MHZA 2NMTA 3PB8X 4QBJA 2XEGA 4LX9A 3PRTA 5ISVA 5J8FA 1I21A 4KSFA 1RO5A 1YQEA 1LAMA 2PJ5A 4UBRA 1MJAA 5K8MA 4KOVA 5JM6A 4NCZA 1ZG8A 1Z8WA 2I00A 1KUYA 2CXAA 2FE7A 4XPDC 1LANA 1Y0RA 1IB1E 2EBJA 3FEDA 5H86A 4CGOA 1PU9A 1YX0A 4JXRA 1BAVA 3FMCA 3V38A 4IF5A 2VEZA 3P2HA 3R1KA 3GYAA 3GIUA 2CNSA 4UIAA 4X3RA 4KZTA 2ZEHA 3RBUA 5HXDA 1VKCA 3S9LA 1R3NA 3VH9A 2PJCA 2BUEA 2OR4A 3CXPA 3D7FA 5J1QA 2ZELA 1S7NA 1TIQA 4CS0B 1Y7EA 2AFMA 3FYNA 2Z3MA 4UEZA 2JEVA 5LYFA 2PR8A 1DE4C 3T8WA 2ODFA 3KHZA 4HNXB 4UFWA 2AFUA 1LCPA 3EO4A 4MFLA 5F48A 4AB7A 3CXQA 5JGFA 2B58A 4IK2A 4MJ8A 4CAWA 4NGTA 1X10A 4MRIA 2HC9A 2I3CA 2ZXVA 2ARHA 4JWPA 4O23A 2XEFA 2VZZA 2PRQA 1JWQA 2OZGA 1I12A 4UWIA 5D29A 2DPSA 2HQYA 5DWNA 2QMLA 1YREA 5G21A 2PE3A 5AG5A 3VARA 3V7ZA 3NH5A 2IJZA 2CF4A 1HDQA 1Z8LA 2Q4ZA 3PBBA 3RO0A 2B3UA 4ZGYB 1PUAA 2WPWA 1Z8XA 3A9LA 4AVCA 2PCUA 1NSLA 3IO1A 4R57A 1UFHA 2FIAA 3VATA 4OADA 2Z3PA 3EY5A 3IWWA 3JVNA 2REEA 3T9YA 3VWEA 2ZENA 2YNCA 2PJ3A 4U9YA 4DUKA 3BI0A 1XBUA 1PYTB 1Q2YA 3IJ3A 2VQYA 2CY2A 3EFAA 1M44A 4OC2A 5C82A 2YNDA 1RXTA 1ARLA 3RZAA 3LODA 5JQ4A
chains in the Genus database with same CATH topology
2IL4A 2EUIA 2FXFA 3OWCA 2B5GB 4JXQA 4NEXA 2BSWA 1V0CA 5F49A 3GKRA 4KS9A 3SXOA 3IU1A 4L8AA 2OU2A 4QVTA 2D4PA 4CAEA 2CNTA 4ORFA 4OLLA 3S6FA 4JD6A 2J8NA 5FVJA 1KUXA 2HUZA 2KCWA 2P6FA 4UFXA 4KVME 5F47A 4BMHA 5IV0A 4KVXA 4MHDA 1NMTA 4C7HA 4CYPA 4CGNA 2HV2A 1YVKA 4KOSA 4PK2A 1P4NA 4KLVA 1M4IA 1I1DA 4L89A 1KUVA 4UFVA 5E96A 2YNEA 4M85A 2WUUA 2ZW7A 3DSBA 3FIXA 2PSWA 2R1IA 3TCVA 4MFZA 4A33A 4KLWA 4B10A 4ZBGA 3D2MA 3QB8A 3G3SA 3ZJ0A 5G22A 4KSAA 1XEBA 2PC1A 3TO7A 2Q0YA 5GCNA 3JTKA 2ZW6A 2Z3OA 1Z4RA 3CXSA 4QB9A 3FB3A 3F5BA 4AVBA 2OH1A 4A95A 4KUBA 5J8CA 2H5MA 4KUAA 5EC4A 4A31A 5F46A 5DWMA 3MGDA 2B4DB 4KOTA 5G1ZA 4A2ZA 4A32A 2VBQA 2JDDA 3D2PA 4PK3A 2Z3KA 4CRZB 3ZZIA 3B8GA 4CGLA 1M4GA 3DR8A 5AGEA 5G20A 3FRMA 3IWGA 4H6ZA 4U5YA 4C2YA 4CGPA 4B13A 1ON0A 1WK4A 1YVOA 4H89A 4MFJA 3TO6A 3H5ZA 2REFA 1Z9UA 5A27A 1QSTA 4QC6A 4HNWB 5H84A 3SHPA 4UCPA 5KTDA 1M1DA 4UA3A 5BWAB 3BJ7A 4II9A 5KTCA 4NXYA 1OZPA 2VXKA 3RYOA 2R98A 1S7KA 4KOWA 2G0BA 4I49A 4CAVA 2B4DA 2Q7BA 4BBHA 3TO9A 1LRZA 3F0AA 3S6GA 4MY0A 2I79A 2P6EA 4J3GA 4KVOE 4C2XA 3F8KA 4KOYA 1IICA 3D8PA 4B5PB 3DNSA 4XNHB 1IYLA 3K9UA 5IB0A 5CNPA 1S5KA 1VHSA 3IWEA 3TE4A 4Y49C 4CYOA 5C88A 4NSQA 5I0CA 1P0HA 4B11A 2Z3NA 4CYQA 2D4OA 4EVYA 1YLEA 2FCKA 3DR6A 2J8MA 4JLYA 4AG9A 4UCNA 1FY7A 4CAFA 2JDCA 1B6BA 2AJ6A 2OZHA 3QAHA 1S3ZA 3GY9A 4IUSA 4MFPA 1M4DA 3I3GA 3TTHA 4NF1A 4R3LA 2AE6A 2B4BA 4GS4A 4DNCA 2Q04A 1MJBA 1BO4A 4FD4A 2PRBA 3D3SA 4FD7A 2DXQA 4B12A 4XPLA 3C26A 1R57A 2BEIA 1N71A 4OAEA 4XPDB 4K30A 1WWZA 2J8RA 4B5PA 1CM0A 3PGPA 2ZPAA 2PQ8A 4B5OA 2YGWA 3SXNA 4R87A 3LD2A 4MFKA 2Z10A 4YGOA 4RI1A 4Q38A 4KOUA 1KZFA 1MJ9A 1Y7RA 4PV6A 3W91A 3NE7A 2P6GA 4C68A 2OB0A 4MFQA 4ONUA 4LUAA 3BLNA 5AG6A 5AG7A 1YR0A 2P0WA 4E2AA 2FSRA 2Q4YA 3E0KA 2FIWA 4E0AA 1IIDA 2F5IA 1QSNA 4XPKA 2EVNA 5A28A 3R9EA 4A30A 3BJ8A 2CNMA 4U9ZA 1QSRA 1S7FA 4KOXA 4C2ZA 2Q4VA 3R9FA 3TT2A 4E8OA 1XE4A 3IGRA 1Y9KA 3EC4A 2O28A 4F0XA 4AVAA 4JJXA 4KORA 4MY3A 2G3TA 4CRYB 4M3SA 5KTAA 5EBVA 2YNCC 4X5KA 1U6MA 2VI7A 3TOBA 5JPHA 3TFYA 4YRHA 4FD5A 4B14A 1Z4EA 3R96A 3I9SA 4H6UA 2GE3A 3S6HA 1CJWA 2ZW5A 3V8IA 1GHEA 2QECA 2WPXA 2Z3LA 4CAXA 1J4JA 4Y49B 4RS2A 4C7IA 2GANA 1S7LA 4YFJA 2WSAA 2FT0A 2GIVA 2R8VA 3FBUA 2G3AA 3R9GA 4FD6A 3R95A 1XIXA 2FS5A 1NE9A 2PR1A 3KKWA 4MBUA 1BOBA 5AG4A 1XF8A 1QSOA 3W6XA 4CGMA 2DPTA 1K4JA 2B3VA 4HKFA 5IX3A 1B87A 3VWDA 3PP9A 3PZJA 1IYKA 3UY5A 2Z11A 3EXNA 3IU2A 3W6SA 5HH1A 1SQHA 3S6KA 4MI4A 4PSWA 2QIRA 2X7BA 3FNCA 2R7HA 5HMNA 4XNHC 3H4QA 2A4NA 1Y9WA 4HNYB 4F6AA 3WR7A 1XMTA 2FL4A 4R3KA 2VZYA 1QSMA 2JLMA 3TOAA 2RC4A 4R9MA 4CYNA 4AG7A 2ZW4A 2Z0ZA 2BL1A 3FXTA 4UCMA 1L0CA 4QUSA 1MK4A 2Q44A 3T90A 4Q36A 3N7ZA 2K5TA 3G8WA 4F0YA 2OZUA 1ZO0A 2PDOA 1YK3A 2B5GA 1Q2CA 3P2FA 4PSXA 2Y0MA 1YGHA 1Q2DA 2C27A 2ATRA 3DDDA 1S60A 3JUWA 4UWJA 2NMTA 4QBJA 4LX9A 5ISVA 5J8FA 1I21A 4KSFA 1RO5A 4UBRA 1MJAA 4KOVA 4NCZA 2I00A 1KUYA 2CXAA 2FE7A 4XPDC 1IB1E 5H86A 4CGOA 1PU9A 1YX0A 4JXRA 4IF5A 2VEZA 3P2HA 3R1KA 3GYAA 2CNSA 4KZTA 1VKCA 2BUEA 3CXPA 1S7NA 1TIQA 4CS0B 3FYNA 2Z3MA 2JEVA 2PR8A 4HNXB 4UFWA 3EO4A 4MFLA 5F48A 4AB7A 3CXQA 2B58A 4CAWA 4MJ8A 2ZXVA 2ARHA 4JWPA 2VZZA 2OZGA 1I12A 4UWIA 2DPSA 2HQYA 5DWNA 2QMLA 1YREA 5G21A 5AG5A 2B3UA 4ZGYB 1PUAA 2WPWA 3A9LA 4AVCA 1NSLA 4R57A 1UFHA 2FIAA 4OADA 2Z3PA 3EY5A 3JVNA 2REEA 3T9YA 3VWEA 2YNCA 4U9YA 1Q2YA 5C82A 3EFAA 2CY2A 2VQYA 1M44A 2YNDA 1RXTA 3LODA 5JQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IL4 A;  2EUI A;  2FXF A;  3OWC A;  2B5G B;  4JXQ A;  4NEX A;  2BSW A;  1V0C A;  5F49 A;  3GKR A;  3SXO A;  4L8A A;  2OU2 A;  4QVT A;  2D4P A;  2CNT A;  4ORF A;  4OLL A;  3S6F A;  4JD6 A;  2J8N A;  5FVJ A;  1KUX A;  2HUZ A;  2KCW A;  2P6F A;  4KVM E;  5F47 A;  4BMH A;  5IV0 A;  4KVX A;  4MHD A;  1NMT A;  2HV2 A;  1YVK A;  4KOS A;  4PK2 A;  1P4N A;  4KLV A;  1M4I A;  1I1D A;  4L89 A;  1KUV A;  5E96 A;  4M85 A;  2ZW7 A;  3DSB A;  3FIX A;  2PSW A;  2R1I A;  3TCV A;  4KLW A;  4ZBG A;  3D2M A;  3QB8 A;  3G3S A;  3ZJ0 A;  1XEB A;  2PC1 A;  3TO7 A;  2Q0Y A;  5GCN A;  2ZW6 A;  1Z4R A;  3CXS A;  4QB9 A;  3FB3 A;  3F5B A;  4AVB A;  2OH1 A;  4KUB A;  5J8C A;  2H5M A;  4KUA A;  5EC4 A;  5F46 A;  5DWM A;  2B4D B;  3MGD A;  4KOT A;  2VBQ A;  2JDD A;  3D2P A;  4PK3 A;  4CRZ B;  3ZZI A;  3B8G A;  1M4G A;  3DR8 A;  3FRM A;  3IWG A;  4H6Z A;  4U5Y A;  1ON0 A;  1WK4 A;  1YVO A;  4H89 A;  3TO6 A;  2REF A;  1Z9U A;  1QST A;  4QC6 A;  4HNW B;  5H84 A;  3SHP A;  5KTD A;  1M1D A;  4UA3 A;  3BJ7 A;  4II9 A;  5KTC A;  4NXY A;  1OZP A;  2VXK A;  3RYO A;  2R98 A;  1S7K A;  4KOW A;  2G0B A;  4I49 A;  4CAV A;  2B4D A;  2Q7B A;  3TO9 A;  1LRZ A;  3F0A A;  3S6G A;  4MY0 A;  2I79 A;  2P6E A;  4J3G A;  4KVO E;  3F8K A;  4KOY A;  1IIC A;  3D8P A;  4B5P B;  3DNS A;  4XNH B;  1IYL A;  3K9U A;  5IB0 A;  5CNP A;  1S5K A;  1VHS A;  3TE4 A;  4Y49 C;  5C88 A;  4NSQ A;  5I0C A;  1P0H A;  2D4O A;  4EVY A;  1YLE A;  2FCK A;  3DR6 A;  2J8M A;  4JLY A;  4AG9 A;  1FY7 A;  2JDC A;  1B6B A;  2AJ6 A;  2OZH A;  3QAH A;  1S3Z A;  3GY9 A;  4IUS A;  1M4D A;  3I3G A;  3TTH A;  4NF1 A;  4R3L A;  2AE6 A;  2B4B A;  4GS4 A;  4DNC A;  2Q04 A;  1MJB A;  1BO4 A;  4FD4 A;  2PRB A;  3D3S A;  4FD7 A;  2DXQ A;  4XPL A;  3C26 A;  1R57 A;  2BEI A;  1N71 A;  4OAE A;  4XPD B;  4K30 A;  1WWZ A;  2J8R A;  4B5P A;  1CM0 A;  3PGP A;  2ZPA A;  2PQ8 A;  4B5O A;  3SXN A;  4R87 A;  3LD2 A;  2Z10 A;  4YGO A;  4RI1 A;  4KOU A;  1KZF A;  1MJ9 A;  1Y7R A;  4PV6 A;  3W91 A;  3NE7 A;  2P6G A;  2OB0 A;  4ONU A;  4LUA A;  3BLN A;  1YR0 A;  2P0W A;  4E2A A;  2FSR A;  2Q4Y A;  3E0K A;  2FIW A;  4E0A A;  1IID A;  2F5I A;  1QSN A;  4XPK A;  2EVN A;  3R9E A;  3BJ8 A;  2CNM A;  4U9Z A;  1QSR A;  1S7F A;  4KOX A;  2Q4V A;  3R9F A;  3TT2 A;  4E8O A;  1XE4 A;  3IGR A;  1Y9K A;  3EC4 A;  2O28 A;  4AVA A;  4KOR A;  4JJX A;  4MY3 A;  2G3T A;  4CRY B;  4M3S A;  5KTA A;  5EBV A;  4X5K A;  1U6M A;  2VI7 A;  3TOB A;  5JPH A;  3TFY A;  4YRH A;  4FD5 A;  1Z4E A;  3R96 A;  3I9S A;  4H6U A;  2GE3 A;  3S6H A;  1CJW A;  2ZW5 A;  3V8I A;  1GHE A;  2QEC A;  2WPX A;  4CAX A;  1J4J A;  4Y49 B;  4RS2 A;  2GAN A;  1S7L A;  4YFJ A;  2FT0 A;  2GIV A;  2R8V A;  3FBU A;  2G3A A;  3R9G A;  4FD6 A;  3R95 A;  1XIX A;  2FS5 A;  1NE9 A;  2PR1 A;  3KKW A;  4MBU A;  1BOB A;  1XF8 A;  1QSO A;  3W6X A;  1K4J A;  2B3V A;  4HKF A;  5IX3 A;  1B87 A;  3VWD A;  3PP9 A;  3PZJ A;  1IYK A;  3UY5 A;  2Z11 A;  3EXN A;  3W6S A;  5HH1 A;  1SQH A;  3S6K A;  4MI4 A;  4PSW A;  2QIR A;  2X7B A;  3FNC A;  2R7H A;  5HMN A;  4XNH C;  3H4Q A;  2A4N A;  1Y9W A;  4HNY B;  4F6A A;  3WR7 A;  1XMT A;  2FL4 A;  4R3K A;  2VZY A;  1QSM A;  2JLM A;  3TOA A;  2RC4 A;  4R9M A;  4AG7 A;  2ZW4 A;  2Z0Z A;  2BL1 A;  3FXT A;  1L0C A;  4QUS A;  1MK4 A;  2Q44 A;  3T90 A;  3N7Z A;  2K5T A;  3G8W A;  4F0Y A;  2OZU A;  2PDO A;  1YK3 A;  2B5G A;  1Q2C A;  3P2F A;  4PSX A;  2Y0M A;  1YGH A;  1Q2D A;  2C27 A;  2ATR A;  3DDD A;  1S60 A;  3JUW A;  4UWJ A;  2NMT A;  4QBJ A;  4LX9 A;  5ISV A;  5J8F A;  1I21 A;  1RO5 A;  4UBR A;  1MJA A;  4KOV A;  4NCZ A;  2I00 A;  1KUY A;  2FE7 A;  4XPD C;  1IB1 E;  5H86 A;  1PU9 A;  1YX0 A;  4JXR A;  4IF5 A;  2VEZ A;  3P2H A;  3R1K A;  3GYA A;  2CNS A;  4KZT A;  1VKC A;  2BUE A;  3CXP A;  1S7N A;  1TIQ A;  4CS0 B;  3FYN A;  2JEV A;  2PR8 A;  4HNX B;  3EO4 A;  5F48 A;  4AB7 A;  3CXQ A;  2B58 A;  4CAW A;  4MJ8 A;  2ZXV A;  2ARH A;  4JWP A;  2VZZ A;  2OZG A;  1I12 A;  4UWI A;  2HQY A;  5DWN A;  2QML A;  1YRE A;  2B3U A;  1PUA A;  2WPW A;  4AVC A;  1NSL A;  4R57 A;  1UFH A;  2FIA A;  4OAD A;  3EY5 A;  3JVN A;  2REE A;  3T9Y A;  3VWE A;  4U9Y A;  1Q2Y A;  5C82 A;  3EFA A;  2CY2 A;  2VQY A;  1M44 A;  1RXT A;  3LOD A;  5JQ4 A; 
#chains in the Genus database with same CATH topology
 1YW6 A;  2DF5 A;  2EUI A;  2FXF A;  2HB6 A;  2IL4 A;  4MHN A;  3HUV A;  4F9U A;  3OWC A;  2B5G B;  4JXQ A;  2CIJ A;  4NEX A;  2BSW A;  1V0C A;  4NJQ A;  5F49 A;  5LRJ A;  5D8N A;  3GKR A;  4AXV A;  2ZEF A;  4KS9 A;  3SXO A;  3IU1 A;  4L8A A;  2OU2 A;  1XMB A;  3B3W A;  4QVT A;  2PJ2 A;  2D4P A;  4PXE A;  2CNT A;  4P10 A;  4CAE A;  1CP6 A;  4ORF A;  2ZEM A;  1CPX A;  4OLL A;  2WZN A;  4NGN A;  3BI1 A;  3S6F A;  4JD6 A;  5K8P A;  2J8N A;  5FVJ A;  2BCO A;  3B35 A;  1KUX A;  2HUZ A;  2KCW A;  2P6F A;  4UFX A;  3D67 A;  4KVM E;  5F47 A;  1Q7L A;  4BMH A;  2G9D A;  4KSI A;  4NGM A;  5IV0 A;  3B7I A;  4KVX A;  4MHD A;  1NMT A;  4ZY1 A;  4C7H A;  4CYP A;  4CGN A;  4NFR A;  2EK8 A;  4BD9 A;  2HV2 A;  1YSJ A;  1YVK A;  2RFH A;  3B2Y A;  4KOS A;  2BO9 A;  1JQG A;  4P4I A;  3FF3 A;  1P4N A;  4PK2 A;  4KLV A;  3MRU A;  1M4I A;  1I1D A;  2AFW A;  4L89 A;  4TNU A;  1IY7 A;  1KUV A;  4UFV A;  4ZI6 A;  2JEW A;  5E96 A;  2AFZ A;  2YNE A;  4M85 A;  2WUU A;  2ZW7 A;  3DSB A;  3KL9 A;  2C1C A;  3FIX A;  2PSW A;  5EMI A;  2R1I A;  4UIB A;  1FNO A;  3TCV A;  4MFZ A;  1LAP A;  4A33 A;  1AMP A;  1HDU A;  4OC1 A;  1TKH A;  4KLW A;  4B10 A;  4FUU A;  1IU8 A;  3CDX A;  4ZBG A;  3D2M A;  4NGS A;  4ZY2 A;  3QB8 A;  3G3S A;  3ISX A;  3ZJ0 A;  2O4H A;  3FX6 A;  3D4U A;  5G22 A;  4KSA A;  1XEB A;  2PC1 A;  3TO7 A;  2QVP A;  5JH9 A;  2Q0Y A;  5GCN A;  5ELY A;  3JTK A;  2ZW6 A;  3FH4 A;  1OBR A;  2Z3O A;  4LQ6 A;  4P4E A;  3H8F A;  1Z4R A;  4PQA A;  3CXS A;  4QB9 A;  3IFE A;  3FB3 A;  3F5B A;  3HLP A;  3CT9 A;  4AVB A;  2OH1 A;  2V8D A;  4A95 A;  2GU2 A;  1FT7 A;  4KUB A;  4GXH A;  5J8C A;  2H5M A;  4KUA A;  5EC4 A;  4A31 A;  5F46 A;  5DWM A;  4ZYQ A;  2B4D B;  2CTB A;  3MGD A;  4KOT A;  5G1Z A;  4A2Z A;  4A32 A;  2VBQ A;  2JDD A;  3ISZ A;  3D2P A;  2PJA A;  4PK3 A;  2PJ0 A;  2Z3K A;  4CRZ B;  4M6G A;  3ZZI A;  2V8G A;  2V8V A;  3B8G A;  4CGL A;  1M4G A;  3DR8 A;  5AGE A;  3WC7 A;  4H2K A;  3BHX A;  3FVL A;  3NH4 A;  4K3N A;  2Q43 A;  4OC0 A;  3SI1 A;  4F9V A;  5G20 A;  2AFX A;  3FRM A;  3IWG A;  4H6Z A;  4R7M A;  3SI0 A;  4U5Y A;  4C2Y A;  3KR5 A;  4CGP A;  4B13 A;  1ON0 A;  1WK4 A;  1YVO A;  3B3C A;  3JRU A;  4H89 A;  4MFJ A;  3TO6 A;  3H5Z A;  2REF A;  1F57 A;  1LOK A;  1Z9U A;  5A27 A;  1TXR A;  1QST A;  1A2Z A;  4QC6 A;  3SJG A;  4A37 A;  4F8Z A;  2PVW A;  4UF4 A;  4HNW B;  1NSA A;  5H84 A;  3SHP A;  1XJO A;  2POK A;  4UCP A;  4X8I A;  5KTD A;  1M1D A;  4MCQ A;  4UA3 A;  5BWA B;  3BJ7 A;  1BPN A;  4GM5 A;  4II9 A;  5KTC A;  4NXY A;  1OZP A;  2VXK A;  2AFS A;  4WJB A;  3RYO A;  1VHO A;  4P45 A;  2R98 A;  1S7K A;  4KOW A;  7CPA A;  2G0B A;  2PJ1 A;  4I49 A;  4CAV A;  3LAC A;  2B4D A;  3BXM A;  4EME A;  5LYL A;  3QAY A;  2Q7B A;  3IC1 A;  4BBH A;  3TO9 A;  1LRZ A;  3F0A A;  3S6G A;  2Q7S A;  4MY0 A;  4FAI A;  2I79 A;  4R76 A;  2P6E A;  1H8L A;  1M4L A;  4J3G A;  4KVO E;  4C2X A;  3F8K A;  4OIW A;  4KOY A;  3PBE A;  4P44 A;  3NA6 A;  1IIC A;  3D8P A;  3MN8 A;  3DNS A;  4B5P B;  4XNH B;  1IYL A;  3K9U A;  5IB0 A;  2PJ6 A;  5CBM A;  2PIZ A;  2PVV A;  5CNP A;  1S5K A;  1VHS A;  4DYO A;  3IWE A;  3TE4 A;  4Y49 C;  4CYO A;  5C88 A;  4NSQ A;  8CPA A;  1ZG7 A;  5I0C A;  1P0H A;  4B11 A;  2Z3N A;  4CYQ A;  2D4O A;  2EK9 A;  4EVY A;  1YLE A;  2FCK A;  3DR6 A;  5LYD A;  1XFO A;  2J8M A;  3LMS A;  3LWU A;  4JLY A;  2Q51 A;  3PB4 X;  3PFO A;  4P4B A;  4AG9 A;  2ZEO A;  4UCN A;  1FY7 A;  3GB0 A;  4CAF A;  2JDC A;  1B6B A;  2XEJ A;  2AJ6 A;  2OZH A;  1XOV A;  1S3Z A;  3GY9 A;  3QAH A;  2ZED A;  1Z2L A;  4IUS A;  1M4D A;  4MFP A;  4W9Y A;  2ZEE A;  4P4F A;  3B3V A;  3L2N A;  3I3G A;  3TTH A;  2ZOG A;  4NF1 A;  1Y0Y A;  2JBK A;  4R3L A;  4R6T A;  2AE6 A;  2ZEP A;  3H8G A;  4WWV A;  2B4B A;  4GS4 A;  3DGV A;  4DNC A;  2Q04 A;  5HVG A;  1MJB A;  1BO4 A;  4FD4 A;  1TKJ A;  2PRB A;  3D3S A;  4FD7 A;  2DXQ A;  4B12 A;  4XPL A;  3C26 A;  2PJ8 A;  1R57 A;  2BEI A;  5DS0 A;  1N71 A;  4OAE A;  4ONW A;  3KGQ A;  4K30 A;  1WWZ A;  4XPD B;  4MCR A;  2J8R A;  4B5P A;  1CM0 A;  2C6P A;  3PGP A;  2ABZ A;  2ZPA A;  5IB9 A;  2GLJ A;  1UWY A;  4EFD A;  3I1U A;  3S9N A;  2PQ8 A;  2PJ4 A;  2ZOF A;  4BIN A;  4B5O A;  3FJU A;  2YGW A;  1ELL P;  3SXN A;  2GLF A;  4DJL A;  1YW4 A;  4R87 A;  3PB7 X;  3LD2 A;  4MFK A;  1CG2 A;  2V8H A;  2Z10 A;  3IEH A;  2PJB A;  4YGO A;  5THW A;  4RI1 A;  4RUH A;  4Q38 A;  2J9A A;  4KOU A;  4B6Z A;  1KZF A;  1MJ9 A;  2WYR A;  2AFO A;  1Y7R A;  2O53 A;  4PV6 A;  3W91 A;  5HVH A;  3KR4 A;  4JYW A;  3NE7 A;  2RB7 A;  2P6G A;  3KQZ A;  4OC3 A;  1ELM P;  2GFQ A;  4C68 A;  1BLL E;  4MMO A;  2OB0 A;  4MFQ A;  4ONU A;  4LUA A;  3BLN A;  5HVF A;  3PEI A;  1R43 A;  3CZX A;  5AG6 A;  1YR0 A;  2P0W A;  5AG7 A;  4E2A A;  2FSR A;  2Q4Y A;  4LQG A;  3E0K A;  2FIW A;  4E0A A;  3PFE A;  2VL1 A;  1IID A;  3CPA A;  2F5I A;  1QSN A;  3NFZ A;  2CTC A;  3S9M A;  1YME A;  1KWM A;  3FEC A;  4XPK A;  3SJE A;  2EVN A;  5A28 A;  3WC6 A;  3R9E A;  4A30 A;  3BJ8 A;  4R8F A;  1F2O A;  2CNM A;  4M6H A;  4MXU A;  4U9Z A;  3B3T A;  1QSR A;  1S7F A;  2PJ9 A;  2V77 A;  4KOX A;  4C2Z A;  2Q4V A;  2DEA A;  3IIB A;  3R9F A;  1VGY A;  3D68 A;  3TT2 A;  4E8O A;  5K8O A;  1AYE A;  1XE4 A;  2XEI A;  3IGR A;  1Y9K A;  3EC4 A;  2O28 A;  4F0X A;  3SJF A;  3K2K A;  3K9T A;  4AVA A;  4JJX A;  1TF9 A;  4KOR A;  2G3T A;  4MY3 A;  4OC5 A;  4CRY B;  1EE3 P;  4M3S A;  5KTA A;  5EBV A;  1VHE A;  2YNC C;  4OME A;  1U6M A;  2BOA A;  2VI7 A;  4X5K A;  3TOB A;  2IMO A;  5JPH A;  3TFY A;  4YRH A;  1YLO A;  4FD5 A;  4P4J A;  3GUX A;  4B14 A;  1Z4E A;  4CPA A;  3R96 A;  1Z5R A;  1CP7 A;  1XRY A;  1X12 A;  3N5F A;  3I9S A;  4G1P A;  4H6U A;  5F09 A;  2GE3 A;  2IQ6 A;  1TF8 A;  1CJW A;  4FWU A;  2ZW5 A;  4OKO A;  3S6H A;  3TX8 A;  3V8I A;  3WC5 A;  1GHE A;  2QEC A;  2WPX A;  2Z3L A;  4FBE A;  1IGB A;  1QQ9 A;  4CAX A;  1J4J A;  4Y49 B;  3PB6 X;  4RS2 A;  1TKF A;  4ZX8 A;  1QMU A;  4A39 A;  2C6G A;  2C6C A;  4C7I A;  4P6Y A;  3KHX A;  2GAN A;  4EWT A;  4MCS A;  1CBX A;  1S7L A;  4MHY A;  4P4D A;  3TC8 A;  2WSA A;  4YFJ A;  2FT0 A;  2GIV A;  1CPS A;  2R8V A;  3FBU A;  4ZX9 A;  3WAB A;  3KZW A;  2G3A A;  4A38 A;  4NGP A;  3R9G A;  6CPA A;  3KI9 A;  5LRG A;  2EWB A;  2QJ8 A;  4PPZ A;  3SI2 A;  4FD6 A;  3R95 A;  1XIX A;  2FS5 A;  4YWY A;  1NE9 A;  2PR1 A;  2F8H A;  2ZEG A;  3NH8 A;  4PXB A;  3KKW A;  4IAV A;  4IHM A;  1ZG9 A;  4MBU A;  1BOB A;  4UEF A;  5AG4 A;  1XF8 A;  1QSO A;  2GRE A;  3D7D A;  2ANP A;  3W6X A;  4CGM A;  2DPT A;  2PIY A;  1K4J A;  2B3V A;  4ZY0 A;  4HKF A;  1BPM A;  1B87 A;  4OID A;  5IX3 A;  3RNZ A;  3VWD A;  5LRK A;  3PP9 A;  3PZJ A;  1IYK A;  5CPA A;  2JBJ A;  2FVG A;  4MCP A;  2PJ7 A;  4OC4 A;  3UY5 A;  3PB9 X;  3QNV A;  2Z11 A;  3EXN A;  3IU2 A;  4X2T A;  2OOT A;  3W6S A;  1LFW A;  4JZ0 A;  3FEE A;  3SJX A;  5HH1 A;  3H8E A;  1SQH A;  3S6K A;  3KQX A;  5LYI A;  1PCA A;  4NGR A;  4MI4 A;  4PSW A;  4M6I A;  2QIR A;  3NE8 A;  4NJR A;  2X7B A;  5K8N A;  3FNC A;  2R7H A;  5HMN A;  1CX8 A;  3DLJ A;  4UEE A;  4XNH C;  2NSM A;  2QYV A;  3RAM A;  3WT4 A;  1ZLI A;  3H4Q A;  4MHP A;  2A4N A;  1IOI A;  1Y9W A;  2F7V A;  4HNY B;  3WR7 A;  4F6A A;  1AUG A;  5I4M A;  1XMT A;  3KAS A;  4OP4 A;  2FL4 A;  4RN7 A;  4PXC A;  2VZY A;  1QSM A;  2JLM A;  2NYQ A;  4R3K A;  4Q7A A;  1VIX A;  1Z8T A;  3TOA A;  1RTQ A;  2RC4 A;  4TWE A;  4R9M A;  4HPS A;  4A94 A;  4CYN A;  4AG7 A;  2ZW4 A;  3D7G A;  1F2P A;  2Z0Z A;  2BL1 A;  3FXT A;  3GLJ A;  4UCM A;  1L0C A;  1ZLH A;  4QUS A;  4Z65 A;  1MK4 A;  1DTD A;  2Q44 A;  3T90 A;  4Q36 A;  4YU9 A;  3N7Z A;  2K5T A;  3G8W A;  4F0Y A;  1IOF A;  2OZU A;  1ZO0 A;  2PDO A;  1YK3 A;  3B3S A;  2B5G A;  1Q2C A;  2EO8 A;  3CPX A;  3D7H A;  3P2F A;  4PSX A;  2Y0M A;  1YGH A;  4NGQ A;  3D66 A;  1Q2D A;  1ARM A;  2C27 A;  2ATR A;  3DDD A;  1S60 A;  1HEE A;  3JUW A;  4PXD A;  1GYT A;  4UWJ A;  4MHZ A;  2NMT A;  3PB8 X;  4QBJ A;  2XEG A;  4LX9 A;  3PRT A;  5ISV A;  5J8F A;  1I21 A;  4KSF A;  1RO5 A;  1YQE A;  1LAM A;  2PJ5 A;  4UBR A;  1MJA A;  5K8M A;  4KOV A;  5JM6 A;  4NCZ A;  1ZG8 A;  1Z8W A;  2I00 A;  1KUY A;  2CXA A;  2FE7 A;  4XPD C;  1LAN A;  1Y0R A;  1IB1 E;  2EBJ A;  3FED A;  5H86 A;  4CGO A;  1PU9 A;  1YX0 A;  4JXR A;  1BAV A;  3FMC A;  3V38 A;  4IF5 A;  2VEZ A;  3P2H A;  3R1K A;  3GYA A;  3GIU A;  2CNS A;  4UIA A;  4X3R A;  4KZT A;  2ZEH A;  3RBU A;  5HXD A;  1VKC A;  3S9L A;  1R3N A;  3VH9 A;  2PJC A;  2BUE A;  2OR4 A;  3CXP A;  3D7F A;  5J1Q A;  2ZEL A;  1S7N A;  1TIQ A;  4CS0 B;  1Y7E A;  2AFM A;  3FYN A;  2Z3M A;  4UEZ A;  2JEV A;  5LYF A;  2PR8 A;  1DE4 C;  3T8W A;  2ODF A;  3KHZ A;  4HNX B;  4UFW A;  2AFU A;  1LCP A;  3EO4 A;  4MFL A;  5F48 A;  4AB7 A;  3CXQ A;  5JGF A;  2B58 A;  4IK2 A;  4MJ8 A;  4CAW A;  4NGT A;  1X10 A;  4MRI A;  2HC9 A;  2I3C A;  2ZXV A;  2ARH A;  4JWP A;  4O23 A;  2XEF A;  2VZZ A;  2PRQ A;  1JWQ A;  2OZG A;  1I12 A;  4UWI A;  5D29 A;  2DPS A;  2HQY A;  5DWN A;  2QML A;  1YRE A;  5G21 A;  2PE3 A;  5AG5 A;  3VAR A;  3V7Z A;  3NH5 A;  2IJZ A;  2CF4 A;  1HDQ A;  1Z8L A;  2Q4Z A;  3PBB A;  3RO0 A;  2B3U A;  4ZGY B;  1PUA A;  2WPW A;  1Z8X A;  3A9L A;  4AVC A;  2PCU A;  1NSL A;  3IO1 A;  4R57 A;  1UFH A;  2FIA A;  3VAT A;  4OAD A;  2Z3P A;  3EY5 A;  3IWW A;  3JVN A;  2REE A;  3T9Y A;  3VWE A;  2ZEN A;  2YNC A;  2PJ3 A;  4U9Y A;  4DUK A;  3BI0 A;  1XBU A;  1PYT B;  1Q2Y A;  3IJ3 A;  2VQY A;  2CY2 A;  3EFA A;  1M44 A;  4OC2 A;  5C82 A;  2YND A;  1RXT A;  1ARL A;  3RZA A;  3LOD A;  5JQ4 A; 
#chains in the Genus database with same CATH homology
 2IL4 A;  2EUI A;  2FXF A;  3OWC A;  2B5G B;  4JXQ A;  4NEX A;  2BSW A;  1V0C A;  5F49 A;  3GKR A;  4KS9 A;  3SXO A;  3IU1 A;  4L8A A;  2OU2 A;  4QVT A;  2D4P A;  4CAE A;  2CNT A;  4ORF A;  4OLL A;  3S6F A;  4JD6 A;  2J8N A;  5FVJ A;  1KUX A;  2HUZ A;  2KCW A;  2P6F A;  4UFX A;  4KVM E;  5F47 A;  4BMH A;  5IV0 A;  4KVX A;  4MHD A;  1NMT A;  4C7H A;  4CYP A;  4CGN A;  2HV2 A;  1YVK A;  4KOS A;  4PK2 A;  1P4N A;  4KLV A;  1M4I A;  1I1D A;  4L89 A;  1KUV A;  4UFV A;  5E96 A;  2YNE A;  4M85 A;  2WUU A;  2ZW7 A;  3DSB A;  3FIX A;  2PSW A;  2R1I A;  3TCV A;  4MFZ A;  4A33 A;  4KLW A;  4B10 A;  4ZBG A;  3D2M A;  3QB8 A;  3G3S A;  3ZJ0 A;  5G22 A;  4KSA A;  1XEB A;  2PC1 A;  3TO7 A;  2Q0Y A;  5GCN A;  3JTK A;  2ZW6 A;  2Z3O A;  1Z4R A;  3CXS A;  4QB9 A;  3FB3 A;  3F5B A;  4AVB A;  2OH1 A;  4A95 A;  4KUB A;  5J8C A;  2H5M A;  4KUA A;  5EC4 A;  4A31 A;  5F46 A;  5DWM A;  3MGD A;  2B4D B;  4KOT A;  5G1Z A;  4A2Z A;  4A32 A;  2VBQ A;  2JDD A;  3D2P A;  4PK3 A;  2Z3K A;  4CRZ B;  3ZZI A;  3B8G A;  4CGL A;  1M4G A;  3DR8 A;  5AGE A;  5G20 A;  3FRM A;  3IWG A;  4H6Z A;  4U5Y A;  4C2Y A;  4CGP A;  4B13 A;  1ON0 A;  1WK4 A;  1YVO A;  4H89 A;  4MFJ A;  3TO6 A;  3H5Z A;  2REF A;  1Z9U A;  5A27 A;  1QST A;  4QC6 A;  4HNW B;  5H84 A;  3SHP A;  4UCP A;  5KTD A;  1M1D A;  4UA3 A;  5BWA B;  3BJ7 A;  4II9 A;  5KTC A;  4NXY A;  1OZP A;  2VXK A;  3RYO A;  2R98 A;  1S7K A;  4KOW A;  2G0B A;  4I49 A;  4CAV A;  2B4D A;  2Q7B A;  4BBH A;  3TO9 A;  1LRZ A;  3F0A A;  3S6G A;  4MY0 A;  2I79 A;  2P6E A;  4J3G A;  4KVO E;  4C2X A;  3F8K A;  4KOY A;  1IIC A;  3D8P A;  4B5P B;  3DNS A;  4XNH B;  1IYL A;  3K9U A;  5IB0 A;  5CNP A;  1S5K A;  1VHS A;  3IWE A;  3TE4 A;  4Y49 C;  4CYO A;  5C88 A;  4NSQ A;  5I0C A;  1P0H A;  4B11 A;  2Z3N A;  4CYQ A;  2D4O A;  4EVY A;  1YLE A;  2FCK A;  3DR6 A;  2J8M A;  4JLY A;  4AG9 A;  4UCN A;  1FY7 A;  4CAF A;  2JDC A;  1B6B A;  2AJ6 A;  2OZH A;  3QAH A;  1S3Z A;  3GY9 A;  4IUS A;  4MFP A;  1M4D A;  3I3G A;  3TTH A;  4NF1 A;  4R3L A;  2AE6 A;  2B4B A;  4GS4 A;  4DNC A;  2Q04 A;  1MJB A;  1BO4 A;  4FD4 A;  2PRB A;  3D3S A;  4FD7 A;  2DXQ A;  4B12 A;  4XPL A;  3C26 A;  1R57 A;  2BEI A;  1N71 A;  4OAE A;  4XPD B;  4K30 A;  1WWZ A;  2J8R A;  4B5P A;  1CM0 A;  3PGP A;  2ZPA A;  2PQ8 A;  4B5O A;  2YGW A;  3SXN A;  4R87 A;  3LD2 A;  4MFK A;  2Z10 A;  4YGO A;  4RI1 A;  4Q38 A;  4KOU A;  1KZF A;  1MJ9 A;  1Y7R A;  4PV6 A;  3W91 A;  3NE7 A;  2P6G A;  4C68 A;  2OB0 A;  4MFQ A;  4ONU A;  4LUA A;  3BLN A;  5AG6 A;  5AG7 A;  1YR0 A;  2P0W A;  4E2A A;  2FSR A;  2Q4Y A;  3E0K A;  2FIW A;  4E0A A;  1IID A;  2F5I A;  1QSN A;  4XPK A;  2EVN A;  5A28 A;  3R9E A;  4A30 A;  3BJ8 A;  2CNM A;  4U9Z A;  1QSR A;  1S7F A;  4KOX A;  4C2Z A;  2Q4V A;  3R9F A;  3TT2 A;  4E8O A;  1XE4 A;  3IGR A;  1Y9K A;  3EC4 A;  2O28 A;  4F0X A;  4AVA A;  4JJX A;  4KOR A;  4MY3 A;  2G3T A;  4CRY B;  4M3S A;  5KTA A;  5EBV A;  2YNC C;  4X5K A;  1U6M A;  2VI7 A;  3TOB A;  5JPH A;  3TFY A;  4YRH A;  4FD5 A;  4B14 A;  1Z4E A;  3R96 A;  3I9S A;  4H6U A;  2GE3 A;  3S6H A;  1CJW A;  2ZW5 A;  3V8I A;  1GHE A;  2QEC A;  2WPX A;  2Z3L A;  4CAX A;  1J4J A;  4Y49 B;  4RS2 A;  4C7I A;  2GAN A;  1S7L A;  4YFJ A;  2WSA A;  2FT0 A;  2GIV A;  2R8V A;  3FBU A;  2G3A A;  3R9G A;  4FD6 A;  3R95 A;  1XIX A;  2FS5 A;  1NE9 A;  2PR1 A;  3KKW A;  4MBU A;  1BOB A;  5AG4 A;  1XF8 A;  1QSO A;  3W6X A;  4CGM A;  2DPT A;  1K4J A;  2B3V A;  4HKF A;  5IX3 A;  1B87 A;  3VWD A;  3PP9 A;  3PZJ A;  1IYK A;  3UY5 A;  2Z11 A;  3EXN A;  3IU2 A;  3W6S A;  5HH1 A;  1SQH A;  3S6K A;  4MI4 A;  4PSW A;  2QIR A;  2X7B A;  3FNC A;  2R7H A;  5HMN A;  4XNH C;  3H4Q A;  2A4N A;  1Y9W A;  4HNY B;  4F6A A;  3WR7 A;  1XMT A;  2FL4 A;  4R3K A;  2VZY A;  1QSM A;  2JLM A;  3TOA A;  2RC4 A;  4R9M A;  4CYN A;  4AG7 A;  2ZW4 A;  2Z0Z A;  2BL1 A;  3FXT A;  4UCM A;  1L0C A;  4QUS A;  1MK4 A;  2Q44 A;  3T90 A;  4Q36 A;  3N7Z A;  2K5T A;  3G8W A;  4F0Y A;  2OZU A;  1ZO0 A;  2PDO A;  1YK3 A;  2B5G A;  1Q2C A;  3P2F A;  4PSX A;  2Y0M A;  1YGH A;  1Q2D A;  2C27 A;  2ATR A;  3DDD A;  1S60 A;  3JUW A;  4UWJ A;  2NMT A;  4QBJ A;  4LX9 A;  5ISV A;  5J8F A;  1I21 A;  4KSF A;  1RO5 A;  4UBR A;  1MJA A;  4KOV A;  4NCZ A;  2I00 A;  1KUY A;  2CXA A;  2FE7 A;  4XPD C;  1IB1 E;  5H86 A;  4CGO A;  1PU9 A;  1YX0 A;  4JXR A;  4IF5 A;  2VEZ A;  3P2H A;  3R1K A;  3GYA A;  2CNS A;  4KZT A;  1VKC A;  2BUE A;  3CXP A;  1S7N A;  1TIQ A;  4CS0 B;  3FYN A;  2Z3M A;  2JEV A;  2PR8 A;  4HNX B;  4UFW A;  3EO4 A;  4MFL A;  5F48 A;  4AB7 A;  3CXQ A;  2B58 A;  4CAW A;  4MJ8 A;  2ZXV A;  2ARH A;  4JWP A;  2VZZ A;  2OZG A;  1I12 A;  4UWI A;  2DPS A;  2HQY A;  5DWN A;  2QML A;  1YRE A;  5G21 A;  5AG5 A;  2B3U A;  4ZGY B;  1PUA A;  2WPW A;  3A9L A;  4AVC A;  1NSL A;  4R57 A;  1UFH A;  2FIA A;  4OAD A;  2Z3P A;  3EY5 A;  3JVN A;  2REE A;  3T9Y A;  3VWE A;  2YNC A;  4U9Y A;  1Q2Y A;  5C82 A;  3EFA A;  2CY2 A;  2VQY A;  1M44 A;  2YND A;  1RXT A;  3LOD A;  5JQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...