1YVKA

Crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
152
structure length
152
Chain Sequence
KLRIELGEETNDELYDLLLLADPSKDIVDEYLERGECYTAWAGDELAGVYVLLKTRPQTVEIVNIAVKESLQKKGFGKQLVLDAIEKAKKLGADTIEIGTGNSSIHQLSLYQKCGFRIQAIDHDFFLRHYDEDIFENGIQCRDMVRLYLDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BSU33890
publication title Crystal Structure of the Bacillis subtilis Acetyltransferase in complex with CoA, Northeast Structural Genomics Target SR237.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Transferase
total genus 39
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yvkA00
3DR8A 4JWPA 3R9GA 3DNSA 1XIXA 1KUXA 3KKWA 4KLWA 2VZYA 3TCVA 2ZW6A 3I3GA 3B8GA 4KOSA 2B4BA 4XPDC 3PP9A 2FIWA 2QMLA 3TO6A 3VWEA 2AJ6A 4R57A 2OZGA 4U9YA 1QSNA 2VQYA 2PC1A 3W91A 1P0HA 1YLEA 3SXNA 3JVNA 4KUAA 1B6BA 4QUSA 5F49A 1MJAA 1M4DA 2FT0A 3QB8A 2Q0YA 1V0CA 1TIQA 4YRHA 3H4QA 2PR8A 2O28A 1R57A 3D2PA 2PQ8A 3R1KA 2B5GA 4OAEA 3BJ7A 4XNHC 4J3GA 3LD2A 4JLYA 4R3LA 4F6AA 2QECA 2X7BA 4JXQA 2G3TA 4R87A 2R7HA 4UWIA 4KUBA 3TTHA 3K9UA 1YVKA 1PUAA 1KZFA 2ZW5A 4H6UA 5IX3A 3D2MA 1NMTA 4XPLA 5IV0A 5EC4A 1Z4RA 5C82A 1IIDA 2OZHA 2OZUA 1S60A 2Z0ZA 4OADA 3R95A 4IF5A 2WPXA 3TOBA 4CRZB 3DSBA 2VBQA 5KTCA 1Q2CA 2B58A 2HQYA 3ZJ0A 4PSXA 2VEZA 4MY0A 4PV6A 2BUEA 2Y0MA 4KVXA 1WWZA 1Y9WA 3P2FA 1K4JA 1P4NA 4FD5A 1PU9A 2I79A 2K5TA 4CAWA 4MY3A 1IB1E 2Z11A 2B5GB 1BO4A 5ISVA 1QSMA 1XF8A 5KTAA 2FSRA 2QIRA 1OZPA 1Q2DA 2ATRA 5C88A 1FY7A 5HH1A 4KOTA 4MBUA 2R8VA 3TO7A 4RI1A 1NSLA 2AE6A 3DDDA 1N71A 4M3SA 3PGPA 3F8KA 1NE9A 4XPDB 2FE7A 1YX0A 1I12A 4UWJA 3G3SA 3SHPA 2B3UA 2Z10A 4LX9A 4NCZA 1CM0A 1S7LA 4AVBA 3R9EA 4L89A 3UY5A 3FNCA 3FYNA 4JJXA 4CS0B 1QSOA 3FRMA 3JUWA 1I21A 3TT2A 2Q4YA 2HV2A 4XNHB 3ZZIA 2CNTA 5F47A 1Y7RA 4PK3A 3W6SA 2J8MA 3D3SA 2ZW7A 1YK3A 3V8IA 3WR7A 1YR0A 3BJ8A 2R98A 3S6GA 4X5KA 4ORFA 4LUAA 5J8CA 3OWCA 5J8FA 4KLVA 4KZTA 2J8NA 3BLNA 2FL4A 3PZJA 3T90A 1IYKA 5JQ4A 3TO9A 2B4DA 2FIAA 4CRYB 4OLLA 3C26A 1RO5A 3G8WA 4U5YA 3I9SA 2OU2A 4FD6A 1GHEA 2EUIA 3EO4A 2ZPAA 4Y49C 1VKCA 1WK4A 4H6ZA 4AB7A 5JPHA 4CAXA 3F5BA 4RS2A 5FVJA 3DR6A 3TE4A 5IB0A 5H86A 1UFHA 2BL1A 2JDDA 2EVNA 1IYLA 1Y9KA 2F5IA 2ZXVA 1YREA 4KVME 3FBUA 4H89A 4MJ8A 3FXTA 3S6KA 2CNSA 1XMTA 4JD6A 1Z4EA 4KVOE 3CXQA 4U9ZA 1S5KA 1YVOA 1J4JA 4M85A 2JEVA 3LODA 3W6XA 2P6EA 2Q04A 2Q4VA 4NF1A 2REFA 2B4DB 1Z9UA 3RYOA 2PSWA 2BSWA 4F0YA 4ZBGA 3P2HA 2JDCA 4AVAA 4ONUA 2P0WA 4E0AA 2BEIA 2G0BA 1S3ZA 1S7NA 2B3VA 4UA3A 2OB0A 4KOVA 2D4OA 4I49A 4BMHA 2P6FA 4NXYA 1S7FA 3GYAA 4AG9A 2CNMA 4KOYA 4B5OA 2REEA 3IGRA 2VZZA 2NMTA 4KOUA 3VWDA 3D8PA 3FB3A 2FXFA 2OH1A 1L0CA 1QSTA 4MHDA 5I0CA 2Q44A 4MI4A 3CXPA 1MJ9A 1M4GA 5H84A 2WPWA 3EC4A 2I00A 1B87A 5KTDA 4E2AA 3SXOA 2JLMA 3EFAA 4R3KA 1CJWA 4AVCA 2P6GA 5F48A 2GANA 2H5MA 3T9YA 4HKFA 4YGOA 4II9A 2KCWA 1XEBA 4Y49B 4AG7A 3NE7A 1XE4A 1Q2YA 4KOWA 2CY2A 1RXTA 3S6HA 3QAHA 3F0AA 1I1DA 3S6FA 2ZW4A 2D4PA 2FS5A 1U6MA 2RC4A 4KOXA 1M4IA 3EY5A 4B5PA 1BOBA 1VHSA 2ARHA 5EBVA 4PSWA 2PRBA 2R1IA 5HMNA 3CXSA 1KUVA 4L8AA 2A4NA 2VXKA 4KORA 1KUYA 4DNCA 2GIVA 5E96A 4NEXA 5CNPA 2PR1A 4EVYA 1M44A 4K30A 4CAVA 5F46A 1M1DA 3TOAA 2DXQA 4HNYB 1MJBA 4HNWB 4R9MA 3R96A 1QSRA 4FD7A 4E8OA 3TFYA 5GCNA 2Q7BA 3GKRA 1MK4A 4XPKA 2VI7A 4QVTA 3R9FA 4QC6A 1S7KA 2G3AA 4B5PB 1YGHA 2FCKA 3GY9A 1ON0A 3FIXA 2PDOA 4JXRA 3MGDA 4NSQA 4FD4A 4QB9A 5DWMA 2GE3A 3IWGA 2C27A 4QBJA 5DWNA 4GS4A 3E0KA 4PK2A 1LRZA 2IL4A 4UBRA 3EXNA 1SQHA 1IICA 4IUSA 2HUZA 3N7ZA 4YFJA 2J8RA 4HNXB
chains in the Genus database with same CATH superfamily
2F7VA 3DR8A 4JWPA 3R9GA 3DNSA 1XIXA 1KUXA 2NYQA 3KKWA 4KLWA 4F8ZA 2VZYA 4MFKA 4C2ZA 3PRTA 3TCVA 1Z8WA 2ZW6A 3I3GA 3B8GA 3D67A 4LQ6A 4KOSA 4RN7A 4B6ZA 2B4BA 3PBEA 4Q38A 3PP9A 4OIDA 4XPDC 2FIWA 2ZEDA 2PJCA 2QMLA 3MRUA 5AGEA 3TO6A 4A31A 3VWEA 4DYOA 4ZY0A 1A2ZA 2AJ6A 5THWA 4OC5A 1FNOA 4R57A 2OZGA 4U9YA 1QSNA 2V8HA 2PRQA 4P4BA 2VQYA 2PC1A 3FMCA 3W91A 3SJGA 1P0HA 2ZOFA 4F0XA 1YLEA 3SXNA 2G9DA 3JVNA 4KUAA 1B6BA 4QUSA 2ZEGA 5HVHA 2ANPA 1BAVA 3B3WA 4M6IA 5F49A 3H8FA 1MJAA 1M4DA 2Z3MA 2FT0A 2PIYA 3QB8A 1CP6A 3PB4X 2Q0YA 3GLJA 3WT4A 1V0CA 1TIQA 1ELMP 2EK8A 3CPXA 4CYOA 4EFDA 3IO1A 3H4QA 4UFWA 4YRHA 1XJOA 4JZ0A 2PR8A 2O28A 1R57A 2V8DA 3LACA 4OKOA 3D2PA 4NGMA 1X10A 2AFXA 1Q7LA 5K8PA 2PQ8A 3NFZA 5HVFA 3R1KA 2B5GA 4PXCA 4OAEA 3BJ7A 3BI0A 3A9LA 4XNHC 4J3GA 2V8GA 3LD2A 2XEGA 3CT9A 4JLYA 4R3LA 2QECA 3LWUA 4F6AA 4CAFA 5JH9A 2X7BA 4JXQA 2G3TA 3DGVA 4R87A 4CGMA 2R7HA 4NGNA 4P10A 3WC7A 1CG2A 4X8IA 2PJ5A 2CTCA 4KUBA 2ZEHA 2C1CA 4UWIA 3TTHA 1VHOA 3K9UA 3PFEA 1YVKA 4A33A 1PUAA 1KZFA 2CF4A 4FUUA 4G1PA 5G21A 2ZELA 2ZW5A 4H6UA 5IX3A 3D2MA 1YQEA 4DUKA 4UFXA 4A94A 1NMTA 5K8OA 4XPLA 3KASA 1Z8TA 4CGPA 5EC4A 1Z4RA 5C82A 5IV0A 1IIDA 2OZHA 4A95A 2AFMA 4R76A 2OZUA 1S60A 2Z0ZA 4OADA 3S9LA 1RTQA 2GLFA 2GREA 3R95A 3H8GA 4IF5A 4OMEA 2WPXA 3TOBA 4A37A 4CRZB 4A32A 3DSBA 2VBQA 5KTCA 4NGPA 2JBKA 5A28A 1Q2CA 2B58A 4MRIA 1QQ9A 3KR4A 5LRGA 2PJ4A 2HQYA 1Z2LA 4MHNA 3ZJ0A 1X12A 3FH4A 4PSXA 1H8LA 2VEZA 4MY0A 4PV6A 5G20A 1QMUA 1ZLIA 2BUEA 2Y0MA 4KVXA 3WABA 1WWZA 3KGQA 1Y9WA 2CXAA 2YNCC 4ZY2A 2F8HA 3P2FA 1ARMA 1K4JA 1P4NA 1GYTA 4FD5A 4A39A 1PU9A 2I79A 2K5TA 4CAWA 4MY3A 4P44A 1IB1E 2V77A 2ZEPA 2Z11A 2PJ2A 2B5GB 1CP7A 3D4UA 3CZXA 2DPSA 1BO4A 5ISVA 3CPAA 4X3RA 5K8NA 1QSMA 2AFZA 1PYTB 1XF8A 5KTAA 4B10A 3VH9A 2DEAA 3ISZA 4HPSA 1ZLHA 2FSRA 2QIRA 1OZPA 1Q2DA 1UWYA 1Y7EA 1YSJA 2ATRA 5C88A 1FY7A 5HH1A 4KOTA 4B12A 4MBUA 2R8VA 3TO7A 4RUHA 4RI1A 5D29A 4ZGYB 4FWUA 1NSLA 2PJ1A 2AE6A 3DDDA 1N71A 3BXMA 4M3SA 3SJFA 3PGPA 4WJBA 3F8KA 4A30A 5K8MA 1NE9A 5LYLA 4KS9A 4XPDB 2FE7A 2EO8A 3PB8X 2PJ9A 5AG7A 5AG5A 4F9VA 4H2KA 1YX0A 1I12A 1BPMA 4UWJA 1ZO0A 3G3SA 3SHPA 2IQ6A 3IU2A 2JBJA 2PE3A 3N5FA 2B3UA 4CAEA 1Y0YA 2Z10A 4LX9A 4NCZA 1Z8LA 1CM0A 1Y0RA 1YW4A 4KSFA 1S7LA 4AVBA 2BO9A 4FBEA 3R9EA 3DLJA 1R43A 4P6YA 4L89A 3UY5A 2DF5A 3FNCA 4A2ZA 3IJ3A 3FYNA 4MMOA 1YLOA 1XMBA 4JJXA 4MCQA 4CS0B 1TKHA 1QSOA 2POKA 2YNCA 5HVGA 4NFRA 3V7ZA 2Z3NA 1ZG8A 2ZEOA 3S9NA 3FRMA 3JUWA 2ZEEA 1I21A 1FT7A 2YGWA 3TT2A 3QNVA 4M6GA 3IC1A 4A38A 2Q4YA 2HV2A 1TKJA 4XNHB 3H5ZA 3ZZIA 2CNTA 4UIBA 1HEEA 5F47A 1Y7RA 4PK3A 4UCPA 3W6SA 2AFOA 2J8MA 2QJ8A 3D3SA 5I4MA 2ZW7A 4O23A 1YK3A 3V8IA 3WR7A 1YR0A 3B7IA 4MHYA 3JTKA 4NJRA 3BJ8A 3IWWA 2R98A 4IHMA 3S6GA 4X5KA 5G1ZA 1ARLA 4ORFA 4OC3A 4LUAA 4IK2A 5J8CA 3OWCA 5J8FA 3SJXA 4KLVA 4KZTA 2J8NA 3BLNA 4F9UA 2FL4A 3PZJA 3T90A 1IYKA 5JQ4A 3JRUA 3TO9A 4MFPA 4Q7AA 2B4DA 4OC0A 2FIAA 4TWEA 4CRYB 4YU9A 2VL1A 3D7FA 4OLLA 1XRYA 4NGRA 1BPNA 2GFQA 2PJ7A 2ZOGA 3B3VA 3C26A 1RO5A 2Z3LA 4DJLA 1CX8A 3G8WA 4U5YA 4UF4A 4P4FA 5G22A 2I3CA 4C2YA 2J9AA 3I9SA 2OU2A 4FD6A 1GHEA 2EUIA 3EO4A 2ZPAA 4Y49C 1VKCA 1WK4A 4H6ZA 3KHZA 4AB7A 5JPHA 3NH5A 4UCNA 5ELYA 4CAXA 4NGQA 3F5BA 4RS2A 3IIBA 5FVJA 4MFQA 1ZG7A 3NA6A 1M4LA 3FJUA 3DR6A 3TE4A 4UEEA 2BOAA 3GIUA 5H86A 1UFHA 5IB0A 2BL1A 2JDDA 2EVNA 2PJ6A 1TF9A 1AUGA 1IYLA 1Y9KA 2F5IA 3RAMA 3PB7X 2ZXVA 4ZX8A 1YREA 2AFSA 1VHEA 2C6PA 4KVME 3FBUA 4H89A 4MJ8A 3FXTA 1EE3P 5LYFA 3S6KA 3HLPA 5JGFA 2CNSA 4CYPA 4ZX9A 1XMTA 4UIAA 1IY7A 4JD6A 1LFWA 3B2YA 3D66A 1IOIA 1Z4EA 4P4EA 3RO0A 4EMEA 4KVOE 2HC9A 3CXQA 3KL9A 1OBRA 3KZWA 4U9ZA 1S5KA 1YVOA 4PPZA 3D7DA 1J4JA 1ELLP 3D7GA 3IU1A 4IAVA 4PQAA 2AFWA 4M85A 4MFJA 4NGTA 4MCSA 2JEVA 2GLJA 5DS0A 4X2TA 3LODA 3W6XA 4PXEA 2P6EA 2Q04A 2Q4VA 4NF1A 2REFA 3KI9A 3GB0A 2B4DB 4ZYQA 1Z9UA 3RYOA 2PSWA 5LRJA 3RNZA 1HDUA 4C7HA 2BSWA 4F0YA 4ZBGA 3P2HA 2JDCA 3TX8A 2WSAA 4AVAA 4ONUA 2P0WA 1F2OA 2Z3OA 2PJ0A 2BCOA 5AG6A 3T8WA 1XBUA 2Q4ZA 4E0AA 3SI0A 4C2XA 3FECA 2BEIA 2G0BA 1XOVA 1S3ZA 3B35A 4OC2A 1S7NA 2B3VA 2Z3KA 5LRKA 1LCPA 4UA3A 4UEFA 4Z65A 2OR4A 3CDXA 4W9YA 2OOTA 2AFUA 2OB0A 3FEEA 5BWAB 8CPAA 3TC8A 1LAMA 4KOVA 4M6HA 2D4OA 4MFLA 4MFZA 4I49A 4BMHA 2P6FA 4MXUA 4NXYA 4CGOA 1S7FA 1IOFA 1LANA 4OC4A 5CPAA 3GYAA 4AG9A 2CNMA 2WYRA 4KOYA 4UCMA 4B5OA 4CGNA 2REEA 3VATA 3IGRA 2VZZA 2NMTA 2WZNA 4KOUA 3VWDA 2CIJA 3D8PA 4P45A 2NSMA 1LAPA 2CTBA 3B3TA 3FB3A 1DE4C 5JM6A 2HB6A 4TNUA 2FXFA 1F2PA 3NH8A 4MHPA 2OH1A 3MN8A 4WWVA 1L0CA 1QSTA 2O4HA 2ABZA 3SJEA 4MHDA 5I0CA 4R7MA 2Q44A 4Q36A 5A27A 4MI4A 1BLLE 2Q51A 3IFEA 4UFVA 3CXPA 5LYDA 1MJ9A 1M4GA 3RBUA 1YMEA 5H84A 2WPWA 3EC4A 4AG7A 1CBXA 2I00A 1B87A 2YNEA 4CYNA 3SXOA 4E2AA 5KTDA 2JLMA 3EFAA 4R3KA 3SI1A 4C7IA 2EBJA 1CJWA 4AVCA 2PJAA 2P6GA 5F48A 2GANA 2ODFA 3FX6A 1AMPA 3LMSA 4B14A 1JQGA 4R6TA 2H5MA 3I1UA 4HKFA 4YGOA 1AYEA 3T9YA 2KCWA 1XEBA 4II9A 3KQZA 3GUXA 4Y49B 3KQXA 1ZG9A 1XE4A 1Q2YA 1VGYA 2CY2A 1XFOA 3NE7A 4KOWA 4LQGA 2PVVA 3WC5A 1RXTA 3S6HA 3K2KA 3QAHA 1CPSA 3F0AA 1F57A 2GU2A 2XEJA 2EK9A 4KSIA 3WC6A 4PXBA 4B13A 1I1DA 3B3SA 3S6FA 4BBHA 2ZW4A 2D4PA 3KR5A 4YWYA 2FS5A 1U6MA 2RC4A 4KOXA 4C68A 3IWEA 1M4IA 2XEIA 3EY5A 2IJZA 3IEHA 3PEIA 4MCPA 4B5PA 1BOBA 4KSAA 1VHSA 4OP4A 4CGLA 2ARHA 3BI1A 4PSWA 5EBVA 2PRBA 2R1IA 5J1QA 4UEZA 5HMNA 2ZENA 2ZEFA 2ZEMA 1KUVA 3CXSA 3PB6X 4L8AA 2PJ8A 4NGSA 5HXDA 2A4NA 2O53A 4ZY1A 1CPXA 5EMIA 2VXKA 4BD9A 1YW6A 2IMOA 4KORA 1KUYA 3D68A 4DNCA 5IB9A 1TXRA 2Z3PA 2GIVA 5E96A 1TF8A 4NEXA 5CNPA 1R3NA 2PR1A 2V8VA 4GXHA 7CPAA 4EVYA 3HUVA 3KHXA 1M44A 1PCAA 4K30A 1IGBA 3RZAA 3PBBA 4CAVA 5F46A 1M1DA 3TOAA 2YNDA 2RFHA 2DXQA 3L2NA 4HNYB 6CPAA 4CYQA 4AXVA 5AG4A 1MJBA 5LYIA 2DPTA 3PB9X 4HNWB 5F09A 2C6GA 4R9MA 1LOKA 3ISXA 3R96A 1QSRA 4FD7A 3NE8A 2PVWA 4E8OA 3TFYA 5GCNA 2Q7BA 5D8NA 3GKRA 4P4JA 3BHXA 4EWTA 4P4IA 1DTDA 2QVPA 3S9MA 3VARA 3B3CA 3SI2A 4GM5A 1MK4A 4XPKA 2EWBA 1VIXA 2VI7A 4MCRA 4QVTA 3R9FA 3K9TA 1S7KA 4MHZA 4QC6A 3H8EA 3D7HA 2C6CA 2JEWA 4OIWA 4ZI6A 4NJQA 1NSAA 2G3AA 1YGHA 4B5PB 4FAIA 2FCKA 2PJ3A 2RB7A 4CPAA 3GY9A 2PJBA 2PCUA 4ONWA 3FVLA 1ON0A 3FIXA 1KWMA 2PDOA 4JXRA 4R8FA 3FF3A 3MGDA 3QAYA 2Q7SA 2FVGA 4JYWA 4NSQA 4FD4A 4QB9A 3V38A 4K3NA 1Z5RA 5DWMA 4B11A 2GE3A 1HDQA 3IWGA 2C27A 3PFOA 4QBJA 5DWNA 4BINA 1Z8XA 3NH4A 4PXDA 4GS4A 2XEFA 3E0KA 2WUUA 3FEDA 4PK2A 1LRZA 2IL4A 4UBRA 2QYVA 2Q43A 3EXNA 4P4DA 1SQHA 1IICA 1TKFA 2HUZA 2PIZA 4IUSA 5CBMA 3N7ZA 4OC1A 2J8RA 4YFJA 1JWQA 1IU8A 4HNXB
chains in the Genus database with same CATH topology
3DR8A 4JWPA 3R9GA 3DNSA 1XIXA 1KUXA 3KKWA 4KLWA 2VZYA 4MFKA 4C2ZA 3TCVA 2ZW6A 3I3GA 3B8GA 4KOSA 2B4BA 4XPDC 4Q38A 3PP9A 2FIWA 2QMLA 4A31A 3TO6A 5AGEA 3VWEA 2AJ6A 4R57A 2OZGA 4U9YA 1QSNA 2VQYA 2PC1A 3W91A 1P0HA 4F0XA 1YLEA 3SXNA 3JVNA 4KUAA 1B6BA 4QUSA 5F49A 1MJAA 1M4DA 2Z3MA 2FT0A 3QB8A 2Q0YA 1V0CA 1TIQA 4CYOA 4YRHA 3H4QA 4UFWA 2PR8A 2O28A 1R57A 3D2PA 2PQ8A 3R1KA 2B5GA 4OAEA 3BJ7A 3A9LA 4XNHC 4J3GA 3LD2A 4JLYA 4R3LA 4F6AA 2QECA 4CAFA 2X7BA 4JXQA 2G3TA 4R87A 4CGMA 2R7HA 4UWIA 4KUBA 3TTHA 3K9UA 1YVKA 4A33A 1PUAA 1KZFA 5G21A 2ZW5A 4H6UA 5IX3A 3D2MA 4UFXA 1NMTA 4XPLA 4CGPA 5IV0A 5EC4A 1Z4RA 5C82A 1IIDA 2OZHA 4A95A 2OZUA 1S60A 2Z0ZA 4OADA 3R95A 4IF5A 2WPXA 3TOBA 4CRZB 4A32A 3DSBA 2VBQA 5KTCA 5A28A 1Q2CA 2B58A 2HQYA 3ZJ0A 4PSXA 2VEZA 5G20A 4MY0A 4PV6A 2BUEA 2Y0MA 4KVXA 1WWZA 1Y9WA 2CXAA 2YNCC 3P2FA 1K4JA 1P4NA 4FD5A 1PU9A 2I79A 2K5TA 4CAWA 4MY3A 1IB1E 2Z11A 2B5GB 2DPSA 1BO4A 5ISVA 1QSMA 1XF8A 5KTAA 4B10A 2FSRA 2QIRA 1OZPA 1Q2DA 2ATRA 5C88A 1FY7A 5HH1A 4KOTA 4B12A 4MBUA 2R8VA 3TO7A 4RI1A 4ZGYB 1NSLA 2AE6A 3DDDA 1N71A 4M3SA 3PGPA 4A30A 3F8KA 1NE9A 4KS9A 4XPDB 2FE7A 5AG7A 5AG5A 1YX0A 1I12A 4UWJA 1ZO0A 3G3SA 3SHPA 3IU2A 4CAEA 2B3UA 2Z10A 4LX9A 4NCZA 1CM0A 4KSFA 1S7LA 4AVBA 3R9EA 4L89A 3UY5A 3FNCA 4A2ZA 3FYNA 4JJXA 4CS0B 2YNCA 1QSOA 2Z3NA 3FRMA 3JUWA 1I21A 2YGWA 3TT2A 2Q4YA 2HV2A 4XNHB 3H5ZA 3ZZIA 2CNTA 5F47A 1Y7RA 4PK3A 4UCPA 3W6SA 2J8MA 3D3SA 2ZW7A 1YK3A 3V8IA 3WR7A 1YR0A 3JTKA 3BJ8A 2R98A 3S6GA 4X5KA 5G1ZA 4ORFA 4LUAA 5J8CA 3OWCA 5J8FA 4KLVA 4KZTA 2J8NA 3BLNA 2FL4A 3PZJA 3T90A 1IYKA 5JQ4A 3TO9A 4MFPA 2B4DA 2FIAA 4CRYB 4OLLA 3C26A 1RO5A 2Z3LA 3G8WA 4U5YA 5G22A 4C2YA 3I9SA 2OU2A 4FD6A 1GHEA 2EUIA 3EO4A 2ZPAA 4Y49C 1VKCA 1WK4A 4H6ZA 4AB7A 5JPHA 4UCNA 4CAXA 3F5BA 4RS2A 5FVJA 4MFQA 3DR6A 3TE4A 5IB0A 5H86A 1UFHA 2BL1A 2JDDA 2EVNA 1IYLA 1Y9KA 2F5IA 2ZXVA 1YREA 4KVME 3FBUA 4H89A 4MJ8A 3FXTA 3S6KA 2CNSA 4CYPA 1XMTA 4JD6A 1Z4EA 4KVOE 3CXQA 4U9ZA 1S5KA 1YVOA 1J4JA 3IU1A 4M85A 4MFJA 2JEVA 3LODA 3W6XA 2P6EA 2Q04A 2Q4VA 4NF1A 2REFA 2B4DB 1Z9UA 3RYOA 2PSWA 4C7HA 2BSWA 4F0YA 4ZBGA 3P2HA 2JDCA 2WSAA 4AVAA 4ONUA 2P0WA 2Z3OA 5AG6A 4E0AA 4C2XA 2BEIA 2G0BA 1S3ZA 1S7NA 2B3VA 2Z3KA 4UA3A 5BWAB 2OB0A 4KOVA 4MFLA 2D4OA 4MFZA 4I49A 4BMHA 2P6FA 4NXYA 4CGOA 1S7FA 3GYAA 4AG9A 2CNMA 4KOYA 4UCMA 4B5OA 4CGNA 2REEA 3IGRA 2VZZA 2NMTA 4KOUA 3VWDA 3D8PA 3FB3A 2FXFA 2OH1A 1L0CA 1QSTA 4MHDA 5I0CA 2Q44A 4Q36A 5A27A 4MI4A 4UFVA 3CXPA 1MJ9A 1M4GA 5H84A 2WPWA 3EC4A 2I00A 1B87A 2YNEA 4CYNA 3SXOA 4E2AA 5KTDA 2JLMA 3EFAA 4R3KA 4C7IA 1CJWA 4AVCA 2P6GA 5F48A 2GANA 4B14A 2H5MA 3T9YA 4HKFA 4YGOA 4II9A 2KCWA 1XEBA 4Y49B 4AG7A 5AG4A 3NE7A 1XE4A 1Q2YA 4KOWA 2CY2A 1RXTA 3S6HA 3QAHA 3F0AA 4B13A 1I1DA 4BBHA 3S6FA 2ZW4A 2D4PA 2FS5A 1U6MA 2RC4A 4KOXA 4C68A 3IWEA 1M4IA 3EY5A 4B5PA 1BOBA 4KSAA 1VHSA 4CGLA 2ARHA 5EBVA 4PSWA 2PRBA 2R1IA 5HMNA 3CXSA 1KUVA 4L8AA 2A4NA 2VXKA 4KORA 1KUYA 4DNCA 2Z3PA 2GIVA 5E96A 4NEXA 5CNPA 2PR1A 4EVYA 1M44A 4K30A 4CAVA 5F46A 1M1DA 3TOAA 2YNDA 2DXQA 4HNYB 4CYQA 1MJBA 2DPTA 4HNWB 4R9MA 3R96A 1QSRA 4FD7A 4E8OA 3TFYA 5GCNA 2Q7BA 3GKRA 1MK4A 4XPKA 2VI7A 4QVTA 3R9FA 4QC6A 1S7KA 2G3AA 4B5PB 1YGHA 2FCKA 3GY9A 1ON0A 3FIXA 2PDOA 4JXRA 3MGDA 4NSQA 4FD4A 4QB9A 5DWMA 4B11A 2GE3A 3IWGA 2C27A 4QBJA 5DWNA 4GS4A 3E0KA 2WUUA 4PK2A 1LRZA 2IL4A 4UBRA 3EXNA 1SQHA 1IICA 4IUSA 2HUZA 3N7ZA 4YFJA 2J8RA 4HNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DR8 A;  4JWP A;  3R9G A;  3DNS A;  1XIX A;  1KUX A;  3KKW A;  4KLW A;  2VZY A;  3TCV A;  2ZW6 A;  3I3G A;  3B8G A;  4KOS A;  2B4B A;  4XPD C;  3PP9 A;  2FIW A;  2QML A;  3TO6 A;  3VWE A;  2AJ6 A;  4R57 A;  2OZG A;  4U9Y A;  1QSN A;  2VQY A;  2PC1 A;  3W91 A;  1P0H A;  1YLE A;  3SXN A;  3JVN A;  4KUA A;  1B6B A;  4QUS A;  5F49 A;  1MJA A;  1M4D A;  2FT0 A;  3QB8 A;  2Q0Y A;  1V0C A;  1TIQ A;  4YRH A;  3H4Q A;  2PR8 A;  2O28 A;  1R57 A;  3D2P A;  2PQ8 A;  3R1K A;  2B5G A;  4OAE A;  3BJ7 A;  4XNH C;  4J3G A;  3LD2 A;  4JLY A;  4R3L A;  4F6A A;  2QEC A;  2X7B A;  4JXQ A;  2G3T A;  4R87 A;  2R7H A;  4UWI A;  4KUB A;  3TTH A;  3K9U A;  1YVK A;  1PUA A;  1KZF A;  2ZW5 A;  4H6U A;  5IX3 A;  3D2M A;  1NMT A;  4XPL A;  5IV0 A;  5EC4 A;  1Z4R A;  5C82 A;  1IID A;  2OZH A;  2OZU A;  1S60 A;  2Z0Z A;  4OAD A;  3R95 A;  4IF5 A;  2WPX A;  3TOB A;  4CRZ B;  3DSB A;  2VBQ A;  5KTC A;  1Q2C A;  2B58 A;  2HQY A;  3ZJ0 A;  4PSX A;  2VEZ A;  4MY0 A;  4PV6 A;  2BUE A;  2Y0M A;  4KVX A;  1WWZ A;  1Y9W A;  3P2F A;  1K4J A;  1P4N A;  4FD5 A;  1PU9 A;  2I79 A;  2K5T A;  4CAW A;  4MY3 A;  1IB1 E;  2Z11 A;  2B5G B;  1BO4 A;  5ISV A;  1QSM A;  1XF8 A;  5KTA A;  2FSR A;  2QIR A;  1OZP A;  1Q2D A;  2ATR A;  5C88 A;  1FY7 A;  5HH1 A;  4KOT A;  4MBU A;  2R8V A;  3TO7 A;  4RI1 A;  1NSL A;  2AE6 A;  3DDD A;  1N71 A;  4M3S A;  3PGP A;  3F8K A;  1NE9 A;  4XPD B;  2FE7 A;  1YX0 A;  1I12 A;  4UWJ A;  3G3S A;  3SHP A;  2B3U A;  2Z10 A;  4LX9 A;  4NCZ A;  1CM0 A;  1S7L A;  4AVB A;  3R9E A;  4L89 A;  3UY5 A;  3FNC A;  3FYN A;  4JJX A;  4CS0 B;  1QSO A;  3FRM A;  3JUW A;  1I21 A;  3TT2 A;  2Q4Y A;  2HV2 A;  4XNH B;  3ZZI A;  2CNT A;  5F47 A;  1Y7R A;  4PK3 A;  3W6S A;  2J8M A;  3D3S A;  2ZW7 A;  1YK3 A;  3V8I A;  3WR7 A;  1YR0 A;  3BJ8 A;  2R98 A;  3S6G A;  4X5K A;  4ORF A;  4LUA A;  5J8C A;  3OWC A;  5J8F A;  4KLV A;  4KZT A;  2J8N A;  3BLN A;  2FL4 A;  3PZJ A;  3T90 A;  1IYK A;  5JQ4 A;  3TO9 A;  2B4D A;  2FIA A;  4CRY B;  4OLL A;  3C26 A;  1RO5 A;  3G8W A;  4U5Y A;  3I9S A;  2OU2 A;  4FD6 A;  1GHE A;  2EUI A;  3EO4 A;  2ZPA A;  4Y49 C;  1VKC A;  1WK4 A;  4H6Z A;  4AB7 A;  5JPH A;  4CAX A;  3F5B A;  4RS2 A;  5FVJ A;  3DR6 A;  3TE4 A;  5IB0 A;  5H86 A;  1UFH A;  2BL1 A;  2JDD A;  2EVN A;  1IYL A;  1Y9K A;  2F5I A;  2ZXV A;  1YRE A;  4KVM E;  3FBU A;  4H89 A;  4MJ8 A;  3FXT A;  3S6K A;  2CNS A;  1XMT A;  4JD6 A;  1Z4E A;  4KVO E;  3CXQ A;  4U9Z A;  1S5K A;  1YVO A;  1J4J A;  4M85 A;  2JEV A;  3LOD A;  3W6X A;  2P6E A;  2Q04 A;  2Q4V A;  4NF1 A;  2REF A;  2B4D B;  1Z9U A;  3RYO A;  2PSW A;  2BSW A;  4F0Y A;  4ZBG A;  3P2H A;  2JDC A;  4AVA A;  4ONU A;  2P0W A;  4E0A A;  2BEI A;  2G0B A;  1S3Z A;  1S7N A;  2B3V A;  4UA3 A;  2OB0 A;  4KOV A;  2D4O A;  4I49 A;  4BMH A;  2P6F A;  4NXY A;  1S7F A;  3GYA A;  4AG9 A;  2CNM A;  4KOY A;  4B5O A;  2REE A;  3IGR A;  2VZZ A;  2NMT A;  4KOU A;  3VWD A;  3D8P A;  3FB3 A;  2FXF A;  2OH1 A;  1L0C A;  1QST A;  4MHD A;  5I0C A;  2Q44 A;  4MI4 A;  3CXP A;  1MJ9 A;  1M4G A;  5H84 A;  2WPW A;  3EC4 A;  2I00 A;  1B87 A;  5KTD A;  4E2A A;  3SXO A;  2JLM A;  3EFA A;  4R3K A;  1CJW A;  4AVC A;  2P6G A;  5F48 A;  2GAN A;  2H5M A;  3T9Y A;  4HKF A;  4YGO A;  4II9 A;  2KCW A;  1XEB A;  4Y49 B;  4AG7 A;  3NE7 A;  1XE4 A;  1Q2Y A;  4KOW A;  2CY2 A;  1RXT A;  3S6H A;  3QAH A;  3F0A A;  1I1D A;  3S6F A;  2ZW4 A;  2D4P A;  2FS5 A;  1U6M A;  2RC4 A;  4KOX A;  1M4I A;  3EY5 A;  4B5P A;  1BOB A;  1VHS A;  2ARH A;  5EBV A;  4PSW A;  2PRB A;  2R1I A;  5HMN A;  3CXS A;  1KUV A;  4L8A A;  2A4N A;  2VXK A;  4KOR A;  1KUY A;  4DNC A;  2GIV A;  5E96 A;  4NEX A;  5CNP A;  2PR1 A;  4EVY A;  1M44 A;  4K30 A;  4CAV A;  5F46 A;  1M1D A;  3TOA A;  2DXQ A;  4HNY B;  1MJB A;  4HNW B;  4R9M A;  3R96 A;  1QSR A;  4FD7 A;  4E8O A;  3TFY A;  5GCN A;  2Q7B A;  3GKR A;  1MK4 A;  4XPK A;  2VI7 A;  4QVT A;  3R9F A;  4QC6 A;  1S7K A;  2G3A A;  4B5P B;  1YGH A;  2FCK A;  3GY9 A;  1ON0 A;  3FIX A;  2PDO A;  4JXR A;  3MGD A;  4NSQ A;  4FD4 A;  4QB9 A;  5DWM A;  2GE3 A;  3IWG A;  2C27 A;  4QBJ A;  5DWN A;  4GS4 A;  3E0K A;  4PK2 A;  1LRZ A;  2IL4 A;  4UBR A;  3EXN A;  1SQH A;  1IIC A;  4IUS A;  2HUZ A;  3N7Z A;  4YFJ A;  2J8R A;  4HNX B; 
#chains in the Genus database with same CATH topology
 2F7V A;  3DR8 A;  4JWP A;  3R9G A;  3DNS A;  1XIX A;  1KUX A;  2NYQ A;  3KKW A;  4KLW A;  4F8Z A;  2VZY A;  4MFK A;  4C2Z A;  3PRT A;  3TCV A;  1Z8W A;  2ZW6 A;  3I3G A;  3B8G A;  3D67 A;  4LQ6 A;  4KOS A;  4RN7 A;  4B6Z A;  2B4B A;  3PBE A;  4Q38 A;  3PP9 A;  4OID A;  4XPD C;  2FIW A;  2ZED A;  2PJC A;  2QML A;  3MRU A;  5AGE A;  3TO6 A;  4A31 A;  3VWE A;  4DYO A;  4ZY0 A;  1A2Z A;  2AJ6 A;  5THW A;  4OC5 A;  1FNO A;  4R57 A;  2OZG A;  4U9Y A;  1QSN A;  2V8H A;  2PRQ A;  4P4B A;  2VQY A;  2PC1 A;  3FMC A;  3W91 A;  3SJG A;  1P0H A;  2ZOF A;  4F0X A;  1YLE A;  3SXN A;  2G9D A;  3JVN A;  4KUA A;  1B6B A;  4QUS A;  2ZEG A;  5HVH A;  2ANP A;  1BAV A;  3B3W A;  4M6I A;  5F49 A;  3H8F A;  1MJA A;  1M4D A;  2Z3M A;  2FT0 A;  2PIY A;  3QB8 A;  1CP6 A;  3PB4 X;  2Q0Y A;  3GLJ A;  3WT4 A;  1V0C A;  1TIQ A;  1ELM P;  2EK8 A;  3CPX A;  4CYO A;  4EFD A;  3IO1 A;  3H4Q A;  4UFW A;  4YRH A;  1XJO A;  4JZ0 A;  2PR8 A;  2O28 A;  1R57 A;  2V8D A;  3LAC A;  4OKO A;  3D2P A;  4NGM A;  1X10 A;  2AFX A;  1Q7L A;  5K8P A;  2PQ8 A;  3NFZ A;  5HVF A;  3R1K A;  2B5G A;  4PXC A;  4OAE A;  3BJ7 A;  3BI0 A;  3A9L A;  4XNH C;  4J3G A;  2V8G A;  3LD2 A;  2XEG A;  3CT9 A;  4JLY A;  4R3L A;  2QEC A;  3LWU A;  4F6A A;  4CAF A;  5JH9 A;  2X7B A;  4JXQ A;  2G3T A;  3DGV A;  4R87 A;  4CGM A;  2R7H A;  4NGN A;  4P10 A;  3WC7 A;  1CG2 A;  4X8I A;  2PJ5 A;  2CTC A;  4KUB A;  2ZEH A;  2C1C A;  4UWI A;  3TTH A;  1VHO A;  3K9U A;  3PFE A;  1YVK A;  4A33 A;  1PUA A;  1KZF A;  2CF4 A;  4FUU A;  4G1P A;  5G21 A;  2ZEL A;  2ZW5 A;  4H6U A;  5IX3 A;  3D2M A;  1YQE A;  4DUK A;  4UFX A;  4A94 A;  1NMT A;  5K8O A;  4XPL A;  3KAS A;  1Z8T A;  4CGP A;  5EC4 A;  1Z4R A;  5C82 A;  5IV0 A;  1IID A;  2OZH A;  4A95 A;  2AFM A;  4R76 A;  2OZU A;  1S60 A;  2Z0Z A;  4OAD A;  3S9L A;  1RTQ A;  2GLF A;  2GRE A;  3R95 A;  3H8G A;  4IF5 A;  4OME A;  2WPX A;  3TOB A;  4A37 A;  4CRZ B;  4A32 A;  3DSB A;  2VBQ A;  5KTC A;  4NGP A;  2JBK A;  5A28 A;  1Q2C A;  2B58 A;  4MRI A;  1QQ9 A;  3KR4 A;  5LRG A;  2PJ4 A;  2HQY A;  1Z2L A;  4MHN A;  3ZJ0 A;  1X12 A;  3FH4 A;  4PSX A;  1H8L A;  2VEZ A;  4MY0 A;  4PV6 A;  5G20 A;  1QMU A;  1ZLI A;  2BUE A;  2Y0M A;  4KVX A;  3WAB A;  1WWZ A;  3KGQ A;  1Y9W A;  2CXA A;  2YNC C;  4ZY2 A;  2F8H A;  3P2F A;  1ARM A;  1K4J A;  1P4N A;  1GYT A;  4FD5 A;  4A39 A;  1PU9 A;  2I79 A;  2K5T A;  4CAW A;  4MY3 A;  4P44 A;  1IB1 E;  2V77 A;  2ZEP A;  2Z11 A;  2PJ2 A;  2B5G B;  1CP7 A;  3D4U A;  3CZX A;  2DPS A;  1BO4 A;  5ISV A;  3CPA A;  4X3R A;  5K8N A;  1QSM A;  2AFZ A;  1PYT B;  1XF8 A;  5KTA A;  4B10 A;  3VH9 A;  2DEA A;  3ISZ A;  4HPS A;  1ZLH A;  2FSR A;  2QIR A;  1OZP A;  1Q2D A;  1UWY A;  1Y7E A;  1YSJ A;  2ATR A;  5C88 A;  1FY7 A;  5HH1 A;  4KOT A;  4B12 A;  4MBU A;  2R8V A;  3TO7 A;  4RUH A;  4RI1 A;  5D29 A;  4ZGY B;  4FWU A;  1NSL A;  2PJ1 A;  2AE6 A;  3DDD A;  1N71 A;  3BXM A;  4M3S A;  3SJF A;  3PGP A;  4WJB A;  3F8K A;  4A30 A;  5K8M A;  1NE9 A;  5LYL A;  4KS9 A;  4XPD B;  2FE7 A;  2EO8 A;  3PB8 X;  2PJ9 A;  5AG7 A;  5AG5 A;  4F9V A;  4H2K A;  1YX0 A;  1I12 A;  1BPM A;  4UWJ A;  1ZO0 A;  3G3S A;  3SHP A;  2IQ6 A;  3IU2 A;  2JBJ A;  2PE3 A;  3N5F A;  2B3U A;  4CAE A;  1Y0Y A;  2Z10 A;  4LX9 A;  4NCZ A;  1Z8L A;  1CM0 A;  1Y0R A;  1YW4 A;  4KSF A;  1S7L A;  4AVB A;  2BO9 A;  4FBE A;  3R9E A;  3DLJ A;  1R43 A;  4P6Y A;  4L89 A;  3UY5 A;  2DF5 A;  3FNC A;  4A2Z A;  3IJ3 A;  3FYN A;  4MMO A;  1YLO A;  1XMB A;  4JJX A;  4MCQ A;  4CS0 B;  1TKH A;  1QSO A;  2POK A;  2YNC A;  5HVG A;  4NFR A;  3V7Z A;  2Z3N A;  1ZG8 A;  2ZEO A;  3S9N A;  3FRM A;  3JUW A;  2ZEE A;  1I21 A;  1FT7 A;  2YGW A;  3TT2 A;  3QNV A;  4M6G A;  3IC1 A;  4A38 A;  2Q4Y A;  2HV2 A;  1TKJ A;  4XNH B;  3H5Z A;  3ZZI A;  2CNT A;  4UIB A;  1HEE A;  5F47 A;  1Y7R A;  4PK3 A;  4UCP A;  3W6S A;  2AFO A;  2J8M A;  2QJ8 A;  3D3S A;  5I4M A;  2ZW7 A;  4O23 A;  1YK3 A;  3V8I A;  3WR7 A;  1YR0 A;  3B7I A;  4MHY A;  3JTK A;  4NJR A;  3BJ8 A;  3IWW A;  2R98 A;  4IHM A;  3S6G A;  4X5K A;  5G1Z A;  1ARL A;  4ORF A;  4OC3 A;  4LUA A;  4IK2 A;  5J8C A;  3OWC A;  5J8F A;  3SJX A;  4KLV A;  4KZT A;  2J8N A;  3BLN A;  4F9U A;  2FL4 A;  3PZJ A;  3T90 A;  1IYK A;  5JQ4 A;  3JRU A;  3TO9 A;  4MFP A;  4Q7A A;  2B4D A;  4OC0 A;  2FIA A;  4TWE A;  4CRY B;  4YU9 A;  2VL1 A;  3D7F A;  4OLL A;  1XRY A;  4NGR A;  1BPN A;  2GFQ A;  2PJ7 A;  2ZOG A;  3B3V A;  3C26 A;  1RO5 A;  2Z3L A;  4DJL A;  1CX8 A;  3G8W A;  4U5Y A;  4UF4 A;  4P4F A;  5G22 A;  2I3C A;  4C2Y A;  2J9A A;  3I9S A;  2OU2 A;  4FD6 A;  1GHE A;  2EUI A;  3EO4 A;  2ZPA A;  4Y49 C;  1VKC A;  1WK4 A;  4H6Z A;  3KHZ A;  4AB7 A;  5JPH A;  3NH5 A;  4UCN A;  5ELY A;  4CAX A;  4NGQ A;  3F5B A;  4RS2 A;  3IIB A;  5FVJ A;  4MFQ A;  1ZG7 A;  3NA6 A;  1M4L A;  3FJU A;  3DR6 A;  3TE4 A;  4UEE A;  2BOA A;  3GIU A;  5H86 A;  1UFH A;  5IB0 A;  2BL1 A;  2JDD A;  2EVN A;  2PJ6 A;  1TF9 A;  1AUG A;  1IYL A;  1Y9K A;  2F5I A;  3RAM A;  3PB7 X;  2ZXV A;  4ZX8 A;  1YRE A;  2AFS A;  1VHE A;  2C6P A;  4KVM E;  3FBU A;  4H89 A;  4MJ8 A;  3FXT A;  1EE3 P;  5LYF A;  3S6K A;  3HLP A;  5JGF A;  2CNS A;  4CYP A;  4ZX9 A;  1XMT A;  4UIA A;  1IY7 A;  4JD6 A;  1LFW A;  3B2Y A;  3D66 A;  1IOI A;  1Z4E A;  4P4E A;  3RO0 A;  4EME A;  4KVO E;  2HC9 A;  3CXQ A;  3KL9 A;  1OBR A;  3KZW A;  4U9Z A;  1S5K A;  1YVO A;  4PPZ A;  3D7D A;  1J4J A;  1ELL P;  3D7G A;  3IU1 A;  4IAV A;  4PQA A;  2AFW A;  4M85 A;  4MFJ A;  4NGT A;  4MCS A;  2JEV A;  2GLJ A;  5DS0 A;  4X2T A;  3LOD A;  3W6X A;  4PXE A;  2P6E A;  2Q04 A;  2Q4V A;  4NF1 A;  2REF A;  3KI9 A;  3GB0 A;  2B4D B;  4ZYQ A;  1Z9U A;  3RYO A;  2PSW A;  5LRJ A;  3RNZ A;  1HDU A;  4C7H A;  2BSW A;  4F0Y A;  4ZBG A;  3P2H A;  2JDC A;  3TX8 A;  2WSA A;  4AVA A;  4ONU A;  2P0W A;  1F2O A;  2Z3O A;  2PJ0 A;  2BCO A;  5AG6 A;  3T8W A;  1XBU A;  2Q4Z A;  4E0A A;  3SI0 A;  4C2X A;  3FEC A;  2BEI A;  2G0B A;  1XOV A;  1S3Z A;  3B35 A;  4OC2 A;  1S7N A;  2B3V A;  2Z3K A;  5LRK A;  1LCP A;  4UA3 A;  4UEF A;  4Z65 A;  2OR4 A;  3CDX A;  4W9Y A;  2OOT A;  2AFU A;  2OB0 A;  3FEE A;  5BWA B;  8CPA A;  3TC8 A;  1LAM A;  4KOV A;  4M6H A;  2D4O A;  4MFL A;  4MFZ A;  4I49 A;  4BMH A;  2P6F A;  4MXU A;  4NXY A;  4CGO A;  1S7F A;  1IOF A;  1LAN A;  4OC4 A;  5CPA A;  3GYA A;  4AG9 A;  2CNM A;  2WYR A;  4KOY A;  4UCM A;  4B5O A;  4CGN A;  2REE A;  3VAT A;  3IGR A;  2VZZ A;  2NMT A;  2WZN A;  4KOU A;  3VWD A;  2CIJ A;  3D8P A;  4P45 A;  2NSM A;  1LAP A;  2CTB A;  3B3T A;  3FB3 A;  1DE4 C;  5JM6 A;  2HB6 A;  4TNU A;  2FXF A;  1F2P A;  3NH8 A;  4MHP A;  2OH1 A;  3MN8 A;  4WWV A;  1L0C A;  1QST A;  2O4H A;  2ABZ A;  3SJE A;  4MHD A;  5I0C A;  4R7M A;  2Q44 A;  4Q36 A;  5A27 A;  4MI4 A;  1BLL E;  2Q51 A;  3IFE A;  4UFV A;  3CXP A;  5LYD A;  1MJ9 A;  1M4G A;  3RBU A;  1YME A;  5H84 A;  2WPW A;  3EC4 A;  4AG7 A;  1CBX A;  2I00 A;  1B87 A;  2YNE A;  4CYN A;  3SXO A;  4E2A A;  5KTD A;  2JLM A;  3EFA A;  4R3K A;  3SI1 A;  4C7I A;  2EBJ A;  1CJW A;  4AVC A;  2PJA A;  2P6G A;  5F48 A;  2GAN A;  2ODF A;  3FX6 A;  1AMP A;  3LMS A;  4B14 A;  1JQG A;  4R6T A;  2H5M A;  3I1U A;  4HKF A;  4YGO A;  1AYE A;  3T9Y A;  2KCW A;  1XEB A;  4II9 A;  3KQZ A;  3GUX A;  4Y49 B;  3KQX A;  1ZG9 A;  1XE4 A;  1Q2Y A;  1VGY A;  2CY2 A;  1XFO A;  3NE7 A;  4KOW A;  4LQG A;  2PVV A;  3WC5 A;  1RXT A;  3S6H A;  3K2K A;  3QAH A;  1CPS A;  3F0A A;  1F57 A;  2GU2 A;  2XEJ A;  2EK9 A;  4KSI A;  3WC6 A;  4PXB A;  4B13 A;  1I1D A;  3B3S A;  3S6F A;  4BBH A;  2ZW4 A;  2D4P A;  3KR5 A;  4YWY A;  2FS5 A;  1U6M A;  2RC4 A;  4KOX A;  4C68 A;  3IWE A;  1M4I A;  2XEI A;  3EY5 A;  2IJZ A;  3IEH A;  3PEI A;  4MCP A;  4B5P A;  1BOB A;  4KSA A;  1VHS A;  4OP4 A;  4CGL A;  2ARH A;  3BI1 A;  4PSW A;  5EBV A;  2PRB A;  2R1I A;  5J1Q A;  4UEZ A;  5HMN A;  2ZEN A;  2ZEF A;  2ZEM A;  1KUV A;  3CXS A;  3PB6 X;  4L8A A;  2PJ8 A;  4NGS A;  5HXD A;  2A4N A;  2O53 A;  4ZY1 A;  1CPX A;  5EMI A;  2VXK A;  4BD9 A;  1YW6 A;  2IMO A;  4KOR A;  1KUY A;  3D68 A;  4DNC A;  5IB9 A;  1TXR A;  2Z3P A;  2GIV A;  5E96 A;  1TF8 A;  4NEX A;  5CNP A;  1R3N A;  2PR1 A;  2V8V A;  4GXH A;  7CPA A;  4EVY A;  3HUV A;  3KHX A;  1M44 A;  1PCA A;  4K30 A;  1IGB A;  3RZA A;  3PBB A;  4CAV A;  5F46 A;  1M1D A;  3TOA A;  2YND A;  2RFH A;  2DXQ A;  3L2N A;  4HNY B;  6CPA A;  4CYQ A;  4AXV A;  5AG4 A;  1MJB A;  5LYI A;  2DPT A;  3PB9 X;  4HNW B;  5F09 A;  2C6G A;  4R9M A;  1LOK A;  3ISX A;  3R96 A;  1QSR A;  4FD7 A;  3NE8 A;  2PVW A;  4E8O A;  3TFY A;  5GCN A;  2Q7B A;  5D8N A;  3GKR A;  4P4J A;  3BHX A;  4EWT A;  4P4I A;  1DTD A;  2QVP A;  3S9M A;  3VAR A;  3B3C A;  3SI2 A;  4GM5 A;  1MK4 A;  4XPK A;  2EWB A;  1VIX A;  2VI7 A;  4MCR A;  4QVT A;  3R9F A;  3K9T A;  1S7K A;  4MHZ A;  4QC6 A;  3H8E A;  3D7H A;  2C6C A;  2JEW A;  4OIW A;  4ZI6 A;  4NJQ A;  1NSA A;  2G3A A;  1YGH A;  4B5P B;  4FAI A;  2FCK A;  2PJ3 A;  2RB7 A;  4CPA A;  3GY9 A;  2PJB A;  2PCU A;  4ONW A;  3FVL A;  1ON0 A;  3FIX A;  1KWM A;  2PDO A;  4JXR A;  4R8F A;  3FF3 A;  3MGD A;  3QAY A;  2Q7S A;  2FVG A;  4JYW A;  4NSQ A;  4FD4 A;  4QB9 A;  3V38 A;  4K3N A;  1Z5R A;  5DWM A;  4B11 A;  2GE3 A;  1HDQ A;  3IWG A;  2C27 A;  3PFO A;  4QBJ A;  5DWN A;  4BIN A;  1Z8X A;  3NH4 A;  4PXD A;  4GS4 A;  2XEF A;  3E0K A;  2WUU A;  3FED A;  4PK2 A;  1LRZ A;  2IL4 A;  4UBR A;  2QYV A;  2Q43 A;  3EXN A;  4P4D A;  1SQH A;  1IIC A;  1TKF A;  2HUZ A;  2PIZ A;  4IUS A;  5CBM A;  3N7Z A;  4OC1 A;  2J8R A;  4YFJ A;  1JWQ A;  1IU8 A;  4HNX B; 
#chains in the Genus database with same CATH homology
 3DR8 A;  4JWP A;  3R9G A;  3DNS A;  1XIX A;  1KUX A;  3KKW A;  4KLW A;  2VZY A;  4MFK A;  4C2Z A;  3TCV A;  2ZW6 A;  3I3G A;  3B8G A;  4KOS A;  2B4B A;  4XPD C;  4Q38 A;  3PP9 A;  2FIW A;  2QML A;  4A31 A;  3TO6 A;  5AGE A;  3VWE A;  2AJ6 A;  4R57 A;  2OZG A;  4U9Y A;  1QSN A;  2VQY A;  2PC1 A;  3W91 A;  1P0H A;  4F0X A;  1YLE A;  3SXN A;  3JVN A;  4KUA A;  1B6B A;  4QUS A;  5F49 A;  1MJA A;  1M4D A;  2Z3M A;  2FT0 A;  3QB8 A;  2Q0Y A;  1V0C A;  1TIQ A;  4CYO A;  4YRH A;  3H4Q A;  4UFW A;  2PR8 A;  2O28 A;  1R57 A;  3D2P A;  2PQ8 A;  3R1K A;  2B5G A;  4OAE A;  3BJ7 A;  3A9L A;  4XNH C;  4J3G A;  3LD2 A;  4JLY A;  4R3L A;  4F6A A;  2QEC A;  4CAF A;  2X7B A;  4JXQ A;  2G3T A;  4R87 A;  4CGM A;  2R7H A;  4UWI A;  4KUB A;  3TTH A;  3K9U A;  1YVK A;  4A33 A;  1PUA A;  1KZF A;  5G21 A;  2ZW5 A;  4H6U A;  5IX3 A;  3D2M A;  4UFX A;  1NMT A;  4XPL A;  4CGP A;  5IV0 A;  5EC4 A;  1Z4R A;  5C82 A;  1IID A;  2OZH A;  4A95 A;  2OZU A;  1S60 A;  2Z0Z A;  4OAD A;  3R95 A;  4IF5 A;  2WPX A;  3TOB A;  4CRZ B;  4A32 A;  3DSB A;  2VBQ A;  5KTC A;  5A28 A;  1Q2C A;  2B58 A;  2HQY A;  3ZJ0 A;  4PSX A;  2VEZ A;  5G20 A;  4MY0 A;  4PV6 A;  2BUE A;  2Y0M A;  4KVX A;  1WWZ A;  1Y9W A;  2CXA A;  2YNC C;  3P2F A;  1K4J A;  1P4N A;  4FD5 A;  1PU9 A;  2I79 A;  2K5T A;  4CAW A;  4MY3 A;  1IB1 E;  2Z11 A;  2B5G B;  2DPS A;  1BO4 A;  5ISV A;  1QSM A;  1XF8 A;  5KTA A;  4B10 A;  2FSR A;  2QIR A;  1OZP A;  1Q2D A;  2ATR A;  5C88 A;  1FY7 A;  5HH1 A;  4KOT A;  4B12 A;  4MBU A;  2R8V A;  3TO7 A;  4RI1 A;  4ZGY B;  1NSL A;  2AE6 A;  3DDD A;  1N71 A;  4M3S A;  3PGP A;  4A30 A;  3F8K A;  1NE9 A;  4KS9 A;  4XPD B;  2FE7 A;  5AG7 A;  5AG5 A;  1YX0 A;  1I12 A;  4UWJ A;  1ZO0 A;  3G3S A;  3SHP A;  3IU2 A;  4CAE A;  2B3U A;  2Z10 A;  4LX9 A;  4NCZ A;  1CM0 A;  4KSF A;  1S7L A;  4AVB A;  3R9E A;  4L89 A;  3UY5 A;  3FNC A;  4A2Z A;  3FYN A;  4JJX A;  4CS0 B;  2YNC A;  1QSO A;  2Z3N A;  3FRM A;  3JUW A;  1I21 A;  2YGW A;  3TT2 A;  2Q4Y A;  2HV2 A;  4XNH B;  3H5Z A;  3ZZI A;  2CNT A;  5F47 A;  1Y7R A;  4PK3 A;  4UCP A;  3W6S A;  2J8M A;  3D3S A;  2ZW7 A;  1YK3 A;  3V8I A;  3WR7 A;  1YR0 A;  3JTK A;  3BJ8 A;  2R98 A;  3S6G A;  4X5K A;  5G1Z A;  4ORF A;  4LUA A;  5J8C A;  3OWC A;  5J8F A;  4KLV A;  4KZT A;  2J8N A;  3BLN A;  2FL4 A;  3PZJ A;  3T90 A;  1IYK A;  5JQ4 A;  3TO9 A;  4MFP A;  2B4D A;  2FIA A;  4CRY B;  4OLL A;  3C26 A;  1RO5 A;  2Z3L A;  3G8W A;  4U5Y A;  5G22 A;  4C2Y A;  3I9S A;  2OU2 A;  4FD6 A;  1GHE A;  2EUI A;  3EO4 A;  2ZPA A;  4Y49 C;  1VKC A;  1WK4 A;  4H6Z A;  4AB7 A;  5JPH A;  4UCN A;  4CAX A;  3F5B A;  4RS2 A;  5FVJ A;  4MFQ A;  3DR6 A;  3TE4 A;  5IB0 A;  5H86 A;  1UFH A;  2BL1 A;  2JDD A;  2EVN A;  1IYL A;  1Y9K A;  2F5I A;  2ZXV A;  1YRE A;  4KVM E;  3FBU A;  4H89 A;  4MJ8 A;  3FXT A;  3S6K A;  2CNS A;  4CYP A;  1XMT A;  4JD6 A;  1Z4E A;  4KVO E;  3CXQ A;  4U9Z A;  1S5K A;  1YVO A;  1J4J A;  3IU1 A;  4M85 A;  4MFJ A;  2JEV A;  3LOD A;  3W6X A;  2P6E A;  2Q04 A;  2Q4V A;  4NF1 A;  2REF A;  2B4D B;  1Z9U A;  3RYO A;  2PSW A;  4C7H A;  2BSW A;  4F0Y A;  4ZBG A;  3P2H A;  2JDC A;  2WSA A;  4AVA A;  4ONU A;  2P0W A;  2Z3O A;  5AG6 A;  4E0A A;  4C2X A;  2BEI A;  2G0B A;  1S3Z A;  1S7N A;  2B3V A;  2Z3K A;  4UA3 A;  5BWA B;  2OB0 A;  4KOV A;  4MFL A;  2D4O A;  4MFZ A;  4I49 A;  4BMH A;  2P6F A;  4NXY A;  4CGO A;  1S7F A;  3GYA A;  4AG9 A;  2CNM A;  4KOY A;  4UCM A;  4B5O A;  4CGN A;  2REE A;  3IGR A;  2VZZ A;  2NMT A;  4KOU A;  3VWD A;  3D8P A;  3FB3 A;  2FXF A;  2OH1 A;  1L0C A;  1QST A;  4MHD A;  5I0C A;  2Q44 A;  4Q36 A;  5A27 A;  4MI4 A;  4UFV A;  3CXP A;  1MJ9 A;  1M4G A;  5H84 A;  2WPW A;  3EC4 A;  2I00 A;  1B87 A;  2YNE A;  4CYN A;  3SXO A;  4E2A A;  5KTD A;  2JLM A;  3EFA A;  4R3K A;  4C7I A;  1CJW A;  4AVC A;  2P6G A;  5F48 A;  2GAN A;  4B14 A;  2H5M A;  3T9Y A;  4HKF A;  4YGO A;  4II9 A;  2KCW A;  1XEB A;  4Y49 B;  4AG7 A;  5AG4 A;  3NE7 A;  1XE4 A;  1Q2Y A;  4KOW A;  2CY2 A;  1RXT A;  3S6H A;  3QAH A;  3F0A A;  4B13 A;  1I1D A;  4BBH A;  3S6F A;  2ZW4 A;  2D4P A;  2FS5 A;  1U6M A;  2RC4 A;  4KOX A;  4C68 A;  3IWE A;  1M4I A;  3EY5 A;  4B5P A;  1BOB A;  4KSA A;  1VHS A;  4CGL A;  2ARH A;  5EBV A;  4PSW A;  2PRB A;  2R1I A;  5HMN A;  3CXS A;  1KUV A;  4L8A A;  2A4N A;  2VXK A;  4KOR A;  1KUY A;  4DNC A;  2Z3P A;  2GIV A;  5E96 A;  4NEX A;  5CNP A;  2PR1 A;  4EVY A;  1M44 A;  4K30 A;  4CAV A;  5F46 A;  1M1D A;  3TOA A;  2YND A;  2DXQ A;  4HNY B;  4CYQ A;  1MJB A;  2DPT A;  4HNW B;  4R9M A;  3R96 A;  1QSR A;  4FD7 A;  4E8O A;  3TFY A;  5GCN A;  2Q7B A;  3GKR A;  1MK4 A;  4XPK A;  2VI7 A;  4QVT A;  3R9F A;  4QC6 A;  1S7K A;  2G3A A;  4B5P B;  1YGH A;  2FCK A;  3GY9 A;  1ON0 A;  3FIX A;  2PDO A;  4JXR A;  3MGD A;  4NSQ A;  4FD4 A;  4QB9 A;  5DWM A;  4B11 A;  2GE3 A;  3IWG A;  2C27 A;  4QBJ A;  5DWN A;  4GS4 A;  3E0K A;  2WUU A;  4PK2 A;  1LRZ A;  2IL4 A;  4UBR A;  3EXN A;  1SQH A;  1IIC A;  4IUS A;  2HUZ A;  3N7Z A;  4YFJ A;  2J8R A;  4HNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...