1YVKA

Crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
152
structure length
152
Chain Sequence
KLRIELGEETNDELYDLLLLADPSKDIVDEYLERGECYTAWAGDELAGVYVLLKTRPQTVEIVNIAVKESLQKKGFGKQLVLDAIEKAKKLGADTIEIGTGNSSIHQLSLYQKCGFRIQAIDHDFFLRHYDEDIFENGIQCRDMVRLYLDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypothetical protein BSU33890
publication title Crystal Structure of the Bacillis subtilis Acetyltransferase in complex with CoA, Northeast Structural Genomics Target SR237.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 39
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yvkA00
2Z10A 3R96A 3EC4A 2FE7A 4YGOA 1IIDA 4KVXA 2OZHA 3D2PA 3PGPA 3TFYA 4IUSA 1S7KA 2C27A 3GYAA 4KOYA 3TT2A 1V0CA 3PZJA 5HMNA 4OAEA 4PSXA 2ZW7A 4I49A 3EXNA 1YR0A 4KOTA 1RO5A 5JQ4A 5DWNA 1M1DA 3SHPA 3R9GA 1RXTA 1J4JA 2PSWA 1KZFA 4RS2A 3C26A 1KUYA 4F6AA 2R7HA 4QB9A 2QECA 1PU9A 1S60A 1Z4RA 3W6SA 2FIAA 2P0WA 2GANA 3FBUA 3T9YA 4CRZB 1NSLA 4B5OA 4CRYB 1I1DA 1Y9WA 5J8FA 4L89A 1S7LA 4E0AA 2FSRA 1BOBA 2HV2A 4KUBA 5GCNA 2D4PA 1M4GA 4CAXA 2VQYA 2CNTA 3F0AA 2P6FA 2Q4VA 4KORA 5JPHA 1NMTA 3FXTA 3NE7A 3TOAA 3PP9A 3S6HA 1IYKA 4HNWB 2J8RA 3GY9A 5KTDA 3TO7A 1XEBA 1YX0A 5F46A 4U5YA 1Q2YA 5F47A 5EC4A 1KUVA 1XF8A 3FRMA 4UA3A 1MK4A 4OLLA 3DR8A 4NXYA 2Q4YA 2A4NA 1R57A 4II9A 4Y49C 2J8NA 4NSQA 4ONUA 4XPDC 2BL1A 1CJWA 4JWPA 3JUWA 4K30A 1Q2CA 1Y7RA 4HNYB 4HKFA 3DR6A 3ZZIA 2EUIA 4B5PB 2Q7BA 3H4QA 3WR7A 1LRZA 5F49A 1YVKA 4E8OA 3BJ8A 1XE4A 2B5GB 3D8PA 3EO4A 1WWZA 1Z9UA 3TTHA 1QSOA 2PR8A 2OZUA 1MJBA 4JD6A 4JJXA 2Q0YA 4RI1A 3TOBA 1QSTA 1IICA 2FXFA 4HNXB 3EY5A 5C88A 4H6UA 2Y0MA 3R95A 1L0CA 3DSBA 4QVTA 2ZW6A 4R87A 1IB1E 2NMTA 4MBUA 4M3SA 1QSMA 2ZPAA 3QAHA 1YK3A 4KLWA 4PK2A 4AG9A 4J3GA 2VBQA 3DNSA 2RC4A 3W91A 4F0YA 5C82A 2JEVA 3OWCA 4JXRA 4QBJA 2Z0ZA 4FD5A 4KLVA 2I00A 2F5IA 4ZBGA 2VZYA 4QC6A 2B58A 3VWDA 3KKWA 2B4DB 2QMLA 4B5PA 4FD6A 4NEXA 5FVJA 3VWEA 2VI7A 1YLEA 2CNSA 5CNPA 3F8KA 3RYOA 4MI4A 1S5KA 2I79A 3TCVA 2FCKA 3TO6A 2B5GA 3R9EA 3F5BA 4M85A 1S7FA 5I0CA 4KVOE 2FT0A 2AJ6A 3ZJ0A 1QSNA 3I9SA 2OU2A 4NCZA 5IB0A 2HUZA 3CXSA 5IV0A 2HQYA 1U6MA 5J8CA 4PK3A 4UWJA 4R3LA 2ZW4A 2JLMA 3CXQA 3SXNA 4E2AA 2P6EA 2IL4A 5EBVA 2WPWA 3BJ7A 2CY2A 3BLNA 2BSWA 4XPKA 4Y49B 1PUAA 4XPDB 2KCWA 4CAWA 3DDDA 1P0HA 2VZZA 5KTAA 3R1KA 4KOSA 2OH1A 1NE9A 1MJ9A 4LUAA 4H6ZA 1I12A 4FD7A 3R9FA 1P4NA 3TO9A 3S6FA 2JDDA 3QB8A 1TIQA 2B4DA 2OB0A 3T90A 1BO4A 2BUEA 1WK4A 4R3KA 2PR1A 2DXQA 4XPLA 4KOVA 2ATRA 4UWIA 2AE6A 3V8IA 2CNMA 2EVNA 4YFJA 4AVCA 1B6BA 2PDOA 2R8VA 2X7BA 2VXKA 4BMHA 2Q44A 2R1IA 2OZGA 4R9MA 2O28A 2B3UA 1YGHA 1I21A 4GS4A 3G8WA 1Z4EA 1B87A 2K5TA 3D3SA 3P2FA 3P2HA 4DNCA 1MJAA 1IYLA 2ZW5A 4U9YA 3D2MA 2B3VA 1QSRA 2R98A 1XIXA 3FIXA 4OADA 3FYNA 1XMTA 1GHEA 2ZXVA 4NF1A 4CAVA 3W6XA 2PQ8A 4UBRA 2FS5A 1K4JA 1FY7A 3FB3A 2GE3A 3G3SA 4PSWA 4MJ8A 4FD4A 1ON0A 4MY0A 1N71A 4JLYA 1S7NA 4MY3A 4AVBA 5HH1A 5ISVA 5H84A 2Q04A 4MHDA 3EFAA 3S6KA 3CXPA 4KUAA 2G0BA 4LX9A 2REEA 1Q2DA 3N7ZA 4AVAA 3GKRA 4L8AA 1KUXA 2H5MA 2QIRA 1M44A 2Z11A 2PRBA 3UY5A 3LODA 4IF5A 1CM0A 2D4OA 3I3GA 1SQHA 1M4IA 4KOWA 5E96A 1Y9KA 4XNHC 3IGRA 4YRHA 2VEZA 2PC1A 3B8GA 4KOUA 2FIWA 4JXQA 4EVYA 5H86A 2J8MA 4QUSA 2REFA 4KZTA 3K9UA 4XNHB 3IWGA 3S6GA 4KVME 4U9ZA 2G3AA 1OZPA 3E0KA 1M4DA 1VHSA 2P6GA 1YVOA 2JDCA 4R57A 1VKCA 4AG7A 4H89A 3LD2A 2ARHA 4PV6A 5DWMA 1YREA 2B4BA 3SXOA 5KTCA 4ORFA 1S3ZA 3TE4A 3JVNA 3MGDA 2BEIA 2FL4A 5IX3A 3FNCA 4CS0B 4KOXA 5F48A 4AB7A 4X5KA 1UFHA 2G3TA 2WPXA 2GIVA
chains in the Genus database with same CATH superfamily
2Z10A 3R96A 3EC4A 2FE7A 3PB9X 4YGOA 1IIDA 2IJZA 4KVXA 2PJ2A 2OZHA 2WZNA 3D2PA 4B13A 5J1QA 2ZEFA 3PGPA 3TFYA 3LWUA 4IUSA 4KSIA 5THWA 3RNZA 4DYOA 2C6GA 1S7KA 2C27A 3GYAA 4KOYA 3TT2A 1V0CA 1QQ9A 1Z8TA 3PZJA 5HMNA 4W9YA 4OC5A 4OAEA 4PSXA 2ZW7A 3FEDA 1XOVA 4I49A 3EXNA 1YR0A 4A37A 4MFZA 4KOTA 1RO5A 5JQ4A 5DWNA 1BPMA 4OIWA 1M1DA 2QJ8A 3V38A 1HDQA 2HC9A 3D4UA 3SHPA 3R9GA 3RO0A 1RXTA 1J4JA 2PSWA 3KGQA 1KZFA 5AG5A 1Z8XA 4JYWA 4RS2A 3C26A 3IEHA 4P4DA 1KUYA 4F6AA 3FH4A 4F8ZA 2R7HA 4QB9A 2QECA 4Q7AA 1PU9A 1S60A 1Z2LA 2AFSA 2J9AA 4MCQA 1TKFA 4F0XA 1Z4RA 4A2ZA 2POKA 2FIAA 4MCPA 3W6SA 3FECA 2P0WA 2GANA 2PJ7A 2XEGA 3FBUA 3T9YA 3SI2A 4CRZB 2PJ0A 2XEJA 1NSLA 4B5OA 3WC5A 4CRYB 1I1DA 1BAVA 1F2PA 1Y9WA 4AXVA 4CGMA 2ZEGA 5J8FA 2ZEMA 4L89A 1S7LA 4E0AA 2FSRA 1BOBA 2NSMA 2HV2A 1FNOA 3D7DA 4P45A 3IU2A 4NGNA 4KUBA 4ZX8A 3IIBA 4P44A 2V8VA 5GCNA 2D4PA 2Z3OA 1M4GA 4CAXA 4M6HA 4M6GA 4ZX9A 1YQEA 2VQYA 2CNTA 3F0AA 2P6FA 2Q4VA 1XMBA 4KORA 3WT4A 5JPHA 1NMTA 3D7GA 3FXTA 3NE7A 3NE8A 3TC8A 4OMEA 2C1CA 3TOAA 3VARA 3PP9A 3ISXA 2PJBA 3S6HA 5D29A 1IYKA 4HNWB 2J8RA 5ELYA 3GY9A 3PRTA 1XBUA 2O53A 5KTDA 3TO7A 4OP4A 1XEBA 3KR5A 4UCNA 3RZAA 2JEWA 1YX0A 5F46A 3PEIA 4U5YA 1F2OA 1Q2YA 4OC4A 5EC4A 5F47A 5JGFA 1KUVA 1XF8A 3FRMA 3IFEA 3SI1A 1TF9A 4UA3A 1BLLE 1MK4A 2V8DA 1JWQA 3KQZA 3DR8A 4OLLA 3TX8A 1LANA 2GREA 4LQ6A 3N5FA 4NJQA 4MFQA 2QVPA 3CPXA 1HEEA 4NXYA 5AG7A 5D8NA 4GXHA 2Q4YA 3MRUA 2A4NA 1R57A 3H8EA 4CYOA 5G22A 1JQGA 5LYLA 4II9A 4YWYA 4X8IA 4Y49C 2J8NA 4NSQA 2C6CA 4ONUA 4F9VA 1CG2A 4XPDC 3WC7A 3PFEA 2BL1A 3FF3A 3SJXA 8CPAA 1AUGA 1CJWA 1CPSA 1PCAA 3JUWA 2EO8A 3KI9A 4JWPA 4C7HA 4K30A 2IMOA 4FAIA 1XJOA 1Q2CA 2ZOGA 1Y0RA 1Y7RA 4HNYB 4UFXA 4HKFA 3VATA 1CPXA 3CT9A 3DR6A 3ZZIA 2YNEA 2Z3MA 4CGNA 2EUIA 3KHXA 4H2KA 3ISZA 4B5PB 2Q7BA 3H4QA 3WR7A 1LRZA 5F49A 1YVKA 4ZGYB 4B10A 1ARLA 4MRIA 2HB6A 2EK9A 1Z8WA 4LQGA 4E8OA 3BJ8A 1XE4A 1FT7A 2B5GB 3D8PA 3SI0A 3EO4A 2Q51A 2YNCC 1WWZA 1Z9UA 3TTHA 1LAPA 1QSOA 1ZLHA 2PR8A 3B35A 4CAEA 4A30A 1CP6A 1LFWA 1MJBA 2OZUA 3HUVA 2Q0YA 2G9DA 3FJUA 4JD6A 4JJXA 4PXBA 4RI1A 3TOBA 4A39A 4UCMA 3WC6A 1QSTA 1IICA 2FXFA 4JZ0A 4X3RA 4OKOA 5F09A 5LYIA 2F7VA 4HNXB 3EY5A 5C88A 4NGSA 3NH4A 2Y0MA 3IWWA 4H6UA 4R8FA 3R95A 1L0CA 3DSBA 4QVTA 1VHOA 4O23A 2PVWA 2ZW6A 2EBJA 4R87A 1IU8A 1Z5RA 4A31A 4UEZA 3JTKA 2DF5A 4Q38A 1LOKA 2DPTA 3D66A 1A2ZA 1IB1E 2FVGA 1R43A 1YLOA 4NFRA 2NMTA 4MBUA 1DE4C 4A38A 4G1PA 2PCUA 4M3SA 1QSMA 2ZPAA 3QAHA 1YK3A 4KLWA 4FBEA 4ZY1A 4PK2A 2PIYA 3KASA 4AG9A 4J3GA 4UF4A 2VBQA 3DNSA 3QAYA 2RC4A 1VHEA 3I1UA 2O4HA 3W91A 4F0YA 2C6PA 4NGRA 5C82A 2JEVA 3OWCA 4DUKA 4JXRA 2ZEHA 4QBJA 3T8WA 2Z0ZA 4FD5A 2Z3LA 4KLVA 4P4JA 4BD9A 2I00A 2F5IA 4KSFA 4ZBGA 4A95A 3B3VA 2VZYA 2Q7SA 2B58A 4QC6A 3BXMA 3B3TA 4OC0A 3VWDA 3KKWA 2B4DB 2ZEDA 2CTBA 1DTDA 2PJ3A 1LCPA 3H8FA 2OOTA 5K8NA 3PBEA 1X12A 4NGMA 2QMLA 1AMPA 4B5PA 4FD6A 4NEXA 3PB4X 2VL1A 5FVJA 2ZEEA 3JRUA 3VWEA 2VI7A 1YLEA 2CNSA 2F8HA 3F8KA 5CNPA 3KZWA 3RYOA 2AFXA 4MI4A 5A28A 2PE3A 4NGTA 1S5KA 2I79A 2EK8A 3NH5A 3L2NA 1CX8A 3FEEA 4MMOA 3TCVA 4EFDA 2FCKA 3TO6A 2B5GA 3R9EA 3F5BA 2AFOA 2PJ1A 4P4IA 3D67A 1QMUA 4UFWA 1ZG7A 1IY7A 2I3CA 3KHZA 3PFOA 2OR4A 3FX6A 4NGPA 4EWTA 4M85A 1S7FA 4M6IA 3CPAA 5I0CA 4KVOE 2PVVA 4P4BA 2Q43A 2FT0A 2AJ6A 2XEIA 3ZJ0A 1QSNA 3NH8A 3I9SA 2OU2A 4NCZA 5IB0A 1UWYA 2RFHA 2HUZA 3CXSA 3S9NA 3PB7X 5IV0A 2HQYA 3DLJA 4DJLA 1U6MA 5J8CA 4PK3A 5K8MA 4KSAA 4UWJA 3WABA 4R3LA 5JM6A 2ZW4A 4KS9A 3H8GA 5JH9A 1EE3P 2V8GA 1ELMP 2JLMA 3B7IA 3CXQA 4OC2A 3B2YA 3SXNA 4E2AA 4OIDA 2P6EA 3BI1A 3IO1A 2BCOA 1X10A 5AG6A 2Z3NA 3GB0A 4CYQA 2PJ8A 1OBRA 2IL4A 5G1ZA 5HVFA 2BO9A 5EBVA 2WPWA 2ODFA 1RTQA 3BJ7A 4ONWA 2CY2A 5CBMA 2PIZA 2PJ5A 3BLNA 2BSWA 4XPKA 4Y49B 3CDXA 1PUAA 2GU2A 4MHYA 4XPDB 4R76A 2KCWA 3IJ3A 2DPSA 4P4EA 4CAWA 3DDDA 4OC1A 4B6ZA 1P0HA 2VZZA 5KTAA 3R1KA 4KOSA 4A94A 2OH1A 1H8LA 1NE9A 1MJ9A 2AFUA 3IWEA 4LUAA 1XRYA 4H6ZA 1I12A 4ZY2A 4FD7A 3R9FA 1P4NA 3BI0A 5HVHA 4WJBA 3S6FA 2JDDA 3TO9A 4CYNA 2RB7A 3QB8A 1TIQA 2B4DA 2OB0A 1AYEA 3T90A 1BO4A 2BUEA 3B3WA 4CYPA 4P4FA 1WK4A 4R3KA 5BWAB 2PR1A 2DXQA 3RAMA 4CGOA 2V8HA 4XPLA 4KOVA 2ATRA 4UWIA 2AE6A 5G20A 3V8IA 2CNMA 1PYTB 1ZO0A 2EVNA 3DGVA 4YFJA 4AVCA 1KWMA 2CTCA 1B6BA 4F9UA 4C7IA 2NYQA 1IOIA 2ZOFA 2PDOA 5LRGA 2R8VA 3K9TA 4TWEA 2X7BA 3GLJA 2VXKA 4BMHA 5IB9A 4NJRA 2Q44A 2PJCA 2R1IA 3QNVA 3CZXA 1Z8LA 4MCSA 1TKJA 2OZGA 1NSAA 3D7FA 4HPSA 2ZEPA 4R9MA 2O28A 2B3UA 1YGHA 1I21A 4GS4A 3B3SA 3G8WA 1Z4EA 1B87A 1LAMA 3VH9A 2K5TA 2PJ6A 3D3SA 4RN7A 3P2FA 3P2HA 5K8OA 4DNCA 3LMSA 1GYTA 1CBXA 3GUXA 4MFKA 4FUUA 2EWBA 4UEFA 3PB8X 1MJAA 1IYLA 2ZW5A 4U9YA 1M4LA 4B11A 3D2MA 2PJAA 2B3VA 1YW6A 1YW4A 4A33A 5DS0A 3IC1A 1QSRA 2R98A 3V7ZA 4A32A 1IGBA 4C2YA 1XIXA 3BHXA 2BOAA 4YU9A 4ZYQA 5K8PA 1CP7A 3FIXA 4OADA 1XFOA 3FYNA 1XMTA 4IHMA 2YNDA 1TXRA 1GHEA 2ZXVA 4NF1A 4CAVA 3W6XA 2PQ8A 4UBRA 3MN8A 2FS5A 2PJ4A 1ZG8A 2PJ9A 5AG4A 4B12A 4MFJA 2AFZA 4UCPA 1ZG9A 1K4JA 3S9LA 4CAFA 1IOFA 1FY7A 1R3NA 3D7HA 3NFZA 3FB3A 2GE3A 3G3SA 4IK2A 4UFVA 4PSWA 4Z65A 1HDUA 2IQ6A 4MJ8A 4FD4A 4PXDA 4EMEA 3PBBA 1ON0A 4MY0A 4MFPA 1N71A 1ZLIA 1S7NA 4JLYA 1VGYA 3H5ZA 4MY3A 4P6YA 4MHPA 3KQXA 5LYDA 4R7MA 4AVBA 4MHNA 5HH1A 5HVGA 5LRKA 5ISVA 5H84A 2Q04A 3KL9A 4MHDA 3EFAA 3S6KA 3CXPA 4KUAA 2G0BA 2JBJA 5AGEA 4MHZA 4LX9A 5CPAA 4C2ZA 2Q4ZA 3GIUA 2CXAA 3A9LA 2REEA 2JBKA 4PPZA 1Q2DA 5LRJA 4C2XA 2ZEOA 4OC3A 5LYFA 1Q7LA 3N7ZA 4AVAA 2YNCA 3FVLA 2YGWA 4X2TA 2ZELA 2WSAA 5G21A 4UIBA 3LACA 5I4MA 3GKRA 4L8AA 1KUXA 2H5MA 2QIRA 1M44A 2Z11A 2PRBA 4MXUA 3SJFA 3UY5A 4PXEA 4GM5A 2Z3KA 3LODA 2CF4A 4IF5A 1CM0A 2D4OA 4MCRA 3D68A 3I3GA 1SQHA 3IU1A 4R6TA 2ZENA 1BPNA 5A27A 1M4IA 4KOWA 5E96A 1F57A 2GLJA 3PB6X 1Y9KA 2AFWA 4ZI6A 4XNHC 1YSJA 3IGRA 3K2KA 4YRHA 2VEZA 1TKHA 2PC1A 5EMIA 3B8GA 4KOUA 3KR4A 2FIWA 4WWVA 4JXQA 4CPAA 4BINA 4EVYA 4RUHA 1TF8A 5H86A 4CGPA 2J8MA 3HLPA 4QUSA 2REFA 4KZTA 3K9UA 4XNHB 3IWGA 3SJGA 4IAVA 7CPAA 3S6GA 2DEAA 2CIJA 2WUUA 1Y0YA 2AFMA 4KVME 4C68A 1ARMA 2Z3PA 4U9ZA 4Q36A 2V77A 2G3AA 4CGLA 1OZPA 3E0KA 1M4DA 1VHSA 2GLFA 2P6GA 4PQAA 6CPAA 1YVOA 4NGQA 4FWUA 3NA6A 2JDCA 4UIAA 4MFLA 4R57A 1VKCA 1VIXA 4AG7A 2GFQA 4UEEA 4H89A 2QYVA 3LD2A 2ARHA 4B14A 4PV6A 5DWMA 1YREA 2B4BA 3SXOA 2ANPA 4ORFA 5KTCA 1S3ZA 2WYRA 4ZY0A 2PRQA 3TE4A 4TNUA 3JVNA 1ELLP 1Y7EA 3MGDA 4BBHA 2ABZA 3B3CA 3RBUA 2BEIA 2FL4A 5IX3A 3FNCA 4CS0B 3SJEA 3FMCA 1YMEA 4KOXA 5F48A 4AB7A 5HXDA 4X5KA 2XEFA 3S9MA 1UFHA 2G3TA 2WPXA 4K3NA 4P10A 4PXCA 2GIVA
chains in the Genus database with same CATH topology
2Z10A 3R96A 3EC4A 2FE7A 4YGOA 1IIDA 4KVXA 2OZHA 3D2PA 4B13A 3PGPA 3TFYA 4IUSA 1S7KA 2C27A 3GYAA 4KOYA 3TT2A 1V0CA 3PZJA 5HMNA 4OAEA 4PSXA 2ZW7A 4I49A 3EXNA 1YR0A 4MFZA 4KOTA 1RO5A 5JQ4A 5DWNA 1M1DA 3SHPA 3R9GA 1RXTA 1J4JA 2PSWA 5AG5A 1KZFA 4RS2A 3C26A 1KUYA 4F6AA 2R7HA 4QB9A 2QECA 1PU9A 1S60A 4F0XA 1Z4RA 4A2ZA 3W6SA 2FIAA 2P0WA 2GANA 3FBUA 3T9YA 4CRZB 1NSLA 4B5OA 4CRYB 1I1DA 1Y9WA 4CGMA 5J8FA 4L89A 1S7LA 4E0AA 2FSRA 1BOBA 2HV2A 3IU2A 4KUBA 5GCNA 2D4PA 2Z3OA 1M4GA 4CAXA 2VQYA 2CNTA 3F0AA 2P6FA 2Q4VA 4KORA 5JPHA 1NMTA 3FXTA 3NE7A 3TOAA 3PP9A 3S6HA 1IYKA 4HNWB 2J8RA 3GY9A 5KTDA 3TO7A 1XEBA 4UCNA 1YX0A 5F46A 4U5YA 1Q2YA 5F47A 5EC4A 1KUVA 1XF8A 3FRMA 4UA3A 1MK4A 4OLLA 3DR8A 4MFQA 4NXYA 5AG7A 2Q4YA 2A4NA 1R57A 4CYOA 5G22A 4II9A 4Y49C 2J8NA 4NSQA 4ONUA 4XPDC 2BL1A 1CJWA 4JWPA 3JUWA 4C7HA 4K30A 1Q2CA 1Y7RA 4HNYB 4UFXA 4HKFA 3DR6A 3ZZIA 2YNEA 2Z3MA 4CGNA 2EUIA 4B5PB 2Q7BA 3H4QA 3WR7A 1LRZA 5F49A 1YVKA 4ZGYB 4B10A 4E8OA 3BJ8A 1XE4A 2B5GB 3D8PA 3EO4A 2YNCC 1WWZA 1Z9UA 3TTHA 1QSOA 2PR8A 4CAEA 4A30A 2OZUA 1MJBA 4JD6A 4JJXA 2Q0YA 4RI1A 3TOBA 4UCMA 1QSTA 1IICA 2FXFA 4HNXB 3EY5A 5C88A 4H6UA 2Y0MA 3R95A 1L0CA 3DSBA 4QVTA 2ZW6A 4R87A 4A31A 3JTKA 4Q38A 2DPTA 1IB1E 2NMTA 4MBUA 4M3SA 1QSMA 2ZPAA 3QAHA 1YK3A 4KLWA 4PK2A 4AG9A 4J3GA 2VBQA 3DNSA 2RC4A 3W91A 4F0YA 5C82A 2JEVA 3OWCA 4JXRA 4QBJA 2Z0ZA 4FD5A 2Z3LA 4KLVA 2I00A 2F5IA 4KSFA 4ZBGA 4A95A 2VZYA 4QC6A 2B58A 3VWDA 3KKWA 2B4DB 2QMLA 4B5PA 4FD6A 4NEXA 5FVJA 3VWEA 2VI7A 1YLEA 2CNSA 5CNPA 3F8KA 3RYOA 4MI4A 5A28A 1S5KA 2I79A 3TCVA 2FCKA 3TO6A 2B5GA 3R9EA 3F5BA 4UFWA 4M85A 1S7FA 5I0CA 4KVOE 2FT0A 2AJ6A 3ZJ0A 1QSNA 3I9SA 2OU2A 4NCZA 5IB0A 2HUZA 3CXSA 5IV0A 2HQYA 1U6MA 5J8CA 4PK3A 4KSAA 4UWJA 4R3LA 2ZW4A 4KS9A 2JLMA 3CXQA 3SXNA 4E2AA 2P6EA 5AG6A 2Z3NA 4CYQA 2IL4A 5G1ZA 5EBVA 2WPWA 3BJ7A 2CY2A 3BLNA 2BSWA 4XPKA 4Y49B 1PUAA 4XPDB 2KCWA 2DPSA 4CAWA 3DDDA 1P0HA 2VZZA 5KTAA 3R1KA 4KOSA 2OH1A 1NE9A 1MJ9A 3IWEA 4LUAA 4H6ZA 1I12A 4FD7A 3R9FA 1P4NA 3TO9A 3S6FA 2JDDA 4CYNA 3QB8A 1TIQA 2B4DA 2OB0A 3T90A 1BO4A 2BUEA 4CYPA 1WK4A 4R3KA 5BWAB 2PR1A 2DXQA 4CGOA 4XPLA 4KOVA 2ATRA 4UWIA 2AE6A 5G20A 3V8IA 2CNMA 1ZO0A 2EVNA 4YFJA 4AVCA 1B6BA 4C7IA 2PDOA 2R8VA 2X7BA 2VXKA 4BMHA 2Q44A 2R1IA 2OZGA 4R9MA 2O28A 2B3UA 1YGHA 1I21A 4GS4A 3G8WA 1Z4EA 1B87A 2K5TA 3D3SA 3P2FA 3P2HA 4DNCA 4MFKA 1MJAA 1IYLA 2ZW5A 4U9YA 4B11A 3D2MA 2B3VA 4A33A 1QSRA 2R98A 4A32A 4C2YA 1XIXA 3FIXA 4OADA 3FYNA 1XMTA 2YNDA 1GHEA 2ZXVA 4NF1A 4CAVA 3W6XA 2PQ8A 4UBRA 2FS5A 5AG4A 4B12A 4MFJA 4UCPA 1K4JA 4CAFA 1FY7A 3FB3A 2GE3A 3G3SA 4UFVA 4PSWA 4MJ8A 4FD4A 1ON0A 4MY0A 4MFPA 1N71A 4JLYA 1S7NA 4MY3A 3H5ZA 4AVBA 5HH1A 5ISVA 5H84A 2Q04A 4MHDA 3EFAA 3S6KA 3CXPA 4KUAA 2G0BA 5AGEA 4LX9A 4C2ZA 2CXAA 3A9LA 2REEA 4C2XA 1Q2DA 3N7ZA 4AVAA 2YNCA 2YGWA 2WSAA 5G21A 3GKRA 4L8AA 1KUXA 2H5MA 2QIRA 1M44A 2Z11A 2PRBA 3UY5A 2Z3KA 3LODA 4IF5A 1CM0A 2D4OA 3I3GA 1SQHA 3IU1A 5A27A 1M4IA 4KOWA 5E96A 1Y9KA 4XNHC 3IGRA 4YRHA 2VEZA 2PC1A 3B8GA 4KOUA 2FIWA 4JXQA 4EVYA 5H86A 4CGPA 2J8MA 4QUSA 2REFA 4KZTA 3K9UA 4XNHB 3IWGA 3S6GA 2WUUA 4KVME 4C68A 2Z3PA 4U9ZA 4Q36A 2G3AA 4CGLA 1OZPA 3E0KA 1M4DA 1VHSA 2P6GA 1YVOA 2JDCA 4MFLA 4R57A 1VKCA 4AG7A 4H89A 3LD2A 2ARHA 4B14A 4PV6A 5DWMA 1YREA 2B4BA 3SXOA 5KTCA 4ORFA 1S3ZA 3TE4A 3JVNA 3MGDA 4BBHA 2BEIA 2FL4A 5IX3A 3FNCA 4CS0B 4KOXA 5F48A 4AB7A 4X5KA 1UFHA 2G3TA 2WPXA 2GIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z10 A;  3R96 A;  3EC4 A;  2FE7 A;  4YGO A;  1IID A;  4KVX A;  2OZH A;  3D2P A;  3PGP A;  3TFY A;  4IUS A;  1S7K A;  2C27 A;  3GYA A;  4KOY A;  3TT2 A;  1V0C A;  3PZJ A;  5HMN A;  4OAE A;  4PSX A;  2ZW7 A;  4I49 A;  3EXN A;  1YR0 A;  4KOT A;  1RO5 A;  5JQ4 A;  5DWN A;  1M1D A;  3SHP A;  3R9G A;  1RXT A;  1J4J A;  2PSW A;  1KZF A;  4RS2 A;  3C26 A;  1KUY A;  4F6A A;  2R7H A;  4QB9 A;  2QEC A;  1PU9 A;  1S60 A;  1Z4R A;  3W6S A;  2FIA A;  2P0W A;  2GAN A;  3FBU A;  3T9Y A;  4CRZ B;  1NSL A;  4B5O A;  4CRY B;  1I1D A;  1Y9W A;  5J8F A;  4L89 A;  1S7L A;  4E0A A;  2FSR A;  1BOB A;  2HV2 A;  4KUB A;  5GCN A;  2D4P A;  1M4G A;  4CAX A;  2VQY A;  2CNT A;  3F0A A;  2P6F A;  2Q4V A;  4KOR A;  5JPH A;  1NMT A;  3FXT A;  3NE7 A;  3TOA A;  3PP9 A;  3S6H A;  1IYK A;  4HNW B;  2J8R A;  3GY9 A;  5KTD A;  3TO7 A;  1XEB A;  1YX0 A;  5F46 A;  4U5Y A;  1Q2Y A;  5F47 A;  5EC4 A;  1KUV A;  1XF8 A;  3FRM A;  4UA3 A;  1MK4 A;  4OLL A;  3DR8 A;  4NXY A;  2Q4Y A;  2A4N A;  1R57 A;  4II9 A;  4Y49 C;  2J8N A;  4NSQ A;  4ONU A;  4XPD C;  2BL1 A;  1CJW A;  4JWP A;  3JUW A;  4K30 A;  1Q2C A;  1Y7R A;  4HNY B;  4HKF A;  3DR6 A;  3ZZI A;  2EUI A;  4B5P B;  2Q7B A;  3H4Q A;  3WR7 A;  1LRZ A;  5F49 A;  1YVK A;  4E8O A;  3BJ8 A;  1XE4 A;  2B5G B;  3D8P A;  3EO4 A;  1WWZ A;  1Z9U A;  3TTH A;  1QSO A;  2PR8 A;  2OZU A;  1MJB A;  4JD6 A;  4JJX A;  2Q0Y A;  4RI1 A;  3TOB A;  1QST A;  1IIC A;  2FXF A;  4HNX B;  3EY5 A;  5C88 A;  4H6U A;  2Y0M A;  3R95 A;  1L0C A;  3DSB A;  4QVT A;  2ZW6 A;  4R87 A;  1IB1 E;  2NMT A;  4MBU A;  4M3S A;  1QSM A;  2ZPA A;  3QAH A;  1YK3 A;  4KLW A;  4PK2 A;  4AG9 A;  4J3G A;  2VBQ A;  3DNS A;  2RC4 A;  3W91 A;  4F0Y A;  5C82 A;  2JEV A;  3OWC A;  4JXR A;  4QBJ A;  2Z0Z A;  4FD5 A;  4KLV A;  2I00 A;  2F5I A;  4ZBG A;  2VZY A;  4QC6 A;  2B58 A;  3VWD A;  3KKW A;  2B4D B;  2QML A;  4B5P A;  4FD6 A;  4NEX A;  5FVJ A;  3VWE A;  2VI7 A;  1YLE A;  2CNS A;  5CNP A;  3F8K A;  3RYO A;  4MI4 A;  1S5K A;  2I79 A;  3TCV A;  2FCK A;  3TO6 A;  2B5G A;  3R9E A;  3F5B A;  4M85 A;  1S7F A;  5I0C A;  4KVO E;  2FT0 A;  2AJ6 A;  3ZJ0 A;  1QSN A;  3I9S A;  2OU2 A;  4NCZ A;  5IB0 A;  2HUZ A;  3CXS A;  5IV0 A;  2HQY A;  1U6M A;  5J8C A;  4PK3 A;  4UWJ A;  4R3L A;  2ZW4 A;  2JLM A;  3CXQ A;  3SXN A;  4E2A A;  2P6E A;  2IL4 A;  5EBV A;  2WPW A;  3BJ7 A;  2CY2 A;  3BLN A;  2BSW A;  4XPK A;  4Y49 B;  1PUA A;  4XPD B;  2KCW A;  4CAW A;  3DDD A;  1P0H A;  2VZZ A;  5KTA A;  3R1K A;  4KOS A;  2OH1 A;  1NE9 A;  1MJ9 A;  4LUA A;  4H6Z A;  1I12 A;  4FD7 A;  3R9F A;  1P4N A;  3TO9 A;  3S6F A;  2JDD A;  3QB8 A;  1TIQ A;  2B4D A;  2OB0 A;  3T90 A;  1BO4 A;  2BUE A;  1WK4 A;  4R3K A;  2PR1 A;  2DXQ A;  4XPL A;  4KOV A;  2ATR A;  4UWI A;  2AE6 A;  3V8I A;  2CNM A;  2EVN A;  4YFJ A;  4AVC A;  1B6B A;  2PDO A;  2R8V A;  2X7B A;  2VXK A;  4BMH A;  2Q44 A;  2R1I A;  2OZG A;  4R9M A;  2O28 A;  2B3U A;  1YGH A;  1I21 A;  4GS4 A;  3G8W A;  1Z4E A;  1B87 A;  2K5T A;  3D3S A;  3P2F A;  3P2H A;  4DNC A;  1MJA A;  1IYL A;  2ZW5 A;  4U9Y A;  3D2M A;  2B3V A;  1QSR A;  2R98 A;  1XIX A;  3FIX A;  4OAD A;  3FYN A;  1XMT A;  1GHE A;  2ZXV A;  4NF1 A;  4CAV A;  3W6X A;  2PQ8 A;  4UBR A;  2FS5 A;  1K4J A;  1FY7 A;  3FB3 A;  2GE3 A;  3G3S A;  4PSW A;  4MJ8 A;  4FD4 A;  1ON0 A;  4MY0 A;  1N71 A;  4JLY A;  1S7N A;  4MY3 A;  4AVB A;  5HH1 A;  5ISV A;  5H84 A;  2Q04 A;  4MHD A;  3EFA A;  3S6K A;  3CXP A;  4KUA A;  2G0B A;  4LX9 A;  2REE A;  1Q2D A;  3N7Z A;  4AVA A;  3GKR A;  4L8A A;  1KUX A;  2H5M A;  2QIR A;  1M44 A;  2Z11 A;  2PRB A;  3UY5 A;  3LOD A;  4IF5 A;  1CM0 A;  2D4O A;  3I3G A;  1SQH A;  1M4I A;  4KOW A;  5E96 A;  1Y9K A;  4XNH C;  3IGR A;  4YRH A;  2VEZ A;  2PC1 A;  3B8G A;  4KOU A;  2FIW A;  4JXQ A;  4EVY A;  5H86 A;  2J8M A;  4QUS A;  2REF A;  4KZT A;  3K9U A;  4XNH B;  3IWG A;  3S6G A;  4KVM E;  4U9Z A;  2G3A A;  1OZP A;  3E0K A;  1M4D A;  1VHS A;  2P6G A;  1YVO A;  2JDC A;  4R57 A;  1VKC A;  4AG7 A;  4H89 A;  3LD2 A;  2ARH A;  4PV6 A;  5DWM A;  1YRE A;  2B4B A;  3SXO A;  5KTC A;  4ORF A;  1S3Z A;  3TE4 A;  3JVN A;  3MGD A;  2BEI A;  2FL4 A;  5IX3 A;  3FNC A;  4CS0 B;  4KOX A;  5F48 A;  4AB7 A;  4X5K A;  1UFH A;  2G3T A;  2WPX A;  2GIV A; 
#chains in the Genus database with same CATH topology
 2Z10 A;  3R96 A;  3EC4 A;  2FE7 A;  3PB9 X;  4YGO A;  1IID A;  2IJZ A;  4KVX A;  2PJ2 A;  2OZH A;  2WZN A;  3D2P A;  4B13 A;  5J1Q A;  2ZEF A;  3PGP A;  3TFY A;  3LWU A;  4IUS A;  4KSI A;  5THW A;  3RNZ A;  4DYO A;  2C6G A;  1S7K A;  2C27 A;  3GYA A;  4KOY A;  3TT2 A;  1V0C A;  1QQ9 A;  1Z8T A;  3PZJ A;  5HMN A;  4W9Y A;  4OC5 A;  4OAE A;  4PSX A;  2ZW7 A;  3FED A;  1XOV A;  4I49 A;  3EXN A;  1YR0 A;  4A37 A;  4MFZ A;  4KOT A;  1RO5 A;  5JQ4 A;  5DWN A;  1BPM A;  4OIW A;  1M1D A;  2QJ8 A;  3V38 A;  1HDQ A;  2HC9 A;  3D4U A;  3SHP A;  3R9G A;  3RO0 A;  1RXT A;  1J4J A;  2PSW A;  3KGQ A;  1KZF A;  5AG5 A;  1Z8X A;  4JYW A;  4RS2 A;  3C26 A;  3IEH A;  4P4D A;  1KUY A;  4F6A A;  3FH4 A;  4F8Z A;  2R7H A;  4QB9 A;  2QEC A;  4Q7A A;  1PU9 A;  1S60 A;  1Z2L A;  2AFS A;  2J9A A;  4MCQ A;  1TKF A;  4F0X A;  1Z4R A;  4A2Z A;  2POK A;  2FIA A;  4MCP A;  3W6S A;  3FEC A;  2P0W A;  2GAN A;  2PJ7 A;  2XEG A;  3FBU A;  3T9Y A;  3SI2 A;  4CRZ B;  2PJ0 A;  2XEJ A;  1NSL A;  4B5O A;  3WC5 A;  4CRY B;  1I1D A;  1BAV A;  1F2P A;  1Y9W A;  4AXV A;  4CGM A;  2ZEG A;  5J8F A;  2ZEM A;  4L89 A;  1S7L A;  4E0A A;  2FSR A;  1BOB A;  2NSM A;  2HV2 A;  1FNO A;  3D7D A;  4P45 A;  3IU2 A;  4NGN A;  4KUB A;  4ZX8 A;  3IIB A;  4P44 A;  2V8V A;  5GCN A;  2D4P A;  2Z3O A;  1M4G A;  4CAX A;  4M6H A;  4M6G A;  4ZX9 A;  1YQE A;  2VQY A;  2CNT A;  3F0A A;  2P6F A;  2Q4V A;  1XMB A;  4KOR A;  3WT4 A;  5JPH A;  1NMT A;  3D7G A;  3FXT A;  3NE7 A;  3NE8 A;  3TC8 A;  4OME A;  2C1C A;  3TOA A;  3VAR A;  3PP9 A;  3ISX A;  2PJB A;  3S6H A;  5D29 A;  1IYK A;  4HNW B;  2J8R A;  5ELY A;  3GY9 A;  3PRT A;  1XBU A;  2O53 A;  5KTD A;  3TO7 A;  4OP4 A;  1XEB A;  3KR5 A;  4UCN A;  3RZA A;  2JEW A;  1YX0 A;  5F46 A;  3PEI A;  4U5Y A;  1F2O A;  1Q2Y A;  4OC4 A;  5EC4 A;  5F47 A;  5JGF A;  1KUV A;  1XF8 A;  3FRM A;  3IFE A;  3SI1 A;  1TF9 A;  4UA3 A;  1BLL E;  1MK4 A;  2V8D A;  1JWQ A;  3KQZ A;  3DR8 A;  4OLL A;  3TX8 A;  1LAN A;  2GRE A;  4LQ6 A;  3N5F A;  4NJQ A;  4MFQ A;  2QVP A;  3CPX A;  1HEE A;  4NXY A;  5AG7 A;  5D8N A;  4GXH A;  2Q4Y A;  3MRU A;  2A4N A;  1R57 A;  3H8E A;  4CYO A;  5G22 A;  1JQG A;  5LYL A;  4II9 A;  4YWY A;  4X8I A;  4Y49 C;  2J8N A;  4NSQ A;  2C6C A;  4ONU A;  4F9V A;  1CG2 A;  4XPD C;  3WC7 A;  3PFE A;  2BL1 A;  3FF3 A;  3SJX A;  8CPA A;  1AUG A;  1CJW A;  1CPS A;  1PCA A;  3JUW A;  2EO8 A;  3KI9 A;  4JWP A;  4C7H A;  4K30 A;  2IMO A;  4FAI A;  1XJO A;  1Q2C A;  2ZOG A;  1Y0R A;  1Y7R A;  4HNY B;  4UFX A;  4HKF A;  3VAT A;  1CPX A;  3CT9 A;  3DR6 A;  3ZZI A;  2YNE A;  2Z3M A;  4CGN A;  2EUI A;  3KHX A;  4H2K A;  3ISZ A;  4B5P B;  2Q7B A;  3H4Q A;  3WR7 A;  1LRZ A;  5F49 A;  1YVK A;  4ZGY B;  4B10 A;  1ARL A;  4MRI A;  2HB6 A;  2EK9 A;  1Z8W A;  4LQG A;  4E8O A;  3BJ8 A;  1XE4 A;  1FT7 A;  2B5G B;  3D8P A;  3SI0 A;  3EO4 A;  2Q51 A;  2YNC C;  1WWZ A;  1Z9U A;  3TTH A;  1LAP A;  1QSO A;  1ZLH A;  2PR8 A;  3B35 A;  4CAE A;  4A30 A;  1CP6 A;  1LFW A;  1MJB A;  2OZU A;  3HUV A;  2Q0Y A;  2G9D A;  3FJU A;  4JD6 A;  4JJX A;  4PXB A;  4RI1 A;  3TOB A;  4A39 A;  4UCM A;  3WC6 A;  1QST A;  1IIC A;  2FXF A;  4JZ0 A;  4X3R A;  4OKO A;  5F09 A;  5LYI A;  2F7V A;  4HNX B;  3EY5 A;  5C88 A;  4NGS A;  3NH4 A;  2Y0M A;  3IWW A;  4H6U A;  4R8F A;  3R95 A;  1L0C A;  3DSB A;  4QVT A;  1VHO A;  4O23 A;  2PVW A;  2ZW6 A;  2EBJ A;  4R87 A;  1IU8 A;  1Z5R A;  4A31 A;  4UEZ A;  3JTK A;  2DF5 A;  4Q38 A;  1LOK A;  2DPT A;  3D66 A;  1A2Z A;  1IB1 E;  2FVG A;  1R43 A;  1YLO A;  4NFR A;  2NMT A;  4MBU A;  1DE4 C;  4A38 A;  4G1P A;  2PCU A;  4M3S A;  1QSM A;  2ZPA A;  3QAH A;  1YK3 A;  4KLW A;  4FBE A;  4ZY1 A;  4PK2 A;  2PIY A;  3KAS A;  4AG9 A;  4J3G A;  4UF4 A;  2VBQ A;  3DNS A;  3QAY A;  2RC4 A;  1VHE A;  3I1U A;  2O4H A;  3W91 A;  4F0Y A;  2C6P A;  4NGR A;  5C82 A;  2JEV A;  3OWC A;  4DUK A;  4JXR A;  2ZEH A;  4QBJ A;  3T8W A;  2Z0Z A;  4FD5 A;  2Z3L A;  4KLV A;  4P4J A;  4BD9 A;  2I00 A;  2F5I A;  4KSF A;  4ZBG A;  4A95 A;  3B3V A;  2VZY A;  2Q7S A;  2B58 A;  4QC6 A;  3BXM A;  3B3T A;  4OC0 A;  3VWD A;  3KKW A;  2B4D B;  2ZED A;  2CTB A;  1DTD A;  2PJ3 A;  1LCP A;  3H8F A;  2OOT A;  5K8N A;  3PBE A;  1X12 A;  4NGM A;  2QML A;  1AMP A;  4B5P A;  4FD6 A;  4NEX A;  3PB4 X;  2VL1 A;  5FVJ A;  2ZEE A;  3JRU A;  3VWE A;  2VI7 A;  1YLE A;  2CNS A;  2F8H A;  3F8K A;  5CNP A;  3KZW A;  3RYO A;  2AFX A;  4MI4 A;  5A28 A;  2PE3 A;  4NGT A;  1S5K A;  2I79 A;  2EK8 A;  3NH5 A;  3L2N A;  1CX8 A;  3FEE A;  4MMO A;  3TCV A;  4EFD A;  2FCK A;  3TO6 A;  2B5G A;  3R9E A;  3F5B A;  2AFO A;  2PJ1 A;  4P4I A;  3D67 A;  1QMU A;  4UFW A;  1ZG7 A;  1IY7 A;  2I3C A;  3KHZ A;  3PFO A;  2OR4 A;  3FX6 A;  4NGP A;  4EWT A;  4M85 A;  1S7F A;  4M6I A;  3CPA A;  5I0C A;  4KVO E;  2PVV A;  4P4B A;  2Q43 A;  2FT0 A;  2AJ6 A;  2XEI A;  3ZJ0 A;  1QSN A;  3NH8 A;  3I9S A;  2OU2 A;  4NCZ A;  5IB0 A;  1UWY A;  2RFH A;  2HUZ A;  3CXS A;  3S9N A;  3PB7 X;  5IV0 A;  2HQY A;  3DLJ A;  4DJL A;  1U6M A;  5J8C A;  4PK3 A;  5K8M A;  4KSA A;  4UWJ A;  3WAB A;  4R3L A;  5JM6 A;  2ZW4 A;  4KS9 A;  3H8G A;  5JH9 A;  1EE3 P;  2V8G A;  1ELM P;  2JLM A;  3B7I A;  3CXQ A;  4OC2 A;  3B2Y A;  3SXN A;  4E2A A;  4OID A;  2P6E A;  3BI1 A;  3IO1 A;  2BCO A;  1X10 A;  5AG6 A;  2Z3N A;  3GB0 A;  4CYQ A;  2PJ8 A;  1OBR A;  2IL4 A;  5G1Z A;  5HVF A;  2BO9 A;  5EBV A;  2WPW A;  2ODF A;  1RTQ A;  3BJ7 A;  4ONW A;  2CY2 A;  5CBM A;  2PIZ A;  2PJ5 A;  3BLN A;  2BSW A;  4XPK A;  4Y49 B;  3CDX A;  1PUA A;  2GU2 A;  4MHY A;  4XPD B;  4R76 A;  2KCW A;  3IJ3 A;  2DPS A;  4P4E A;  4CAW A;  3DDD A;  4OC1 A;  4B6Z A;  1P0H A;  2VZZ A;  5KTA A;  3R1K A;  4KOS A;  4A94 A;  2OH1 A;  1H8L A;  1NE9 A;  1MJ9 A;  2AFU A;  3IWE A;  4LUA A;  1XRY A;  4H6Z A;  1I12 A;  4ZY2 A;  4FD7 A;  3R9F A;  1P4N A;  3BI0 A;  5HVH A;  4WJB A;  3S6F A;  2JDD A;  3TO9 A;  4CYN A;  2RB7 A;  3QB8 A;  1TIQ A;  2B4D A;  2OB0 A;  1AYE A;  3T90 A;  1BO4 A;  2BUE A;  3B3W A;  4CYP A;  4P4F A;  1WK4 A;  4R3K A;  5BWA B;  2PR1 A;  2DXQ A;  3RAM A;  4CGO A;  2V8H A;  4XPL A;  4KOV A;  2ATR A;  4UWI A;  2AE6 A;  5G20 A;  3V8I A;  2CNM A;  1PYT B;  1ZO0 A;  2EVN A;  3DGV A;  4YFJ A;  4AVC A;  1KWM A;  2CTC A;  1B6B A;  4F9U A;  4C7I A;  2NYQ A;  1IOI A;  2ZOF A;  2PDO A;  5LRG A;  2R8V A;  3K9T A;  4TWE A;  2X7B A;  3GLJ A;  2VXK A;  4BMH A;  5IB9 A;  4NJR A;  2Q44 A;  2PJC A;  2R1I A;  3QNV A;  3CZX A;  1Z8L A;  4MCS A;  1TKJ A;  2OZG A;  1NSA A;  3D7F A;  4HPS A;  2ZEP A;  4R9M A;  2O28 A;  2B3U A;  1YGH A;  1I21 A;  4GS4 A;  3B3S A;  3G8W A;  1Z4E A;  1B87 A;  1LAM A;  3VH9 A;  2K5T A;  2PJ6 A;  3D3S A;  4RN7 A;  3P2F A;  3P2H A;  5K8O A;  4DNC A;  3LMS A;  1GYT A;  1CBX A;  3GUX A;  4MFK A;  4FUU A;  2EWB A;  4UEF A;  3PB8 X;  1MJA A;  1IYL A;  2ZW5 A;  4U9Y A;  1M4L A;  4B11 A;  3D2M A;  2PJA A;  2B3V A;  1YW6 A;  1YW4 A;  4A33 A;  5DS0 A;  3IC1 A;  1QSR A;  2R98 A;  3V7Z A;  4A32 A;  1IGB A;  4C2Y A;  1XIX A;  3BHX A;  2BOA A;  4YU9 A;  4ZYQ A;  5K8P A;  1CP7 A;  3FIX A;  4OAD A;  1XFO A;  3FYN A;  1XMT A;  4IHM A;  2YND A;  1TXR A;  1GHE A;  2ZXV A;  4NF1 A;  4CAV A;  3W6X A;  2PQ8 A;  4UBR A;  3MN8 A;  2FS5 A;  2PJ4 A;  1ZG8 A;  2PJ9 A;  5AG4 A;  4B12 A;  4MFJ A;  2AFZ A;  4UCP A;  1ZG9 A;  1K4J A;  3S9L A;  4CAF A;  1IOF A;  1FY7 A;  1R3N A;  3D7H A;  3NFZ A;  3FB3 A;  2GE3 A;  3G3S A;  4IK2 A;  4UFV A;  4PSW A;  4Z65 A;  1HDU A;  2IQ6 A;  4MJ8 A;  4FD4 A;  4PXD A;  4EME A;  3PBB A;  1ON0 A;  4MY0 A;  4MFP A;  1N71 A;  1ZLI A;  1S7N A;  4JLY A;  1VGY A;  3H5Z A;  4MY3 A;  4P6Y A;  4MHP A;  3KQX A;  5LYD A;  4R7M A;  4AVB A;  4MHN A;  5HH1 A;  5HVG A;  5LRK A;  5ISV A;  5H84 A;  2Q04 A;  3KL9 A;  4MHD A;  3EFA A;  3S6K A;  3CXP A;  4KUA A;  2G0B A;  2JBJ A;  5AGE A;  4MHZ A;  4LX9 A;  5CPA A;  4C2Z A;  2Q4Z A;  3GIU A;  2CXA A;  3A9L A;  2REE A;  2JBK A;  4PPZ A;  1Q2D A;  5LRJ A;  4C2X A;  2ZEO A;  4OC3 A;  5LYF A;  1Q7L A;  3N7Z A;  4AVA A;  2YNC A;  3FVL A;  2YGW A;  4X2T A;  2ZEL A;  2WSA A;  5G21 A;  4UIB A;  3LAC A;  5I4M A;  3GKR A;  4L8A A;  1KUX A;  2H5M A;  2QIR A;  1M44 A;  2Z11 A;  2PRB A;  4MXU A;  3SJF A;  3UY5 A;  4PXE A;  4GM5 A;  2Z3K A;  3LOD A;  2CF4 A;  4IF5 A;  1CM0 A;  2D4O A;  4MCR A;  3D68 A;  3I3G A;  1SQH A;  3IU1 A;  4R6T A;  2ZEN A;  1BPN A;  5A27 A;  1M4I A;  4KOW A;  5E96 A;  1F57 A;  2GLJ A;  3PB6 X;  1Y9K A;  2AFW A;  4ZI6 A;  4XNH C;  1YSJ A;  3IGR A;  3K2K A;  4YRH A;  2VEZ A;  1TKH A;  2PC1 A;  5EMI A;  3B8G A;  4KOU A;  3KR4 A;  2FIW A;  4WWV A;  4JXQ A;  4CPA A;  4BIN A;  4EVY A;  4RUH A;  1TF8 A;  5H86 A;  4CGP A;  2J8M A;  3HLP A;  4QUS A;  2REF A;  4KZT A;  3K9U A;  4XNH B;  3IWG A;  3SJG A;  4IAV A;  7CPA A;  3S6G A;  2DEA A;  2CIJ A;  2WUU A;  1Y0Y A;  2AFM A;  4KVM E;  4C68 A;  1ARM A;  2Z3P A;  4U9Z A;  4Q36 A;  2V77 A;  2G3A A;  4CGL A;  1OZP A;  3E0K A;  1M4D A;  1VHS A;  2GLF A;  2P6G A;  4PQA A;  6CPA A;  1YVO A;  4NGQ A;  4FWU A;  3NA6 A;  2JDC A;  4UIA A;  4MFL A;  4R57 A;  1VKC A;  1VIX A;  4AG7 A;  2GFQ A;  4UEE A;  4H89 A;  2QYV A;  3LD2 A;  2ARH A;  4B14 A;  4PV6 A;  5DWM A;  1YRE A;  2B4B A;  3SXO A;  2ANP A;  4ORF A;  5KTC A;  1S3Z A;  2WYR A;  4ZY0 A;  2PRQ A;  3TE4 A;  4TNU A;  3JVN A;  1ELL P;  1Y7E A;  3MGD A;  4BBH A;  2ABZ A;  3B3C A;  3RBU A;  2BEI A;  2FL4 A;  5IX3 A;  3FNC A;  4CS0 B;  3SJE A;  3FMC A;  1YME A;  4KOX A;  5F48 A;  4AB7 A;  5HXD A;  4X5K A;  2XEF A;  3S9M A;  1UFH A;  2G3T A;  2WPX A;  4K3N A;  4P10 A;  4PXC A;  2GIV A; 
#chains in the Genus database with same CATH homology
 2Z10 A;  3R96 A;  3EC4 A;  2FE7 A;  4YGO A;  1IID A;  4KVX A;  2OZH A;  3D2P A;  4B13 A;  3PGP A;  3TFY A;  4IUS A;  1S7K A;  2C27 A;  3GYA A;  4KOY A;  3TT2 A;  1V0C A;  3PZJ A;  5HMN A;  4OAE A;  4PSX A;  2ZW7 A;  4I49 A;  3EXN A;  1YR0 A;  4MFZ A;  4KOT A;  1RO5 A;  5JQ4 A;  5DWN A;  1M1D A;  3SHP A;  3R9G A;  1RXT A;  1J4J A;  2PSW A;  5AG5 A;  1KZF A;  4RS2 A;  3C26 A;  1KUY A;  4F6A A;  2R7H A;  4QB9 A;  2QEC A;  1PU9 A;  1S60 A;  4F0X A;  1Z4R A;  4A2Z A;  3W6S A;  2FIA A;  2P0W A;  2GAN A;  3FBU A;  3T9Y A;  4CRZ B;  1NSL A;  4B5O A;  4CRY B;  1I1D A;  1Y9W A;  4CGM A;  5J8F A;  4L89 A;  1S7L A;  4E0A A;  2FSR A;  1BOB A;  2HV2 A;  3IU2 A;  4KUB A;  5GCN A;  2D4P A;  2Z3O A;  1M4G A;  4CAX A;  2VQY A;  2CNT A;  3F0A A;  2P6F A;  2Q4V A;  4KOR A;  5JPH A;  1NMT A;  3FXT A;  3NE7 A;  3TOA A;  3PP9 A;  3S6H A;  1IYK A;  4HNW B;  2J8R A;  3GY9 A;  5KTD A;  3TO7 A;  1XEB A;  4UCN A;  1YX0 A;  5F46 A;  4U5Y A;  1Q2Y A;  5F47 A;  5EC4 A;  1KUV A;  1XF8 A;  3FRM A;  4UA3 A;  1MK4 A;  4OLL A;  3DR8 A;  4MFQ A;  4NXY A;  5AG7 A;  2Q4Y A;  2A4N A;  1R57 A;  4CYO A;  5G22 A;  4II9 A;  4Y49 C;  2J8N A;  4NSQ A;  4ONU A;  4XPD C;  2BL1 A;  1CJW A;  4JWP A;  3JUW A;  4C7H A;  4K30 A;  1Q2C A;  1Y7R A;  4HNY B;  4UFX A;  4HKF A;  3DR6 A;  3ZZI A;  2YNE A;  2Z3M A;  4CGN A;  2EUI A;  4B5P B;  2Q7B A;  3H4Q A;  3WR7 A;  1LRZ A;  5F49 A;  1YVK A;  4ZGY B;  4B10 A;  4E8O A;  3BJ8 A;  1XE4 A;  2B5G B;  3D8P A;  3EO4 A;  2YNC C;  1WWZ A;  1Z9U A;  3TTH A;  1QSO A;  2PR8 A;  4CAE A;  4A30 A;  2OZU A;  1MJB A;  4JD6 A;  4JJX A;  2Q0Y A;  4RI1 A;  3TOB A;  4UCM A;  1QST A;  1IIC A;  2FXF A;  4HNX B;  3EY5 A;  5C88 A;  4H6U A;  2Y0M A;  3R95 A;  1L0C A;  3DSB A;  4QVT A;  2ZW6 A;  4R87 A;  4A31 A;  3JTK A;  4Q38 A;  2DPT A;  1IB1 E;  2NMT A;  4MBU A;  4M3S A;  1QSM A;  2ZPA A;  3QAH A;  1YK3 A;  4KLW A;  4PK2 A;  4AG9 A;  4J3G A;  2VBQ A;  3DNS A;  2RC4 A;  3W91 A;  4F0Y A;  5C82 A;  2JEV A;  3OWC A;  4JXR A;  4QBJ A;  2Z0Z A;  4FD5 A;  2Z3L A;  4KLV A;  2I00 A;  2F5I A;  4KSF A;  4ZBG A;  4A95 A;  2VZY A;  4QC6 A;  2B58 A;  3VWD A;  3KKW A;  2B4D B;  2QML A;  4B5P A;  4FD6 A;  4NEX A;  5FVJ A;  3VWE A;  2VI7 A;  1YLE A;  2CNS A;  5CNP A;  3F8K A;  3RYO A;  4MI4 A;  5A28 A;  1S5K A;  2I79 A;  3TCV A;  2FCK A;  3TO6 A;  2B5G A;  3R9E A;  3F5B A;  4UFW A;  4M85 A;  1S7F A;  5I0C A;  4KVO E;  2FT0 A;  2AJ6 A;  3ZJ0 A;  1QSN A;  3I9S A;  2OU2 A;  4NCZ A;  5IB0 A;  2HUZ A;  3CXS A;  5IV0 A;  2HQY A;  1U6M A;  5J8C A;  4PK3 A;  4KSA A;  4UWJ A;  4R3L A;  2ZW4 A;  4KS9 A;  2JLM A;  3CXQ A;  3SXN A;  4E2A A;  2P6E A;  5AG6 A;  2Z3N A;  4CYQ A;  2IL4 A;  5G1Z A;  5EBV A;  2WPW A;  3BJ7 A;  2CY2 A;  3BLN A;  2BSW A;  4XPK A;  4Y49 B;  1PUA A;  4XPD B;  2KCW A;  2DPS A;  4CAW A;  3DDD A;  1P0H A;  2VZZ A;  5KTA A;  3R1K A;  4KOS A;  2OH1 A;  1NE9 A;  1MJ9 A;  3IWE A;  4LUA A;  4H6Z A;  1I12 A;  4FD7 A;  3R9F A;  1P4N A;  3TO9 A;  3S6F A;  2JDD A;  4CYN A;  3QB8 A;  1TIQ A;  2B4D A;  2OB0 A;  3T90 A;  1BO4 A;  2BUE A;  4CYP A;  1WK4 A;  4R3K A;  5BWA B;  2PR1 A;  2DXQ A;  4CGO A;  4XPL A;  4KOV A;  2ATR A;  4UWI A;  2AE6 A;  5G20 A;  3V8I A;  2CNM A;  1ZO0 A;  2EVN A;  4YFJ A;  4AVC A;  1B6B A;  4C7I A;  2PDO A;  2R8V A;  2X7B A;  2VXK A;  4BMH A;  2Q44 A;  2R1I A;  2OZG A;  4R9M A;  2O28 A;  2B3U A;  1YGH A;  1I21 A;  4GS4 A;  3G8W A;  1Z4E A;  1B87 A;  2K5T A;  3D3S A;  3P2F A;  3P2H A;  4DNC A;  4MFK A;  1MJA A;  1IYL A;  2ZW5 A;  4U9Y A;  4B11 A;  3D2M A;  2B3V A;  4A33 A;  1QSR A;  2R98 A;  4A32 A;  4C2Y A;  1XIX A;  3FIX A;  4OAD A;  3FYN A;  1XMT A;  2YND A;  1GHE A;  2ZXV A;  4NF1 A;  4CAV A;  3W6X A;  2PQ8 A;  4UBR A;  2FS5 A;  5AG4 A;  4B12 A;  4MFJ A;  4UCP A;  1K4J A;  4CAF A;  1FY7 A;  3FB3 A;  2GE3 A;  3G3S A;  4UFV A;  4PSW A;  4MJ8 A;  4FD4 A;  1ON0 A;  4MY0 A;  4MFP A;  1N71 A;  4JLY A;  1S7N A;  4MY3 A;  3H5Z A;  4AVB A;  5HH1 A;  5ISV A;  5H84 A;  2Q04 A;  4MHD A;  3EFA A;  3S6K A;  3CXP A;  4KUA A;  2G0B A;  5AGE A;  4LX9 A;  4C2Z A;  2CXA A;  3A9L A;  2REE A;  4C2X A;  1Q2D A;  3N7Z A;  4AVA A;  2YNC A;  2YGW A;  2WSA A;  5G21 A;  3GKR A;  4L8A A;  1KUX A;  2H5M A;  2QIR A;  1M44 A;  2Z11 A;  2PRB A;  3UY5 A;  2Z3K A;  3LOD A;  4IF5 A;  1CM0 A;  2D4O A;  3I3G A;  1SQH A;  3IU1 A;  5A27 A;  1M4I A;  4KOW A;  5E96 A;  1Y9K A;  4XNH C;  3IGR A;  4YRH A;  2VEZ A;  2PC1 A;  3B8G A;  4KOU A;  2FIW A;  4JXQ A;  4EVY A;  5H86 A;  4CGP A;  2J8M A;  4QUS A;  2REF A;  4KZT A;  3K9U A;  4XNH B;  3IWG A;  3S6G A;  2WUU A;  4KVM E;  4C68 A;  2Z3P A;  4U9Z A;  4Q36 A;  2G3A A;  4CGL A;  1OZP A;  3E0K A;  1M4D A;  1VHS A;  2P6G A;  1YVO A;  2JDC A;  4MFL A;  4R57 A;  1VKC A;  4AG7 A;  4H89 A;  3LD2 A;  2ARH A;  4B14 A;  4PV6 A;  5DWM A;  1YRE A;  2B4B A;  3SXO A;  5KTC A;  4ORF A;  1S3Z A;  3TE4 A;  3JVN A;  3MGD A;  4BBH A;  2BEI A;  2FL4 A;  5IX3 A;  3FNC A;  4CS0 B;  4KOX A;  5F48 A;  4AB7 A;  4X5K A;  1UFH A;  2G3T A;  2WPX A;  2GIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...