3R96A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
total genus 57
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r96A00
3CXQA 3CXSA 4NCZA 1FY7A 3T9YA 3T90A 4X5KA 4PK2A 4HKFA 4XPKA 1QSRA 4FD4A 3TE4A 4KZTA 2BL1A 4FD7A 4CRYB 5KTDA 4L89A 4J3GA 4UWIA 3PGPA 1QSTA 2ZW5A 1YVKA 2PSWA 3EO4A 4KOXA 3S6GA 3TFYA 4H89A 1U6MA 1YLEA 2EUIA 2ZW6A 4JJXA 3R9EA 3R9FA 2FE7A 1Q2CA 1YK3A 2P0WA 1MJBA 3W6XA 2OB0A 1YGHA 4OLLA 3S6KA 3ZZIA 5I0CA 3GKRA 4JLYA 4UWJA 4ONUA 3H4QA 5F48A 2A4NA 2OZUA 1Z9UA 3FB3A 2R98A 4KOYA 2B3VA 2H5MA 2BSWA 3EY5A 4KOWA 2R1IA 1M1DA 3TT2A 2NMTA 3G3SA 2G3AA 3PP9A 1RXTA 1VKCA 1I21A 4AG9A 2VI7A 2X7BA 2D4PA 4XPDB 1XF8A 4OAEA 2FS5A 4UA3A 4U9ZA 3RYOA 3PZJA 4L8AA 3MGDA 3FBUA 2PC1A 2Q4VA 4YRHA 5H86A 1IYKA 1XIXA 2REFA 4BMHA 2ZW7A 4YFJA 2CY2A 2ZPAA 1NSLA 4B5OA 3DSBA 3E0KA 2BUEA 4FD5A 1P0HA 2Z11A 4UBRA 1R57A 3FIXA 4MI4A 2D4OA 3F0AA 2OH1A 3SHPA 4RS2A 2RC4A 2WPWA 3BJ7A 2B3UA 1Z4EA 4JWPA 3DDDA 2C27A 1L0CA 4M3SA 2K5TA 4NF1A 1I12A 2F5IA 5E96A 4QVTA 2QMLA 1GHEA 2HV2A 3I9SA 3TO9A 3BJ8A 5HMNA 3P2HA 2HQYA 5EC4A 1XMTA 4JXQA 1ON0A 2O28A 3N7ZA 4KLVA 5C82A 2PQ8A 1Q2YA 1J4JA 4GS4A 2WPXA 4Y49C 3GYAA 3FRMA 4R57A 3IWGA 2PDOA 1S7FA 3D2PA 4U9YA 3GY9A 4CAVA 2Z0ZA 4AG7A 2Q7BA 2I00A 1WWZA 1M4GA 1XEBA 2CNMA 2PRBA 4Y49B 2J8MA 4CRZB 5IV0A 2FXFA 3JVNA 3D3SA 1KZFA 1TIQA 1P4NA 1S7KA 4AVAA 3TO7A 5C88A 3F8KA 1QSNA 4MJ8A 3CXPA 1N71A 1VHSA 2CNTA 4QC6A 2CNSA 1S7LA 5KTCA 1CJWA 2VQYA 2G3TA 3OWCA 1Y9KA 4KLWA 1YREA 4NEXA 3VWDA 3TTHA 2OZHA 4HNWB 4HNYB 2J8RA 1Y7RA 2DXQA 1Z4RA 5J8CA 1BOBA 4XPLA 4R3LA 1MK4A 3LODA 4LUAA 4KUAA 2FL4A 4YGOA 1PU9A 3TOBA 2JEVA 5H84A 4B5PB 4B5PA 5J8FA 3UY5A 2G0BA 2Q44A 1M4DA 5ISVA 4AVCA 1IYLA 1KUXA 3C26A 4NXYA 1SQHA 3VWEA 5IB0A 2ATRA 2P6FA 1OZPA 3I3GA 5F49A 1IIDA 2R8VA 2JLMA 3IGRA 2JDCA 4KUBA 3R95A 2B58A 3W91A 3LD2A 4E8OA 4KOUA 4DNCA 3SXNA 5F46A 4F0YA 4JXRA 1S60A 1NMTA 5DWNA 1Y9WA 1BO4A 4R3KA 4IF5A 4AVBA 3R9GA 1I1DA 1QSMA 4HNXB 1Q2DA 4QB9A 2J8NA 5CNPA 2FIWA 5HH1A 1QSOA 2B4DB 2IL4A 1RO5A 2B4DA 3FXTA 3F5BA 3R96A 2I79A 2VBQA 3EC4A 4R9MA 2B4BA 4OADA 1MJAA 4U5YA 2KCWA 4NSQA 4M85A 4ZBGA 1YR0A 1WK4A 1KUYA 1IB1E 4KVOE 4LX9A 2ZW4A 3D2MA 1CM0A 2Z10A 1B87A 2JDDA 4MY0A 3DR8A 2Y0MA 3FNCA 3G8WA 3TCVA 3ZJ0A 5IX3A 2P6GA 3SXOA 4MBUA 3TO6A 2FIAA 1S3ZA 4PV6A 4KVXA 3BLNA 4MY3A 1NE9A 4PSWA 1B6BA 2BEIA 2P6EA 3QAHA 3EXNA 4PSXA 5F47A 1M44A 1XE4A 2R7HA 1YVOA 3WR7A 4KOTA 5GCNA 1V0CA 3EFAA 4II9A 3R1KA 3JUWA 4ORFA 3P2FA 2VEZA 2AE6A 4RI1A 5KTAA 3B8GA 5EBVA 4KORA 1MJ9A 2GIVA 3NE7A 4FD6A 4XPDC 2Q0YA 4KOSA 4QBJA 4IUSA 1YX0A 3W6SA 1PUAA 4I49A 4EVYA 1S5KA 4QUSA 2HUZA 2ARHA 2FCKA 2GE3A 3S6HA 2VXKA 4MHDA 5JPHA 2GANA 4R87A 4XNHC 2OZGA 4PK3A 1LRZA 2Q4YA 3S6FA 4E0AA 1S7NA 1KUVA 2PR1A 2AJ6A 1M4IA 3FYNA 4F6AA 3KKWA 3D8PA 2VZZA 4XNHB 2QECA 2ZXVA 2FT0A 2REEA 1UFHA 4AB7A 2Q04A 1K4JA 2B5GB 3QB8A 4JD6A 2B5GA 5JQ4A 4CS0B 2EVNA 3K9UA 1IICA 4E2AA 2PR8A 5DWMA 3V8IA 2QIRA 3DNSA 4H6ZA 2OU2A 4CAXA 4KOVA 4KVME 2FSRA 5FVJA 4CAWA 3DR6A 4K30A 3TOAA 4H6UA 2VZYA
chains in the Genus database with same CATH superfamily
3CXQA 2JBJA 3CXSA 3A9LA 4NCZA 4NGRA 1ELMP 1CP6A 1FY7A 2QJ8A 3T9YA 1LANA 3GUXA 4A94A 2WUUA 3IU1A 4X5KA 3I1UA 1AMPA 3T90A 4CGLA 1RTQA 4PK2A 3D67A 4ZGYB 1XOVA 4HKFA 4XPKA 1QSRA 4FD4A 3TE4A 3FF3A 2YNCA 4UIBA 4A38A 4KZTA 1ZLHA 2BL1A 4FD7A 4A31A 4BBHA 4CRYB 2PIYA 5KTDA 4L89A 4J3GA 4UWIA 3KHXA 4CGMA 3PGPA 1QSTA 2ZW5A 4YWYA 3S9NA 1YVKA 2PSWA 2V8HA 3NH5A 4UFXA 3EO4A 5LYLA 1Q7LA 4KOXA 3S6GA 1Z8TA 3TFYA 1QMUA 4BINA 4HPSA 1ZG7A 2YNDA 4H89A 2RB7A 2RFHA 2EK8A 1U6MA 1YLEA 2EUIA 2ZW6A 4JJXA 3R9EA 5CPAA 4C7HA 2WZNA 2ZEOA 3R9FA 1CPSA 1CPXA 1Z2LA 2NYQA 2FE7A 1Q2CA 4PXEA 2Q7SA 1YK3A 2P0WA 1MJBA 4A95A 3H8FA 5LRJA 2F8HA 1Z8XA 4C2YA 1ARLA 3CZXA 4P4JA 4MCSA 2PIZA 3W6XA 2OB0A 3H5ZA 3IFEA 3ISZA 1Z5RA 1YGHA 2PJ0A 4OLLA 3S6KA 3ZZIA 5I0CA 4CYQA 3GKRA 4JLYA 4UWJA 2EWBA 1CG2A 4ONUA 4OC3A 3H4QA 3TX8A 8CPAA 1YSJA 5F48A 2A4NA 2OZUA 3SI0A 1Z9UA 2ZEMA 3FB3A 2AFUA 4MHZA 4UFVA 5EMIA 2R98A 3B2YA 2B3VA 4KOYA 4UEFA 3D7FA 2H5MA 4ZX9A 2BSWA 4RUHA 1IY7A 2AFXA 4H2KA 3CDXA 4PXCA 3RAMA 3EY5A 3CPAA 1IOIA 3MRUA 2AFSA 2C6PA 4KOWA 2R1IA 1M1DA 3TT2A 2NMTA 2PCUA 4MFJA 1BPMA 3B3WA 3G3SA 2G3AA 2JEWA 3PP9A 4P4EA 3BI1A 3RO0A 1RXTA 1VKCA 1I21A 2XEFA 4X3RA 4AG9A 2VI7A 1VGYA 1F57A 2X7BA 2D4PA 2XEGA 4KSFA 4XPDB 1XF8A 4OAEA 2FS5A 4OC1A 4UA3A 2ABZA 4NGMA 4U9ZA 3RYOA 3PZJA 1EE3P 3KQXA 1PCAA 3FBUA 3K2KA 3MGDA 4L8AA 2BOAA 4P44A 2PC1A 2Q4VA 2ZEDA 4YRHA 5H86A 1IYKA 1XIXA 2REFA 3FVLA 2J9AA 2ZW7A 3LMSA 4BMHA 5AG4A 4YFJA 2CY2A 2PJ3A 5LYIA 3NA6A 2ZPAA 4KS9A 1NSLA 5G1ZA 4B5OA 3DSBA 3E0KA 5HVHA 4CGPA 2BUEA 1XFOA 4MHYA 3FECA 4FD5A 3IEHA 1P0HA 2Z11A 5ELYA 4CPAA 4UBRA 3B35A 4Q7AA 1R57A 3FIXA 5K8NA 4P4DA 5G20A 4MI4A 1XBUA 3JTKA 2D4OA 3F0AA 2OH1A 1LAMA 4PXBA 3SHPA 4G1PA 4RS2A 2RC4A 5THWA 2WPWA 3BJ7A 4CYPA 1CX8A 2B3UA 1Z4EA 3KR4A 4ZY1A 3T8WA 4JWPA 2C6GA 3DDDA 2ZEPA 1Y7EA 2C27A 3PB7X 1L0CA 4ZYQA 4CGOA 4M3SA 2K5TA 1XJOA 1TKJA 1I12A 4NF1A 4F0XA 3IO1A 2F5IA 5E96A 4MFPA 1ZLIA 4UFWA 4QVTA 2QMLA 1GHEA 2DEAA 3FX6A 2IMOA 5JM6A 4Q38A 3B3TA 1R43A 2C1CA 2HV2A 3I9SA 1R3NA 3PRTA 3TO9A 2GREA 2Q51A 3BJ8A 4LQ6A 4BD9A 4P10A 5F09A 5HMNA 2Z3OA 3KI9A 3P2HA 2HQYA 5EC4A 1XMTA 3KR5A 4JXQA 2Z3LA 3BHXA 3SI1A 3VH9A 2QVPA 1ON0A 2Q43A 4WJBA 2O28A 3N7ZA 3PBEA 3GB0A 2PQ8A 4KLVA 1Q2YA 5C82A 1J4JA 4GS4A 1LAPA 2WPXA 4Y49C 2I3CA 3GYAA 3FRMA 4R57A 3IWGA 2PDOA 5LYFA 4OP4A 1S7FA 3D2PA 3IIBA 4U9YA 3GY9A 4CAVA 1ARMA 3JRUA 2Z0ZA 5D29A 4IAVA 2Q7BA 4AG7A 2I00A 2CIJA 1HDQA 1WWZA 1YQEA 1M4GA 3PB8X 1XEBA 3FMCA 2CNMA 2PRBA 2BCOA 4Y49B 2J8MA 4CRZB 5IV0A 3KL9A 3WABA 2PJ2A 4A33A 3FH4A 1BLLE 3HUVA 3K9TA 4X2TA 2FXFA 3KGQA 3JVNA 5DS0A 3SJGA 3D3SA 4UCPA 2C6CA 1KZFA 2OOTA 1TIQA 4MMOA 1P4NA 2GLFA 1LOKA 1IGBA 1S7KA 2ZEEA 3DGVA 4MRIA 4AVAA 3RNZA 3D7HA 4TNUA 1TKFA 4MCPA 3TO7A 5C88A 4M6HA 1QQ9A 3F8KA 2PJ1A 4OKOA 4UEZA 5AGEA 5A28A 1QSNA 4C2ZA 4MJ8A 4OMEA 2ZEFA 3CXPA 1N71A 1VHSA 2PVVA 2CNTA 2WSAA 4QC6A 2CNSA 1S7LA 4MHNA 5KTCA 1CJWA 2VQYA 1ZG8A 2G3TA 3OWCA 1Y9KA 3IWWA 3GLJA 3H8GA 1TF9A 4KLWA 1YREA 4NEXA 1IOFA 3VWDA 1F2OA 4UCNA 2IQ6A 3WC6A 3TTHA 4A2ZA 2OZHA 2AFZA 3ISXA 1XMBA 4HNWB 2DF5A 2J8RA 1Y7RA 2WYRA 4HNYB 2DXQA 4C2XA 1Z4RA 1HEEA 3LACA 3D68A 1BOBA 4XPLA 2JBKA 5J8CA 2CTBA 4R8FA 4R3LA 5J1QA 1MK4A 4MFQA 3PFEA 3LODA 4B12A 1GYTA 4LUAA 2AFOA 4KUAA 3D7DA 4P4IA 1BPNA 2FL4A 1Z8LA 4O23A 4YGOA 1PU9A 3TOBA 2JEVA 5H84A 4B5PB 1TXRA 2V8VA 3B3CA 2HC9A 4B5PA 5J8FA 4PPZA 5A27A 3UY5A 2G0BA 2Q44A 4GXHA 1X10A 3IWEA 3LWUA 1M4DA 5ISVA 3KHZA 4AVCA 4EMEA 2PJ8A 3V7ZA 1IYLA 1KUXA 3C26A 3B3SA 4NXYA 2YGWA 1Z8WA 1SQHA 3VWEA 1VHEA 2ATRA 4FAIA 5IB0A 4EWTA 2P6FA 5AG5A 4FBEA 1OZPA 4P45A 3I3GA 3D7GA 1OBRA 5LYDA 2XEIA 2ZENA 5F49A 1IIDA 4Z65A 3DLJA 2R8VA 4WWVA 5AG6A 2JLMA 3IGRA 2NSMA 4MFKA 2ANPA 2JDCA 4KUBA 4Q36A 3R95A 3TC8A 2Z3KA 1ELLP 1XRYA 1NSAA 2V8DA 4P4FA 2B58A 3W91A 3LD2A 4E8OA 1Y0YA 2OR4A 4KOUA 4DNCA 2PJ7A 4YU9A 3D66A 3SXNA 5F46A 3FJUA 3N5FA 4F0YA 4AXVA 2EO8A 3FEEA 4JXRA 2DPSA 2ZOFA 4A30A 1S60A 1NMTA 3RZAA 3PFOA 1VIXA 3GIUA 1Y9WA 5AG7A 1YMEA 2XEJA 5DWNA 3SJXA 4ONWA 1BO4A 4B11A 4CYNA 1JWQA 4A37A 4R3KA 4IF5A 4AVBA 3R9GA 5IB9A 4C68A 4B10A 1I1DA 1CP7A 1QSMA 1Q2DA 1YW6A 1M4LA 4HNXB 3V38A 4X8IA 3VATA 4QB9A 4R7MA 5K8OA 2PJ9A 4OC5A 1IU8A 3D4UA 4UCMA 3WC7A 2J8NA 4NGQA 2DPTA 1X12A 5CNPA 2GLJA 2FIWA 4LQGA 4MHPA 1QSOA 4NGNA 4OC2A 5HH1A 4F8ZA 2B4DB 5I4MA 2IL4A 5LRGA 1RO5A 3IJ3A 2B4DA 3FXTA 3F5BA 3R96A 4M6IA 2I79A 4NGPA 1H8LA 2CF4A 2VBQA 1A2ZA 4MXUA 5K8PA 1FNOA 4W9YA 3BXMA 1ZO0A 3EC4A 5LRKA 1YLOA 2G9DA 2POKA 2YNCC 4R9MA 2B4BA 4OADA 1MJAA 4U5YA 4A32A 4DYOA 2EK9A 5HVGA 4OIWA 4ZX8A 2KCWA 1ZG9A 4NSQA 4M85A 4ZBGA 4UEEA 2ZEHA 1DTDA 1YR0A 4KSAA 2PJCA 3VARA 4NJQA 1WK4A 1KUYA 1IB1E 4KVOE 3PB6X 4B14A 4UF4A 3PEIA 4IK2A 4OC0A 4LX9A 1PYTB 4P6YA 2ZW4A 3D2MA 1Y0RA 3BI0A 3RBUA 1CM0A 2Z10A 2ZEGA 4B13A 3SJFA 3S9LA 1B87A 2Q4ZA 2HB6A 2JDDA 1JQGA 3KZWA 4GM5A 4M6GA 3L2NA 5HXDA 4MY0A 2O53A 3DR8A 2Y0MA 3FNCA 3G8WA 1F2PA 3TCVA 3ZJ0A 5IX3A 2P6GA 3SXOA 4MBUA 3TO6A 2FIAA 3NE8A 1S3ZA 3B7IA 4OC4A 4PV6A 3QAYA 3IU2A 4KVXA 3BLNA 3CPXA 1NE9A 4MY3A 4B6ZA 5G22A 4MCRA 4PSWA 1B6BA 4DUKA 4DJLA 2V8GA 3QNVA 2BEIA 2P6EA 3EXNA 3PBBA 3QAHA 4PSXA 5F47A 1M44A 1XE4A 2R7HA 1YVOA 5HVFA 3H8EA 4JZ0A 3WR7A 3NFZA 4KOTA 5GCNA 4FUUA 1V0CA 3EFAA 4II9A 3R1KA 5CBMA 2PJ5A 3JUWA 4ORFA 3P2FA 2VEZA 2AE6A 2AFMA 2IJZA 3IC1A 4RI1A 1YW4A 5KTAA 3B8GA 5EBVA 4KORA 1MJ9A 2GU2A 5D8NA 2GIVA 3SI2A 2ZELA 4CAEA 4PQAA 3NH4A 4ZI6A 2PJ4A 2GFQA 3NE7A 4FD6A 4XPDC 4IHMA 2Q0YA 4KOSA 4PXDA 4QBJA 2AFWA 1TKHA 2F7VA 3PB9X 4K3NA 4NGSA 4IUSA 1YX0A 5G21A 5JGFA 4P4BA 3W6SA 1PUAA 2VL1A 4I49A 4EVYA 1CBXA 4RN7A 4R6TA 1S5KA 4QUSA 2HUZA 2ARHA 2FCKA 2GE3A 2ODFA 3S6HA 2VXKA 4MHDA 2BO9A 4MFZA 5JPHA 1LFWA 2GANA 4R87A 4ZY2A 2PRQA 3WT4A 3KASA 4UIAA 4XNHC 2QYVA 2OZGA 2CTCA 3SJEA 3KQZA 4PK3A 1LRZA 1AUGA 4F9UA 2Q4YA 3S6FA 2Z3MA 1DE4C 1S7NA 1FT7A 2Z3PA 4CYOA 4E0AA 4C7IA 1KUVA 4NJRA 1UWYA 4NFRA 2PR1A 2AJ6A 1M4IA 3FYNA 2O4HA 4NGTA 3WC5A 3MN8A 4A39A 1TF8A 4F6AA 3KKWA 3D8PA 2VZZA 3S9MA 4ZY0A 4XNHB 3CT9A 2QECA 2ZXVA 4MCQA 2V77A 4R76A 1VHOA 2PJAA 4OIDA 4CAFA 2FT0A 2REEA 1UFHA 3PB4X 4AB7A 2Q04A 1K4JA 2B5GB 3QB8A 1KWMA 4JD6A 4KSIA 1HDUA 2B5GA 3HLPA 4EFDA 4CS0B 5JQ4A 4CGNA 2Z3NA 1AYEA 2FVGA 2EVNA 2PVWA 3K9UA 7CPAA 1IICA 3B3VA 2PJ6A 2EBJA 4E2AA 2PR8A 6CPAA 5DWMA 3FEDA 3V8IA 5JH9A 2QIRA 3DNSA 4H6ZA 2PJBA 5BWAB 2OU2A 2PE3A 4CAXA 4KOVA 4TWEA 1LCPA 4KVME 2CXAA 4F9VA 4MFLA 3NH8A 2FSRA 2ZOGA 4FWUA 5FVJA 4JYWA 4CAWA 2YNEA 3DR6A 5K8MA 4K30A 1BAVA 3TOAA 4H6UA 2VZYA
chains in the Genus database with same CATH topology
3CXQA 3CXSA 3A9LA 4NCZA 1FY7A 3T9YA 2WUUA 3IU1A 4X5KA 3T90A 4CGLA 4PK2A 4ZGYB 4HKFA 4XPKA 1QSRA 4FD4A 3TE4A 2YNCA 4KZTA 2BL1A 4FD7A 4A31A 4BBHA 4CRYB 5KTDA 4L89A 4J3GA 4UWIA 4CGMA 3PGPA 1QSTA 2ZW5A 1YVKA 2PSWA 4UFXA 3EO4A 4KOXA 3S6GA 3TFYA 2YNDA 4H89A 1U6MA 1YLEA 2EUIA 2ZW6A 4JJXA 3R9EA 4C7HA 3R9FA 2FE7A 1Q2CA 1YK3A 2P0WA 1MJBA 4A95A 4C2YA 3W6XA 2OB0A 3H5ZA 1YGHA 4OLLA 3S6KA 3ZZIA 5I0CA 4CYQA 3GKRA 4JLYA 4UWJA 4ONUA 3H4QA 5F48A 2A4NA 2OZUA 1Z9UA 3FB3A 4UFVA 2R98A 4KOYA 2B3VA 2H5MA 2BSWA 3EY5A 4KOWA 2R1IA 1M1DA 3TT2A 2NMTA 4MFJA 3G3SA 2G3AA 3PP9A 1RXTA 1VKCA 1I21A 4AG9A 2VI7A 2X7BA 2D4PA 4KSFA 4XPDB 1XF8A 4OAEA 2FS5A 4UA3A 4U9ZA 3RYOA 3PZJA 4L8AA 3MGDA 3FBUA 2PC1A 2Q4VA 4YRHA 5H86A 1IYKA 1XIXA 2REFA 4BMHA 2ZW7A 5AG4A 4YFJA 2CY2A 2ZPAA 4KS9A 1NSLA 5G1ZA 4B5OA 3DSBA 3E0KA 4CGPA 2BUEA 4FD5A 1P0HA 2Z11A 4UBRA 1R57A 3FIXA 5G20A 4MI4A 3JTKA 2D4OA 3F0AA 2OH1A 3SHPA 4RS2A 2RC4A 4CYPA 2WPWA 3BJ7A 2B3UA 1Z4EA 4JWPA 3DDDA 2C27A 1L0CA 4CGOA 4M3SA 2K5TA 4NF1A 1I12A 4F0XA 2F5IA 5E96A 4MFPA 4UFWA 4QVTA 2QMLA 1GHEA 4Q38A 2HV2A 3I9SA 3TO9A 3BJ8A 5HMNA 2Z3OA 3P2HA 2HQYA 5EC4A 1XMTA 4JXQA 2Z3LA 1ON0A 2O28A 3N7ZA 4KLVA 5C82A 2PQ8A 1Q2YA 1J4JA 4GS4A 2WPXA 4Y49C 3GYAA 3FRMA 4R57A 3IWGA 2PDOA 1S7FA 3D2PA 4U9YA 3GY9A 4CAVA 2Z0ZA 4AG7A 2Q7BA 2I00A 1WWZA 1M4GA 1XEBA 2CNMA 2PRBA 4Y49B 2J8MA 4CRZB 5IV0A 4A33A 2FXFA 3JVNA 3D3SA 4UCPA 1KZFA 1TIQA 1P4NA 1S7KA 4AVAA 3TO7A 5C88A 3F8KA 5AGEA 5A28A 1QSNA 4C2ZA 4MJ8A 3CXPA 1N71A 1VHSA 2CNTA 2WSAA 4QC6A 2CNSA 1S7LA 5KTCA 1CJWA 2VQYA 2G3TA 3OWCA 1Y9KA 4KLWA 1YREA 4NEXA 3VWDA 4UCNA 3TTHA 4A2ZA 2OZHA 4HNWB 4HNYB 2J8RA 1Y7RA 2DXQA 4C2XA 1Z4RA 5J8CA 1BOBA 4XPLA 4R3LA 1MK4A 4MFQA 3LODA 4B12A 4LUAA 4KUAA 2FL4A 4YGOA 1PU9A 3TOBA 2JEVA 5H84A 4B5PB 4B5PA 5J8FA 5A27A 3UY5A 2G0BA 2Q44A 3IWEA 1M4DA 5ISVA 4AVCA 1IYLA 1KUXA 3C26A 4NXYA 2YGWA 1SQHA 3VWEA 5IB0A 2ATRA 2P6FA 5AG5A 1OZPA 3I3GA 5F49A 1IIDA 2R8VA 5AG6A 2JLMA 3IGRA 4MFKA 2JDCA 4KUBA 4Q36A 3R95A 2Z3KA 2B58A 3W91A 3LD2A 4E8OA 4KOUA 4DNCA 3SXNA 5F46A 4F0YA 4JXRA 2DPSA 4A30A 1S60A 1NMTA 5AG7A 5DWNA 1Y9WA 1BO4A 4B11A 4CYNA 4R3KA 4IF5A 4AVBA 3R9GA 4C68A 4B10A 1I1DA 1QSMA 4HNXB 1Q2DA 4QB9A 4UCMA 2J8NA 2DPTA 5CNPA 2FIWA 5HH1A 1QSOA 2B4DB 2IL4A 1RO5A 2B4DA 3FXTA 3F5BA 3R96A 2I79A 2VBQA 1ZO0A 3EC4A 2YNCC 4R9MA 2B4BA 4OADA 1MJAA 4U5YA 4A32A 2KCWA 4NSQA 4M85A 4ZBGA 1YR0A 4KSAA 1WK4A 1KUYA 1IB1E 4KVOE 4B14A 4LX9A 2ZW4A 3D2MA 1CM0A 2Z10A 4B13A 1B87A 2JDDA 4MY0A 3DR8A 2Y0MA 3FNCA 3G8WA 3TCVA 3ZJ0A 5IX3A 2P6GA 3SXOA 4MBUA 3TO6A 2FIAA 1S3ZA 4PV6A 3IU2A 4KVXA 3BLNA 4MY3A 1NE9A 5G22A 4PSWA 1B6BA 2BEIA 2P6EA 3QAHA 3EXNA 4PSXA 5F47A 1M44A 1XE4A 2R7HA 1YVOA 3WR7A 4KOTA 5GCNA 1V0CA 3EFAA 4II9A 3R1KA 3JUWA 4ORFA 3P2FA 2VEZA 2AE6A 4RI1A 5KTAA 3B8GA 5EBVA 4KORA 1MJ9A 2GIVA 4CAEA 3NE7A 4FD6A 4XPDC 2Q0YA 4KOSA 4QBJA 4IUSA 1YX0A 5G21A 3W6SA 1PUAA 4I49A 4EVYA 1S5KA 4QUSA 2HUZA 2ARHA 2FCKA 2GE3A 3S6HA 2VXKA 4MHDA 4MFZA 5JPHA 2GANA 4R87A 4XNHC 2OZGA 4PK3A 1LRZA 2Q4YA 3S6FA 2Z3MA 4E0AA 1S7NA 2Z3PA 4CYOA 4C7IA 1KUVA 2PR1A 2AJ6A 1M4IA 3FYNA 4F6AA 3KKWA 3D8PA 2VZZA 4XNHB 2QECA 2ZXVA 4CAFA 2FT0A 2REEA 1UFHA 4AB7A 2Q04A 1K4JA 2B5GB 3QB8A 4JD6A 2B5GA 5JQ4A 4CS0B 4CGNA 2Z3NA 2EVNA 3K9UA 1IICA 4E2AA 2PR8A 5DWMA 3V8IA 2QIRA 3DNSA 4H6ZA 5BWAB 2OU2A 4CAXA 4KOVA 4KVME 2CXAA 4MFLA 2FSRA 5FVJA 4CAWA 2YNEA 3DR6A 4K30A 3TOAA 4H6UA 2VZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXQ A;  3CXS A;  4NCZ A;  1FY7 A;  3T9Y A;  3T90 A;  4X5K A;  4PK2 A;  4HKF A;  4XPK A;  1QSR A;  4FD4 A;  3TE4 A;  4KZT A;  2BL1 A;  4FD7 A;  4CRY B;  5KTD A;  4L89 A;  4J3G A;  4UWI A;  3PGP A;  1QST A;  2ZW5 A;  1YVK A;  2PSW A;  3EO4 A;  4KOX A;  3S6G A;  3TFY A;  4H89 A;  1U6M A;  1YLE A;  2EUI A;  2ZW6 A;  4JJX A;  3R9E A;  3R9F A;  2FE7 A;  1Q2C A;  1YK3 A;  2P0W A;  1MJB A;  3W6X A;  2OB0 A;  1YGH A;  4OLL A;  3S6K A;  3ZZI A;  5I0C A;  3GKR A;  4JLY A;  4UWJ A;  4ONU A;  3H4Q A;  5F48 A;  2A4N A;  2OZU A;  1Z9U A;  3FB3 A;  2R98 A;  4KOY A;  2B3V A;  2H5M A;  2BSW A;  3EY5 A;  4KOW A;  2R1I A;  1M1D A;  3TT2 A;  2NMT A;  3G3S A;  2G3A A;  3PP9 A;  1RXT A;  1VKC A;  1I21 A;  4AG9 A;  2VI7 A;  2X7B A;  2D4P A;  4XPD B;  1XF8 A;  4OAE A;  2FS5 A;  4UA3 A;  4U9Z A;  3RYO A;  3PZJ A;  4L8A A;  3MGD A;  3FBU A;  2PC1 A;  2Q4V A;  4YRH A;  5H86 A;  1IYK A;  1XIX A;  2REF A;  4BMH A;  2ZW7 A;  4YFJ A;  2CY2 A;  2ZPA A;  1NSL A;  4B5O A;  3DSB A;  3E0K A;  2BUE A;  4FD5 A;  1P0H A;  2Z11 A;  4UBR A;  1R57 A;  3FIX A;  4MI4 A;  2D4O A;  3F0A A;  2OH1 A;  3SHP A;  4RS2 A;  2RC4 A;  2WPW A;  3BJ7 A;  2B3U A;  1Z4E A;  4JWP A;  3DDD A;  2C27 A;  1L0C A;  4M3S A;  2K5T A;  4NF1 A;  1I12 A;  2F5I A;  5E96 A;  4QVT A;  2QML A;  1GHE A;  2HV2 A;  3I9S A;  3TO9 A;  3BJ8 A;  5HMN A;  3P2H A;  2HQY A;  5EC4 A;  1XMT A;  4JXQ A;  1ON0 A;  2O28 A;  3N7Z A;  4KLV A;  5C82 A;  2PQ8 A;  1Q2Y A;  1J4J A;  4GS4 A;  2WPX A;  4Y49 C;  3GYA A;  3FRM A;  4R57 A;  3IWG A;  2PDO A;  1S7F A;  3D2P A;  4U9Y A;  3GY9 A;  4CAV A;  2Z0Z A;  4AG7 A;  2Q7B A;  2I00 A;  1WWZ A;  1M4G A;  1XEB A;  2CNM A;  2PRB A;  4Y49 B;  2J8M A;  4CRZ B;  5IV0 A;  2FXF A;  3JVN A;  3D3S A;  1KZF A;  1TIQ A;  1P4N A;  1S7K A;  4AVA A;  3TO7 A;  5C88 A;  3F8K A;  1QSN A;  4MJ8 A;  3CXP A;  1N71 A;  1VHS A;  2CNT A;  4QC6 A;  2CNS A;  1S7L A;  5KTC A;  1CJW A;  2VQY A;  2G3T A;  3OWC A;  1Y9K A;  4KLW A;  1YRE A;  4NEX A;  3VWD A;  3TTH A;  2OZH A;  4HNW B;  4HNY B;  2J8R A;  1Y7R A;  2DXQ A;  1Z4R A;  5J8C A;  1BOB A;  4XPL A;  4R3L A;  1MK4 A;  3LOD A;  4LUA A;  4KUA A;  2FL4 A;  4YGO A;  1PU9 A;  3TOB A;  2JEV A;  5H84 A;  4B5P B;  4B5P A;  5J8F A;  3UY5 A;  2G0B A;  2Q44 A;  1M4D A;  5ISV A;  4AVC A;  1IYL A;  1KUX A;  3C26 A;  4NXY A;  1SQH A;  3VWE A;  5IB0 A;  2ATR A;  2P6F A;  1OZP A;  3I3G A;  5F49 A;  1IID A;  2R8V A;  2JLM A;  3IGR A;  2JDC A;  4KUB A;  3R95 A;  2B58 A;  3W91 A;  3LD2 A;  4E8O A;  4KOU A;  4DNC A;  3SXN A;  5F46 A;  4F0Y A;  4JXR A;  1S60 A;  1NMT A;  5DWN A;  1Y9W A;  1BO4 A;  4R3K A;  4IF5 A;  4AVB A;  3R9G A;  1I1D A;  1QSM A;  4HNX B;  1Q2D A;  4QB9 A;  2J8N A;  5CNP A;  2FIW A;  5HH1 A;  1QSO A;  2B4D B;  2IL4 A;  1RO5 A;  2B4D A;  3FXT A;  3F5B A;  3R96 A;  2I79 A;  2VBQ A;  3EC4 A;  4R9M A;  2B4B A;  4OAD A;  1MJA A;  4U5Y A;  2KCW A;  4NSQ A;  4M85 A;  4ZBG A;  1YR0 A;  1WK4 A;  1KUY A;  1IB1 E;  4KVO E;  4LX9 A;  2ZW4 A;  3D2M A;  1CM0 A;  2Z10 A;  1B87 A;  2JDD A;  4MY0 A;  3DR8 A;  2Y0M A;  3FNC A;  3G8W A;  3TCV A;  3ZJ0 A;  5IX3 A;  2P6G A;  3SXO A;  4MBU A;  3TO6 A;  2FIA A;  1S3Z A;  4PV6 A;  4KVX A;  3BLN A;  4MY3 A;  1NE9 A;  4PSW A;  1B6B A;  2BEI A;  2P6E A;  3QAH A;  3EXN A;  4PSX A;  5F47 A;  1M44 A;  1XE4 A;  2R7H A;  1YVO A;  3WR7 A;  4KOT A;  5GCN A;  1V0C A;  3EFA A;  4II9 A;  3R1K A;  3JUW A;  4ORF A;  3P2F A;  2VEZ A;  2AE6 A;  4RI1 A;  5KTA A;  3B8G A;  5EBV A;  4KOR A;  1MJ9 A;  2GIV A;  3NE7 A;  4FD6 A;  4XPD C;  2Q0Y A;  4KOS A;  4QBJ A;  4IUS A;  1YX0 A;  3W6S A;  1PUA A;  4I49 A;  4EVY A;  1S5K A;  4QUS A;  2HUZ A;  2ARH A;  2FCK A;  2GE3 A;  3S6H A;  2VXK A;  4MHD A;  5JPH A;  2GAN A;  4R87 A;  4XNH C;  2OZG A;  4PK3 A;  1LRZ A;  2Q4Y A;  3S6F A;  4E0A A;  1S7N A;  1KUV A;  2PR1 A;  2AJ6 A;  1M4I A;  3FYN A;  4F6A A;  3KKW A;  3D8P A;  2VZZ A;  4XNH B;  2QEC A;  2ZXV A;  2FT0 A;  2REE A;  1UFH A;  4AB7 A;  2Q04 A;  1K4J A;  2B5G B;  3QB8 A;  4JD6 A;  2B5G A;  5JQ4 A;  4CS0 B;  2EVN A;  3K9U A;  1IIC A;  4E2A A;  2PR8 A;  5DWM A;  3V8I A;  2QIR A;  3DNS A;  4H6Z A;  2OU2 A;  4CAX A;  4KOV A;  4KVM E;  2FSR A;  5FVJ A;  4CAW A;  3DR6 A;  4K30 A;  3TOA A;  4H6U A;  2VZY A; 
#chains in the Genus database with same CATH topology
 3CXQ A;  2JBJ A;  3CXS A;  3A9L A;  4NCZ A;  4NGR A;  1ELM P;  1CP6 A;  1FY7 A;  2QJ8 A;  3T9Y A;  1LAN A;  3GUX A;  4A94 A;  2WUU A;  3IU1 A;  4X5K A;  3I1U A;  1AMP A;  3T90 A;  4CGL A;  1RTQ A;  4PK2 A;  3D67 A;  4ZGY B;  1XOV A;  4HKF A;  4XPK A;  1QSR A;  4FD4 A;  3TE4 A;  3FF3 A;  2YNC A;  4UIB A;  4A38 A;  4KZT A;  1ZLH A;  2BL1 A;  4FD7 A;  4A31 A;  4BBH A;  4CRY B;  2PIY A;  5KTD A;  4L89 A;  4J3G A;  4UWI A;  3KHX A;  4CGM A;  3PGP A;  1QST A;  2ZW5 A;  4YWY A;  3S9N A;  1YVK A;  2PSW A;  2V8H A;  3NH5 A;  4UFX A;  3EO4 A;  5LYL A;  1Q7L A;  4KOX A;  3S6G A;  1Z8T A;  3TFY A;  1QMU A;  4BIN A;  4HPS A;  1ZG7 A;  2YND A;  4H89 A;  2RB7 A;  2RFH A;  2EK8 A;  1U6M A;  1YLE A;  2EUI A;  2ZW6 A;  4JJX A;  3R9E A;  5CPA A;  4C7H A;  2WZN A;  2ZEO A;  3R9F A;  1CPS A;  1CPX A;  1Z2L A;  2NYQ A;  2FE7 A;  1Q2C A;  4PXE A;  2Q7S A;  1YK3 A;  2P0W A;  1MJB A;  4A95 A;  3H8F A;  5LRJ A;  2F8H A;  1Z8X A;  4C2Y A;  1ARL A;  3CZX A;  4P4J A;  4MCS A;  2PIZ A;  3W6X A;  2OB0 A;  3H5Z A;  3IFE A;  3ISZ A;  1Z5R A;  1YGH A;  2PJ0 A;  4OLL A;  3S6K A;  3ZZI A;  5I0C A;  4CYQ A;  3GKR A;  4JLY A;  4UWJ A;  2EWB A;  1CG2 A;  4ONU A;  4OC3 A;  3H4Q A;  3TX8 A;  8CPA A;  1YSJ A;  5F48 A;  2A4N A;  2OZU A;  3SI0 A;  1Z9U A;  2ZEM A;  3FB3 A;  2AFU A;  4MHZ A;  4UFV A;  5EMI A;  2R98 A;  3B2Y A;  2B3V A;  4KOY A;  4UEF A;  3D7F A;  2H5M A;  4ZX9 A;  2BSW A;  4RUH A;  1IY7 A;  2AFX A;  4H2K A;  3CDX A;  4PXC A;  3RAM A;  3EY5 A;  3CPA A;  1IOI A;  3MRU A;  2AFS A;  2C6P A;  4KOW A;  2R1I A;  1M1D A;  3TT2 A;  2NMT A;  2PCU A;  4MFJ A;  1BPM A;  3B3W A;  3G3S A;  2G3A A;  2JEW A;  3PP9 A;  4P4E A;  3BI1 A;  3RO0 A;  1RXT A;  1VKC A;  1I21 A;  2XEF A;  4X3R A;  4AG9 A;  2VI7 A;  1VGY A;  1F57 A;  2X7B A;  2D4P A;  2XEG A;  4KSF A;  4XPD B;  1XF8 A;  4OAE A;  2FS5 A;  4OC1 A;  4UA3 A;  2ABZ A;  4NGM A;  4U9Z A;  3RYO A;  3PZJ A;  1EE3 P;  3KQX A;  1PCA A;  3FBU A;  3K2K A;  3MGD A;  4L8A A;  2BOA A;  4P44 A;  2PC1 A;  2Q4V A;  2ZED A;  4YRH A;  5H86 A;  1IYK A;  1XIX A;  2REF A;  3FVL A;  2J9A A;  2ZW7 A;  3LMS A;  4BMH A;  5AG4 A;  4YFJ A;  2CY2 A;  2PJ3 A;  5LYI A;  3NA6 A;  2ZPA A;  4KS9 A;  1NSL A;  5G1Z A;  4B5O A;  3DSB A;  3E0K A;  5HVH A;  4CGP A;  2BUE A;  1XFO A;  4MHY A;  3FEC A;  4FD5 A;  3IEH A;  1P0H A;  2Z11 A;  5ELY A;  4CPA A;  4UBR A;  3B35 A;  4Q7A A;  1R57 A;  3FIX A;  5K8N A;  4P4D A;  5G20 A;  4MI4 A;  1XBU A;  3JTK A;  2D4O A;  3F0A A;  2OH1 A;  1LAM A;  4PXB A;  3SHP A;  4G1P A;  4RS2 A;  2RC4 A;  5THW A;  2WPW A;  3BJ7 A;  4CYP A;  1CX8 A;  2B3U A;  1Z4E A;  3KR4 A;  4ZY1 A;  3T8W A;  4JWP A;  2C6G A;  3DDD A;  2ZEP A;  1Y7E A;  2C27 A;  3PB7 X;  1L0C A;  4ZYQ A;  4CGO A;  4M3S A;  2K5T A;  1XJO A;  1TKJ A;  1I12 A;  4NF1 A;  4F0X A;  3IO1 A;  2F5I A;  5E96 A;  4MFP A;  1ZLI A;  4UFW A;  4QVT A;  2QML A;  1GHE A;  2DEA A;  3FX6 A;  2IMO A;  5JM6 A;  4Q38 A;  3B3T A;  1R43 A;  2C1C A;  2HV2 A;  3I9S A;  1R3N A;  3PRT A;  3TO9 A;  2GRE A;  2Q51 A;  3BJ8 A;  4LQ6 A;  4BD9 A;  4P10 A;  5F09 A;  5HMN A;  2Z3O A;  3KI9 A;  3P2H A;  2HQY A;  5EC4 A;  1XMT A;  3KR5 A;  4JXQ A;  2Z3L A;  3BHX A;  3SI1 A;  3VH9 A;  2QVP A;  1ON0 A;  2Q43 A;  4WJB A;  2O28 A;  3N7Z A;  3PBE A;  3GB0 A;  2PQ8 A;  4KLV A;  1Q2Y A;  5C82 A;  1J4J A;  4GS4 A;  1LAP A;  2WPX A;  4Y49 C;  2I3C A;  3GYA A;  3FRM A;  4R57 A;  3IWG A;  2PDO A;  5LYF A;  4OP4 A;  1S7F A;  3D2P A;  3IIB A;  4U9Y A;  3GY9 A;  4CAV A;  1ARM A;  3JRU A;  2Z0Z A;  5D29 A;  4IAV A;  2Q7B A;  4AG7 A;  2I00 A;  2CIJ A;  1HDQ A;  1WWZ A;  1YQE A;  1M4G A;  3PB8 X;  1XEB A;  3FMC A;  2CNM A;  2PRB A;  2BCO A;  4Y49 B;  2J8M A;  4CRZ B;  5IV0 A;  3KL9 A;  3WAB A;  2PJ2 A;  4A33 A;  3FH4 A;  1BLL E;  3HUV A;  3K9T A;  4X2T A;  2FXF A;  3KGQ A;  3JVN A;  5DS0 A;  3SJG A;  3D3S A;  4UCP A;  2C6C A;  1KZF A;  2OOT A;  1TIQ A;  4MMO A;  1P4N A;  2GLF A;  1LOK A;  1IGB A;  1S7K A;  2ZEE A;  3DGV A;  4MRI A;  4AVA A;  3RNZ A;  3D7H A;  4TNU A;  1TKF A;  4MCP A;  3TO7 A;  5C88 A;  4M6H A;  1QQ9 A;  3F8K A;  2PJ1 A;  4OKO A;  4UEZ A;  5AGE A;  5A28 A;  1QSN A;  4C2Z A;  4MJ8 A;  4OME A;  2ZEF A;  3CXP A;  1N71 A;  1VHS A;  2PVV A;  2CNT A;  2WSA A;  4QC6 A;  2CNS A;  1S7L A;  4MHN A;  5KTC A;  1CJW A;  2VQY A;  1ZG8 A;  2G3T A;  3OWC A;  1Y9K A;  3IWW A;  3GLJ A;  3H8G A;  1TF9 A;  4KLW A;  1YRE A;  4NEX A;  1IOF A;  3VWD A;  1F2O A;  4UCN A;  2IQ6 A;  3WC6 A;  3TTH A;  4A2Z A;  2OZH A;  2AFZ A;  3ISX A;  1XMB A;  4HNW B;  2DF5 A;  2J8R A;  1Y7R A;  2WYR A;  4HNY B;  2DXQ A;  4C2X A;  1Z4R A;  1HEE A;  3LAC A;  3D68 A;  1BOB A;  4XPL A;  2JBK A;  5J8C A;  2CTB A;  4R8F A;  4R3L A;  5J1Q A;  1MK4 A;  4MFQ A;  3PFE A;  3LOD A;  4B12 A;  1GYT A;  4LUA A;  2AFO A;  4KUA A;  3D7D A;  4P4I A;  1BPN A;  2FL4 A;  1Z8L A;  4O23 A;  4YGO A;  1PU9 A;  3TOB A;  2JEV A;  5H84 A;  4B5P B;  1TXR A;  2V8V A;  3B3C A;  2HC9 A;  4B5P A;  5J8F A;  4PPZ A;  5A27 A;  3UY5 A;  2G0B A;  2Q44 A;  4GXH A;  1X10 A;  3IWE A;  3LWU A;  1M4D A;  5ISV A;  3KHZ A;  4AVC A;  4EME A;  2PJ8 A;  3V7Z A;  1IYL A;  1KUX A;  3C26 A;  3B3S A;  4NXY A;  2YGW A;  1Z8W A;  1SQH A;  3VWE A;  1VHE A;  2ATR A;  4FAI A;  5IB0 A;  4EWT A;  2P6F A;  5AG5 A;  4FBE A;  1OZP A;  4P45 A;  3I3G A;  3D7G A;  1OBR A;  5LYD A;  2XEI A;  2ZEN A;  5F49 A;  1IID A;  4Z65 A;  3DLJ A;  2R8V A;  4WWV A;  5AG6 A;  2JLM A;  3IGR A;  2NSM A;  4MFK A;  2ANP A;  2JDC A;  4KUB A;  4Q36 A;  3R95 A;  3TC8 A;  2Z3K A;  1ELL P;  1XRY A;  1NSA A;  2V8D A;  4P4F A;  2B58 A;  3W91 A;  3LD2 A;  4E8O A;  1Y0Y A;  2OR4 A;  4KOU A;  4DNC A;  2PJ7 A;  4YU9 A;  3D66 A;  3SXN A;  5F46 A;  3FJU A;  3N5F A;  4F0Y A;  4AXV A;  2EO8 A;  3FEE A;  4JXR A;  2DPS A;  2ZOF A;  4A30 A;  1S60 A;  1NMT A;  3RZA A;  3PFO A;  1VIX A;  3GIU A;  1Y9W A;  5AG7 A;  1YME A;  2XEJ A;  5DWN A;  3SJX A;  4ONW A;  1BO4 A;  4B11 A;  4CYN A;  1JWQ A;  4A37 A;  4R3K A;  4IF5 A;  4AVB A;  3R9G A;  5IB9 A;  4C68 A;  4B10 A;  1I1D A;  1CP7 A;  1QSM A;  1Q2D A;  1YW6 A;  1M4L A;  4HNX B;  3V38 A;  4X8I A;  3VAT A;  4QB9 A;  4R7M A;  5K8O A;  2PJ9 A;  4OC5 A;  1IU8 A;  3D4U A;  4UCM A;  3WC7 A;  2J8N A;  4NGQ A;  2DPT A;  1X12 A;  5CNP A;  2GLJ A;  2FIW A;  4LQG A;  4MHP A;  1QSO A;  4NGN A;  4OC2 A;  5HH1 A;  4F8Z A;  2B4D B;  5I4M A;  2IL4 A;  5LRG A;  1RO5 A;  3IJ3 A;  2B4D A;  3FXT A;  3F5B A;  3R96 A;  4M6I A;  2I79 A;  4NGP A;  1H8L A;  2CF4 A;  2VBQ A;  1A2Z A;  4MXU A;  5K8P A;  1FNO A;  4W9Y A;  3BXM A;  1ZO0 A;  3EC4 A;  5LRK A;  1YLO A;  2G9D A;  2POK A;  2YNC C;  4R9M A;  2B4B A;  4OAD A;  1MJA A;  4U5Y A;  4A32 A;  4DYO A;  2EK9 A;  5HVG A;  4OIW A;  4ZX8 A;  2KCW A;  1ZG9 A;  4NSQ A;  4M85 A;  4ZBG A;  4UEE A;  2ZEH A;  1DTD A;  1YR0 A;  4KSA A;  2PJC A;  3VAR A;  4NJQ A;  1WK4 A;  1KUY A;  1IB1 E;  4KVO E;  3PB6 X;  4B14 A;  4UF4 A;  3PEI A;  4IK2 A;  4OC0 A;  4LX9 A;  1PYT B;  4P6Y A;  2ZW4 A;  3D2M A;  1Y0R A;  3BI0 A;  3RBU A;  1CM0 A;  2Z10 A;  2ZEG A;  4B13 A;  3SJF A;  3S9L A;  1B87 A;  2Q4Z A;  2HB6 A;  2JDD A;  1JQG A;  3KZW A;  4GM5 A;  4M6G A;  3L2N A;  5HXD A;  4MY0 A;  2O53 A;  3DR8 A;  2Y0M A;  3FNC A;  3G8W A;  1F2P A;  3TCV A;  3ZJ0 A;  5IX3 A;  2P6G A;  3SXO A;  4MBU A;  3TO6 A;  2FIA A;  3NE8 A;  1S3Z A;  3B7I A;  4OC4 A;  4PV6 A;  3QAY A;  3IU2 A;  4KVX A;  3BLN A;  3CPX A;  1NE9 A;  4MY3 A;  4B6Z A;  5G22 A;  4MCR A;  4PSW A;  1B6B A;  4DUK A;  4DJL A;  2V8G A;  3QNV A;  2BEI A;  2P6E A;  3EXN A;  3PBB A;  3QAH A;  4PSX A;  5F47 A;  1M44 A;  1XE4 A;  2R7H A;  1YVO A;  5HVF A;  3H8E A;  4JZ0 A;  3WR7 A;  3NFZ A;  4KOT A;  5GCN A;  4FUU A;  1V0C A;  3EFA A;  4II9 A;  3R1K A;  5CBM A;  2PJ5 A;  3JUW A;  4ORF A;  3P2F A;  2VEZ A;  2AE6 A;  2AFM A;  2IJZ A;  3IC1 A;  4RI1 A;  1YW4 A;  5KTA A;  3B8G A;  5EBV A;  4KOR A;  1MJ9 A;  2GU2 A;  5D8N A;  2GIV A;  3SI2 A;  2ZEL A;  4CAE A;  4PQA A;  3NH4 A;  4ZI6 A;  2PJ4 A;  2GFQ A;  3NE7 A;  4FD6 A;  4XPD C;  4IHM A;  2Q0Y A;  4KOS A;  4PXD A;  4QBJ A;  2AFW A;  1TKH A;  2F7V A;  3PB9 X;  4K3N A;  4NGS A;  4IUS A;  1YX0 A;  5G21 A;  5JGF A;  4P4B A;  3W6S A;  1PUA A;  2VL1 A;  4I49 A;  4EVY A;  1CBX A;  4RN7 A;  4R6T A;  1S5K A;  4QUS A;  2HUZ A;  2ARH A;  2FCK A;  2GE3 A;  2ODF A;  3S6H A;  2VXK A;  4MHD A;  2BO9 A;  4MFZ A;  5JPH A;  1LFW A;  2GAN A;  4R87 A;  4ZY2 A;  2PRQ A;  3WT4 A;  3KAS A;  4UIA A;  4XNH C;  2QYV A;  2OZG A;  2CTC A;  3SJE A;  3KQZ A;  4PK3 A;  1LRZ A;  1AUG A;  4F9U A;  2Q4Y A;  3S6F A;  2Z3M A;  1DE4 C;  1S7N A;  1FT7 A;  2Z3P A;  4CYO A;  4E0A A;  4C7I A;  1KUV A;  4NJR A;  1UWY A;  4NFR A;  2PR1 A;  2AJ6 A;  1M4I A;  3FYN A;  2O4H A;  4NGT A;  3WC5 A;  3MN8 A;  4A39 A;  1TF8 A;  4F6A A;  3KKW A;  3D8P A;  2VZZ A;  3S9M A;  4ZY0 A;  4XNH B;  3CT9 A;  2QEC A;  2ZXV A;  4MCQ A;  2V77 A;  4R76 A;  1VHO A;  2PJA A;  4OID A;  4CAF A;  2FT0 A;  2REE A;  1UFH A;  3PB4 X;  4AB7 A;  2Q04 A;  1K4J A;  2B5G B;  3QB8 A;  1KWM A;  4JD6 A;  4KSI A;  1HDU A;  2B5G A;  3HLP A;  4EFD A;  4CS0 B;  5JQ4 A;  4CGN A;  2Z3N A;  1AYE A;  2FVG A;  2EVN A;  2PVW A;  3K9U A;  7CPA A;  1IIC A;  3B3V A;  2PJ6 A;  2EBJ A;  4E2A A;  2PR8 A;  6CPA A;  5DWM A;  3FED A;  3V8I A;  5JH9 A;  2QIR A;  3DNS A;  4H6Z A;  2PJB A;  5BWA B;  2OU2 A;  2PE3 A;  4CAX A;  4KOV A;  4TWE A;  1LCP A;  4KVM E;  2CXA A;  4F9V A;  4MFL A;  3NH8 A;  2FSR A;  2ZOG A;  4FWU A;  5FVJ A;  4JYW A;  4CAW A;  2YNE A;  3DR6 A;  5K8M A;  4K30 A;  1BAV A;  3TOA A;  4H6U A;  2VZY A; 
#chains in the Genus database with same CATH homology
 3CXQ A;  3CXS A;  3A9L A;  4NCZ A;  1FY7 A;  3T9Y A;  2WUU A;  3IU1 A;  4X5K A;  3T90 A;  4CGL A;  4PK2 A;  4ZGY B;  4HKF A;  4XPK A;  1QSR A;  4FD4 A;  3TE4 A;  2YNC A;  4KZT A;  2BL1 A;  4FD7 A;  4A31 A;  4BBH A;  4CRY B;  5KTD A;  4L89 A;  4J3G A;  4UWI A;  4CGM A;  3PGP A;  1QST A;  2ZW5 A;  1YVK A;  2PSW A;  4UFX A;  3EO4 A;  4KOX A;  3S6G A;  3TFY A;  2YND A;  4H89 A;  1U6M A;  1YLE A;  2EUI A;  2ZW6 A;  4JJX A;  3R9E A;  4C7H A;  3R9F A;  2FE7 A;  1Q2C A;  1YK3 A;  2P0W A;  1MJB A;  4A95 A;  4C2Y A;  3W6X A;  2OB0 A;  3H5Z A;  1YGH A;  4OLL A;  3S6K A;  3ZZI A;  5I0C A;  4CYQ A;  3GKR A;  4JLY A;  4UWJ A;  4ONU A;  3H4Q A;  5F48 A;  2A4N A;  2OZU A;  1Z9U A;  3FB3 A;  4UFV A;  2R98 A;  4KOY A;  2B3V A;  2H5M A;  2BSW A;  3EY5 A;  4KOW A;  2R1I A;  1M1D A;  3TT2 A;  2NMT A;  4MFJ A;  3G3S A;  2G3A A;  3PP9 A;  1RXT A;  1VKC A;  1I21 A;  4AG9 A;  2VI7 A;  2X7B A;  2D4P A;  4KSF A;  4XPD B;  1XF8 A;  4OAE A;  2FS5 A;  4UA3 A;  4U9Z A;  3RYO A;  3PZJ A;  4L8A A;  3MGD A;  3FBU A;  2PC1 A;  2Q4V A;  4YRH A;  5H86 A;  1IYK A;  1XIX A;  2REF A;  4BMH A;  2ZW7 A;  5AG4 A;  4YFJ A;  2CY2 A;  2ZPA A;  4KS9 A;  1NSL A;  5G1Z A;  4B5O A;  3DSB A;  3E0K A;  4CGP A;  2BUE A;  4FD5 A;  1P0H A;  2Z11 A;  4UBR A;  1R57 A;  3FIX A;  5G20 A;  4MI4 A;  3JTK A;  2D4O A;  3F0A A;  2OH1 A;  3SHP A;  4RS2 A;  2RC4 A;  4CYP A;  2WPW A;  3BJ7 A;  2B3U A;  1Z4E A;  4JWP A;  3DDD A;  2C27 A;  1L0C A;  4CGO A;  4M3S A;  2K5T A;  4NF1 A;  1I12 A;  4F0X A;  2F5I A;  5E96 A;  4MFP A;  4UFW A;  4QVT A;  2QML A;  1GHE A;  4Q38 A;  2HV2 A;  3I9S A;  3TO9 A;  3BJ8 A;  5HMN A;  2Z3O A;  3P2H A;  2HQY A;  5EC4 A;  1XMT A;  4JXQ A;  2Z3L A;  1ON0 A;  2O28 A;  3N7Z A;  4KLV A;  5C82 A;  2PQ8 A;  1Q2Y A;  1J4J A;  4GS4 A;  2WPX A;  4Y49 C;  3GYA A;  3FRM A;  4R57 A;  3IWG A;  2PDO A;  1S7F A;  3D2P A;  4U9Y A;  3GY9 A;  4CAV A;  2Z0Z A;  4AG7 A;  2Q7B A;  2I00 A;  1WWZ A;  1M4G A;  1XEB A;  2CNM A;  2PRB A;  4Y49 B;  2J8M A;  4CRZ B;  5IV0 A;  4A33 A;  2FXF A;  3JVN A;  3D3S A;  4UCP A;  1KZF A;  1TIQ A;  1P4N A;  1S7K A;  4AVA A;  3TO7 A;  5C88 A;  3F8K A;  5AGE A;  5A28 A;  1QSN A;  4C2Z A;  4MJ8 A;  3CXP A;  1N71 A;  1VHS A;  2CNT A;  2WSA A;  4QC6 A;  2CNS A;  1S7L A;  5KTC A;  1CJW A;  2VQY A;  2G3T A;  3OWC A;  1Y9K A;  4KLW A;  1YRE A;  4NEX A;  3VWD A;  4UCN A;  3TTH A;  4A2Z A;  2OZH A;  4HNW B;  4HNY B;  2J8R A;  1Y7R A;  2DXQ A;  4C2X A;  1Z4R A;  5J8C A;  1BOB A;  4XPL A;  4R3L A;  1MK4 A;  4MFQ A;  3LOD A;  4B12 A;  4LUA A;  4KUA A;  2FL4 A;  4YGO A;  1PU9 A;  3TOB A;  2JEV A;  5H84 A;  4B5P B;  4B5P A;  5J8F A;  5A27 A;  3UY5 A;  2G0B A;  2Q44 A;  3IWE A;  1M4D A;  5ISV A;  4AVC A;  1IYL A;  1KUX A;  3C26 A;  4NXY A;  2YGW A;  1SQH A;  3VWE A;  5IB0 A;  2ATR A;  2P6F A;  5AG5 A;  1OZP A;  3I3G A;  5F49 A;  1IID A;  2R8V A;  5AG6 A;  2JLM A;  3IGR A;  4MFK A;  2JDC A;  4KUB A;  4Q36 A;  3R95 A;  2Z3K A;  2B58 A;  3W91 A;  3LD2 A;  4E8O A;  4KOU A;  4DNC A;  3SXN A;  5F46 A;  4F0Y A;  4JXR A;  2DPS A;  4A30 A;  1S60 A;  1NMT A;  5AG7 A;  5DWN A;  1Y9W A;  1BO4 A;  4B11 A;  4CYN A;  4R3K A;  4IF5 A;  4AVB A;  3R9G A;  4C68 A;  4B10 A;  1I1D A;  1QSM A;  4HNX B;  1Q2D A;  4QB9 A;  4UCM A;  2J8N A;  2DPT A;  5CNP A;  2FIW A;  5HH1 A;  1QSO A;  2B4D B;  2IL4 A;  1RO5 A;  2B4D A;  3FXT A;  3F5B A;  3R96 A;  2I79 A;  2VBQ A;  1ZO0 A;  3EC4 A;  2YNC C;  4R9M A;  2B4B A;  4OAD A;  1MJA A;  4U5Y A;  4A32 A;  2KCW A;  4NSQ A;  4M85 A;  4ZBG A;  1YR0 A;  4KSA A;  1WK4 A;  1KUY A;  1IB1 E;  4KVO E;  4B14 A;  4LX9 A;  2ZW4 A;  3D2M A;  1CM0 A;  2Z10 A;  4B13 A;  1B87 A;  2JDD A;  4MY0 A;  3DR8 A;  2Y0M A;  3FNC A;  3G8W A;  3TCV A;  3ZJ0 A;  5IX3 A;  2P6G A;  3SXO A;  4MBU A;  3TO6 A;  2FIA A;  1S3Z A;  4PV6 A;  3IU2 A;  4KVX A;  3BLN A;  4MY3 A;  1NE9 A;  5G22 A;  4PSW A;  1B6B A;  2BEI A;  2P6E A;  3QAH A;  3EXN A;  4PSX A;  5F47 A;  1M44 A;  1XE4 A;  2R7H A;  1YVO A;  3WR7 A;  4KOT A;  5GCN A;  1V0C A;  3EFA A;  4II9 A;  3R1K A;  3JUW A;  4ORF A;  3P2F A;  2VEZ A;  2AE6 A;  4RI1 A;  5KTA A;  3B8G A;  5EBV A;  4KOR A;  1MJ9 A;  2GIV A;  4CAE A;  3NE7 A;  4FD6 A;  4XPD C;  2Q0Y A;  4KOS A;  4QBJ A;  4IUS A;  1YX0 A;  5G21 A;  3W6S A;  1PUA A;  4I49 A;  4EVY A;  1S5K A;  4QUS A;  2HUZ A;  2ARH A;  2FCK A;  2GE3 A;  3S6H A;  2VXK A;  4MHD A;  4MFZ A;  5JPH A;  2GAN A;  4R87 A;  4XNH C;  2OZG A;  4PK3 A;  1LRZ A;  2Q4Y A;  3S6F A;  2Z3M A;  4E0A A;  1S7N A;  2Z3P A;  4CYO A;  4C7I A;  1KUV A;  2PR1 A;  2AJ6 A;  1M4I A;  3FYN A;  4F6A A;  3KKW A;  3D8P A;  2VZZ A;  4XNH B;  2QEC A;  2ZXV A;  4CAF A;  2FT0 A;  2REE A;  1UFH A;  4AB7 A;  2Q04 A;  1K4J A;  2B5G B;  3QB8 A;  4JD6 A;  2B5G A;  5JQ4 A;  4CS0 B;  4CGN A;  2Z3N A;  2EVN A;  3K9U A;  1IIC A;  4E2A A;  2PR8 A;  5DWM A;  3V8I A;  2QIR A;  3DNS A;  4H6Z A;  5BWA B;  2OU2 A;  4CAX A;  4KOV A;  4KVM E;  2CXA A;  4MFL A;  2FSR A;  5FVJ A;  4CAW A;  2YNE A;  3DR6 A;  4K30 A;  3TOA A;  4H6U A;  2VZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...