3R96A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MccE protein
total genus 57
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r96A00
2F5IA 2J8NA 2Y0MA 1NE9A 2Q4VA 4AG9A 4CAXA 4DNCA 5EC4A 5E96A 2FE7A 4QC6A 4CS0B 5HMNA 4KOXA 2EVNA 3QB8A 4R57A 5ISVA 1XE4A 4KORA 2Q7BA 1QSTA 2FIWA 2Z11A 2H5MA 3B8GA 4M3SA 3V8IA 4JXQA 3TOBA 4YFJA 1U6MA 1WK4A 2VEZA 1CJWA 2B58A 4H89A 2BL1A 2OZHA 2ATRA 2VXKA 1KZFA 3EFAA 5J8FA 2PDOA 4PK2A 1Q2YA 2OH1A 1M4GA 2FT0A 1Z4RA 3IWGA 1MJ9A 3W91A 2Q4YA 2K5TA 4RS2A 4IUSA 2B4BA 1BOBA 1OZPA 1CM0A 3FNCA 4LX9A 4MI4A 2WPWA 3TO9A 4JWPA 2HUZA 4F6AA 1S60A 3I9SA 3TFYA 2R8VA 4L89A 2HV2A 1M4DA 3DDDA 4B5PA 3OWCA 2G0BA 1IYKA 4KUBA 3R1KA 1NMTA 2CNMA 3LD2A 3ZZIA 2JDCA 2REEA 1WWZA 4H6ZA 3TO7A 4KVME 1IYLA 3TCVA 4PK3A 4AVAA 2EUIA 2R98A 4PV6A 4MBUA 3NE7A 1S5KA 4CAVA 1I1DA 4X5KA 3KKWA 3IGRA 3P2HA 4JD6A 1P4NA 4AB7A 4KOUA 1B87A 4UWIA 4YRHA 3BLNA 4FD5A 4R3LA 4Y49C 4UBRA 5F49A 2D4OA 2JEVA 3ZJ0A 1RXTA 2P6FA 2JDDA 1XMTA 4KVXA 5JQ4A 4J3GA 3DSBA 3G3SA 4U9YA 5HH1A 3R9FA 4CRZB 1LRZA 2BUEA 3S6HA 4OADA 2B4DA 3FYNA 1NSLA 3GY9A 4L8AA 2ZXVA 2P0WA 2OZUA 3PZJA 2ZW4A 4KLVA 4E8OA 5IB0A 1UFHA 3BJ8A 4OAEA 2QIRA 1R57A 4ORFA 2Q0YA 3SXOA 1B6BA 2B3VA 1MJBA 1Q2CA 2X7BA 4XPDB 2RC4A 5F48A 4R87A 3GYAA 1RO5A 4XPDC 4II9A 2Q44A 4E0AA 2OZGA 3DR6A 1MK4A 3K9UA 3D2MA 4B5OA 3FIXA 4HKFA 1S3ZA 3T90A 1GHEA 2BSWA 4HNWB 1M1DA 4XPLA 4Y49B 2CY2A 2PR1A 2G3TA 2VZYA 2ZW5A 1I21A 2QMLA 3FRMA 1KUYA 1PU9A 4FD6A 4B5PB 2REFA 1S7LA 2FSRA 3W6XA 2FL4A 2BEIA 2OU2A 4ZBGA 2B4DB 4HNXB 2FIAA 3CXSA 1XIXA 2VI7A 3S6GA 3E0KA 3VWEA 1QSMA 4KOYA 1S7KA 4NSQA 1QSNA 2GE3A 2PQ8A 4CRYB 3TT2A 1M44A 3D2PA 4KOSA 4R9MA 5H84A 2C27A 3MGDA 4MHDA 2WPXA 1Y9WA 2D4PA 1FY7A 3F5BA 3G8WA 4KOVA 1QSOA 2G3AA 3JVNA 3FB3A 2B5GB 3EO4A 4OLLA 4UA3A 1QSRA 4NEXA 1YK3A 2QECA 3CXPA 2PC1A 5I0CA 4R3KA 3R9GA 3DNSA 4MJ8A 2ZW6A 3F8KA 2AJ6A 4KZTA 3TOAA 5EBVA 4QUSA 3C26A 2Q04A 2HQYA 1XEBA 4H6UA 5DWNA 3VWDA 2CNTA 1YVKA 3TTHA 3D8PA 4U5YA 4NXYA 4F0YA 1IICA 5KTCA 4KUAA 3GKRA 5CNPA 1XF8A 5JPHA 1YR0A 1KUXA 3JUWA 1Q2DA 1TIQA 5F47A 2B3UA 4FD7A 1MJAA 3CXQA 1M4IA 4KLWA 4RI1A 3SXNA 1S7NA 1IB1E 1YGHA 1YREA 4FD4A 1Y7RA 1I12A 3S6KA 2B5GA 2VBQA 4AVBA 1Y9KA 4QB9A 1Z4EA 1YLEA 3S6FA 4KVOE 1IIDA 2FCKA 3R9EA 1K4JA 3QAHA 1N71A 2CNSA 3R96A 3I3GA 4ONUA 2GANA 4E2AA 2GIVA 3PGPA 5KTDA 5F46A 5IV0A 3F0AA 2VZZA 3FBUA 2ARHA 2ZPAA 1J4JA 1V0CA 5C88A 2FXFA 4M85A 2I79A 4QVTA 3DR8A 3H4QA 4MY0A 1S7FA 2JLMA 2FS5A 2OB0A 4HNYB 4K30A 4KOWA 2NMTA 4CAWA 5GCNA 3UY5A 3EY5A 2R7HA 4XPKA 3W6SA 1YVOA 3N7ZA 4YGOA 2P6EA 2R1IA 3T9YA 1VHSA 4JLYA 1YX0A 2A4NA 2J8MA 2PRBA 4JJXA 5J8CA 2J8RA 3D3SA 3TO6A 2I00A 2O28A 4XNHC 4GS4A 2ZW7A 4I49A 1SQHA 2AE6A 3LODA 3EC4A 3RYOA 5IX3A 3P2FA 2P6GA 1KUVA 4NCZA 5FVJA 4PSXA 1Z9UA 4PSWA 2PSWA 5DWMA 4IF5A 2Z0ZA 1ON0A 3BJ7A 4JXRA 3TE4A 3FXTA 4NF1A 4AVCA 1L0CA 2DXQA 4XNHB 3R95A 3PP9A 2KCWA 4MY3A 4LUAA 1BO4A 4AG7A 3SHPA 4KOTA 1VKCA 3EXNA 4QBJA 5H86A 2PR8A 1P0HA 4U9ZA 3WR7A 4UWJA 2Z10A 5KTAA 5C82A 4BMHA 2IL4A 2VQYA 4EVYA 1PUAA
chains in the Genus database with same CATH superfamily
4AXVA 2F5IA 2J8NA 2Y0MA 1NE9A 1GYTA 2Q4VA 3D7FA 4AG9A 4NGTA 4CAXA 5EC4A 5E96A 4DNCA 2FE7A 4QC6A 4Z65A 5JH9A 4CS0B 5HMNA 4JYWA 4ZX9A 1TKJA 4KOXA 4PXBA 5LRJA 2EVNA 3QB8A 4R57A 5ISVA 1ZLHA 2NYQA 1XE4A 4KORA 2ZEPA 2Q7BA 1QSTA 2FIWA 2JBKA 2Z11A 1ELMP 4CYOA 2H5MA 3B8GA 5AG7A 4M3SA 2PIZA 3V8IA 4LQ6A 2V8GA 4JXQA 3TOBA 4YFJA 1U6MA 2Z3NA 1BAVA 1WK4A 2CXAA 2VEZA 3H5ZA 1CJWA 4P4JA 1XBUA 2F7VA 2B58A 1FNOA 4H89A 3D7HA 2BL1A 2OZHA 2ATRA 3FMCA 4PXCA 2IQ6A 2VXKA 4MFQA 1KZFA 3EFAA 4A31A 5J8FA 2PDOA 4MCPA 4PK2A 1Q2YA 1CBXA 2OH1A 2PJCA 1M4GA 5EMIA 4CYNA 2FT0A 4FAIA 1Z4RA 3IWGA 1MJ9A 3W91A 2Q4YA 2GREA 3PB8X 3FVLA 4RN7A 4P4EA 2K5TA 2PVVA 3D4UA 4RS2A 4IUSA 2B4BA 1F57A 4MFKA 4OC4A 3VARA 3WABA 1BOBA 1OZPA 1CM0A 3FNCA 4LX9A 4MI4A 2WPWA 3ISXA 3TO9A 4JWPA 4CGMA 2HUZA 4G1PA 2PJBA 4NGMA 1F2PA 4ZGYB 4F6AA 5I4MA 1HEEA 1S60A 3I9SA 2ANPA 1QMUA 4PXDA 3NFZA 3TFYA 2R8VA 2QVPA 3JTKA 4OKOA 4L89A 2HV2A 1M4DA 1VIXA 2G9DA 3DDDA 4B5PA 3OWCA 5IB9A 1TF8A 4B10A 2G0BA 4ZY2A 5LYIA 2C6PA 1IYKA 2DF5A 2Z3PA 4KUBA 2AFUA 3R1KA 2YNEA 1NMTA 2ZEMA 1NSAA 2CNMA 3LD2A 3LWUA 3ZZIA 2JDCA 4M6IA 1Q7LA 2REEA 3SJFA 1WWZA 3RAMA 4ZYQA 4H6ZA 3MRUA 2AFOA 3FJUA 4WWVA 1XJOA 3TO7A 4KVME 1IYLA 4R76A 3TCVA 2ZELA 4R8FA 1YLOA 6CPAA 2QJ8A 4PK3A 4AVAA 1XRYA 2EUIA 2R98A 1LCPA 4PV6A 4NJRA 3QNVA 8CPAA 4MBUA 4A37A 4C68A 2Z3LA 3NE7A 4CRYB 1S5KA 4C2XA 4X8IA 4CAVA 4BD9A 1I1DA 4X5KA 2PJ8A 3KKWA 2PJ1A 3IGRA 3P2HA 1Y7EA 4JD6A 4MCSA 4CGPA 1P4NA 4A95A 4AB7A 4KOUA 1LAMA 1B87A 4UWIA 4YRHA 4Q7AA 3PRTA 2PVWA 3BLNA 3S9LA 4FD5A 4R3LA 5AGEA 3IJ3A 1Z5RA 4KSIA 2VL1A 4Y49C 3KASA 1LOKA 3K2KA 3KR4A 3B2YA 4GM5A 4UBRA 5F49A 2D4OA 2IJZA 2JEVA 2F8HA 1RXTA 2P6FA 3ZJ0A 4UCPA 3GIUA 4UEEA 3NH4A 2JDDA 3CT9A 5THWA 3WC5A 2FVGA 2CF4A 1CP6A 3LMSA 3PFEA 1XMTA 4KVXA 5JQ4A 4J3GA 3IFEA 3NE8A 1YW6A 1ZG7A 3DSBA 3FH4A 3H8EA 3G3SA 1TF9A 4PQAA 3D66A 4U9YA 1AYEA 4IK2A 4K3NA 4A38A 4CGLA 5HH1A 4YWYA 1BLLE 3R9FA 5G20A 1TXRA 4CRZB 1LRZA 2XEJA 2DEAA 2BUEA 3T8WA 3I1UA 3S6HA 4OADA 4P45A 5HVFA 2B4DA 1IOIA 3FYNA 3IO1A 3PFOA 3WT4A 3KQZA 4DYOA 4TWEA 1A2ZA 5G22A 1VHOA 5DS0A 4OP4A 1NSLA 1ZO0A 3GY9A 4L8AA 4ZY0A 4MMOA 2ZXVA 2P0WA 2OZUA 2ZW4A 3PZJA 4KLVA 4E8OA 5IB0A 3GLJA 4B14A 1UFHA 3BJ8A 3D68A 4MCRA 4OAEA 3B35A 2QIRA 1R57A 1OBRA 2EBJA 2Q0YA 4ORFA 3SI1A 1B6BA 3PEIA 3SXOA 4BINA 5AG5A 3RO0A 4P4FA 2B3VA 4NGNA 1LFWA 2GU2A 1MJBA 1Q2CA 1UWYA 1Y0RA 2BO9A 2X7BA 4XPDB 3SJEA 2RC4A 5F48A 1XOVA 3GYAA 4R87A 2XEFA 2QYVA 2ZEOA 1RO5A 4CGNA 2XEGA 2Z3KA 3KHXA 3WC7A 4XPDC 3SI0A 4II9A 3SI2A 2Q44A 4E0AA 3KQXA 2OZGA 3DR6A 2PJ5A 4F0XA 1MK4A 2DPSA 3D2MA 3K9UA 4B5OA 3FIXA 4HKFA 1S3ZA 3T90A 1GHEA 3IU2A 2BSWA 2V8DA 5LYDA 4HNWB 3D67A 3KHZA 1M1DA 4PXEA 4XPLA 2AFMA 4Y49B 4LQGA 1R3NA 5K8NA 5F09A 3DGVA 2AFZA 3D7DA 2CY2A 2PR1A 2G3TA 2VZYA 3BHXA 4MHYA 2DPTA 2BCOA 1ZLIA 4YU9A 3NA6A 2EWBA 2ZW5A 1I21A 3IIBA 2PJ6A 2JBJA 4P6YA 2QMLA 2Q4ZA 3FRMA 4UIAA 1KUYA 1PU9A 3DLJA 3S9NA 2WYRA 4FD6A 3VH9A 4B5PB 1IGBA 4MHZA 5JGFA 2PJ9A 2REFA 1S7LA 2FSRA 3IEHA 3W6XA 2FL4A 3V7ZA 2BEIA 3IWEA 3PBEA 4C7HA 2OU2A 4EFDA 2YNCC 4CAFA 3B3VA 4ZBGA 2JEWA 2B4DB 4HNXB 2FIAA 3CXSA 1XIXA 2PJAA 2Q43A 4UCNA 2WZNA 4UFVA 2VI7A 3KGQA 3S6GA 4Q36A 3E0KA 3VWEA 1QSMA 4KOYA 1S7KA 4NSQA 1QSNA 2GE3A 1YQEA 2PQ8A 1M4LA 4ZY1A 1BPNA 5ELYA 3KR5A 2AFXA 3TT2A 4IHMA 1M44A 3D2PA 4OIWA 3WC6A 4KOSA 4A2ZA 1Z8TA 3CPAA 4MFZA 4R9MA 5H84A 4B11A 3L2NA 2C27A 3MGDA 4MHDA 4X2TA 3D7GA 2WPXA 3SJXA 1Y9WA 5K8OA 2D4PA 2AFWA 1FY7A 3F5BA 3G8WA 4KOVA 2BOAA 2O4HA 1QSOA 2G3AA 3PB7X 1Z8LA 3JVNA 4H2KA 3FB3A 2B5GB 3EO4A 4OLLA 3FF3A 4EMEA 1TKFA 4UA3A 1QSRA 4NEXA 1YK3A 1ARLA 1ZG8A 2QECA 3H8FA 4CPAA 3CXPA 2PC1A 5I0CA 5K8MA 1LAPA 4R3KA 2CTCA 3R9GA 1YSJA 2GFQA 3DNSA 2C6CA 4FWUA 4MJ8A 2ZW6A 4OC0A 3F8KA 2AJ6A 4KZTA 1FT7A 3TOAA 1QQ9A 4MRIA 5D29A 5EBVA 4QUSA 3BI0A 3FECA 3C26A 4A33A 4C2ZA 2Q04A 2HQYA 1XEBA 2CTBA 4H6UA 3MN8A 2PJ3A 5DWNA 5HXDA 3VWDA 2CNTA 1YVKA 4KSAA 3BI1A 4P4DA 3B3CA 4R7MA 3TTHA 3D8PA 4CAEA 2PRQA 4U5YA 2ZEGA 5D8NA 4NXYA 4F0YA 4PPZA 1PYTB 1LANA 2V77A 1IICA 4FUUA 4UFWA 5HVHA 3RBUA 2Z3MA 5KTCA 3CPXA 4KUAA 3GKRA 4MFPA 3ISZA 2XEIA 5CNPA 1DTDA 1XF8A 5BWAB 1ARMA 4NGRA 1Z2LA 3TX8A 4P4IA 1YR0A 1KUXA 3JUWA 1X10A 1Q2DA 3CDXA 3PBBA 1TIQA 5F47A 4W9YA 2B3UA 4FD7A 4A39A 4P44A 4CYPA 5A28A 3HLPA 1MJAA 3CXQA 4F9UA 3KI9A 1M4IA 2PJ2A 4EWTA 4KLWA 4RI1A 2ODFA 5AG6A 3B7IA 3SXNA 2ZEHA 2Q51A 4B12A 1XFOA 1S7NA 1IB1E 1ZG9A 3RZAA 1YGHA 1YREA 5G21A 4WJBA 4FD4A 1Y7RA 1CX8A 1I12A 3S6KA 2I3CA 2J9AA 2PJ7A 4ONWA 5J1QA 2B5GA 2VBQA 3KL9A 4AVBA 4UCMA 2RB7A 4P10A 3TC8A 1XMBA 3A9LA 1Y9KA 1JWQA 1Z4EA 1YLEA 4QB9A 4IAVA 3S6FA 4KVOE 1IIDA 4NJQA 2FCKA 3R9EA 5HVGA 5JM6A 2Z3OA 1K4JA 1HDUA 3QAHA 1VGYA 5AG4A 1N71A 3B3SA 2CNSA 3IU1A 3I3GA 2HC9A 3R96A 4ONUA 2GANA 4OC5A 4X3RA 3VATA 1JQGA 4E2AA 4B13A 1KWMA 2GIVA 3PGPA 1AMPA 5KTDA 5F46A 4CYQA 5IV0A 2EK8A 3F0AA 2VZZA 1AUGA 3FBUA 2ARHA 2C1CA 1H8LA 2ZPAA 4ZI6A 4UEZA 4Q38A 1J4JA 1V0CA 3BXMA 2PE3A 5C88A 2POKA 2FXFA 4M85A 4MFLA 2I79A 2HB6A 4QVTA 3SJGA 2YGWA 2PIYA 4KS9A 3DR8A 2EO8A 3B3WA 3H4QA 4MY0A 1S7FA 2RFHA 2JLMA 2PJ0A 5LRKA 4C2YA 2FS5A 1CPXA 2V8VA 3IC1A 2ZOFA 2OB0A 4HNYB 5CBMA 1RTQA 2ZENA 4NGSA 2ZOGA 4K30A 5G1ZA 4KOWA 2NMTA 4CAWA 5GCNA 4OIDA 3UY5A 3EY5A 4JZ0A 2R7HA 4NFRA 4XPKA 3W6SA 1YVOA 3GB0A 3N7ZA 1BPMA 3KZWA 3HUVA 4YGOA 4B6ZA 3FX6A 2P6EA 4O23A 3IWWA 2ZEDA 1IOFA 2R1IA 1VHSA 3T9YA 1EE3P 1IY7A 4JLYA 2AFSA 1YX0A 2A4NA 4R6TA 2J8MA 2PRBA 4JJXA 4NGQA 4OC1A 2J8RA 5J8CA 2ABZA 3D3SA 4A32A 1PCAA 3JRUA 4MHPA 2OOTA 3TO6A 2I00A 7CPAA 2ZEEA 2NSMA 2O28A 3CZXA 4XNHC 2IMOA 3K9TA 4GS4A 2ZW7A 3V38A 4I49A 4HPSA 5LYLA 4OC3A 1SQHA 2AE6A 4OMEA 1Z8WA 3N5FA 4MFJA 4MHNA 3LODA 3EC4A 3RYOA 5IX3A 3P2FA 4GXHA 2P6GA 4F9VA 1KUVA 2Q7SA 2OR4A 4F8ZA 5CPAA 5LYFA 4NCZA 5FVJA 1CG2A 3FEDA 4PSXA 1Z9UA 4PSWA 4OC2A 4FBEA 1YW4A 4M6HA 4UEFA 3RNZA 2PSWA 5K8PA 1ELLP 5DWMA 3S9MA 4IF5A 1HDQA 4C7IA 2Z0ZA 1ON0A 2YNCA 3BJ7A 4ZX8A 1CPSA 1TKHA 4JXRA 3TE4A 3LACA 3FXTA 4NF1A 3NH5A 4UF4A 4AVCA 5JPHA 2PCUA 3H8GA 1L0CA 2EK9A 4A30A 2DXQA 4BBHA 4XNHB 4P4BA 5LRGA 3R95A 4UFXA 3PP9A 1YMEA 1Z8XA 2WSAA 2KCWA 4MY3A 4A94A 5A27A 1Y0YA 2C6GA 4LUAA 1IU8A 1X12A 4UIBA 1BO4A 4AG7A 3QAYA 2CIJA 3SHPA 2GLJA 4KOTA 1CP7A 2V8HA 3PB4X 4DUKA 1VKCA 3EXNA 4CGOA 4QBJA 4KSFA 2O53A 1F2OA 5H86A 3GUXA 4RUHA 3FEEA 1VHEA 3NH8A 2PR8A 2YNDA 3PB9X 1P0HA 4U9ZA 3WR7A 4UWJA 3PB6X 4NGPA 1DE4C 2Z10A 4TNUA 3B3TA 5KTAA 5C82A 2GLFA 4M6GA 4MCQA 2ZEFA 2WUUA 4MXUA 1R43A 4BMHA 2IL4A 2VQYA 4DJLA 4EVYA 1PUAA 2PJ4A
chains in the Genus database with same CATH topology
2F5IA 2J8NA 2Y0MA 1NE9A 2Q4VA 4AG9A 4CAXA 4DNCA 5EC4A 5E96A 2FE7A 4QC6A 4CS0B 5HMNA 4KOXA 2EVNA 3QB8A 4R57A 5ISVA 1XE4A 4KORA 2Q7BA 1QSTA 2FIWA 2Z11A 4CYOA 2H5MA 3B8GA 5AG7A 4M3SA 3V8IA 4JXQA 3TOBA 4YFJA 1U6MA 2Z3NA 1WK4A 2CXAA 2VEZA 3H5ZA 1CJWA 2B58A 4H89A 2BL1A 2OZHA 2ATRA 2VXKA 4MFQA 1KZFA 3EFAA 4A31A 5J8FA 2PDOA 4PK2A 1Q2YA 2OH1A 1M4GA 4CYNA 2FT0A 1Z4RA 3IWGA 1MJ9A 3W91A 2Q4YA 2K5TA 4RS2A 4IUSA 2B4BA 4MFKA 1BOBA 1OZPA 1CM0A 3FNCA 4LX9A 4MI4A 2WPWA 3TO9A 4JWPA 4CGMA 2HUZA 4ZGYB 4F6AA 1S60A 3I9SA 3TFYA 2R8VA 3JTKA 4L89A 2HV2A 1M4DA 3DDDA 4B5PA 3OWCA 4B10A 2G0BA 1IYKA 2Z3PA 4KUBA 3R1KA 2YNEA 1NMTA 2CNMA 3LD2A 3ZZIA 2JDCA 2REEA 1WWZA 4H6ZA 3TO7A 4KVME 1IYLA 3TCVA 4PK3A 4AVAA 2EUIA 2R98A 4PV6A 4MBUA 4C68A 2Z3LA 3NE7A 1S5KA 4C2XA 4CAVA 1I1DA 4X5KA 3KKWA 3IGRA 3P2HA 4JD6A 4CGPA 1P4NA 4A95A 4AB7A 4KOUA 1B87A 4UWIA 4YRHA 3BLNA 4FD5A 4R3LA 5AGEA 4Y49C 4UBRA 5F49A 2D4OA 2JEVA 3ZJ0A 1RXTA 2P6FA 4UCPA 2JDDA 1XMTA 4KVXA 5JQ4A 4J3GA 3DSBA 3G3SA 4U9YA 4CGLA 5HH1A 3R9FA 5G20A 4CRZB 1LRZA 2BUEA 3S6HA 4OADA 2B4DA 3FYNA 5G22A 1NSLA 1ZO0A 3GY9A 4L8AA 2ZXVA 2P0WA 2OZUA 3PZJA 2ZW4A 4KLVA 4E8OA 5IB0A 4B14A 1UFHA 3BJ8A 4OAEA 2QIRA 1R57A 4ORFA 2Q0YA 3SXOA 1B6BA 5AG5A 2B3VA 1MJBA 1Q2CA 2X7BA 4XPDB 2RC4A 5F48A 4R87A 3GYAA 4CGNA 1RO5A 2Z3KA 4XPDC 4II9A 2Q44A 4E0AA 2OZGA 3DR6A 4F0XA 1MK4A 2DPSA 3D2MA 3K9UA 4B5OA 3FIXA 4HKFA 1S3ZA 3T90A 1GHEA 3IU2A 2BSWA 4HNWB 1M1DA 4XPLA 4Y49B 2CY2A 2PR1A 2G3TA 2VZYA 2DPTA 2ZW5A 1I21A 2QMLA 3FRMA 1KUYA 1PU9A 4FD6A 4B5PB 2REFA 1S7LA 2FSRA 3W6XA 2FL4A 2BEIA 3IWEA 4C7HA 2OU2A 2YNCC 4CAFA 4ZBGA 2B4DB 4HNXB 2FIAA 3CXSA 1XIXA 4UCNA 4UFVA 2VI7A 3S6GA 4Q36A 3E0KA 3VWEA 1QSMA 4KOYA 1S7KA 4NSQA 1QSNA 2GE3A 2PQ8A 4CRYB 3TT2A 4A2ZA 1M44A 3D2PA 4KOSA 4MFZA 4R9MA 5H84A 4B11A 2C27A 3MGDA 4MHDA 2WPXA 1Y9WA 2D4PA 1FY7A 3F5BA 3G8WA 4KOVA 1QSOA 2G3AA 3JVNA 3FB3A 2B5GB 3EO4A 4OLLA 4UA3A 1QSRA 4NEXA 1YK3A 2QECA 3CXPA 2PC1A 5I0CA 4R3KA 3R9GA 3DNSA 4MJ8A 2ZW6A 3F8KA 2AJ6A 4KZTA 3TOAA 5EBVA 4QUSA 4A33A 3C26A 4C2ZA 2Q04A 2HQYA 1XEBA 4H6UA 5DWNA 3VWDA 2CNTA 1YVKA 4KSAA 3TTHA 3D8PA 4CAEA 4U5YA 4NXYA 4F0YA 1IICA 4UFWA 2Z3MA 5KTCA 4KUAA 3GKRA 4MFPA 5CNPA 1XF8A 5BWAB 5JPHA 1YR0A 1KUXA 3JUWA 1Q2DA 1TIQA 5F47A 2B3UA 4FD7A 4CYPA 5A28A 1MJAA 3CXQA 1M4IA 4KLWA 4RI1A 5AG6A 3SXNA 4B12A 1S7NA 1IB1E 1YGHA 1YREA 5G21A 4FD4A 1Y7RA 1I12A 3S6KA 2B5GA 2VBQA 4AVBA 4UCMA 3A9LA 1Y9KA 4QB9A 1Z4EA 1YLEA 3S6FA 4KVOE 1IIDA 2FCKA 3R9EA 2Z3OA 1K4JA 3QAHA 5AG4A 1N71A 2CNSA 3IU1A 3I3GA 3R96A 4ONUA 2GANA 4E2AA 4B13A 2GIVA 3PGPA 5KTDA 5F46A 4CYQA 5IV0A 3F0AA 2VZZA 3FBUA 2ARHA 2ZPAA 4Q38A 1J4JA 1V0CA 5C88A 2FXFA 4M85A 4MFLA 2I79A 4QVTA 2YGWA 4KS9A 3DR8A 3H4QA 4MY0A 1S7FA 2JLMA 4C2YA 2FS5A 2OB0A 4HNYB 4K30A 5G1ZA 4KOWA 2NMTA 4CAWA 5GCNA 3UY5A 3EY5A 2R7HA 4XPKA 3W6SA 1YVOA 3N7ZA 4YGOA 2P6EA 2R1IA 3T9YA 1VHSA 4JLYA 1YX0A 2A4NA 2J8MA 2PRBA 4JJXA 5J8CA 2J8RA 3D3SA 4A32A 3TO6A 2I00A 2O28A 4XNHC 4GS4A 2ZW7A 4I49A 1SQHA 2AE6A 4MFJA 3LODA 3EC4A 3RYOA 5IX3A 3P2FA 2P6GA 1KUVA 4NCZA 5FVJA 4PSXA 1Z9UA 4PSWA 2PSWA 5DWMA 4C7IA 4IF5A 2Z0ZA 1ON0A 2YNCA 3BJ7A 4JXRA 3TE4A 3FXTA 4NF1A 4AVCA 4A30A 1L0CA 4BBHA 2DXQA 4XNHB 3R95A 4UFXA 3PP9A 2WSAA 2KCWA 4MY3A 5A27A 4LUAA 1BO4A 4AG7A 3SHPA 4KOTA 1VKCA 3EXNA 4CGOA 4QBJA 4KSFA 5H86A 2PR8A 2YNDA 1P0HA 4U9ZA 3WR7A 4UWJA 2Z10A 5KTAA 5C82A 2WUUA 4BMHA 2IL4A 2VQYA 4EVYA 1PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5I A;  2J8N A;  2Y0M A;  1NE9 A;  2Q4V A;  4AG9 A;  4CAX A;  4DNC A;  5EC4 A;  5E96 A;  2FE7 A;  4QC6 A;  4CS0 B;  5HMN A;  4KOX A;  2EVN A;  3QB8 A;  4R57 A;  5ISV A;  1XE4 A;  4KOR A;  2Q7B A;  1QST A;  2FIW A;  2Z11 A;  2H5M A;  3B8G A;  4M3S A;  3V8I A;  4JXQ A;  3TOB A;  4YFJ A;  1U6M A;  1WK4 A;  2VEZ A;  1CJW A;  2B58 A;  4H89 A;  2BL1 A;  2OZH A;  2ATR A;  2VXK A;  1KZF A;  3EFA A;  5J8F A;  2PDO A;  4PK2 A;  1Q2Y A;  2OH1 A;  1M4G A;  2FT0 A;  1Z4R A;  3IWG A;  1MJ9 A;  3W91 A;  2Q4Y A;  2K5T A;  4RS2 A;  4IUS A;  2B4B A;  1BOB A;  1OZP A;  1CM0 A;  3FNC A;  4LX9 A;  4MI4 A;  2WPW A;  3TO9 A;  4JWP A;  2HUZ A;  4F6A A;  1S60 A;  3I9S A;  3TFY A;  2R8V A;  4L89 A;  2HV2 A;  1M4D A;  3DDD A;  4B5P A;  3OWC A;  2G0B A;  1IYK A;  4KUB A;  3R1K A;  1NMT A;  2CNM A;  3LD2 A;  3ZZI A;  2JDC A;  2REE A;  1WWZ A;  4H6Z A;  3TO7 A;  4KVM E;  1IYL A;  3TCV A;  4PK3 A;  4AVA A;  2EUI A;  2R98 A;  4PV6 A;  4MBU A;  3NE7 A;  1S5K A;  4CAV A;  1I1D A;  4X5K A;  3KKW A;  3IGR A;  3P2H A;  4JD6 A;  1P4N A;  4AB7 A;  4KOU A;  1B87 A;  4UWI A;  4YRH A;  3BLN A;  4FD5 A;  4R3L A;  4Y49 C;  4UBR A;  5F49 A;  2D4O A;  2JEV A;  3ZJ0 A;  1RXT A;  2P6F A;  2JDD A;  1XMT A;  4KVX A;  5JQ4 A;  4J3G A;  3DSB A;  3G3S A;  4U9Y A;  5HH1 A;  3R9F A;  4CRZ B;  1LRZ A;  2BUE A;  3S6H A;  4OAD A;  2B4D A;  3FYN A;  1NSL A;  3GY9 A;  4L8A A;  2ZXV A;  2P0W A;  2OZU A;  3PZJ A;  2ZW4 A;  4KLV A;  4E8O A;  5IB0 A;  1UFH A;  3BJ8 A;  4OAE A;  2QIR A;  1R57 A;  4ORF A;  2Q0Y A;  3SXO A;  1B6B A;  2B3V A;  1MJB A;  1Q2C A;  2X7B A;  4XPD B;  2RC4 A;  5F48 A;  4R87 A;  3GYA A;  1RO5 A;  4XPD C;  4II9 A;  2Q44 A;  4E0A A;  2OZG A;  3DR6 A;  1MK4 A;  3K9U A;  3D2M A;  4B5O A;  3FIX A;  4HKF A;  1S3Z A;  3T90 A;  1GHE A;  2BSW A;  4HNW B;  1M1D A;  4XPL A;  4Y49 B;  2CY2 A;  2PR1 A;  2G3T A;  2VZY A;  2ZW5 A;  1I21 A;  2QML A;  3FRM A;  1KUY A;  1PU9 A;  4FD6 A;  4B5P B;  2REF A;  1S7L A;  2FSR A;  3W6X A;  2FL4 A;  2BEI A;  2OU2 A;  4ZBG A;  2B4D B;  4HNX B;  2FIA A;  3CXS A;  1XIX A;  2VI7 A;  3S6G A;  3E0K A;  3VWE A;  1QSM A;  4KOY A;  1S7K A;  4NSQ A;  1QSN A;  2GE3 A;  2PQ8 A;  4CRY B;  3TT2 A;  1M44 A;  3D2P A;  4KOS A;  4R9M A;  5H84 A;  2C27 A;  3MGD A;  4MHD A;  2WPX A;  1Y9W A;  2D4P A;  1FY7 A;  3F5B A;  3G8W A;  4KOV A;  1QSO A;  2G3A A;  3JVN A;  3FB3 A;  2B5G B;  3EO4 A;  4OLL A;  4UA3 A;  1QSR A;  4NEX A;  1YK3 A;  2QEC A;  3CXP A;  2PC1 A;  5I0C A;  4R3K A;  3R9G A;  3DNS A;  4MJ8 A;  2ZW6 A;  3F8K A;  2AJ6 A;  4KZT A;  3TOA A;  5EBV A;  4QUS A;  3C26 A;  2Q04 A;  2HQY A;  1XEB A;  4H6U A;  5DWN A;  3VWD A;  2CNT A;  1YVK A;  3TTH A;  3D8P A;  4U5Y A;  4NXY A;  4F0Y A;  1IIC A;  5KTC A;  4KUA A;  3GKR A;  5CNP A;  1XF8 A;  5JPH A;  1YR0 A;  1KUX A;  3JUW A;  1Q2D A;  1TIQ A;  5F47 A;  2B3U A;  4FD7 A;  1MJA A;  3CXQ A;  1M4I A;  4KLW A;  4RI1 A;  3SXN A;  1S7N A;  1IB1 E;  1YGH A;  1YRE A;  4FD4 A;  1Y7R A;  1I12 A;  3S6K A;  2B5G A;  2VBQ A;  4AVB A;  1Y9K A;  4QB9 A;  1Z4E A;  1YLE A;  3S6F A;  4KVO E;  1IID A;  2FCK A;  3R9E A;  1K4J A;  3QAH A;  1N71 A;  2CNS A;  3R96 A;  3I3G A;  4ONU A;  2GAN A;  4E2A A;  2GIV A;  3PGP A;  5KTD A;  5F46 A;  5IV0 A;  3F0A A;  2VZZ A;  3FBU A;  2ARH A;  2ZPA A;  1J4J A;  1V0C A;  5C88 A;  2FXF A;  4M85 A;  2I79 A;  4QVT A;  3DR8 A;  3H4Q A;  4MY0 A;  1S7F A;  2JLM A;  2FS5 A;  2OB0 A;  4HNY B;  4K30 A;  4KOW A;  2NMT A;  4CAW A;  5GCN A;  3UY5 A;  3EY5 A;  2R7H A;  4XPK A;  3W6S A;  1YVO A;  3N7Z A;  4YGO A;  2P6E A;  2R1I A;  3T9Y A;  1VHS A;  4JLY A;  1YX0 A;  2A4N A;  2J8M A;  2PRB A;  4JJX A;  5J8C A;  2J8R A;  3D3S A;  3TO6 A;  2I00 A;  2O28 A;  4XNH C;  4GS4 A;  2ZW7 A;  4I49 A;  1SQH A;  2AE6 A;  3LOD A;  3EC4 A;  3RYO A;  5IX3 A;  3P2F A;  2P6G A;  1KUV A;  4NCZ A;  5FVJ A;  4PSX A;  1Z9U A;  4PSW A;  2PSW A;  5DWM A;  4IF5 A;  2Z0Z A;  1ON0 A;  3BJ7 A;  4JXR A;  3TE4 A;  3FXT A;  4NF1 A;  4AVC A;  1L0C A;  2DXQ A;  4XNH B;  3R95 A;  3PP9 A;  2KCW A;  4MY3 A;  4LUA A;  1BO4 A;  4AG7 A;  3SHP A;  4KOT A;  1VKC A;  3EXN A;  4QBJ A;  5H86 A;  2PR8 A;  1P0H A;  4U9Z A;  3WR7 A;  4UWJ A;  2Z10 A;  5KTA A;  5C82 A;  4BMH A;  2IL4 A;  2VQY A;  4EVY A;  1PUA A; 
#chains in the Genus database with same CATH topology
 4AXV A;  2F5I A;  2J8N A;  2Y0M A;  1NE9 A;  1GYT A;  2Q4V A;  3D7F A;  4AG9 A;  4NGT A;  4CAX A;  5EC4 A;  5E96 A;  4DNC A;  2FE7 A;  4QC6 A;  4Z65 A;  5JH9 A;  4CS0 B;  5HMN A;  4JYW A;  4ZX9 A;  1TKJ A;  4KOX A;  4PXB A;  5LRJ A;  2EVN A;  3QB8 A;  4R57 A;  5ISV A;  1ZLH A;  2NYQ A;  1XE4 A;  4KOR A;  2ZEP A;  2Q7B A;  1QST A;  2FIW A;  2JBK A;  2Z11 A;  1ELM P;  4CYO A;  2H5M A;  3B8G A;  5AG7 A;  4M3S A;  2PIZ A;  3V8I A;  4LQ6 A;  2V8G A;  4JXQ A;  3TOB A;  4YFJ A;  1U6M A;  2Z3N A;  1BAV A;  1WK4 A;  2CXA A;  2VEZ A;  3H5Z A;  1CJW A;  4P4J A;  1XBU A;  2F7V A;  2B58 A;  1FNO A;  4H89 A;  3D7H A;  2BL1 A;  2OZH A;  2ATR A;  3FMC A;  4PXC A;  2IQ6 A;  2VXK A;  4MFQ A;  1KZF A;  3EFA A;  4A31 A;  5J8F A;  2PDO A;  4MCP A;  4PK2 A;  1Q2Y A;  1CBX A;  2OH1 A;  2PJC A;  1M4G A;  5EMI A;  4CYN A;  2FT0 A;  4FAI A;  1Z4R A;  3IWG A;  1MJ9 A;  3W91 A;  2Q4Y A;  2GRE A;  3PB8 X;  3FVL A;  4RN7 A;  4P4E A;  2K5T A;  2PVV A;  3D4U A;  4RS2 A;  4IUS A;  2B4B A;  1F57 A;  4MFK A;  4OC4 A;  3VAR A;  3WAB A;  1BOB A;  1OZP A;  1CM0 A;  3FNC A;  4LX9 A;  4MI4 A;  2WPW A;  3ISX A;  3TO9 A;  4JWP A;  4CGM A;  2HUZ A;  4G1P A;  2PJB A;  4NGM A;  1F2P A;  4ZGY B;  4F6A A;  5I4M A;  1HEE A;  1S60 A;  3I9S A;  2ANP A;  1QMU A;  4PXD A;  3NFZ A;  3TFY A;  2R8V A;  2QVP A;  3JTK A;  4OKO A;  4L89 A;  2HV2 A;  1M4D A;  1VIX A;  2G9D A;  3DDD A;  4B5P A;  3OWC A;  5IB9 A;  1TF8 A;  4B10 A;  2G0B A;  4ZY2 A;  5LYI A;  2C6P A;  1IYK A;  2DF5 A;  2Z3P A;  4KUB A;  2AFU A;  3R1K A;  2YNE A;  1NMT A;  2ZEM A;  1NSA A;  2CNM A;  3LD2 A;  3LWU A;  3ZZI A;  2JDC A;  4M6I A;  1Q7L A;  2REE A;  3SJF A;  1WWZ A;  3RAM A;  4ZYQ A;  4H6Z A;  3MRU A;  2AFO A;  3FJU A;  4WWV A;  1XJO A;  3TO7 A;  4KVM E;  1IYL A;  4R76 A;  3TCV A;  2ZEL A;  4R8F A;  1YLO A;  6CPA A;  2QJ8 A;  4PK3 A;  4AVA A;  1XRY A;  2EUI A;  2R98 A;  1LCP A;  4PV6 A;  4NJR A;  3QNV A;  8CPA A;  4MBU A;  4A37 A;  4C68 A;  2Z3L A;  3NE7 A;  4CRY B;  1S5K A;  4C2X A;  4X8I A;  4CAV A;  4BD9 A;  1I1D A;  4X5K A;  2PJ8 A;  3KKW A;  2PJ1 A;  3IGR A;  3P2H A;  1Y7E A;  4JD6 A;  4MCS A;  4CGP A;  1P4N A;  4A95 A;  4AB7 A;  4KOU A;  1LAM A;  1B87 A;  4UWI A;  4YRH A;  4Q7A A;  3PRT A;  2PVW A;  3BLN A;  3S9L A;  4FD5 A;  4R3L A;  5AGE A;  3IJ3 A;  1Z5R A;  4KSI A;  2VL1 A;  4Y49 C;  3KAS A;  1LOK A;  3K2K A;  3KR4 A;  3B2Y A;  4GM5 A;  4UBR A;  5F49 A;  2D4O A;  2IJZ A;  2JEV A;  2F8H A;  1RXT A;  2P6F A;  3ZJ0 A;  4UCP A;  3GIU A;  4UEE A;  3NH4 A;  2JDD A;  3CT9 A;  5THW A;  3WC5 A;  2FVG A;  2CF4 A;  1CP6 A;  3LMS A;  3PFE A;  1XMT A;  4KVX A;  5JQ4 A;  4J3G A;  3IFE A;  3NE8 A;  1YW6 A;  1ZG7 A;  3DSB A;  3FH4 A;  3H8E A;  3G3S A;  1TF9 A;  4PQA A;  3D66 A;  4U9Y A;  1AYE A;  4IK2 A;  4K3N A;  4A38 A;  4CGL A;  5HH1 A;  4YWY A;  1BLL E;  3R9F A;  5G20 A;  1TXR A;  4CRZ B;  1LRZ A;  2XEJ A;  2DEA A;  2BUE A;  3T8W A;  3I1U A;  3S6H A;  4OAD A;  4P45 A;  5HVF A;  2B4D A;  1IOI A;  3FYN A;  3IO1 A;  3PFO A;  3WT4 A;  3KQZ A;  4DYO A;  4TWE A;  1A2Z A;  5G22 A;  1VHO A;  5DS0 A;  4OP4 A;  1NSL A;  1ZO0 A;  3GY9 A;  4L8A A;  4ZY0 A;  4MMO A;  2ZXV A;  2P0W A;  2OZU A;  2ZW4 A;  3PZJ A;  4KLV A;  4E8O A;  5IB0 A;  3GLJ A;  4B14 A;  1UFH A;  3BJ8 A;  3D68 A;  4MCR A;  4OAE A;  3B35 A;  2QIR A;  1R57 A;  1OBR A;  2EBJ A;  2Q0Y A;  4ORF A;  3SI1 A;  1B6B A;  3PEI A;  3SXO A;  4BIN A;  5AG5 A;  3RO0 A;  4P4F A;  2B3V A;  4NGN A;  1LFW A;  2GU2 A;  1MJB A;  1Q2C A;  1UWY A;  1Y0R A;  2BO9 A;  2X7B A;  4XPD B;  3SJE A;  2RC4 A;  5F48 A;  1XOV A;  3GYA A;  4R87 A;  2XEF A;  2QYV A;  2ZEO A;  1RO5 A;  4CGN A;  2XEG A;  2Z3K A;  3KHX A;  3WC7 A;  4XPD C;  3SI0 A;  4II9 A;  3SI2 A;  2Q44 A;  4E0A A;  3KQX A;  2OZG A;  3DR6 A;  2PJ5 A;  4F0X A;  1MK4 A;  2DPS A;  3D2M A;  3K9U A;  4B5O A;  3FIX A;  4HKF A;  1S3Z A;  3T90 A;  1GHE A;  3IU2 A;  2BSW A;  2V8D A;  5LYD A;  4HNW B;  3D67 A;  3KHZ A;  1M1D A;  4PXE A;  4XPL A;  2AFM A;  4Y49 B;  4LQG A;  1R3N A;  5K8N A;  5F09 A;  3DGV A;  2AFZ A;  3D7D A;  2CY2 A;  2PR1 A;  2G3T A;  2VZY A;  3BHX A;  4MHY A;  2DPT A;  2BCO A;  1ZLI A;  4YU9 A;  3NA6 A;  2EWB A;  2ZW5 A;  1I21 A;  3IIB A;  2PJ6 A;  2JBJ A;  4P6Y A;  2QML A;  2Q4Z A;  3FRM A;  4UIA A;  1KUY A;  1PU9 A;  3DLJ A;  3S9N A;  2WYR A;  4FD6 A;  3VH9 A;  4B5P B;  1IGB A;  4MHZ A;  5JGF A;  2PJ9 A;  2REF A;  1S7L A;  2FSR A;  3IEH A;  3W6X A;  2FL4 A;  3V7Z A;  2BEI A;  3IWE A;  3PBE A;  4C7H A;  2OU2 A;  4EFD A;  2YNC C;  4CAF A;  3B3V A;  4ZBG A;  2JEW A;  2B4D B;  4HNX B;  2FIA A;  3CXS A;  1XIX A;  2PJA A;  2Q43 A;  4UCN A;  2WZN A;  4UFV A;  2VI7 A;  3KGQ A;  3S6G A;  4Q36 A;  3E0K A;  3VWE A;  1QSM A;  4KOY A;  1S7K A;  4NSQ A;  1QSN A;  2GE3 A;  1YQE A;  2PQ8 A;  1M4L A;  4ZY1 A;  1BPN A;  5ELY A;  3KR5 A;  2AFX A;  3TT2 A;  4IHM A;  1M44 A;  3D2P A;  4OIW A;  3WC6 A;  4KOS A;  4A2Z A;  1Z8T A;  3CPA A;  4MFZ A;  4R9M A;  5H84 A;  4B11 A;  3L2N A;  2C27 A;  3MGD A;  4MHD A;  4X2T A;  3D7G A;  2WPX A;  3SJX A;  1Y9W A;  5K8O A;  2D4P A;  2AFW A;  1FY7 A;  3F5B A;  3G8W A;  4KOV A;  2BOA A;  2O4H A;  1QSO A;  2G3A A;  3PB7 X;  1Z8L A;  3JVN A;  4H2K A;  3FB3 A;  2B5G B;  3EO4 A;  4OLL A;  3FF3 A;  4EME A;  1TKF A;  4UA3 A;  1QSR A;  4NEX A;  1YK3 A;  1ARL A;  1ZG8 A;  2QEC A;  3H8F A;  4CPA A;  3CXP A;  2PC1 A;  5I0C A;  5K8M A;  1LAP A;  4R3K A;  2CTC A;  3R9G A;  1YSJ A;  2GFQ A;  3DNS A;  2C6C A;  4FWU A;  4MJ8 A;  2ZW6 A;  4OC0 A;  3F8K A;  2AJ6 A;  4KZT A;  1FT7 A;  3TOA A;  1QQ9 A;  4MRI A;  5D29 A;  5EBV A;  4QUS A;  3BI0 A;  3FEC A;  3C26 A;  4A33 A;  4C2Z A;  2Q04 A;  2HQY A;  1XEB A;  2CTB A;  4H6U A;  3MN8 A;  2PJ3 A;  5DWN A;  5HXD A;  3VWD A;  2CNT A;  1YVK A;  4KSA A;  3BI1 A;  4P4D A;  3B3C A;  4R7M A;  3TTH A;  3D8P A;  4CAE A;  2PRQ A;  4U5Y A;  2ZEG A;  5D8N A;  4NXY A;  4F0Y A;  4PPZ A;  1PYT B;  1LAN A;  2V77 A;  1IIC A;  4FUU A;  4UFW A;  5HVH A;  3RBU A;  2Z3M A;  5KTC A;  3CPX A;  4KUA A;  3GKR A;  4MFP A;  3ISZ A;  2XEI A;  5CNP A;  1DTD A;  1XF8 A;  5BWA B;  1ARM A;  4NGR A;  1Z2L A;  3TX8 A;  4P4I A;  1YR0 A;  1KUX A;  3JUW A;  1X10 A;  1Q2D A;  3CDX A;  3PBB A;  1TIQ A;  5F47 A;  4W9Y A;  2B3U A;  4FD7 A;  4A39 A;  4P44 A;  4CYP A;  5A28 A;  3HLP A;  1MJA A;  3CXQ A;  4F9U A;  3KI9 A;  1M4I A;  2PJ2 A;  4EWT A;  4KLW A;  4RI1 A;  2ODF A;  5AG6 A;  3B7I A;  3SXN A;  2ZEH A;  2Q51 A;  4B12 A;  1XFO A;  1S7N A;  1IB1 E;  1ZG9 A;  3RZA A;  1YGH A;  1YRE A;  5G21 A;  4WJB A;  4FD4 A;  1Y7R A;  1CX8 A;  1I12 A;  3S6K A;  2I3C A;  2J9A A;  2PJ7 A;  4ONW A;  5J1Q A;  2B5G A;  2VBQ A;  3KL9 A;  4AVB A;  4UCM A;  2RB7 A;  4P10 A;  3TC8 A;  1XMB A;  3A9L A;  1Y9K A;  1JWQ A;  1Z4E A;  1YLE A;  4QB9 A;  4IAV A;  3S6F A;  4KVO E;  1IID A;  4NJQ A;  2FCK A;  3R9E A;  5HVG A;  5JM6 A;  2Z3O A;  1K4J A;  1HDU A;  3QAH A;  1VGY A;  5AG4 A;  1N71 A;  3B3S A;  2CNS A;  3IU1 A;  3I3G A;  2HC9 A;  3R96 A;  4ONU A;  2GAN A;  4OC5 A;  4X3R A;  3VAT A;  1JQG A;  4E2A A;  4B13 A;  1KWM A;  2GIV A;  3PGP A;  1AMP A;  5KTD A;  5F46 A;  4CYQ A;  5IV0 A;  2EK8 A;  3F0A A;  2VZZ A;  1AUG A;  3FBU A;  2ARH A;  2C1C A;  1H8L A;  2ZPA A;  4ZI6 A;  4UEZ A;  4Q38 A;  1J4J A;  1V0C A;  3BXM A;  2PE3 A;  5C88 A;  2POK A;  2FXF A;  4M85 A;  4MFL A;  2I79 A;  2HB6 A;  4QVT A;  3SJG A;  2YGW A;  2PIY A;  4KS9 A;  3DR8 A;  2EO8 A;  3B3W A;  3H4Q A;  4MY0 A;  1S7F A;  2RFH A;  2JLM A;  2PJ0 A;  5LRK A;  4C2Y A;  2FS5 A;  1CPX A;  2V8V A;  3IC1 A;  2ZOF A;  2OB0 A;  4HNY B;  5CBM A;  1RTQ A;  2ZEN A;  4NGS A;  2ZOG A;  4K30 A;  5G1Z A;  4KOW A;  2NMT A;  4CAW A;  5GCN A;  4OID A;  3UY5 A;  3EY5 A;  4JZ0 A;  2R7H A;  4NFR A;  4XPK A;  3W6S A;  1YVO A;  3GB0 A;  3N7Z A;  1BPM A;  3KZW A;  3HUV A;  4YGO A;  4B6Z A;  3FX6 A;  2P6E A;  4O23 A;  3IWW A;  2ZED A;  1IOF A;  2R1I A;  1VHS A;  3T9Y A;  1EE3 P;  1IY7 A;  4JLY A;  2AFS A;  1YX0 A;  2A4N A;  4R6T A;  2J8M A;  2PRB A;  4JJX A;  4NGQ A;  4OC1 A;  2J8R A;  5J8C A;  2ABZ A;  3D3S A;  4A32 A;  1PCA A;  3JRU A;  4MHP A;  2OOT A;  3TO6 A;  2I00 A;  7CPA A;  2ZEE A;  2NSM A;  2O28 A;  3CZX A;  4XNH C;  2IMO A;  3K9T A;  4GS4 A;  2ZW7 A;  3V38 A;  4I49 A;  4HPS A;  5LYL A;  4OC3 A;  1SQH A;  2AE6 A;  4OME A;  1Z8W A;  3N5F A;  4MFJ A;  4MHN A;  3LOD A;  3EC4 A;  3RYO A;  5IX3 A;  3P2F A;  4GXH A;  2P6G A;  4F9V A;  1KUV A;  2Q7S A;  2OR4 A;  4F8Z A;  5CPA A;  5LYF A;  4NCZ A;  5FVJ A;  1CG2 A;  3FED A;  4PSX A;  1Z9U A;  4PSW A;  4OC2 A;  4FBE A;  1YW4 A;  4M6H A;  4UEF A;  3RNZ A;  2PSW A;  5K8P A;  1ELL P;  5DWM A;  3S9M A;  4IF5 A;  1HDQ A;  4C7I A;  2Z0Z A;  1ON0 A;  2YNC A;  3BJ7 A;  4ZX8 A;  1CPS A;  1TKH A;  4JXR A;  3TE4 A;  3LAC A;  3FXT A;  4NF1 A;  3NH5 A;  4UF4 A;  4AVC A;  5JPH A;  2PCU A;  3H8G A;  1L0C A;  2EK9 A;  4A30 A;  2DXQ A;  4BBH A;  4XNH B;  4P4B A;  5LRG A;  3R95 A;  4UFX A;  3PP9 A;  1YME A;  1Z8X A;  2WSA A;  2KCW A;  4MY3 A;  4A94 A;  5A27 A;  1Y0Y A;  2C6G A;  4LUA A;  1IU8 A;  1X12 A;  4UIB A;  1BO4 A;  4AG7 A;  3QAY A;  2CIJ A;  3SHP A;  2GLJ A;  4KOT A;  1CP7 A;  2V8H A;  3PB4 X;  4DUK A;  1VKC A;  3EXN A;  4CGO A;  4QBJ A;  4KSF A;  2O53 A;  1F2O A;  5H86 A;  3GUX A;  4RUH A;  3FEE A;  1VHE A;  3NH8 A;  2PR8 A;  2YND A;  3PB9 X;  1P0H A;  4U9Z A;  3WR7 A;  4UWJ A;  3PB6 X;  4NGP A;  1DE4 C;  2Z10 A;  4TNU A;  3B3T A;  5KTA A;  5C82 A;  2GLF A;  4M6G A;  4MCQ A;  2ZEF A;  2WUU A;  4MXU A;  1R43 A;  4BMH A;  2IL4 A;  2VQY A;  4DJL A;  4EVY A;  1PUA A;  2PJ4 A; 
#chains in the Genus database with same CATH homology
 2F5I A;  2J8N A;  2Y0M A;  1NE9 A;  2Q4V A;  4AG9 A;  4CAX A;  4DNC A;  5EC4 A;  5E96 A;  2FE7 A;  4QC6 A;  4CS0 B;  5HMN A;  4KOX A;  2EVN A;  3QB8 A;  4R57 A;  5ISV A;  1XE4 A;  4KOR A;  2Q7B A;  1QST A;  2FIW A;  2Z11 A;  4CYO A;  2H5M A;  3B8G A;  5AG7 A;  4M3S A;  3V8I A;  4JXQ A;  3TOB A;  4YFJ A;  1U6M A;  2Z3N A;  1WK4 A;  2CXA A;  2VEZ A;  3H5Z A;  1CJW A;  2B58 A;  4H89 A;  2BL1 A;  2OZH A;  2ATR A;  2VXK A;  4MFQ A;  1KZF A;  3EFA A;  4A31 A;  5J8F A;  2PDO A;  4PK2 A;  1Q2Y A;  2OH1 A;  1M4G A;  4CYN A;  2FT0 A;  1Z4R A;  3IWG A;  1MJ9 A;  3W91 A;  2Q4Y A;  2K5T A;  4RS2 A;  4IUS A;  2B4B A;  4MFK A;  1BOB A;  1OZP A;  1CM0 A;  3FNC A;  4LX9 A;  4MI4 A;  2WPW A;  3TO9 A;  4JWP A;  4CGM A;  2HUZ A;  4ZGY B;  4F6A A;  1S60 A;  3I9S A;  3TFY A;  2R8V A;  3JTK A;  4L89 A;  2HV2 A;  1M4D A;  3DDD A;  4B5P A;  3OWC A;  4B10 A;  2G0B A;  1IYK A;  2Z3P A;  4KUB A;  3R1K A;  2YNE A;  1NMT A;  2CNM A;  3LD2 A;  3ZZI A;  2JDC A;  2REE A;  1WWZ A;  4H6Z A;  3TO7 A;  4KVM E;  1IYL A;  3TCV A;  4PK3 A;  4AVA A;  2EUI A;  2R98 A;  4PV6 A;  4MBU A;  4C68 A;  2Z3L A;  3NE7 A;  1S5K A;  4C2X A;  4CAV A;  1I1D A;  4X5K A;  3KKW A;  3IGR A;  3P2H A;  4JD6 A;  4CGP A;  1P4N A;  4A95 A;  4AB7 A;  4KOU A;  1B87 A;  4UWI A;  4YRH A;  3BLN A;  4FD5 A;  4R3L A;  5AGE A;  4Y49 C;  4UBR A;  5F49 A;  2D4O A;  2JEV A;  3ZJ0 A;  1RXT A;  2P6F A;  4UCP A;  2JDD A;  1XMT A;  4KVX A;  5JQ4 A;  4J3G A;  3DSB A;  3G3S A;  4U9Y A;  4CGL A;  5HH1 A;  3R9F A;  5G20 A;  4CRZ B;  1LRZ A;  2BUE A;  3S6H A;  4OAD A;  2B4D A;  3FYN A;  5G22 A;  1NSL A;  1ZO0 A;  3GY9 A;  4L8A A;  2ZXV A;  2P0W A;  2OZU A;  3PZJ A;  2ZW4 A;  4KLV A;  4E8O A;  5IB0 A;  4B14 A;  1UFH A;  3BJ8 A;  4OAE A;  2QIR A;  1R57 A;  4ORF A;  2Q0Y A;  3SXO A;  1B6B A;  5AG5 A;  2B3V A;  1MJB A;  1Q2C A;  2X7B A;  4XPD B;  2RC4 A;  5F48 A;  4R87 A;  3GYA A;  4CGN A;  1RO5 A;  2Z3K A;  4XPD C;  4II9 A;  2Q44 A;  4E0A A;  2OZG A;  3DR6 A;  4F0X A;  1MK4 A;  2DPS A;  3D2M A;  3K9U A;  4B5O A;  3FIX A;  4HKF A;  1S3Z A;  3T90 A;  1GHE A;  3IU2 A;  2BSW A;  4HNW B;  1M1D A;  4XPL A;  4Y49 B;  2CY2 A;  2PR1 A;  2G3T A;  2VZY A;  2DPT A;  2ZW5 A;  1I21 A;  2QML A;  3FRM A;  1KUY A;  1PU9 A;  4FD6 A;  4B5P B;  2REF A;  1S7L A;  2FSR A;  3W6X A;  2FL4 A;  2BEI A;  3IWE A;  4C7H A;  2OU2 A;  2YNC C;  4CAF A;  4ZBG A;  2B4D B;  4HNX B;  2FIA A;  3CXS A;  1XIX A;  4UCN A;  4UFV A;  2VI7 A;  3S6G A;  4Q36 A;  3E0K A;  3VWE A;  1QSM A;  4KOY A;  1S7K A;  4NSQ A;  1QSN A;  2GE3 A;  2PQ8 A;  4CRY B;  3TT2 A;  4A2Z A;  1M44 A;  3D2P A;  4KOS A;  4MFZ A;  4R9M A;  5H84 A;  4B11 A;  2C27 A;  3MGD A;  4MHD A;  2WPX A;  1Y9W A;  2D4P A;  1FY7 A;  3F5B A;  3G8W A;  4KOV A;  1QSO A;  2G3A A;  3JVN A;  3FB3 A;  2B5G B;  3EO4 A;  4OLL A;  4UA3 A;  1QSR A;  4NEX A;  1YK3 A;  2QEC A;  3CXP A;  2PC1 A;  5I0C A;  4R3K A;  3R9G A;  3DNS A;  4MJ8 A;  2ZW6 A;  3F8K A;  2AJ6 A;  4KZT A;  3TOA A;  5EBV A;  4QUS A;  4A33 A;  3C26 A;  4C2Z A;  2Q04 A;  2HQY A;  1XEB A;  4H6U A;  5DWN A;  3VWD A;  2CNT A;  1YVK A;  4KSA A;  3TTH A;  3D8P A;  4CAE A;  4U5Y A;  4NXY A;  4F0Y A;  1IIC A;  4UFW A;  2Z3M A;  5KTC A;  4KUA A;  3GKR A;  4MFP A;  5CNP A;  1XF8 A;  5BWA B;  5JPH A;  1YR0 A;  1KUX A;  3JUW A;  1Q2D A;  1TIQ A;  5F47 A;  2B3U A;  4FD7 A;  4CYP A;  5A28 A;  1MJA A;  3CXQ A;  1M4I A;  4KLW A;  4RI1 A;  5AG6 A;  3SXN A;  4B12 A;  1S7N A;  1IB1 E;  1YGH A;  1YRE A;  5G21 A;  4FD4 A;  1Y7R A;  1I12 A;  3S6K A;  2B5G A;  2VBQ A;  4AVB A;  4UCM A;  3A9L A;  1Y9K A;  4QB9 A;  1Z4E A;  1YLE A;  3S6F A;  4KVO E;  1IID A;  2FCK A;  3R9E A;  2Z3O A;  1K4J A;  3QAH A;  5AG4 A;  1N71 A;  2CNS A;  3IU1 A;  3I3G A;  3R96 A;  4ONU A;  2GAN A;  4E2A A;  4B13 A;  2GIV A;  3PGP A;  5KTD A;  5F46 A;  4CYQ A;  5IV0 A;  3F0A A;  2VZZ A;  3FBU A;  2ARH A;  2ZPA A;  4Q38 A;  1J4J A;  1V0C A;  5C88 A;  2FXF A;  4M85 A;  4MFL A;  2I79 A;  4QVT A;  2YGW A;  4KS9 A;  3DR8 A;  3H4Q A;  4MY0 A;  1S7F A;  2JLM A;  4C2Y A;  2FS5 A;  2OB0 A;  4HNY B;  4K30 A;  5G1Z A;  4KOW A;  2NMT A;  4CAW A;  5GCN A;  3UY5 A;  3EY5 A;  2R7H A;  4XPK A;  3W6S A;  1YVO A;  3N7Z A;  4YGO A;  2P6E A;  2R1I A;  3T9Y A;  1VHS A;  4JLY A;  1YX0 A;  2A4N A;  2J8M A;  2PRB A;  4JJX A;  5J8C A;  2J8R A;  3D3S A;  4A32 A;  3TO6 A;  2I00 A;  2O28 A;  4XNH C;  4GS4 A;  2ZW7 A;  4I49 A;  1SQH A;  2AE6 A;  4MFJ A;  3LOD A;  3EC4 A;  3RYO A;  5IX3 A;  3P2F A;  2P6G A;  1KUV A;  4NCZ A;  5FVJ A;  4PSX A;  1Z9U A;  4PSW A;  2PSW A;  5DWM A;  4C7I A;  4IF5 A;  2Z0Z A;  1ON0 A;  2YNC A;  3BJ7 A;  4JXR A;  3TE4 A;  3FXT A;  4NF1 A;  4AVC A;  4A30 A;  1L0C A;  4BBH A;  2DXQ A;  4XNH B;  3R95 A;  4UFX A;  3PP9 A;  2WSA A;  2KCW A;  4MY3 A;  5A27 A;  4LUA A;  1BO4 A;  4AG7 A;  3SHP A;  4KOT A;  1VKC A;  3EXN A;  4CGO A;  4QBJ A;  4KSF A;  5H86 A;  2PR8 A;  2YND A;  1P0H A;  4U9Z A;  3WR7 A;  4UWJ A;  2Z10 A;  5KTA A;  5C82 A;  2WUU A;  4BMH A;  2IL4 A;  2VQY A;  4EVY A;  1PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...