3R96A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 57
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r96A00
1RXTA 3G3SA 2NMTA 3B8GA 1Q2YA 4NXYA 2Q7BA 3K9UA 3IWGA 2ZW7A 2I79A 1XMTA 2ZXVA 5C88A 5DWNA 3MGDA 1KZFA 1L0CA 4CAVA 3JVNA 2VEZA 4AG9A 2VZYA 4KOSA 4ZBGA 3D3SA 4KVME 5HH1A 2Q4YA 3I3GA 2R7HA 1M4IA 3QAHA 1LRZA 4ONUA 5KTCA 1S7NA 2OZUA 4MI4A 2KCWA 4RI1A 3H4QA 4FD5A 5ISVA 3SHPA 4X5KA 3BLNA 4E8OA 3S6FA 5F48A 2Y0MA 3CXQA 4NCZA 4R3KA 2OZGA 4L89A 3E0KA 2BUEA 4FD4A 2ZW6A 5E96A 2VXKA 1I21A 2Z11A 4II9A 2B5GB 1KUYA 2JEVA 3DNSA 4NSQA 1B87A 3TO9A 2R8VA 3BJ8A 4BMHA 1IIDA 1XIXA 1KUXA 2WPWA 1K4JA 1S7LA 1QSTA 4GS4A 1M1DA 2D4PA 4H89A 2FS5A 1YREA 4JLYA 1BO4A 4MJ8A 3R9FA 4AG7A 4XNHC 3N7ZA 2P6EA 5HMNA 2FE7A 2I00A 1V0CA 1MJBA 2AE6A 3D8PA 3CXSA 3EFAA 2AJ6A 3TTHA 3F5BA 1P0HA 2G0BA 2ZW4A 2VBQA 1WK4A 1NSLA 4MY3A 5J8FA 4KOWA 1UFHA 4PSWA 2PR8A 3DSBA 1XE4A 3DR8A 4KOXA 3EO4A 2B4DA 4PK2A 2RC4A 4OAEA 2ARHA 1S5KA 4KVXA 1Q2CA 4CAXA 4QBJA 4KZTA 4JJXA 2C27A 4HNXB 2JDDA 4J3GA 2ATRA 3FXTA 1VKCA 3EXNA 3G8WA 1Y9WA 2Z0ZA 4R57A 4U9ZA 4KOTA 4KUBA 1N71A 4E0AA 4KOYA 4R3LA 4OADA 2PQ8A 3UY5A 2PDOA 3V8IA 2B5GA 4KOVA 1J4JA 1IYLA 4NF1A 4CRZB 4KVOE 1P4NA 2CY2A 4M85A 3R95A 2WPXA 1YVKA 5JQ4A 1XEBA 1M4GA 2R98A 1TIQA 2BL1A 1M4DA 3VWDA 2Q4VA 4H6ZA 2GIVA 3TE4A 4JD6A 2B3VA 3S6KA 2FIAA 3JUWA 3PP9A 2D4OA 4UBRA 1M44A 4ORFA 3TFYA 4FD6A 5F49A 4U9YA 2A4NA 3GKRA 2GE3A 1VHSA 1CJWA 5IX3A 5IV0A 1B6BA 4QUSA 3ZZIA 2R1IA 5F47A 4JWPA 3EC4A 3S6GA 1U6MA 2BSWA 4KLWA 4KUAA 3ZJ0A 3W6XA 3P2FA 1Y7RA 2FT0A 2J8RA 5KTAA 4AVBA 3TOAA 4XPDC 1YVOA 4RS2A 4M3SA 2PRBA 1S60A 5KTDA 2HV2A 5C82A 1IICA 4B5PA 3I9SA 4PSXA 4FD7A 2ZW5A 1YR0A 2CNMA 2ZPAA 2FCKA 2FSRA 1Z9UA 1PUAA 4MY0A 2FIWA 4XNHB 5IB0A 3F0AA 5CNPA 4F6AA 4NEXA 4QB9A 3S6HA 1XF8A 1YLEA 1SQHA 2GANA 3TO7A 3LD2A 5EC4A 4K30A 3R9EA 1QSOA 4AB7A 4IUSA 1YGHA 2B4BA 4EVYA 2HQYA 2QMLA 2X7BA 3FRMA 2PR1A 1Q2DA 1WWZA 2G3AA 4MBUA 1CM0A 3T90A 4Y49C 2EVNA 2O28A 4YFJA 5JPHA 2Q04A 1BOBA 4DNCA 2OH1A 1ON0A 3W91A 1Z4EA 3RYOA 2REEA 2OB0A 3DDDA 4PK3A 4AVAA 2PSWA 3FB3A 4QC6A 2DXQA 5GCNA 4U5YA 4HNWB 1QSRA 3W6SA 1NMTA 3CXPA 4HNYB 2Z10A 2Q44A 2HUZA 4JXRA 5H86A 3R1KA 1R57A 3TOBA 1YX0A 4YGOA 3FIXA 3R96A 3FNCA 2QECA 1OZPA 1Y9KA 4XPLA 3D2MA 4KORA 3OWCA 2PC1A 1I1DA 5I0CA 3P2HA 2VQYA 5H84A 2B4DB 1QSMA 3TO6A 3R9GA 2G3TA 3D2PA 2FL4A 3GYAA 3GY9A 4CS0B 4UWIA 4AVCA 2B3UA 2CNTA 2P0WA 3QB8A 5FVJA 4CRYB 2JDCA 4KLVA 1IYKA 4R87A 2P6FA 3EY5A 1S7FA 2JLMA 1QSNA 3VWEA 3F8KA 4UA3A 4CAWA 4JXQA 4XPDB 2Q0YA 4UWJA 4LX9A 2H5MA 3TT2A 2VZZA 2CNSA 4B5OA 1S7KA 3PZJA 4R9MA 5F46A 3IGRA 3PGPA 1MJ9A 3LODA 2FXFA 2OU2A 1MK4A 3SXNA 1S3ZA 1Z4RA 4KOUA 1YK3A 3NE7A 4HKFA 1I12A 2B58A 3TCVA 2K5TA 4H6UA 4IF5A 2P6GA 1MJAA 3DR6A 5DWMA 1IB1E 4YRHA 1NE9A 2BEIA 2QIRA 5J8CA 3WR7A 2F5IA 3BJ7A 1GHEA 3KKWA 1KUVA 2J8NA 4L8AA 5EBVA 4XPKA 1PU9A 4I49A 2OZHA 1RO5A 2REFA 3FYNA 3T9YA 4Y49B 2EUIA 3FBUA 2J8MA 3SXOA 4PV6A 3C26A 2VI7A 4E2AA 4F0YA 2IL4A 4LUAA 4OLLA 4QVTA 4MHDA 4B5PB 1FY7A
chains in the Genus database with same CATH superfamily
2PJ7A 1RXTA 2V8VA 3G3SA 1CG2A 2NMTA 2PJ1A 2V77A 3B8GA 4CYPA 1Q2YA 4NXYA 4MMOA 1YLOA 4MHPA 4UCPA 2Q7BA 1LOKA 3K9UA 3IWGA 2ZW7A 2I79A 4F0XA 2XEGA 3DGVA 4RUHA 1XMTA 1Z5RA 1Z8XA 2ZXVA 5C88A 4MCSA 5DWNA 3KR4A 3MGDA 1KZFA 2CXAA 1L0CA 4CAVA 3JVNA 3B3CA 4UEFA 4C68A 2VEZA 1X10A 4B11A 2PJ5A 4AG9A 4WWVA 3D7HA 3PB9X 4DJLA 1YW6A 5AG5A 3BXMA 4H2KA 5K8MA 2VZYA 4KOSA 4ZBGA 3D3SA 2PJ9A 4KVME 4R8FA 2ZEMA 5HH1A 2Q4YA 3I3GA 2EK9A 2R7HA 1M4IA 3QAHA 3RAMA 1LRZA 4ONUA 4GXHA 4ZGYB 5KTCA 4P45A 4C7IA 1S7NA 2OZUA 2AFUA 1ELMP 2GFQA 4MI4A 2KCWA 2ZEDA 3SJFA 4CAEA 4RI1A 3H4QA 4OC1A 1Z8TA 4FD5A 1LFWA 4CPAA 5LRGA 5ISVA 4A38A 1UWYA 3SHPA 4X5KA 3BLNA 5HXDA 4LQ6A 4E8OA 1CP7A 5F48A 2Y0MA 3S6FA 3IWWA 3KI9A 2Z3NA 3CXQA 4NCZA 4R3KA 5CPAA 4O23A 5AG7A 1Z8LA 4UFXA 3S9LA 2XEIA 3FEEA 5AGEA 2OZGA 4L89A 5ELYA 3E0KA 1PYTB 2BUEA 4FD4A 2ZW6A 5E96A 2VXKA 1I21A 1XRYA 2AFXA 2IJZA 4UF4A 2Z11A 4II9A 2B5GB 1KUYA 3I1UA 2JEVA 1XOVA 1YMEA 3DNSA 4M6GA 4NSQA 4F9VA 1B87A 1YW4A 1ZG9A 2C6PA 3S6HA 3TO9A 5I4MA 3KQXA 1ELLP 2R8VA 1CP6A 4OKOA 3BJ8A 4TWEA 3T8WA 4P4IA 3FJUA 1IIDA 4BMHA 2O53A 1XIXA 3CT9A 5JM6A 1KUXA 2WPWA 4KSAA 3S9MA 5F09A 4M6IA 1K4JA 1S7LA 3FMCA 2NSMA 1YSJA 1QSTA 4GS4A 4F8ZA 3KASA 3NE8A 4Q7AA 5AG6A 1M1DA 4BD9A 4KS9A 2ODFA 2D4PA 3NFZA 4YU9A 4H89A 3B2YA 2FS5A 1YREA 2F8HA 4A39A 1M4LA 3ISXA 4JLYA 1BO4A 4MJ8A 3FX6A 3R9FA 4F9UA 4IK2A 4AG7A 4XNHC 2PCUA 1GYTA 3N7ZA 2P6EA 2Q43A 4OIWA 2FE7A 2I00A 5LYIA 5HMNA 1V0CA 4A30A 4NJQA 1DE4C 3PRTA 4IHMA 5K8NA 1MJBA 2AE6A 3D8PA 3CXSA 4NGQA 3EFAA 2AJ6A 3SI2A 3TTHA 3K9TA 4P4BA 2V8GA 4KSFA 3F5BA 1P0HA 2G0BA 2ZW4A 2VBQA 1WK4A 1NSLA 3IU2A 2YNEA 4MY3A 5J1QA 2PJ8A 2J9AA 1CPSA 5J8FA 4KOWA 3V7ZA 2YGWA 3B7IA 1UFHA 4P6YA 3D67A 4PSWA 2PR8A 3DSBA 1XE4A 3DR8A 3IC1A 3EO4A 4KOXA 1AYEA 4ZY2A 3V38A 2B4DA 4FAIA 5AG4A 4PK2A 4C2YA 4MHNA 2RC4A 4OAEA 4DYOA 2ARHA 1S5KA 3WABA 4KVXA 2GLJA 2ZEGA 1FNOA 1Q2CA 3IIBA 2WUUA 4CAXA 4QBJA 2PJ3A 4KZTA 4JJXA 2C27A 4HNXB 4P4EA 1Y0YA 2AFMA 1ZO0A 2JDDA 4J3GA 3SJEA 2ATRA 1XJOA 2IMOA 2DEAA 3D7GA 3FXTA 4HPSA 4G1PA 4LQGA 1VKCA 2DPSA 3EXNA 4WJBA 2QVPA 1Y9WA 2Z0ZA 2JBJA 3G8WA 2EWBA 4R57A 4MFQA 4MCQA 1YQEA 3NH4A 5HVGA 4U9ZA 4KOTA 4KUBA 2JBKA 4OC4A 3BI1A 1CPXA 1R43A 1N71A 4E0AA 2PJCA 3PBEA 4KOYA 2PVVA 4R3LA 1LANA 2PQ8A 4OADA 5G22A 3UY5A 4EWTA 2PDOA 3V8IA 2B5GA 4KOVA 1J4JA 5HVFA 1IYLA 4PPZA 4MCRA 4NF1A 4CRZB 4KVOE 2YNCC 1P4NA 2CTCA 2CY2A 4M85A 2WPXA 3R95A 1YVKA 2Z3LA 5JQ4A 4RN7A 3VATA 1XEBA 1M4GA 4OP4A 2HC9A 2R98A 1TIQA 2BL1A 1M4DA 1DTDA 3DLJA 3PFEA 4UIBA 3VWDA 2Q4VA 5DS0A 1KWMA 4JZ0A 1TXRA 4H6ZA 2GIVA 1TF8A 4CYQA 3TE4A 4JD6A 4R7MA 3D68A 2B3VA 3S6KA 2BO9A 2AFOA 2FIAA 1AMPA 3JUWA 3PBBA 3PP9A 4A2ZA 2D4OA 3PB7X 2CTBA 1IU8A 2ZEOA 4A33A 4UBRA 1M44A 5K8OA 2PE3A 4ORFA 3TFYA 4P44A 4Z65A 2OOTA 4FD6A 3K2KA 5F49A 4U9YA 3FECA 2QYVA 1R3NA 1A2ZA 2A4NA 2G9DA 4JYWA 3GKRA 2GE3A 1VHSA 1CJWA 4CAFA 1X12A 5IX3A 5IV0A 1B6BA 1BAVA 1VGYA 4QUSA 3ZZIA 2R1IA 4CGMA 4X8IA 2AFWA 5F47A 5JGFA 2RFHA 3PB6X 3EC4A 4JWPA 5EMIA 2GLFA 2ZOGA 3S6GA 5K8PA 1ZLIA 4ONWA 1U6MA 3D7FA 4NGNA 2BSWA 4KLWA 4KUAA 5D8NA 2CF4A 3KL9A 3BI0A 3ZJ0A 3W6XA 3P2FA 1Y7RA 3B35A 4UEEA 2FT0A 2J8RA 3N5FA 1BPNA 3SI0A 5KTAA 4AVBA 2EK8A 4XPDC 3TOAA 1YVOA 4RS2A 5LRJA 4M3SA 2F7VA 4ZX8A 2PRBA 2PVWA 4OIDA 4P10A 8CPAA 2WYRA 1S60A 1LAPA 2JEWA 2HV2A 3L2NA 5C82A 5KTDA 1IICA 4B5PA 2AFSA 3I9SA 4PSXA 4FD7A 2Q4ZA 4CGOA 2Z3MA 2ZW5A 4UFWA 2PJ2A 3LACA 1YR0A 1ARLA 4PXBA 2CNMA 1IY7A 4X2TA 2ZPAA 2FCKA 2FSRA 3CZXA 1OBRA 1VIXA 1Z9UA 1PUAA 4GM5A 1FT7A 2PJ4A 2ZEHA 3FH4A 4MY0A 4OC2A 4PXEA 2FIWA 2ANPA 1NSAA 2PIZA 2QJ8A 4MHZA 4XNHB 5IB0A 2EO8A 3F0AA 5CNPA 4F6AA 4K3NA 4MRIA 4UCMA 4NEXA 4OC0A 2O4HA 3NH5A 1H8LA 1XF8A 2POKA 4QB9A 1YLEA 1SQHA 2DF5A 2GANA 2ZENA 3TO7A 2ZEFA 3LD2A 3MN8A 1IOIA 4MHYA 2OR4A 2YNDA 4YWYA 3VH9A 1LCPA 3S9NA 4MFKA 5EC4A 4K30A 1AUGA 2RB7A 3BHXA 3H8GA 1EE3P 2Z3PA 3RNZA 3H8EA 3R9EA 1QSOA 4UFVA 1ZLHA 3HUVA 2XEFA 3WC7A 4AB7A 4IUSA 1YGHA 2B4BA 4EVYA 2HQYA 1ARMA 1BPMA 2QMLA 2X7BA 3FRMA 2PR1A 4UIAA 4BINA 1Q2DA 3GUXA 4P4FA 4W9YA 1WWZA 2G3AA 2ZEPA 4MBUA 1CM0A 3WT4A 3WC5A 1BLLE 3T90A 2GU2A 4ZYQA 2HB6A 4BBHA 5A27A 4Y49C 2EVNA 5G1ZA 1JWQA 2O28A 4NGMA 4YFJA 4OC3A 4OC5A 3GLJA 4NFRA 5JPHA 2Q04A 1BOBA 4DNCA 2OH1A 1ON0A 3D4UA 3W91A 1Z4EA 2Z3KA 2REEA 3RYOA 2OB0A 4ZI6A 3TC8A 3DDDA 3KZWA 4OMEA 4PK3A 4AVAA 3FVLA 2PSWA 3FB3A 3IWEA 4NGSA 4EMEA 4QC6A 4PXCA 2DXQA 1HDQA 4U5YA 5GCNA 3H8FA 2DPTA 2GREA 3D7DA 4MFZA 2XEJA 4C2ZA 4HNWB 4PQAA 5IB9A 1QSRA 3SI1A 5G20A 3W6SA 1XMBA 1JQGA 4CGPA 2NYQA 1NMTA 2PJ6A 3CXPA 3RO0A 4HNYB 4A32A 1IOFA 2Z10A 2Q44A 2HUZA 4JXRA 5H86A 3VARA 5JH9A 3KGQA 1TKHA 4C2XA 3R1KA 1R57A 1ZG7A 3TOBA 1YX0A 4A37A 5A28A 1F2OA 4MCPA 4TNUA 2PJBA 4YGOA 3FIXA 3FEDA 4A31A 3R96A 3FNCA 2QECA 3HLPA 3PB8X 3QNVA 4CGLA 4P4DA 3SJXA 4CYOA 1OZPA 1Y9KA 4XPLA 3D2MA 4KORA 3OWCA 4IAVA 3MRUA 1ZG8A 2PC1A 1I1DA 4PXDA 2BOAA 4UEZA 5I0CA 3P2HA 3KR5A 2VQYA 5H84A 4CGNA 4ZX9A 1HEEA 1XFOA 4B14A 2B4DB 3ISZA 1QSMA 1VHOA 4MXUA 4Q36A 3TO6A 4A94A 3IO1A 2PRQA 3R9GA 2G3TA 2ZOFA 3D2PA 5D29A 1TF9A 2FL4A 1CX8A 5LYFA 3GYAA 5G21A 1TKFA 1Y7EA 3GY9A 4CS0B 4UWIA 4AVCA 5LYDA 3PFOA 2B3UA 2CNTA 2WZNA 3B3SA 2P0WA 3QB8A 5FVJA 4FUUA 2ABZA 3RBUA 2WSAA 2VL1A 4CRYB 2C6CA 4Q38A 2JDCA 4KLVA 4CYNA 1TKJA 1IYKA 4R87A 2P6FA 3H5ZA 3KHXA 3EY5A 1S7FA 4ZY1A 2JLMA 1QSNA 3VWEA 5LYLA 4NJRA 1IGBA 3B3WA 3F8KA 5BWAB 1QMUA 4UA3A 2V8HA 4CAWA 1RTQA 3NH8A 4JXQA 4XPDB 2Q0YA 3GIUA 4M6HA 1F57A 3CPXA 4LX9A 4MFPA 2H5MA 4UWJA 3TT2A 6CPAA 3FF3A 3IJ3A 1Z2LA 2VZZA 2CNSA 3NA6A 2BCOA 4DUKA 4MFLA 5THWA 4B5OA 2FVGA 2AFZA 4B10A 3GB0A 3IFEA 3D66A 3KHZA 4NGTA 1S7KA 3JTKA 3PZJA 4R9MA 7CPAA 4NGRA 5F46A 1CBXA 2C6GA 3IGRA 3A9LA 1F2PA 4B12A 3PB4X 3IU1A 3LMSA 3PGPA 1PCAA 2PJAA 1MJ9A 3IEHA 3LODA 2FXFA 2C1CA 3WC6A 2V8DA 2OU2A 2EBJA 1MK4A 3SXNA 1S3ZA 4FWUA 4R6TA 5LRKA 3KQZA 1Z4RA 4KOUA 5HVHA 1YK3A 3RZAA 2Q51A 2YNCA 1I12A 1VHEA 2B58A 3NE7A 4HKFA 4A95A 3QAYA 3TCVA 4FBEA 2ZEEA 2IQ6A 4EFDA 2K5TA 4H6UA 4C7HA 4IF5A 4AXVA 3PEIA 2P6GA 1MJAA 3DR6A 2I3CA 5DWMA 4B13A 1IB1E 4YRHA 1NE9A 2BEIA 2QIRA 3SJGA 4ZY0A 5J8CA 3WR7A 2F5IA 3BJ7A 1GHEA 3KKWA 4B6ZA 2Z3OA 1KUVA 2J8NA 4L8AA 4UCNA 3B3VA 1Z8WA 2PIYA 2PJ0A 4X3RA 5EBVA 1LAMA 2CIJA 4XPKA 1PU9A 4I49A 2OZHA 1RO5A 2REFA 4MFJA 3FYNA 3T9YA 3TX8A 4Y49B 1Q7LA 2EUIA 2Q7SA 3FBUA 3JRUA 2J8MA 3SXOA 4PV6A 1QQ9A 3C26A 2VI7A 4E2AA 1Y0RA 4KSIA 4F0YA 1HDUA 4R76A 2IL4A 4LUAA 4OLLA 3CPAA 4MHDA 4NGPA 4P4JA 4QVTA 3CDXA 4B5PB 3LWUA 5CBMA 3B3TA 1XBUA 1FY7A 2ZELA
chains in the Genus database with same CATH topology
1RXTA 3G3SA 2NMTA 3B8GA 4CYPA 1Q2YA 4NXYA 2Q7BA 4UCPA 3K9UA 3IWGA 2ZW7A 2I79A 4F0XA 1XMTA 2ZXVA 5C88A 5DWNA 3MGDA 1KZFA 2CXAA 1L0CA 4CAVA 3JVNA 4C68A 2VEZA 4B11A 4AG9A 5AG5A 2VZYA 4KOSA 4ZBGA 3D3SA 4KVME 5HH1A 2Q4YA 3I3GA 2R7HA 1M4IA 3QAHA 1LRZA 4ONUA 4ZGYB 5KTCA 4C7IA 1S7NA 2OZUA 4MI4A 2KCWA 4CAEA 4RI1A 3H4QA 4FD5A 5ISVA 3SHPA 4X5KA 3BLNA 4E8OA 3S6FA 5F48A 2Y0MA 2Z3NA 3CXQA 4NCZA 4R3KA 5AG7A 4UFXA 5AGEA 2OZGA 4L89A 3E0KA 2BUEA 4FD4A 2ZW6A 5E96A 2VXKA 1I21A 2Z11A 4II9A 2B5GB 1KUYA 2JEVA 3DNSA 4NSQA 1B87A 3TO9A 2R8VA 3BJ8A 4BMHA 1IIDA 1XIXA 1KUXA 2WPWA 4KSAA 1K4JA 1S7LA 1QSTA 4GS4A 5AG6A 1M1DA 4KS9A 2D4PA 4H89A 2FS5A 1YREA 4JLYA 1BO4A 4MJ8A 3R9FA 4AG7A 4XNHC 3N7ZA 2P6EA 5HMNA 2FE7A 2I00A 1V0CA 4A30A 1MJBA 2AE6A 3D8PA 3CXSA 3EFAA 2AJ6A 3TTHA 4KSFA 3F5BA 1P0HA 2G0BA 2ZW4A 2VBQA 1WK4A 1NSLA 3IU2A 2YNEA 4MY3A 5J8FA 4KOWA 2YGWA 1UFHA 4PSWA 2PR8A 3DSBA 1XE4A 3DR8A 4KOXA 3EO4A 5AG4A 2B4DA 4PK2A 4C2YA 2RC4A 4OAEA 2ARHA 1S5KA 4KVXA 1Q2CA 2WUUA 4CAXA 4QBJA 4KZTA 4JJXA 2C27A 4HNXB 1ZO0A 2JDDA 4J3GA 2ATRA 3FXTA 1VKCA 2DPSA 3EXNA 3G8WA 1Y9WA 2Z0ZA 4R57A 4MFQA 4U9ZA 4KOTA 4KUBA 1N71A 4E0AA 4KOYA 4R3LA 4OADA 2PQ8A 5G22A 3UY5A 2PDOA 3V8IA 2B5GA 4KOVA 1J4JA 1IYLA 4NF1A 4CRZB 4KVOE 2YNCC 1P4NA 2CY2A 4M85A 3R95A 2WPXA 1YVKA 2Z3LA 5JQ4A 1XEBA 1M4GA 2R98A 1TIQA 2BL1A 1M4DA 3VWDA 2Q4VA 4H6ZA 2GIVA 4CYQA 3TE4A 4JD6A 2B3VA 3S6KA 4A2ZA 2FIAA 3JUWA 3PP9A 2D4OA 4A33A 4UBRA 1M44A 4ORFA 3TFYA 4FD6A 5F49A 4U9YA 2A4NA 3GKRA 2GE3A 1VHSA 1CJWA 4CAFA 5IX3A 5IV0A 1B6BA 4QUSA 3ZZIA 4CGMA 2R1IA 5F47A 4JWPA 3EC4A 3S6GA 1U6MA 2BSWA 4KLWA 4KUAA 3ZJ0A 3W6XA 3P2FA 1Y7RA 2FT0A 2J8RA 5KTAA 4AVBA 3TOAA 4XPDC 1YVOA 4RS2A 4M3SA 2PRBA 1S60A 5KTDA 2HV2A 5C82A 1IICA 4B5PA 3I9SA 4PSXA 4FD7A 4CGOA 2Z3MA 2ZW5A 4UFWA 1YR0A 2CNMA 2ZPAA 2FCKA 2FSRA 1Z9UA 1PUAA 4MY0A 2FIWA 4XNHB 5IB0A 3F0AA 5CNPA 4F6AA 4UCMA 4NEXA 4QB9A 3S6HA 1XF8A 1YLEA 1SQHA 2GANA 3TO7A 3LD2A 2YNDA 4MFKA 5EC4A 4K30A 2Z3PA 3R9EA 1QSOA 4UFVA 4AB7A 4IUSA 1YGHA 2B4BA 4EVYA 2HQYA 2QMLA 2X7BA 3FRMA 2PR1A 1Q2DA 1WWZA 2G3AA 4MBUA 1CM0A 3T90A 4BBHA 5A27A 4Y49C 2EVNA 5G1ZA 2O28A 4YFJA 5JPHA 2Q04A 1BOBA 4DNCA 2OH1A 1ON0A 3W91A 1Z4EA 2Z3KA 2REEA 3RYOA 2OB0A 3DDDA 4PK3A 4AVAA 2PSWA 3FB3A 3IWEA 4QC6A 2DXQA 5GCNA 4U5YA 4C2ZA 2DPTA 4MFZA 4HNWB 1QSRA 5G20A 3W6SA 4CGPA 1NMTA 3CXPA 4HNYB 4A32A 2Z10A 2Q44A 2HUZA 4JXRA 5H86A 4C2XA 3R1KA 1R57A 3TOBA 1YX0A 5A28A 4YGOA 3FIXA 4A31A 3R96A 3FNCA 2QECA 4CGLA 4CYOA 1OZPA 1Y9KA 4XPLA 3D2MA 4KORA 3OWCA 2PC1A 1I1DA 5I0CA 3P2HA 2VQYA 5H84A 4CGNA 4B14A 2B4DB 4Q36A 1QSMA 3TO6A 3R9GA 2G3TA 3D2PA 2FL4A 3GYAA 5G21A 3GY9A 4CS0B 4UWIA 4AVCA 2B3UA 2CNTA 2P0WA 3QB8A 5FVJA 2WSAA 4CRYB 4Q38A 2JDCA 4KLVA 4CYNA 1IYKA 4R87A 2P6FA 3H5ZA 3EY5A 1S7FA 2JLMA 1QSNA 3VWEA 3F8KA 5BWAB 4UA3A 4CAWA 4JXQA 4XPDB 2Q0YA 4MFPA 4UWJA 4LX9A 2H5MA 3TT2A 2VZZA 2CNSA 4MFLA 4B5OA 4B10A 1S7KA 3JTKA 3PZJA 4R9MA 5F46A 3IGRA 3A9LA 4B12A 3IU1A 3PGPA 1MJ9A 3LODA 2FXFA 2OU2A 1MK4A 3SXNA 1S3ZA 1Z4RA 4KOUA 1YK3A 4HKFA 2YNCA 1I12A 3NE7A 2B58A 4A95A 3TCVA 2K5TA 4H6UA 4C7HA 4IF5A 2P6GA 1MJAA 3DR6A 5DWMA 4B13A 1IB1E 4YRHA 1NE9A 2BEIA 2QIRA 5J8CA 3WR7A 2F5IA 3BJ7A 1GHEA 3KKWA 2Z3OA 1KUVA 2J8NA 4L8AA 4UCNA 5EBVA 4XPKA 1PU9A 4I49A 2OZHA 1RO5A 2REFA 4MFJA 3FYNA 3T9YA 4Y49B 2EUIA 3FBUA 2J8MA 3SXOA 4PV6A 3C26A 2VI7A 4E2AA 4F0YA 2IL4A 4LUAA 4OLLA 4QVTA 4MHDA 4B5PB 1FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXT A;  3G3S A;  2NMT A;  3B8G A;  1Q2Y A;  4NXY A;  2Q7B A;  3K9U A;  3IWG A;  2ZW7 A;  2I79 A;  1XMT A;  2ZXV A;  5C88 A;  5DWN A;  3MGD A;  1KZF A;  1L0C A;  4CAV A;  3JVN A;  2VEZ A;  4AG9 A;  2VZY A;  4KOS A;  4ZBG A;  3D3S A;  4KVM E;  5HH1 A;  2Q4Y A;  3I3G A;  2R7H A;  1M4I A;  3QAH A;  1LRZ A;  4ONU A;  5KTC A;  1S7N A;  2OZU A;  4MI4 A;  2KCW A;  4RI1 A;  3H4Q A;  4FD5 A;  5ISV A;  3SHP A;  4X5K A;  3BLN A;  4E8O A;  3S6F A;  5F48 A;  2Y0M A;  3CXQ A;  4NCZ A;  4R3K A;  2OZG A;  4L89 A;  3E0K A;  2BUE A;  4FD4 A;  2ZW6 A;  5E96 A;  2VXK A;  1I21 A;  2Z11 A;  4II9 A;  2B5G B;  1KUY A;  2JEV A;  3DNS A;  4NSQ A;  1B87 A;  3TO9 A;  2R8V A;  3BJ8 A;  4BMH A;  1IID A;  1XIX A;  1KUX A;  2WPW A;  1K4J A;  1S7L A;  1QST A;  4GS4 A;  1M1D A;  2D4P A;  4H89 A;  2FS5 A;  1YRE A;  4JLY A;  1BO4 A;  4MJ8 A;  3R9F A;  4AG7 A;  4XNH C;  3N7Z A;  2P6E A;  5HMN A;  2FE7 A;  2I00 A;  1V0C A;  1MJB A;  2AE6 A;  3D8P A;  3CXS A;  3EFA A;  2AJ6 A;  3TTH A;  3F5B A;  1P0H A;  2G0B A;  2ZW4 A;  2VBQ A;  1WK4 A;  1NSL A;  4MY3 A;  5J8F A;  4KOW A;  1UFH A;  4PSW A;  2PR8 A;  3DSB A;  1XE4 A;  3DR8 A;  4KOX A;  3EO4 A;  2B4D A;  4PK2 A;  2RC4 A;  4OAE A;  2ARH A;  1S5K A;  4KVX A;  1Q2C A;  4CAX A;  4QBJ A;  4KZT A;  4JJX A;  2C27 A;  4HNX B;  2JDD A;  4J3G A;  2ATR A;  3FXT A;  1VKC A;  3EXN A;  3G8W A;  1Y9W A;  2Z0Z A;  4R57 A;  4U9Z A;  4KOT A;  4KUB A;  1N71 A;  4E0A A;  4KOY A;  4R3L A;  4OAD A;  2PQ8 A;  3UY5 A;  2PDO A;  3V8I A;  2B5G A;  4KOV A;  1J4J A;  1IYL A;  4NF1 A;  4CRZ B;  4KVO E;  1P4N A;  2CY2 A;  4M85 A;  3R95 A;  2WPX A;  1YVK A;  5JQ4 A;  1XEB A;  1M4G A;  2R98 A;  1TIQ A;  2BL1 A;  1M4D A;  3VWD A;  2Q4V A;  4H6Z A;  2GIV A;  3TE4 A;  4JD6 A;  2B3V A;  3S6K A;  2FIA A;  3JUW A;  3PP9 A;  2D4O A;  4UBR A;  1M44 A;  4ORF A;  3TFY A;  4FD6 A;  5F49 A;  4U9Y A;  2A4N A;  3GKR A;  2GE3 A;  1VHS A;  1CJW A;  5IX3 A;  5IV0 A;  1B6B A;  4QUS A;  3ZZI A;  2R1I A;  5F47 A;  4JWP A;  3EC4 A;  3S6G A;  1U6M A;  2BSW A;  4KLW A;  4KUA A;  3ZJ0 A;  3W6X A;  3P2F A;  1Y7R A;  2FT0 A;  2J8R A;  5KTA A;  4AVB A;  3TOA A;  4XPD C;  1YVO A;  4RS2 A;  4M3S A;  2PRB A;  1S60 A;  5KTD A;  2HV2 A;  5C82 A;  1IIC A;  4B5P A;  3I9S A;  4PSX A;  4FD7 A;  2ZW5 A;  1YR0 A;  2CNM A;  2ZPA A;  2FCK A;  2FSR A;  1Z9U A;  1PUA A;  4MY0 A;  2FIW A;  4XNH B;  5IB0 A;  3F0A A;  5CNP A;  4F6A A;  4NEX A;  4QB9 A;  3S6H A;  1XF8 A;  1YLE A;  1SQH A;  2GAN A;  3TO7 A;  3LD2 A;  5EC4 A;  4K30 A;  3R9E A;  1QSO A;  4AB7 A;  4IUS A;  1YGH A;  2B4B A;  4EVY A;  2HQY A;  2QML A;  2X7B A;  3FRM A;  2PR1 A;  1Q2D A;  1WWZ A;  2G3A A;  4MBU A;  1CM0 A;  3T90 A;  4Y49 C;  2EVN A;  2O28 A;  4YFJ A;  5JPH A;  2Q04 A;  1BOB A;  4DNC A;  2OH1 A;  1ON0 A;  3W91 A;  1Z4E A;  3RYO A;  2REE A;  2OB0 A;  3DDD A;  4PK3 A;  4AVA A;  2PSW A;  3FB3 A;  4QC6 A;  2DXQ A;  5GCN A;  4U5Y A;  4HNW B;  1QSR A;  3W6S A;  1NMT A;  3CXP A;  4HNY B;  2Z10 A;  2Q44 A;  2HUZ A;  4JXR A;  5H86 A;  3R1K A;  1R57 A;  3TOB A;  1YX0 A;  4YGO A;  3FIX A;  3R96 A;  3FNC A;  2QEC A;  1OZP A;  1Y9K A;  4XPL A;  3D2M A;  4KOR A;  3OWC A;  2PC1 A;  1I1D A;  5I0C A;  3P2H A;  2VQY A;  5H84 A;  2B4D B;  1QSM A;  3TO6 A;  3R9G A;  2G3T A;  3D2P A;  2FL4 A;  3GYA A;  3GY9 A;  4CS0 B;  4UWI A;  4AVC A;  2B3U A;  2CNT A;  2P0W A;  3QB8 A;  5FVJ A;  4CRY B;  2JDC A;  4KLV A;  1IYK A;  4R87 A;  2P6F A;  3EY5 A;  1S7F A;  2JLM A;  1QSN A;  3VWE A;  3F8K A;  4UA3 A;  4CAW A;  4JXQ A;  4XPD B;  2Q0Y A;  4UWJ A;  4LX9 A;  2H5M A;  3TT2 A;  2VZZ A;  2CNS A;  4B5O A;  1S7K A;  3PZJ A;  4R9M A;  5F46 A;  3IGR A;  3PGP A;  1MJ9 A;  3LOD A;  2FXF A;  2OU2 A;  1MK4 A;  3SXN A;  1S3Z A;  1Z4R A;  4KOU A;  1YK3 A;  3NE7 A;  4HKF A;  1I12 A;  2B58 A;  3TCV A;  2K5T A;  4H6U A;  4IF5 A;  2P6G A;  1MJA A;  3DR6 A;  5DWM A;  1IB1 E;  4YRH A;  1NE9 A;  2BEI A;  2QIR A;  5J8C A;  3WR7 A;  2F5I A;  3BJ7 A;  1GHE A;  3KKW A;  1KUV A;  2J8N A;  4L8A A;  5EBV A;  4XPK A;  1PU9 A;  4I49 A;  2OZH A;  1RO5 A;  2REF A;  3FYN A;  3T9Y A;  4Y49 B;  2EUI A;  3FBU A;  2J8M A;  3SXO A;  4PV6 A;  3C26 A;  2VI7 A;  4E2A A;  4F0Y A;  2IL4 A;  4LUA A;  4OLL A;  4QVT A;  4MHD A;  4B5P B;  1FY7 A; 
#chains in the Genus database with same CATH topology
 2PJ7 A;  1RXT A;  2V8V A;  3G3S A;  1CG2 A;  2NMT A;  2PJ1 A;  2V77 A;  3B8G A;  4CYP A;  1Q2Y A;  4NXY A;  4MMO A;  1YLO A;  4MHP A;  4UCP A;  2Q7B A;  1LOK A;  3K9U A;  3IWG A;  2ZW7 A;  2I79 A;  4F0X A;  2XEG A;  3DGV A;  4RUH A;  1XMT A;  1Z5R A;  1Z8X A;  2ZXV A;  5C88 A;  4MCS A;  5DWN A;  3KR4 A;  3MGD A;  1KZF A;  2CXA A;  1L0C A;  4CAV A;  3JVN A;  3B3C A;  4UEF A;  4C68 A;  2VEZ A;  1X10 A;  4B11 A;  2PJ5 A;  4AG9 A;  4WWV A;  3D7H A;  3PB9 X;  4DJL A;  1YW6 A;  5AG5 A;  3BXM A;  4H2K A;  5K8M A;  2VZY A;  4KOS A;  4ZBG A;  3D3S A;  2PJ9 A;  4KVM E;  4R8F A;  2ZEM A;  5HH1 A;  2Q4Y A;  3I3G A;  2EK9 A;  2R7H A;  1M4I A;  3QAH A;  3RAM A;  1LRZ A;  4ONU A;  4GXH A;  4ZGY B;  5KTC A;  4P45 A;  4C7I A;  1S7N A;  2OZU A;  2AFU A;  1ELM P;  2GFQ A;  4MI4 A;  2KCW A;  2ZED A;  3SJF A;  4CAE A;  4RI1 A;  3H4Q A;  4OC1 A;  1Z8T A;  4FD5 A;  1LFW A;  4CPA A;  5LRG A;  5ISV A;  4A38 A;  1UWY A;  3SHP A;  4X5K A;  3BLN A;  5HXD A;  4LQ6 A;  4E8O A;  1CP7 A;  5F48 A;  2Y0M A;  3S6F A;  3IWW A;  3KI9 A;  2Z3N A;  3CXQ A;  4NCZ A;  4R3K A;  5CPA A;  4O23 A;  5AG7 A;  1Z8L A;  4UFX A;  3S9L A;  2XEI A;  3FEE A;  5AGE A;  2OZG A;  4L89 A;  5ELY A;  3E0K A;  1PYT B;  2BUE A;  4FD4 A;  2ZW6 A;  5E96 A;  2VXK A;  1I21 A;  1XRY A;  2AFX A;  2IJZ A;  4UF4 A;  2Z11 A;  4II9 A;  2B5G B;  1KUY A;  3I1U A;  2JEV A;  1XOV A;  1YME A;  3DNS A;  4M6G A;  4NSQ A;  4F9V A;  1B87 A;  1YW4 A;  1ZG9 A;  2C6P A;  3S6H A;  3TO9 A;  5I4M A;  3KQX A;  1ELL P;  2R8V A;  1CP6 A;  4OKO A;  3BJ8 A;  4TWE A;  3T8W A;  4P4I A;  3FJU A;  1IID A;  4BMH A;  2O53 A;  1XIX A;  3CT9 A;  5JM6 A;  1KUX A;  2WPW A;  4KSA A;  3S9M A;  5F09 A;  4M6I A;  1K4J A;  1S7L A;  3FMC A;  2NSM A;  1YSJ A;  1QST A;  4GS4 A;  4F8Z A;  3KAS A;  3NE8 A;  4Q7A A;  5AG6 A;  1M1D A;  4BD9 A;  4KS9 A;  2ODF A;  2D4P A;  3NFZ A;  4YU9 A;  4H89 A;  3B2Y A;  2FS5 A;  1YRE A;  2F8H A;  4A39 A;  1M4L A;  3ISX A;  4JLY A;  1BO4 A;  4MJ8 A;  3FX6 A;  3R9F A;  4F9U A;  4IK2 A;  4AG7 A;  4XNH C;  2PCU A;  1GYT A;  3N7Z A;  2P6E A;  2Q43 A;  4OIW A;  2FE7 A;  2I00 A;  5LYI A;  5HMN A;  1V0C A;  4A30 A;  4NJQ A;  1DE4 C;  3PRT A;  4IHM A;  5K8N A;  1MJB A;  2AE6 A;  3D8P A;  3CXS A;  4NGQ A;  3EFA A;  2AJ6 A;  3SI2 A;  3TTH A;  3K9T A;  4P4B A;  2V8G A;  4KSF A;  3F5B A;  1P0H A;  2G0B A;  2ZW4 A;  2VBQ A;  1WK4 A;  1NSL A;  3IU2 A;  2YNE A;  4MY3 A;  5J1Q A;  2PJ8 A;  2J9A A;  1CPS A;  5J8F A;  4KOW A;  3V7Z A;  2YGW A;  3B7I A;  1UFH A;  4P6Y A;  3D67 A;  4PSW A;  2PR8 A;  3DSB A;  1XE4 A;  3DR8 A;  3IC1 A;  3EO4 A;  4KOX A;  1AYE A;  4ZY2 A;  3V38 A;  2B4D A;  4FAI A;  5AG4 A;  4PK2 A;  4C2Y A;  4MHN A;  2RC4 A;  4OAE A;  4DYO A;  2ARH A;  1S5K A;  3WAB A;  4KVX A;  2GLJ A;  2ZEG A;  1FNO A;  1Q2C A;  3IIB A;  2WUU A;  4CAX A;  4QBJ A;  2PJ3 A;  4KZT A;  4JJX A;  2C27 A;  4HNX B;  4P4E A;  1Y0Y A;  2AFM A;  1ZO0 A;  2JDD A;  4J3G A;  3SJE A;  2ATR A;  1XJO A;  2IMO A;  2DEA A;  3D7G A;  3FXT A;  4HPS A;  4G1P A;  4LQG A;  1VKC A;  2DPS A;  3EXN A;  4WJB A;  2QVP A;  1Y9W A;  2Z0Z A;  2JBJ A;  3G8W A;  2EWB A;  4R57 A;  4MFQ A;  4MCQ A;  1YQE A;  3NH4 A;  5HVG A;  4U9Z A;  4KOT A;  4KUB A;  2JBK A;  4OC4 A;  3BI1 A;  1CPX A;  1R43 A;  1N71 A;  4E0A A;  2PJC A;  3PBE A;  4KOY A;  2PVV A;  4R3L A;  1LAN A;  2PQ8 A;  4OAD A;  5G22 A;  3UY5 A;  4EWT A;  2PDO A;  3V8I A;  2B5G A;  4KOV A;  1J4J A;  5HVF A;  1IYL A;  4PPZ A;  4MCR A;  4NF1 A;  4CRZ B;  4KVO E;  2YNC C;  1P4N A;  2CTC A;  2CY2 A;  4M85 A;  2WPX A;  3R95 A;  1YVK A;  2Z3L A;  5JQ4 A;  4RN7 A;  3VAT A;  1XEB A;  1M4G A;  4OP4 A;  2HC9 A;  2R98 A;  1TIQ A;  2BL1 A;  1M4D A;  1DTD A;  3DLJ A;  3PFE A;  4UIB A;  3VWD A;  2Q4V A;  5DS0 A;  1KWM A;  4JZ0 A;  1TXR A;  4H6Z A;  2GIV A;  1TF8 A;  4CYQ A;  3TE4 A;  4JD6 A;  4R7M A;  3D68 A;  2B3V A;  3S6K A;  2BO9 A;  2AFO A;  2FIA A;  1AMP A;  3JUW A;  3PBB A;  3PP9 A;  4A2Z A;  2D4O A;  3PB7 X;  2CTB A;  1IU8 A;  2ZEO A;  4A33 A;  4UBR A;  1M44 A;  5K8O A;  2PE3 A;  4ORF A;  3TFY A;  4P44 A;  4Z65 A;  2OOT A;  4FD6 A;  3K2K A;  5F49 A;  4U9Y A;  3FEC A;  2QYV A;  1R3N A;  1A2Z A;  2A4N A;  2G9D A;  4JYW A;  3GKR A;  2GE3 A;  1VHS A;  1CJW A;  4CAF A;  1X12 A;  5IX3 A;  5IV0 A;  1B6B A;  1BAV A;  1VGY A;  4QUS A;  3ZZI A;  2R1I A;  4CGM A;  4X8I A;  2AFW A;  5F47 A;  5JGF A;  2RFH A;  3PB6 X;  3EC4 A;  4JWP A;  5EMI A;  2GLF A;  2ZOG A;  3S6G A;  5K8P A;  1ZLI A;  4ONW A;  1U6M A;  3D7F A;  4NGN A;  2BSW A;  4KLW A;  4KUA A;  5D8N A;  2CF4 A;  3KL9 A;  3BI0 A;  3ZJ0 A;  3W6X A;  3P2F A;  1Y7R A;  3B35 A;  4UEE A;  2FT0 A;  2J8R A;  3N5F A;  1BPN A;  3SI0 A;  5KTA A;  4AVB A;  2EK8 A;  4XPD C;  3TOA A;  1YVO A;  4RS2 A;  5LRJ A;  4M3S A;  2F7V A;  4ZX8 A;  2PRB A;  2PVW A;  4OID A;  4P10 A;  8CPA A;  2WYR A;  1S60 A;  1LAP A;  2JEW A;  2HV2 A;  3L2N A;  5C82 A;  5KTD A;  1IIC A;  4B5P A;  2AFS A;  3I9S A;  4PSX A;  4FD7 A;  2Q4Z A;  4CGO A;  2Z3M A;  2ZW5 A;  4UFW A;  2PJ2 A;  3LAC A;  1YR0 A;  1ARL A;  4PXB A;  2CNM A;  1IY7 A;  4X2T A;  2ZPA A;  2FCK A;  2FSR A;  3CZX A;  1OBR A;  1VIX A;  1Z9U A;  1PUA A;  4GM5 A;  1FT7 A;  2PJ4 A;  2ZEH A;  3FH4 A;  4MY0 A;  4OC2 A;  4PXE A;  2FIW A;  2ANP A;  1NSA A;  2PIZ A;  2QJ8 A;  4MHZ A;  4XNH B;  5IB0 A;  2EO8 A;  3F0A A;  5CNP A;  4F6A A;  4K3N A;  4MRI A;  4UCM A;  4NEX A;  4OC0 A;  2O4H A;  3NH5 A;  1H8L A;  1XF8 A;  2POK A;  4QB9 A;  1YLE A;  1SQH A;  2DF5 A;  2GAN A;  2ZEN A;  3TO7 A;  2ZEF A;  3LD2 A;  3MN8 A;  1IOI A;  4MHY A;  2OR4 A;  2YND A;  4YWY A;  3VH9 A;  1LCP A;  3S9N A;  4MFK A;  5EC4 A;  4K30 A;  1AUG A;  2RB7 A;  3BHX A;  3H8G A;  1EE3 P;  2Z3P A;  3RNZ A;  3H8E A;  3R9E A;  1QSO A;  4UFV A;  1ZLH A;  3HUV A;  2XEF A;  3WC7 A;  4AB7 A;  4IUS A;  1YGH A;  2B4B A;  4EVY A;  2HQY A;  1ARM A;  1BPM A;  2QML A;  2X7B A;  3FRM A;  2PR1 A;  4UIA A;  4BIN A;  1Q2D A;  3GUX A;  4P4F A;  4W9Y A;  1WWZ A;  2G3A A;  2ZEP A;  4MBU A;  1CM0 A;  3WT4 A;  3WC5 A;  1BLL E;  3T90 A;  2GU2 A;  4ZYQ A;  2HB6 A;  4BBH A;  5A27 A;  4Y49 C;  2EVN A;  5G1Z A;  1JWQ A;  2O28 A;  4NGM A;  4YFJ A;  4OC3 A;  4OC5 A;  3GLJ A;  4NFR A;  5JPH A;  2Q04 A;  1BOB A;  4DNC A;  2OH1 A;  1ON0 A;  3D4U A;  3W91 A;  1Z4E A;  2Z3K A;  2REE A;  3RYO A;  2OB0 A;  4ZI6 A;  3TC8 A;  3DDD A;  3KZW A;  4OME A;  4PK3 A;  4AVA A;  3FVL A;  2PSW A;  3FB3 A;  3IWE A;  4NGS A;  4EME A;  4QC6 A;  4PXC A;  2DXQ A;  1HDQ A;  4U5Y A;  5GCN A;  3H8F A;  2DPT A;  2GRE A;  3D7D A;  4MFZ A;  2XEJ A;  4C2Z A;  4HNW B;  4PQA A;  5IB9 A;  1QSR A;  3SI1 A;  5G20 A;  3W6S A;  1XMB A;  1JQG A;  4CGP A;  2NYQ A;  1NMT A;  2PJ6 A;  3CXP A;  3RO0 A;  4HNY B;  4A32 A;  1IOF A;  2Z10 A;  2Q44 A;  2HUZ A;  4JXR A;  5H86 A;  3VAR A;  5JH9 A;  3KGQ A;  1TKH A;  4C2X A;  3R1K A;  1R57 A;  1ZG7 A;  3TOB A;  1YX0 A;  4A37 A;  5A28 A;  1F2O A;  4MCP A;  4TNU A;  2PJB A;  4YGO A;  3FIX A;  3FED A;  4A31 A;  3R96 A;  3FNC A;  2QEC A;  3HLP A;  3PB8 X;  3QNV A;  4CGL A;  4P4D A;  3SJX A;  4CYO A;  1OZP A;  1Y9K A;  4XPL A;  3D2M A;  4KOR A;  3OWC A;  4IAV A;  3MRU A;  1ZG8 A;  2PC1 A;  1I1D A;  4PXD A;  2BOA A;  4UEZ A;  5I0C A;  3P2H A;  3KR5 A;  2VQY A;  5H84 A;  4CGN A;  4ZX9 A;  1HEE A;  1XFO A;  4B14 A;  2B4D B;  3ISZ A;  1QSM A;  1VHO A;  4MXU A;  4Q36 A;  3TO6 A;  4A94 A;  3IO1 A;  2PRQ A;  3R9G A;  2G3T A;  2ZOF A;  3D2P A;  5D29 A;  1TF9 A;  2FL4 A;  1CX8 A;  5LYF A;  3GYA A;  5G21 A;  1TKF A;  1Y7E A;  3GY9 A;  4CS0 B;  4UWI A;  4AVC A;  5LYD A;  3PFO A;  2B3U A;  2CNT A;  2WZN A;  3B3S A;  2P0W A;  3QB8 A;  5FVJ A;  4FUU A;  2ABZ A;  3RBU A;  2WSA A;  2VL1 A;  4CRY B;  2C6C A;  4Q38 A;  2JDC A;  4KLV A;  4CYN A;  1TKJ A;  1IYK A;  4R87 A;  2P6F A;  3H5Z A;  3KHX A;  3EY5 A;  1S7F A;  4ZY1 A;  2JLM A;  1QSN A;  3VWE A;  5LYL A;  4NJR A;  1IGB A;  3B3W A;  3F8K A;  5BWA B;  1QMU A;  4UA3 A;  2V8H A;  4CAW A;  1RTQ A;  3NH8 A;  4JXQ A;  4XPD B;  2Q0Y A;  3GIU A;  4M6H A;  1F57 A;  3CPX A;  4LX9 A;  4MFP A;  2H5M A;  4UWJ A;  3TT2 A;  6CPA A;  3FF3 A;  3IJ3 A;  1Z2L A;  2VZZ A;  2CNS A;  3NA6 A;  2BCO A;  4DUK A;  4MFL A;  5THW A;  4B5O A;  2FVG A;  2AFZ A;  4B10 A;  3GB0 A;  3IFE A;  3D66 A;  3KHZ A;  4NGT A;  1S7K A;  3JTK A;  3PZJ A;  4R9M A;  7CPA A;  4NGR A;  5F46 A;  1CBX A;  2C6G A;  3IGR A;  3A9L A;  1F2P A;  4B12 A;  3PB4 X;  3IU1 A;  3LMS A;  3PGP A;  1PCA A;  2PJA A;  1MJ9 A;  3IEH A;  3LOD A;  2FXF A;  2C1C A;  3WC6 A;  2V8D A;  2OU2 A;  2EBJ A;  1MK4 A;  3SXN A;  1S3Z A;  4FWU A;  4R6T A;  5LRK A;  3KQZ A;  1Z4R A;  4KOU A;  5HVH A;  1YK3 A;  3RZA A;  2Q51 A;  2YNC A;  1I12 A;  1VHE A;  2B58 A;  3NE7 A;  4HKF A;  4A95 A;  3QAY A;  3TCV A;  4FBE A;  2ZEE A;  2IQ6 A;  4EFD A;  2K5T A;  4H6U A;  4C7H A;  4IF5 A;  4AXV A;  3PEI A;  2P6G A;  1MJA A;  3DR6 A;  2I3C A;  5DWM A;  4B13 A;  1IB1 E;  4YRH A;  1NE9 A;  2BEI A;  2QIR A;  3SJG A;  4ZY0 A;  5J8C A;  3WR7 A;  2F5I A;  3BJ7 A;  1GHE A;  3KKW A;  4B6Z A;  2Z3O A;  1KUV A;  2J8N A;  4L8A A;  4UCN A;  3B3V A;  1Z8W A;  2PIY A;  2PJ0 A;  4X3R A;  5EBV A;  1LAM A;  2CIJ A;  4XPK A;  1PU9 A;  4I49 A;  2OZH A;  1RO5 A;  2REF A;  4MFJ A;  3FYN A;  3T9Y A;  3TX8 A;  4Y49 B;  1Q7L A;  2EUI A;  2Q7S A;  3FBU A;  3JRU A;  2J8M A;  3SXO A;  4PV6 A;  1QQ9 A;  3C26 A;  2VI7 A;  4E2A A;  1Y0R A;  4KSI A;  4F0Y A;  1HDU A;  4R76 A;  2IL4 A;  4LUA A;  4OLL A;  3CPA A;  4MHD A;  4NGP A;  4P4J A;  4QVT A;  3CDX A;  4B5P B;  3LWU A;  5CBM A;  3B3T A;  1XBU A;  1FY7 A;  2ZEL A; 
#chains in the Genus database with same CATH homology
 1RXT A;  3G3S A;  2NMT A;  3B8G A;  4CYP A;  1Q2Y A;  4NXY A;  2Q7B A;  4UCP A;  3K9U A;  3IWG A;  2ZW7 A;  2I79 A;  4F0X A;  1XMT A;  2ZXV A;  5C88 A;  5DWN A;  3MGD A;  1KZF A;  2CXA A;  1L0C A;  4CAV A;  3JVN A;  4C68 A;  2VEZ A;  4B11 A;  4AG9 A;  5AG5 A;  2VZY A;  4KOS A;  4ZBG A;  3D3S A;  4KVM E;  5HH1 A;  2Q4Y A;  3I3G A;  2R7H A;  1M4I A;  3QAH A;  1LRZ A;  4ONU A;  4ZGY B;  5KTC A;  4C7I A;  1S7N A;  2OZU A;  4MI4 A;  2KCW A;  4CAE A;  4RI1 A;  3H4Q A;  4FD5 A;  5ISV A;  3SHP A;  4X5K A;  3BLN A;  4E8O A;  3S6F A;  5F48 A;  2Y0M A;  2Z3N A;  3CXQ A;  4NCZ A;  4R3K A;  5AG7 A;  4UFX A;  5AGE A;  2OZG A;  4L89 A;  3E0K A;  2BUE A;  4FD4 A;  2ZW6 A;  5E96 A;  2VXK A;  1I21 A;  2Z11 A;  4II9 A;  2B5G B;  1KUY A;  2JEV A;  3DNS A;  4NSQ A;  1B87 A;  3TO9 A;  2R8V A;  3BJ8 A;  4BMH A;  1IID A;  1XIX A;  1KUX A;  2WPW A;  4KSA A;  1K4J A;  1S7L A;  1QST A;  4GS4 A;  5AG6 A;  1M1D A;  4KS9 A;  2D4P A;  4H89 A;  2FS5 A;  1YRE A;  4JLY A;  1BO4 A;  4MJ8 A;  3R9F A;  4AG7 A;  4XNH C;  3N7Z A;  2P6E A;  5HMN A;  2FE7 A;  2I00 A;  1V0C A;  4A30 A;  1MJB A;  2AE6 A;  3D8P A;  3CXS A;  3EFA A;  2AJ6 A;  3TTH A;  4KSF A;  3F5B A;  1P0H A;  2G0B A;  2ZW4 A;  2VBQ A;  1WK4 A;  1NSL A;  3IU2 A;  2YNE A;  4MY3 A;  5J8F A;  4KOW A;  2YGW A;  1UFH A;  4PSW A;  2PR8 A;  3DSB A;  1XE4 A;  3DR8 A;  4KOX A;  3EO4 A;  5AG4 A;  2B4D A;  4PK2 A;  4C2Y A;  2RC4 A;  4OAE A;  2ARH A;  1S5K A;  4KVX A;  1Q2C A;  2WUU A;  4CAX A;  4QBJ A;  4KZT A;  4JJX A;  2C27 A;  4HNX B;  1ZO0 A;  2JDD A;  4J3G A;  2ATR A;  3FXT A;  1VKC A;  2DPS A;  3EXN A;  3G8W A;  1Y9W A;  2Z0Z A;  4R57 A;  4MFQ A;  4U9Z A;  4KOT A;  4KUB A;  1N71 A;  4E0A A;  4KOY A;  4R3L A;  4OAD A;  2PQ8 A;  5G22 A;  3UY5 A;  2PDO A;  3V8I A;  2B5G A;  4KOV A;  1J4J A;  1IYL A;  4NF1 A;  4CRZ B;  4KVO E;  2YNC C;  1P4N A;  2CY2 A;  4M85 A;  3R95 A;  2WPX A;  1YVK A;  2Z3L A;  5JQ4 A;  1XEB A;  1M4G A;  2R98 A;  1TIQ A;  2BL1 A;  1M4D A;  3VWD A;  2Q4V A;  4H6Z A;  2GIV A;  4CYQ A;  3TE4 A;  4JD6 A;  2B3V A;  3S6K A;  4A2Z A;  2FIA A;  3JUW A;  3PP9 A;  2D4O A;  4A33 A;  4UBR A;  1M44 A;  4ORF A;  3TFY A;  4FD6 A;  5F49 A;  4U9Y A;  2A4N A;  3GKR A;  2GE3 A;  1VHS A;  1CJW A;  4CAF A;  5IX3 A;  5IV0 A;  1B6B A;  4QUS A;  3ZZI A;  4CGM A;  2R1I A;  5F47 A;  4JWP A;  3EC4 A;  3S6G A;  1U6M A;  2BSW A;  4KLW A;  4KUA A;  3ZJ0 A;  3W6X A;  3P2F A;  1Y7R A;  2FT0 A;  2J8R A;  5KTA A;  4AVB A;  3TOA A;  4XPD C;  1YVO A;  4RS2 A;  4M3S A;  2PRB A;  1S60 A;  5KTD A;  2HV2 A;  5C82 A;  1IIC A;  4B5P A;  3I9S A;  4PSX A;  4FD7 A;  4CGO A;  2Z3M A;  2ZW5 A;  4UFW A;  1YR0 A;  2CNM A;  2ZPA A;  2FCK A;  2FSR A;  1Z9U A;  1PUA A;  4MY0 A;  2FIW A;  4XNH B;  5IB0 A;  3F0A A;  5CNP A;  4F6A A;  4UCM A;  4NEX A;  4QB9 A;  3S6H A;  1XF8 A;  1YLE A;  1SQH A;  2GAN A;  3TO7 A;  3LD2 A;  2YND A;  4MFK A;  5EC4 A;  4K30 A;  2Z3P A;  3R9E A;  1QSO A;  4UFV A;  4AB7 A;  4IUS A;  1YGH A;  2B4B A;  4EVY A;  2HQY A;  2QML A;  2X7B A;  3FRM A;  2PR1 A;  1Q2D A;  1WWZ A;  2G3A A;  4MBU A;  1CM0 A;  3T90 A;  4BBH A;  5A27 A;  4Y49 C;  2EVN A;  5G1Z A;  2O28 A;  4YFJ A;  5JPH A;  2Q04 A;  1BOB A;  4DNC A;  2OH1 A;  1ON0 A;  3W91 A;  1Z4E A;  2Z3K A;  2REE A;  3RYO A;  2OB0 A;  3DDD A;  4PK3 A;  4AVA A;  2PSW A;  3FB3 A;  3IWE A;  4QC6 A;  2DXQ A;  5GCN A;  4U5Y A;  4C2Z A;  2DPT A;  4MFZ A;  4HNW B;  1QSR A;  5G20 A;  3W6S A;  4CGP A;  1NMT A;  3CXP A;  4HNY B;  4A32 A;  2Z10 A;  2Q44 A;  2HUZ A;  4JXR A;  5H86 A;  4C2X A;  3R1K A;  1R57 A;  3TOB A;  1YX0 A;  5A28 A;  4YGO A;  3FIX A;  4A31 A;  3R96 A;  3FNC A;  2QEC A;  4CGL A;  4CYO A;  1OZP A;  1Y9K A;  4XPL A;  3D2M A;  4KOR A;  3OWC A;  2PC1 A;  1I1D A;  5I0C A;  3P2H A;  2VQY A;  5H84 A;  4CGN A;  4B14 A;  2B4D B;  4Q36 A;  1QSM A;  3TO6 A;  3R9G A;  2G3T A;  3D2P A;  2FL4 A;  3GYA A;  5G21 A;  3GY9 A;  4CS0 B;  4UWI A;  4AVC A;  2B3U A;  2CNT A;  2P0W A;  3QB8 A;  5FVJ A;  2WSA A;  4CRY B;  4Q38 A;  2JDC A;  4KLV A;  4CYN A;  1IYK A;  4R87 A;  2P6F A;  3H5Z A;  3EY5 A;  1S7F A;  2JLM A;  1QSN A;  3VWE A;  3F8K A;  5BWA B;  4UA3 A;  4CAW A;  4JXQ A;  4XPD B;  2Q0Y A;  4MFP A;  4UWJ A;  4LX9 A;  2H5M A;  3TT2 A;  2VZZ A;  2CNS A;  4MFL A;  4B5O A;  4B10 A;  1S7K A;  3JTK A;  3PZJ A;  4R9M A;  5F46 A;  3IGR A;  3A9L A;  4B12 A;  3IU1 A;  3PGP A;  1MJ9 A;  3LOD A;  2FXF A;  2OU2 A;  1MK4 A;  3SXN A;  1S3Z A;  1Z4R A;  4KOU A;  1YK3 A;  4HKF A;  2YNC A;  1I12 A;  3NE7 A;  2B58 A;  4A95 A;  3TCV A;  2K5T A;  4H6U A;  4C7H A;  4IF5 A;  2P6G A;  1MJA A;  3DR6 A;  5DWM A;  4B13 A;  1IB1 E;  4YRH A;  1NE9 A;  2BEI A;  2QIR A;  5J8C A;  3WR7 A;  2F5I A;  3BJ7 A;  1GHE A;  3KKW A;  2Z3O A;  1KUV A;  2J8N A;  4L8A A;  4UCN A;  5EBV A;  4XPK A;  1PU9 A;  4I49 A;  2OZH A;  1RO5 A;  2REF A;  4MFJ A;  3FYN A;  3T9Y A;  4Y49 B;  2EUI A;  3FBU A;  2J8M A;  3SXO A;  4PV6 A;  3C26 A;  2VI7 A;  4E2A A;  4F0Y A;  2IL4 A;  4LUA A;  4OLL A;  4QVT A;  4MHD A;  4B5P B;  1FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...