3R96A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
180
Chain Sequence
b'DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 57
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r96A00
2GIVA 2JEVA 1YREA 4ZBGA 3VWEA 4YFJA 5EC4A 2Q4VA 1VHSA 1OZPA 4M3SA 1WK4A 5JQ4A 2FT0A 2Z0ZA 4CRZB 4FD4A 3JVNA 4ORFA 1S7FA 4QB9A 4IF5A 2P6EA 3D2MA 2G0BA 3D2PA 3EY5A 1VKCA 5DWMA 4LX9A 1XEBA 3FRMA 1V0CA 2J8MA 2Q4YA 5F47A 1QSOA 2VQYA 3PP9A 2FIWA 3B8GA 4KVXA 1S5KA 4XPDC 2C27A 2D4OA 2K5TA 4QC6A 1M1DA 2ZPAA 2Z10A 1MJBA 4HNYB 2B4BA 3OWCA 4KOUA 1TIQA 1YVKA 2VEZA 1Q2CA 3C26A 3R95A 2R1IA 2CNSA 1YVOA 5J8CA 2FSRA 4OADA 2GANA 4KZTA 4KLWA 4PSXA 1WWZA 4L89A 4K30A 4MJ8A 3JUWA 2VZZA 1M4GA 1NSLA 3TOBA 3FIXA 4UWJA 1P0HA 4DNCA 3S6FA 4B5OA 4XPLA 4NEXA 3D3SA 4R3KA 4PSWA 2B3UA 2B4DA 2CY2A 3P2FA 4LUAA 2BL1A 4ONUA 3SXNA 1P4NA 3BLNA 4EVYA 3CXQA 3SHPA 1IYLA 1Z4RA 4MBUA 4R57A 3EFAA 1CM0A 2HQYA 4M85A 3H4QA 4MY3A 2FIAA 1PU9A 4OAEA 1BO4A 2I00A 5ISVA 2QMLA 2AJ6A 4HNWB 2PC1A 4PK3A 3TE4A 2NMTA 3I9SA 3W6XA 4I49A 1QSMA 3S6KA 3TOAA 4R3LA 1YR0A 3G3SA 2B4DB 4MY0A 1Y9KA 3LODA 4KOYA 4CAVA 3F5BA 3GKRA 1SQHA 3DR8A 3DR6A 4CAWA 2R8VA 2PSWA 4R9MA 4NF1A 4UBRA 2P0WA 3CXSA 3R9GA 5HMNA 4HNXB 3FYNA 4RI1A 4E0AA 5C88A 4U5YA 2WPXA 5F48A 3IWGA 2WPWA 3EC4A 2QECA 2QIRA 4KOSA 2FE7A 5IX3A 3FB3A 5F46A 4AB7A 3KKWA 5HH1A 4YRHA 4RS2A 3TCVA 1I1DA 2FL4A 4B5PA 1Z4EA 3W91A 1RO5A 5KTCA 3BJ7A 2Q0YA 3RYOA 4QUSA 4YGOA 1YGHA 1K4JA 1QSNA 4X5KA 4NXYA 3DNSA 2CNTA 3R9FA 2PR8A 1GHEA 2F5IA 2CNMA 1U6MA 4UWIA 1IYKA 2KCWA 2REEA 3BJ8A 5CNPA 4F6AA 4JXRA 1IICA 2REFA 3EO4A 3TTHA 4MI4A 1BOBA 4BMHA 4L8AA 5EBVA 2JDDA 5C82A 5KTDA 2ZW4A 2OH1A 4CAXA 1Q2DA 3W6SA 3F8KA 2Q7BA 4JXQA 2ZW5A 1RXTA 1N71A 1FY7A 1LRZA 2X7BA 4B5PB 1Q2YA 2AE6A 1M4IA 2FCKA 3NE7A 4PK2A 4HKFA 4II9A 3S6HA 4CRYB 1XIXA 2BSWA 2B5GB 4KUBA 1KZFA 1QSRA 3WR7A 4U9ZA 2FS5A 3ZZIA 4XNHC 3SXOA 1I21A 3FBUA 2ARHA 4FD5A 4KVME 2ZW6A 4NCZA 1R57A 1CJWA 5DWNA 5JPHA 3CXPA 3V8IA 2P6GA 2HV2A 2JLMA 3EXNA 4FD7A 3GYAA 4R87A 2H5MA 2VZYA 5E96A 2OB0A 3TO7A 1M44A 1MJ9A 4OLLA 4PV6A 4AVCA 2JDCA 2B58A 5GCNA 1I12A 1IIDA 3VWDA 3I3GA 2BUEA 1YX0A 3E0KA 2ZXVA 1MJAA 4IUSA 1YLEA 1NMTA 4KVOE 2EUIA 4KOXA 4Y49B 3DDDA 4MHDA 2PDOA 2Q04A 5I0CA 3R1KA 2OZGA 5J8FA 4KUAA 4E8OA 3PGPA 4XNHB 3T90A 3TFYA 2Q44A 1Y9WA 4H89A 4AVBA 4JD6A 2G3TA 3TO6A 1S7NA 5H84A 2I79A 1B87A 4QBJA 2D4PA 2DXQA 2J8RA 3IGRA 4XPKA 4KOTA 4QVTA 2Y0MA 1XMTA 1NE9A 2O28A 2B5GA 3D8PA 3F0AA 2GE3A 3TO9A 1Y7RA 2VI7A 4KOWA 3R9EA 1ON0A 1S7LA 4H6ZA 4JLYA 4FD6A 1QSTA 4JJXA 2PQ8A 3TT2A 2G3AA 4JWPA 2R7HA 5IB0A 1UFHA 3LD2A 1S60A 4KOVA 2P6FA 5KTAA 3PZJA 2ATRA 4UA3A 3UY5A 3K9UA 4AG7A 2OZUA 2B3VA 1S3ZA 5H86A 4KORA 3QAHA 5F49A 2OZHA 1KUXA 1PUAA 4H6UA 4KLVA 1M4DA 2R98A 4J3GA 4Y49C 1IB1E 2IL4A 1Z9UA 3FXTA 3MGDA 3T9YA 4F0YA 1L0CA 5FVJA 2BEIA 4CS0B 2HUZA 3R96A 3ZJ0A 1XE4A 3S6GA 2FXFA 2RC4A 4E2AA 1XF8A 4AVAA 4XPDB 2PR1A 4NSQA 2OU2A 3DSBA 4U9YA 3FNCA 2EVNA 2A4NA 4GS4A 4AG9A 1KUVA 1YK3A 3N7ZA 2PRBA 3QB8A 3G8WA 1MK4A 2Z11A 5IV0A 2J8NA 2VBQA 3GY9A 2VXKA 1KUYA 1S7KA 1B6BA 3P2HA 1J4JA 2ZW7A
chains in the Genus database with same CATH superfamily
4DUKA 3GIUA 5LYIA 2GIVA 2JEVA 4ZI6A 3KZWA 1YREA 3BI0A 1DE4C 2ZEOA 4ZBGA 1Z8LA 3IFEA 3VWEA 4YFJA 2ZEDA 5EC4A 3SI0A 1CG2A 3BI1A 4HPSA 2IQ6A 1LFWA 2Q4VA 3SJEA 3NE8A 2PVVA 2Z3NA 4C68A 3IWWA 1VHSA 1OZPA 4M3SA 2NYQA 3D68A 1WK4A 5JQ4A 4P4BA 4CGPA 1OBRA 2FT0A 2Z0ZA 4CRZB 4FD4A 3JVNA 1BPNA 1F2PA 1S7FA 4ORFA 4QB9A 4IF5A 2P6EA 2WSAA 3CDXA 3D2MA 4WWVA 2G0BA 3D2PA 3EY5A 4IHMA 1VKCA 4NGNA 4LX9A 2GREA 1XEBA 5DWMA 3SI1A 4CYPA 3FECA 1Z8XA 3FRMA 4PXCA 1V0CA 3NA6A 4OIWA 2J8MA 2Q4YA 2DPSA 5F47A 2IMOA 1QSOA 2PJ6A 2VQYA 5AG6A 3PP9A 1VHEA 4EMEA 2AFMA 3KGQA 1R43A 4P4IA 2FIWA 3B8GA 2RB7A 4P4EA 1PCAA 4KVXA 4UIAA 1S5KA 4C2XA 4XPDC 1JQGA 2C27A 2C6PA 2D4OA 2HB6A 2K5TA 2Q4ZA 2V8VA 4QC6A 1M1DA 4A32A 1ZO0A 2O53A 2ZPAA 1XMBA 1YW4A 2PCUA 2Z10A 4MRIA 1VHOA 3VARA 4FAIA 1MJBA 3QNVA 2B4BA 3OWCA 4HNYB 4KOUA 1R3NA 1TIQA 1YVKA 2PJ5A 1TF8A 5G20A 2FVGA 2VEZA 1Q2CA 3C26A 3R95A 2R1IA 2CNSA 1YVOA 3H8FA 4M6IA 5J8CA 4MHZA 4UEZA 4UCPA 2FSRA 4NJRA 3KL9A 4MFQA 4OADA 2GANA 4KZTA 3KI9A 3FF3A 1XBUA 4KLWA 4MXUA 2ZEEA 4PSXA 1WWZA 3KASA 5AGEA 1F2OA 4NGMA 2ZENA 4L89A 4K30A 3JRUA 4MJ8A 3CT9A 3JUWA 2VZZA 2PJ7A 3S9MA 4C2ZA 4MHPA 1M4GA 5G21A 4P4JA 1NSLA 3TOBA 2ZOFA 3FIXA 3BHXA 3QAYA 4UWJA 1P0HA 4DNCA 3S6FA 2BOAA 4B5OA 5BWAB 3B2YA 2YNCC 4NEXA 4X2TA 3N5FA 4XPLA 1CX8A 2AFXA 3D3SA 4OC4A 4R3KA 4CGNA 4PSWA 3D7FA 3B3VA 2B3UA 4P45A 4C2YA 2B4DA 3H8GA 4OIDA 5F09A 4CGOA 2CY2A 3PFOA 2ZOGA 3P2FA 1H8LA 2V8DA 4LUAA 2BL1A 4ONUA 3SJFA 3SXNA 2PE3A 1P4NA 5HVFA 4UCNA 4CGMA 3B3WA 4A37A 4C7IA 3BLNA 4BBHA 4EVYA 1LCPA 3CXQA 3RZAA 2EO8A 4GXHA 3SHPA 4A31A 1IYLA 1LAMA 1Z4RA 1Q7LA 4MBUA 1BLLE 4R57A 4A39A 5CBMA 4O23A 3TX8A 2C6GA 5JM6A 3L2NA 4UEEA 4UFWA 2AFOA 3EFAA 1CM0A 1Z8TA 4ZY0A 2HQYA 2I3CA 4G1PA 4M85A 2ZEGA 2BCOA 3H4QA 4UCMA 4JYWA 4OMEA 4MY3A 2FIAA 4MFPA 1PU9A 4OAEA 1BO4A 5LRGA 1PYTB 2PJBA 5JH9A 2I00A 4MFKA 4NJQA 2AFSA 4F9UA 1VIXA 2Z3LA 5ISVA 2QMLA 3FX6A 2AJ6A 4HNWB 2F7VA 1CBXA 3DGVA 5DS0A 4R6TA 2PC1A 3PBEA 4PK3A 3T8WA 3TE4A 2NMTA 3I9SA 3W6XA 4I49A 3IIBA 1QSMA 4TWEA 1YQEA 3S6KA 3WT4A 1ZLHA 3TOAA 4R3LA 1YR0A 3G3SA 1TKFA 2B4DB 1NSAA 4MY0A 4OC5A 1Y9KA 4MFLA 2G9DA 1Y0YA 3CZXA 3IWEA 3LODA 5G22A 2C6CA 4KOYA 4CAVA 5D8NA 4H2KA 3F5BA 3GKRA 4NGSA 1SQHA 3DR8A 2PJ3A 3DR6A 4CAWA 2R8VA 4ZY2A 2C1CA 4P6YA 2PSWA 4R9MA 4NF1A 4A94A 3GB0A 2XEIA 1ZG7A 1Y0RA 3B7IA 2AFWA 4UBRA 2GLFA 2P0WA 3CXSA 5LRKA 3R9GA 3RAMA 3NH5A 5HMNA 3WC6A 3FYNA 4HNXB 1TKHA 4RI1A 4E0AA 5C88A 7CPAA 4U5YA 5ELYA 2CTCA 2PJ4A 2WPXA 5F48A 3IWGA 2WPWA 4M6GA 3EC4A 2QECA 2QIRA 4KOSA 5AG5A 4KSIA 2FE7A 4R76A 2V8HA 5IX3A 3FB3A 5F46A 4AB7A 4KSAA 3KKWA 1XFOA 1XJOA 4YRHA 4RS2A 5HH1A 3TCVA 1CP7A 5AG4A 1X10A 4OC1A 1I1DA 2FL4A 1LANA 3PEIA 4B5PA 1Z4EA 3W91A 1RO5A 4F0XA 5KTCA 3BJ7A 1IOFA 2PJ2A 2Q0YA 1LOKA 3RYOA 2EK9A 3PB9X 4QUSA 4YGOA 1YGHA 4B6ZA 1K4JA 3IO1A 1FT7A 1QSNA 4X5KA 4NXYA 1DTDA 2PIYA 3DNSA 4A33A 4FWUA 4CYOA 2NSMA 2CNTA 4K3NA 4YU9A 3R9FA 4A30A 3VATA 1IGBA 2ZEMA 2PR8A 1GHEA 2F5IA 4CGLA 2CNMA 1U6MA 5D29A 2Z3MA 4UWIA 5LYDA 1IYKA 2KCWA 2OR4A 2REEA 3FH4A 4FUUA 3BJ8A 4OKOA 1AMPA 4JZ0A 2Z3OA 3D67A 5CNPA 4F6AA 1KWMA 2ANPA 4JXRA 5CPAA 1IICA 3WC7A 3D7HA 2REFA 3EO4A 3TTHA 4MI4A 1BOBA 4BMHA 2CIJA 4BINA 4ZX9A 1UWYA 4L8AA 5EBVA 2JDDA 3D4UA 4KSFA 4C7HA 3ISXA 4CYNA 5C82A 2ZW4A 1ZLIA 5KTDA 2OH1A 4CAXA 2XEJA 1Q2DA 3W6SA 4UEFA 6CPAA 2POKA 3F8KA 1YLOA 4P10A 2Q7BA 4P4FA 3CPXA 4JXQA 1X12A 4CAFA 1ZG8A 2ZW5A 3JTKA 1RXTA 3PBBA 1FNOA 1N71A 3K9TA 1FY7A 1LRZA 2X7BA 2Z3KA 3PB8X 4B11A 4B12A 1Q2YA 4B5PB 2AE6A 1M4IA 4NGQA 2FCKA 2VL1A 3NE7A 1Y7EA 4PK2A 4RUHA 1BPMA 2WYRA 4HKFA 1ELMP 3HUVA 5I4MA 4II9A 2V8GA 2YNCA 3S9LA 3S6HA 4CRYB 5A28A 5HVGA 1XIXA 2BSWA 2PJ1A 1TKJA 2QJ8A 2B5GB 4OC3A 4KUBA 1KZFA 4A95A 1QSRA 1Z5RA 3WR7A 4NGTA 4MCSA 4U9ZA 1TF9A 1IOIA 2FS5A 3SJXA 1ARMA 3ZZIA 2F8HA 4XNHC 3WABA 2PJAA 2ZELA 1I21A 3SXOA 4CPAA 3FBUA 2ARHA 4FD5A 4KVME 2ZW6A 4NCZA 1CPXA 1R57A 1CJWA 4GM5A 5DWNA 4RN7A 4ZX8A 5JPHA 3CXPA 3V8IA 2P6GA 5HVHA 2PVWA 2HV2A 2Q51A 4PPZA 2JLMA 4UFXA 2YNEA 3EXNA 2IJZA 4NGRA 2DEAA 4FD7A 4M6HA 3V7ZA 4MFZA 3GYAA 4UF4A 4R87A 1AYEA 3TC8A 2XEFA 2H5MA 3KHZA 1HDUA 5EMIA 3B3SA 2VZYA 5E96A 2OB0A 4IK2A 3TO7A 1M44A 1MJ9A 2GLJA 3FEEA 4OLLA 4PV6A 4AVCA 2ZW7A 2JDCA 4OC2A 1AUGA 2PJ8A 1XRYA 2B58A 2CTBA 5LYFA 5HXDA 5K8MA 5JGFA 5GCNA 1A2ZA 1I12A 3GUXA 1IIDA 2Q43A 3VH9A 5A27A 3VWDA 3I3GA 3RO0A 2BUEA 2O4HA 1CPSA 1YX0A 2QVPA 3E0KA 4Q38A 2ZXVA 3KR5A 1YMEA 4KS9A 1MJAA 2PJ0A 1YSJA 4IUSA 1YLEA 1NMTA 4KVOE 2EUIA 2DPTA 4KOXA 4Y49B 3DDDA 5LRJA 5LYLA 3ISZA 4MHDA 2PDOA 2Q04A 5I0CA 3R1KA 2OZGA 5J8FA 4KUAA 3KHXA 5K8OA 4X3RA 3PGPA 4E8OA 2RFHA 4IAVA 4PXDA 4XNHB 3IJ3A 3FJUA 4PXEA 3T90A 3TFYA 2Q44A 3NH8A 8CPAA 1Y9WA 5J1QA 4H89A 4AVBA 4JD6A 2G3TA 2GFQA 1YW6A 1S7NA 3TO6A 4EWTA 4A2ZA 2OOTA 5H84A 4X8IA 3A9LA 2JBJA 2JEWA 2I79A 3FMCA 4UFVA 1VGYA 2YGWA 1HEEA 1B87A 4QBJA 2D4PA 1Z2LA 3PFEA 1IU8A 2DXQA 2EWBA 1TXRA 2DF5A 2J8RA 3IGRA 4KOTA 4LQGA 4XPKA 4W9YA 4MCQA 4OC0A 4QVTA 3WC5A 2Y0MA 1XMTA 1NE9A 2O28A 2B5GA 3BXMA 4B14A 3D8PA 3F0AA 3PB7X 4Q36A 3TO9A 4LQ6A 5K8NA 1Y7RA 5G1ZA 2VI7A 3H8EA 4EFDA 4KOWA 2J9AA 4NGPA 4PQAA 4MCPA 3R9EA 4ZGYB 1ON0A 3B3CA 3HLPA 3PRTA 4MHYA 3MRUA 2QYVA 1S7LA 3MN8A 1CP6A 4MHNA 5IB9A 4H6ZA 3FVLA 4JLYA 4YWYA 4P4DA 4FD6A 3CPAA 1QSTA 3K2KA 2WUUA 3S9NA 1QQ9A 2GU2A 1XOVA 4JJXA 3KQXA 2PQ8A 3TT2A 2G3AA 4JWPA 4F9VA 4R8FA 4TNUA 2R7HA 3B3TA 3DLJA 5IB0A 3SJGA 1UFHA 3LD2A 4B13A 3LWUA 1S60A 2PJ9A 4PXBA 1JWQA 4KOVA 2P6FA 3D66A 3NH4A 5KTAA 3PZJA 4ZY1A 2ATRA 4MCRA 2EK8A 4UA3A 4A38A 1Z8WA 1BAVA 3UY5A 3K9UA 4AG7A 2OZUA 2ZEFA 2B3VA 1S3ZA 2HC9A 4AXVA 3RNZA 5H86A 2ODFA 4KORA 3H5ZA 2PJCA 3QAHA 3PB6X 5F49A 5THWA 2AFZA 4ONWA 2OZHA 1KUXA 2XEGA 3V38A 1PUAA 4F8ZA 2CF4A 4H6UA 4KLVA 4OP4A 4ZYQA 1M4DA 1ZG9A 2R98A 4J3GA 4Y49C 1IB1E 2IL4A 1Z9UA 2Q7SA 3FXTA 4CYQA 2PRQA 3MGDA 3T9YA 4F0YA 1L0CA 1HDQA 3PB4X 4P44A 5FVJA 2AFUA 1QMUA 2BEIA 3NFZA 4DJLA 1EE3P 2PIZA 3IU2A 4B10A 4BD9A 2HUZA 4MMOA 2JBKA 1F57A 4CAEA 4CS0B 3R96A 3ZJ0A 5AG7A 2CXAA 1XE4A 4R7MA 3FEDA 2ZEPA 4MFJA 2EBJA 2FXFA 3IC1A 2RC4A 3S6GA 5K8PA 3RBUA 2Z3PA 4E2AA 1XF8A 4AVAA 1RTQA 4XPDB 2PR1A 4NSQA 4DYOA 2OU2A 3DSBA 4UIBA 3IEHA 3SI2A 4U9YA 3D7DA 3D7GA 2ABZA 3IU1A 3FNCA 2EVNA 2A4NA 2YNDA 4Q7AA 4GS4A 4AG9A 1KUVA 1YK3A 2BO9A 2WZNA 3LMSA 3LACA 3KQZA 3N7ZA 4FBEA 2PRBA 3GLJA 1ARLA 4NFRA 1ELLP 3QB8A 3G8WA 4Z65A 1MK4A 2Z11A 2ZEHA 5IV0A 2J8NA 3B35A 2VBQA 3GY9A 2VXKA 1GYTA 3I1UA 1KUYA 1LAPA 1IY7A 1M4LA 1S7KA 2V77A 3KR4A 1B6BA 3P2HA 4WJBA 1J4JA 2GE3A
chains in the Genus database with same CATH topology
2GIVA 2JEVA 1YREA 4ZBGA 3VWEA 4YFJA 5EC4A 2Q4VA 2Z3NA 4C68A 1VHSA 1OZPA 4M3SA 1WK4A 5JQ4A 4CGPA 2FT0A 2Z0ZA 4CRZB 4FD4A 3JVNA 4ORFA 1S7FA 4QB9A 4IF5A 2P6EA 2WSAA 3D2MA 2G0BA 3D2PA 3EY5A 1VKCA 5DWMA 4LX9A 4CYPA 1XEBA 3FRMA 1V0CA 2J8MA 2Q4YA 2DPSA 5F47A 1QSOA 2VQYA 5AG6A 3PP9A 2FIWA 3B8GA 4KVXA 1S5KA 4C2XA 4XPDC 2C27A 2D4OA 2K5TA 4QC6A 1M1DA 4A32A 1ZO0A 2ZPAA 2Z10A 1MJBA 4HNYB 2B4BA 3OWCA 4KOUA 1TIQA 1YVKA 5G20A 2VEZA 1Q2CA 3C26A 3R95A 2R1IA 2CNSA 1YVOA 5J8CA 4UCPA 2FSRA 4MFQA 4OADA 2GANA 4KZTA 4KLWA 4PSXA 1WWZA 5AGEA 4L89A 4K30A 4MJ8A 3JUWA 2VZZA 4C2ZA 5G21A 1M4GA 1NSLA 3TOBA 3FIXA 4UWJA 1P0HA 4DNCA 3S6FA 4B5OA 5BWAB 2YNCC 4NEXA 4XPLA 3D3SA 4CGNA 4R3KA 4PSWA 2B3UA 4C2YA 2B4DA 4CGOA 2CY2A 3P2FA 4LUAA 2BL1A 4ONUA 3SXNA 1P4NA 4UCNA 4CGMA 4C7IA 3BLNA 4BBHA 4EVYA 3CXQA 3SHPA 4A31A 1IYLA 1Z4RA 4MBUA 4R57A 4UFWA 3EFAA 1CM0A 2HQYA 4M85A 3H4QA 4UCMA 4MY3A 2FIAA 4MFPA 1PU9A 4OAEA 1BO4A 2I00A 4MFKA 2Z3LA 5ISVA 2QMLA 2AJ6A 4HNWB 2PC1A 4PK3A 3TE4A 2NMTA 3I9SA 3W6XA 4I49A 1QSMA 3S6KA 3TOAA 4R3LA 1YR0A 3G3SA 2B4DB 4MY0A 1Y9KA 4MFLA 3IWEA 3LODA 5G22A 4KOYA 4CAVA 3F5BA 3GKRA 1SQHA 3DR8A 3DR6A 4CAWA 2R8VA 2PSWA 4R9MA 4NF1A 4UBRA 2P0WA 3CXSA 3R9GA 5HMNA 4HNXB 3FYNA 4RI1A 4E0AA 5C88A 4U5YA 2WPXA 5F48A 3IWGA 2WPWA 3EC4A 2QECA 2QIRA 4KOSA 5AG5A 2FE7A 5IX3A 3FB3A 5F46A 4AB7A 4KSAA 3KKWA 5HH1A 4YRHA 4RS2A 3TCVA 5AG4A 1I1DA 2FL4A 4B5PA 1Z4EA 3W91A 1RO5A 4F0XA 5KTCA 3BJ7A 2Q0YA 3RYOA 4QUSA 4YGOA 1YGHA 1K4JA 1QSNA 4X5KA 4NXYA 3DNSA 4A33A 4CYOA 2CNTA 3R9FA 4A30A 2PR8A 1GHEA 2F5IA 4CGLA 2CNMA 1U6MA 2Z3MA 4UWIA 1IYKA 2KCWA 2REEA 3BJ8A 2Z3OA 5CNPA 4F6AA 4JXRA 1IICA 2REFA 3EO4A 3TTHA 4MI4A 1BOBA 4BMHA 4L8AA 5EBVA 2JDDA 4C7HA 4KSFA 4CYNA 5C82A 5KTDA 2ZW4A 2OH1A 4CAXA 1Q2DA 3W6SA 3F8KA 2Q7BA 4JXQA 4CAFA 2ZW5A 3JTKA 1RXTA 1N71A 1FY7A 1LRZA 2X7BA 2Z3KA 4B5PB 4B11A 4B12A 1Q2YA 2AE6A 1M4IA 2FCKA 3NE7A 4PK2A 4HKFA 4II9A 2YNCA 3S6HA 4CRYB 5A28A 1XIXA 2BSWA 4A95A 2B5GB 4KUBA 1KZFA 1QSRA 3WR7A 4U9ZA 2FS5A 3ZZIA 4XNHC 3SXOA 1I21A 3FBUA 2ARHA 4FD5A 4KVME 2ZW6A 4NCZA 1R57A 1CJWA 5DWNA 5JPHA 3CXPA 3V8IA 2P6GA 2HV2A 2JLMA 4UFXA 2YNEA 3EXNA 4FD7A 4MFZA 3GYAA 4R87A 2H5MA 2VZYA 5E96A 2OB0A 3TO7A 1M44A 1MJ9A 4OLLA 4PV6A 4AVCA 2JDCA 2B58A 5GCNA 1I12A 1IIDA 5A27A 3VWDA 3I3GA 2BUEA 1YX0A 4Q38A 3E0KA 2ZXVA 4KS9A 1MJAA 4IUSA 1YLEA 1NMTA 4KVOE 2EUIA 2DPTA 4KOXA 4Y49B 3DDDA 4MHDA 2PDOA 2Q04A 5I0CA 3R1KA 2OZGA 5J8FA 4KUAA 4E8OA 3PGPA 4XNHB 3T90A 3TFYA 2Q44A 1Y9WA 4H89A 4AVBA 4JD6A 2G3TA 3TO6A 1S7NA 4A2ZA 5H84A 3A9LA 2I79A 4UFVA 2YGWA 1B87A 4QBJA 2D4PA 2DXQA 2J8RA 3IGRA 4XPKA 4KOTA 4QVTA 2Y0MA 1XMTA 1NE9A 2O28A 2B5GA 4B14A 3D8PA 3F0AA 2GE3A 4Q36A 3TO9A 1Y7RA 5G1ZA 2VI7A 4KOWA 3R9EA 4ZGYB 1ON0A 1S7LA 4H6ZA 4JLYA 4FD6A 1QSTA 2WUUA 4JJXA 2PQ8A 3TT2A 2G3AA 4JWPA 2R7HA 5IB0A 1UFHA 3LD2A 4B13A 1S60A 4KOVA 2P6FA 5KTAA 3PZJA 2ATRA 4UA3A 3UY5A 3K9UA 4AG7A 2OZUA 2B3VA 1S3ZA 5H86A 4KORA 3H5ZA 3QAHA 5F49A 2OZHA 1KUXA 1PUAA 4H6UA 4KLVA 1M4DA 2R98A 4J3GA 4Y49C 1IB1E 2IL4A 1Z9UA 3FXTA 4CYQA 3MGDA 3T9YA 4F0YA 1L0CA 5FVJA 2BEIA 3IU2A 4B10A 4CS0B 2HUZA 4CAEA 3R96A 3ZJ0A 5AG7A 2CXAA 1XE4A 4MFJA 3S6GA 2FXFA 2RC4A 2Z3PA 4E2AA 1XF8A 4AVAA 4XPDB 2PR1A 4NSQA 2OU2A 3DSBA 4U9YA 3IU1A 3FNCA 2EVNA 2A4NA 2YNDA 4GS4A 4AG9A 1KUVA 1YK3A 3N7ZA 2PRBA 3QB8A 3G8WA 1MK4A 2Z11A 5IV0A 2J8NA 2VBQA 3GY9A 2VXKA 1KUYA 1S7KA 1B6BA 3P2HA 1J4JA 2ZW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GIV A;  2JEV A;  1YRE A;  4ZBG A;  3VWE A;  4YFJ A;  5EC4 A;  2Q4V A;  1VHS A;  1OZP A;  4M3S A;  1WK4 A;  5JQ4 A;  2FT0 A;  2Z0Z A;  4CRZ B;  4FD4 A;  3JVN A;  4ORF A;  1S7F A;  4QB9 A;  4IF5 A;  2P6E A;  3D2M A;  2G0B A;  3D2P A;  3EY5 A;  1VKC A;  5DWM A;  4LX9 A;  1XEB A;  3FRM A;  1V0C A;  2J8M A;  2Q4Y A;  5F47 A;  1QSO A;  2VQY A;  3PP9 A;  2FIW A;  3B8G A;  4KVX A;  1S5K A;  4XPD C;  2C27 A;  2D4O A;  2K5T A;  4QC6 A;  1M1D A;  2ZPA A;  2Z10 A;  1MJB A;  4HNY B;  2B4B A;  3OWC A;  4KOU A;  1TIQ A;  1YVK A;  2VEZ A;  1Q2C A;  3C26 A;  3R95 A;  2R1I A;  2CNS A;  1YVO A;  5J8C A;  2FSR A;  4OAD A;  2GAN A;  4KZT A;  4KLW A;  4PSX A;  1WWZ A;  4L89 A;  4K30 A;  4MJ8 A;  3JUW A;  2VZZ A;  1M4G A;  1NSL A;  3TOB A;  3FIX A;  4UWJ A;  1P0H A;  4DNC A;  3S6F A;  4B5O A;  4XPL A;  4NEX A;  3D3S A;  4R3K A;  4PSW A;  2B3U A;  2B4D A;  2CY2 A;  3P2F A;  4LUA A;  2BL1 A;  4ONU A;  3SXN A;  1P4N A;  3BLN A;  4EVY A;  3CXQ A;  3SHP A;  1IYL A;  1Z4R A;  4MBU A;  4R57 A;  3EFA A;  1CM0 A;  2HQY A;  4M85 A;  3H4Q A;  4MY3 A;  2FIA A;  1PU9 A;  4OAE A;  1BO4 A;  2I00 A;  5ISV A;  2QML A;  2AJ6 A;  4HNW B;  2PC1 A;  4PK3 A;  3TE4 A;  2NMT A;  3I9S A;  3W6X A;  4I49 A;  1QSM A;  3S6K A;  3TOA A;  4R3L A;  1YR0 A;  3G3S A;  2B4D B;  4MY0 A;  1Y9K A;  3LOD A;  4KOY A;  4CAV A;  3F5B A;  3GKR A;  1SQH A;  3DR8 A;  3DR6 A;  4CAW A;  2R8V A;  2PSW A;  4R9M A;  4NF1 A;  4UBR A;  2P0W A;  3CXS A;  3R9G A;  5HMN A;  4HNX B;  3FYN A;  4RI1 A;  4E0A A;  5C88 A;  4U5Y A;  2WPX A;  5F48 A;  3IWG A;  2WPW A;  3EC4 A;  2QEC A;  2QIR A;  4KOS A;  2FE7 A;  5IX3 A;  3FB3 A;  5F46 A;  4AB7 A;  3KKW A;  5HH1 A;  4YRH A;  4RS2 A;  3TCV A;  1I1D A;  2FL4 A;  4B5P A;  1Z4E A;  3W91 A;  1RO5 A;  5KTC A;  3BJ7 A;  2Q0Y A;  3RYO A;  4QUS A;  4YGO A;  1YGH A;  1K4J A;  1QSN A;  4X5K A;  4NXY A;  3DNS A;  2CNT A;  3R9F A;  2PR8 A;  1GHE A;  2F5I A;  2CNM A;  1U6M A;  4UWI A;  1IYK A;  2KCW A;  2REE A;  3BJ8 A;  5CNP A;  4F6A A;  4JXR A;  1IIC A;  2REF A;  3EO4 A;  3TTH A;  4MI4 A;  1BOB A;  4BMH A;  4L8A A;  5EBV A;  2JDD A;  5C82 A;  5KTD A;  2ZW4 A;  2OH1 A;  4CAX A;  1Q2D A;  3W6S A;  3F8K A;  2Q7B A;  4JXQ A;  2ZW5 A;  1RXT A;  1N71 A;  1FY7 A;  1LRZ A;  2X7B A;  4B5P B;  1Q2Y A;  2AE6 A;  1M4I A;  2FCK A;  3NE7 A;  4PK2 A;  4HKF A;  4II9 A;  3S6H A;  4CRY B;  1XIX A;  2BSW A;  2B5G B;  4KUB A;  1KZF A;  1QSR A;  3WR7 A;  4U9Z A;  2FS5 A;  3ZZI A;  4XNH C;  3SXO A;  1I21 A;  3FBU A;  2ARH A;  4FD5 A;  4KVM E;  2ZW6 A;  4NCZ A;  1R57 A;  1CJW A;  5DWN A;  5JPH A;  3CXP A;  3V8I A;  2P6G A;  2HV2 A;  2JLM A;  3EXN A;  4FD7 A;  3GYA A;  4R87 A;  2H5M A;  2VZY A;  5E96 A;  2OB0 A;  3TO7 A;  1M44 A;  1MJ9 A;  4OLL A;  4PV6 A;  4AVC A;  2JDC A;  2B58 A;  5GCN A;  1I12 A;  1IID A;  3VWD A;  3I3G A;  2BUE A;  1YX0 A;  3E0K A;  2ZXV A;  1MJA A;  4IUS A;  1YLE A;  1NMT A;  4KVO E;  2EUI A;  4KOX A;  4Y49 B;  3DDD A;  4MHD A;  2PDO A;  2Q04 A;  5I0C A;  3R1K A;  2OZG A;  5J8F A;  4KUA A;  4E8O A;  3PGP A;  4XNH B;  3T90 A;  3TFY A;  2Q44 A;  1Y9W A;  4H89 A;  4AVB A;  4JD6 A;  2G3T A;  3TO6 A;  1S7N A;  5H84 A;  2I79 A;  1B87 A;  4QBJ A;  2D4P A;  2DXQ A;  2J8R A;  3IGR A;  4XPK A;  4KOT A;  4QVT A;  2Y0M A;  1XMT A;  1NE9 A;  2O28 A;  2B5G A;  3D8P A;  3F0A A;  2GE3 A;  3TO9 A;  1Y7R A;  2VI7 A;  4KOW A;  3R9E A;  1ON0 A;  1S7L A;  4H6Z A;  4JLY A;  4FD6 A;  1QST A;  4JJX A;  2PQ8 A;  3TT2 A;  2G3A A;  4JWP A;  2R7H A;  5IB0 A;  1UFH A;  3LD2 A;  1S60 A;  4KOV A;  2P6F A;  5KTA A;  3PZJ A;  2ATR A;  4UA3 A;  3UY5 A;  3K9U A;  4AG7 A;  2OZU A;  2B3V A;  1S3Z A;  5H86 A;  4KOR A;  3QAH A;  5F49 A;  2OZH A;  1KUX A;  1PUA A;  4H6U A;  4KLV A;  1M4D A;  2R98 A;  4J3G A;  4Y49 C;  1IB1 E;  2IL4 A;  1Z9U A;  3FXT A;  3MGD A;  3T9Y A;  4F0Y A;  1L0C A;  5FVJ A;  2BEI A;  4CS0 B;  2HUZ A;  3R96 A;  3ZJ0 A;  1XE4 A;  3S6G A;  2FXF A;  2RC4 A;  4E2A A;  1XF8 A;  4AVA A;  4XPD B;  2PR1 A;  4NSQ A;  2OU2 A;  3DSB A;  4U9Y A;  3FNC A;  2EVN A;  2A4N A;  4GS4 A;  4AG9 A;  1KUV A;  1YK3 A;  3N7Z A;  2PRB A;  3QB8 A;  3G8W A;  1MK4 A;  2Z11 A;  5IV0 A;  2J8N A;  2VBQ A;  3GY9 A;  2VXK A;  1KUY A;  1S7K A;  1B6B A;  3P2H A;  1J4J A;  2ZW7 A; 
#chains in the Genus database with same CATH topology
 4DUK A;  3GIU A;  5LYI A;  2GIV A;  2JEV A;  4ZI6 A;  3KZW A;  1YRE A;  3BI0 A;  1DE4 C;  2ZEO A;  4ZBG A;  1Z8L A;  3IFE A;  3VWE A;  4YFJ A;  2ZED A;  5EC4 A;  3SI0 A;  1CG2 A;  3BI1 A;  4HPS A;  2IQ6 A;  1LFW A;  2Q4V A;  3SJE A;  3NE8 A;  2PVV A;  2Z3N A;  4C68 A;  3IWW A;  1VHS A;  1OZP A;  4M3S A;  2NYQ A;  3D68 A;  1WK4 A;  5JQ4 A;  4P4B A;  4CGP A;  1OBR A;  2FT0 A;  2Z0Z A;  4CRZ B;  4FD4 A;  3JVN A;  1BPN A;  1F2P A;  1S7F A;  4ORF A;  4QB9 A;  4IF5 A;  2P6E A;  2WSA A;  3CDX A;  3D2M A;  4WWV A;  2G0B A;  3D2P A;  3EY5 A;  4IHM A;  1VKC A;  4NGN A;  4LX9 A;  2GRE A;  1XEB A;  5DWM A;  3SI1 A;  4CYP A;  3FEC A;  1Z8X A;  3FRM A;  4PXC A;  1V0C A;  3NA6 A;  4OIW A;  2J8M A;  2Q4Y A;  2DPS A;  5F47 A;  2IMO A;  1QSO A;  2PJ6 A;  2VQY A;  5AG6 A;  3PP9 A;  1VHE A;  4EME A;  2AFM A;  3KGQ A;  1R43 A;  4P4I A;  2FIW A;  3B8G A;  2RB7 A;  4P4E A;  1PCA A;  4KVX A;  4UIA A;  1S5K A;  4C2X A;  4XPD C;  1JQG A;  2C27 A;  2C6P A;  2D4O A;  2HB6 A;  2K5T A;  2Q4Z A;  2V8V A;  4QC6 A;  1M1D A;  4A32 A;  1ZO0 A;  2O53 A;  2ZPA A;  1XMB A;  1YW4 A;  2PCU A;  2Z10 A;  4MRI A;  1VHO A;  3VAR A;  4FAI A;  1MJB A;  3QNV A;  2B4B A;  3OWC A;  4HNY B;  4KOU A;  1R3N A;  1TIQ A;  1YVK A;  2PJ5 A;  1TF8 A;  5G20 A;  2FVG A;  2VEZ A;  1Q2C A;  3C26 A;  3R95 A;  2R1I A;  2CNS A;  1YVO A;  3H8F A;  4M6I A;  5J8C A;  4MHZ A;  4UEZ A;  4UCP A;  2FSR A;  4NJR A;  3KL9 A;  4MFQ A;  4OAD A;  2GAN A;  4KZT A;  3KI9 A;  3FF3 A;  1XBU A;  4KLW A;  4MXU A;  2ZEE A;  4PSX A;  1WWZ A;  3KAS A;  5AGE A;  1F2O A;  4NGM A;  2ZEN A;  4L89 A;  4K30 A;  3JRU A;  4MJ8 A;  3CT9 A;  3JUW A;  2VZZ A;  2PJ7 A;  3S9M A;  4C2Z A;  4MHP A;  1M4G A;  5G21 A;  4P4J A;  1NSL A;  3TOB A;  2ZOF A;  3FIX A;  3BHX A;  3QAY A;  4UWJ A;  1P0H A;  4DNC A;  3S6F A;  2BOA A;  4B5O A;  5BWA B;  3B2Y A;  2YNC C;  4NEX A;  4X2T A;  3N5F A;  4XPL A;  1CX8 A;  2AFX A;  3D3S A;  4OC4 A;  4R3K A;  4CGN A;  4PSW A;  3D7F A;  3B3V A;  2B3U A;  4P45 A;  4C2Y A;  2B4D A;  3H8G A;  4OID A;  5F09 A;  4CGO A;  2CY2 A;  3PFO A;  2ZOG A;  3P2F A;  1H8L A;  2V8D A;  4LUA A;  2BL1 A;  4ONU A;  3SJF A;  3SXN A;  2PE3 A;  1P4N A;  5HVF A;  4UCN A;  4CGM A;  3B3W A;  4A37 A;  4C7I A;  3BLN A;  4BBH A;  4EVY A;  1LCP A;  3CXQ A;  3RZA A;  2EO8 A;  4GXH A;  3SHP A;  4A31 A;  1IYL A;  1LAM A;  1Z4R A;  1Q7L A;  4MBU A;  1BLL E;  4R57 A;  4A39 A;  5CBM A;  4O23 A;  3TX8 A;  2C6G A;  5JM6 A;  3L2N A;  4UEE A;  4UFW A;  2AFO A;  3EFA A;  1CM0 A;  1Z8T A;  4ZY0 A;  2HQY A;  2I3C A;  4G1P A;  4M85 A;  2ZEG A;  2BCO A;  3H4Q A;  4UCM A;  4JYW A;  4OME A;  4MY3 A;  2FIA A;  4MFP A;  1PU9 A;  4OAE A;  1BO4 A;  5LRG A;  1PYT B;  2PJB A;  5JH9 A;  2I00 A;  4MFK A;  4NJQ A;  2AFS A;  4F9U A;  1VIX A;  2Z3L A;  5ISV A;  2QML A;  3FX6 A;  2AJ6 A;  4HNW B;  2F7V A;  1CBX A;  3DGV A;  5DS0 A;  4R6T A;  2PC1 A;  3PBE A;  4PK3 A;  3T8W A;  3TE4 A;  2NMT A;  3I9S A;  3W6X A;  4I49 A;  3IIB A;  1QSM A;  4TWE A;  1YQE A;  3S6K A;  3WT4 A;  1ZLH A;  3TOA A;  4R3L A;  1YR0 A;  3G3S A;  1TKF A;  2B4D B;  1NSA A;  4MY0 A;  4OC5 A;  1Y9K A;  4MFL A;  2G9D A;  1Y0Y A;  3CZX A;  3IWE A;  3LOD A;  5G22 A;  2C6C A;  4KOY A;  4CAV A;  5D8N A;  4H2K A;  3F5B A;  3GKR A;  4NGS A;  1SQH A;  3DR8 A;  2PJ3 A;  3DR6 A;  4CAW A;  2R8V A;  4ZY2 A;  2C1C A;  4P6Y A;  2PSW A;  4R9M A;  4NF1 A;  4A94 A;  3GB0 A;  2XEI A;  1ZG7 A;  1Y0R A;  3B7I A;  2AFW A;  4UBR A;  2GLF A;  2P0W A;  3CXS A;  5LRK A;  3R9G A;  3RAM A;  3NH5 A;  5HMN A;  3WC6 A;  3FYN A;  4HNX B;  1TKH A;  4RI1 A;  4E0A A;  5C88 A;  7CPA A;  4U5Y A;  5ELY A;  2CTC A;  2PJ4 A;  2WPX A;  5F48 A;  3IWG A;  2WPW A;  4M6G A;  3EC4 A;  2QEC A;  2QIR A;  4KOS A;  5AG5 A;  4KSI A;  2FE7 A;  4R76 A;  2V8H A;  5IX3 A;  3FB3 A;  5F46 A;  4AB7 A;  4KSA A;  3KKW A;  1XFO A;  1XJO A;  4YRH A;  4RS2 A;  5HH1 A;  3TCV A;  1CP7 A;  5AG4 A;  1X10 A;  4OC1 A;  1I1D A;  2FL4 A;  1LAN A;  3PEI A;  4B5P A;  1Z4E A;  3W91 A;  1RO5 A;  4F0X A;  5KTC A;  3BJ7 A;  1IOF A;  2PJ2 A;  2Q0Y A;  1LOK A;  3RYO A;  2EK9 A;  3PB9 X;  4QUS A;  4YGO A;  1YGH A;  4B6Z A;  1K4J A;  3IO1 A;  1FT7 A;  1QSN A;  4X5K A;  4NXY A;  1DTD A;  2PIY A;  3DNS A;  4A33 A;  4FWU A;  4CYO A;  2NSM A;  2CNT A;  4K3N A;  4YU9 A;  3R9F A;  4A30 A;  3VAT A;  1IGB A;  2ZEM A;  2PR8 A;  1GHE A;  2F5I A;  4CGL A;  2CNM A;  1U6M A;  5D29 A;  2Z3M A;  4UWI A;  5LYD A;  1IYK A;  2KCW A;  2OR4 A;  2REE A;  3FH4 A;  4FUU A;  3BJ8 A;  4OKO A;  1AMP A;  4JZ0 A;  2Z3O A;  3D67 A;  5CNP A;  4F6A A;  1KWM A;  2ANP A;  4JXR A;  5CPA A;  1IIC A;  3WC7 A;  3D7H A;  2REF A;  3EO4 A;  3TTH A;  4MI4 A;  1BOB A;  4BMH A;  2CIJ A;  4BIN A;  4ZX9 A;  1UWY A;  4L8A A;  5EBV A;  2JDD A;  3D4U A;  4KSF A;  4C7H A;  3ISX A;  4CYN A;  5C82 A;  2ZW4 A;  1ZLI A;  5KTD A;  2OH1 A;  4CAX A;  2XEJ A;  1Q2D A;  3W6S A;  4UEF A;  6CPA A;  2POK A;  3F8K A;  1YLO A;  4P10 A;  2Q7B A;  4P4F A;  3CPX A;  4JXQ A;  1X12 A;  4CAF A;  1ZG8 A;  2ZW5 A;  3JTK A;  1RXT A;  3PBB A;  1FNO A;  1N71 A;  3K9T A;  1FY7 A;  1LRZ A;  2X7B A;  2Z3K A;  3PB8 X;  4B11 A;  4B12 A;  1Q2Y A;  4B5P B;  2AE6 A;  1M4I A;  4NGQ A;  2FCK A;  2VL1 A;  3NE7 A;  1Y7E A;  4PK2 A;  4RUH A;  1BPM A;  2WYR A;  4HKF A;  1ELM P;  3HUV A;  5I4M A;  4II9 A;  2V8G A;  2YNC A;  3S9L A;  3S6H A;  4CRY B;  5A28 A;  5HVG A;  1XIX A;  2BSW A;  2PJ1 A;  1TKJ A;  2QJ8 A;  2B5G B;  4OC3 A;  4KUB A;  1KZF A;  4A95 A;  1QSR A;  1Z5R A;  3WR7 A;  4NGT A;  4MCS A;  4U9Z A;  1TF9 A;  1IOI A;  2FS5 A;  3SJX A;  1ARM A;  3ZZI A;  2F8H A;  4XNH C;  3WAB A;  2PJA A;  2ZEL A;  1I21 A;  3SXO A;  4CPA A;  3FBU A;  2ARH A;  4FD5 A;  4KVM E;  2ZW6 A;  4NCZ A;  1CPX A;  1R57 A;  1CJW A;  4GM5 A;  5DWN A;  4RN7 A;  4ZX8 A;  5JPH A;  3CXP A;  3V8I A;  2P6G A;  5HVH A;  2PVW A;  2HV2 A;  2Q51 A;  4PPZ A;  2JLM A;  4UFX A;  2YNE A;  3EXN A;  2IJZ A;  4NGR A;  2DEA A;  4FD7 A;  4M6H A;  3V7Z A;  4MFZ A;  3GYA A;  4UF4 A;  4R87 A;  1AYE A;  3TC8 A;  2XEF A;  2H5M A;  3KHZ A;  1HDU A;  5EMI A;  3B3S A;  2VZY A;  5E96 A;  2OB0 A;  4IK2 A;  3TO7 A;  1M44 A;  1MJ9 A;  2GLJ A;  3FEE A;  4OLL A;  4PV6 A;  4AVC A;  2ZW7 A;  2JDC A;  4OC2 A;  1AUG A;  2PJ8 A;  1XRY A;  2B58 A;  2CTB A;  5LYF A;  5HXD A;  5K8M A;  5JGF A;  5GCN A;  1A2Z A;  1I12 A;  3GUX A;  1IID A;  2Q43 A;  3VH9 A;  5A27 A;  3VWD A;  3I3G A;  3RO0 A;  2BUE A;  2O4H A;  1CPS A;  1YX0 A;  2QVP A;  3E0K A;  4Q38 A;  2ZXV A;  3KR5 A;  1YME A;  4KS9 A;  1MJA A;  2PJ0 A;  1YSJ A;  4IUS A;  1YLE A;  1NMT A;  4KVO E;  2EUI A;  2DPT A;  4KOX A;  4Y49 B;  3DDD A;  5LRJ A;  5LYL A;  3ISZ A;  4MHD A;  2PDO A;  2Q04 A;  5I0C A;  3R1K A;  2OZG A;  5J8F A;  4KUA A;  3KHX A;  5K8O A;  4X3R A;  3PGP A;  4E8O A;  2RFH A;  4IAV A;  4PXD A;  4XNH B;  3IJ3 A;  3FJU A;  4PXE A;  3T90 A;  3TFY A;  2Q44 A;  3NH8 A;  8CPA A;  1Y9W A;  5J1Q A;  4H89 A;  4AVB A;  4JD6 A;  2G3T A;  2GFQ A;  1YW6 A;  1S7N A;  3TO6 A;  4EWT A;  4A2Z A;  2OOT A;  5H84 A;  4X8I A;  3A9L A;  2JBJ A;  2JEW A;  2I79 A;  3FMC A;  4UFV A;  1VGY A;  2YGW A;  1HEE A;  1B87 A;  4QBJ A;  2D4P A;  1Z2L A;  3PFE A;  1IU8 A;  2DXQ A;  2EWB A;  1TXR A;  2DF5 A;  2J8R A;  3IGR A;  4KOT A;  4LQG A;  4XPK A;  4W9Y A;  4MCQ A;  4OC0 A;  4QVT A;  3WC5 A;  2Y0M A;  1XMT A;  1NE9 A;  2O28 A;  2B5G A;  3BXM A;  4B14 A;  3D8P A;  3F0A A;  3PB7 X;  4Q36 A;  3TO9 A;  4LQ6 A;  5K8N A;  1Y7R A;  5G1Z A;  2VI7 A;  3H8E A;  4EFD A;  4KOW A;  2J9A A;  4NGP A;  4PQA A;  4MCP A;  3R9E A;  4ZGY B;  1ON0 A;  3B3C A;  3HLP A;  3PRT A;  4MHY A;  3MRU A;  2QYV A;  1S7L A;  3MN8 A;  1CP6 A;  4MHN A;  5IB9 A;  4H6Z A;  3FVL A;  4JLY A;  4YWY A;  4P4D A;  4FD6 A;  3CPA A;  1QST A;  3K2K A;  2WUU A;  3S9N A;  1QQ9 A;  2GU2 A;  1XOV A;  4JJX A;  3KQX A;  2PQ8 A;  3TT2 A;  2G3A A;  4JWP A;  4F9V A;  4R8F A;  4TNU A;  2R7H A;  3B3T A;  3DLJ A;  5IB0 A;  3SJG A;  1UFH A;  3LD2 A;  4B13 A;  3LWU A;  1S60 A;  2PJ9 A;  4PXB A;  1JWQ A;  4KOV A;  2P6F A;  3D66 A;  3NH4 A;  5KTA A;  3PZJ A;  4ZY1 A;  2ATR A;  4MCR A;  2EK8 A;  4UA3 A;  4A38 A;  1Z8W A;  1BAV A;  3UY5 A;  3K9U A;  4AG7 A;  2OZU A;  2ZEF A;  2B3V A;  1S3Z A;  2HC9 A;  4AXV A;  3RNZ A;  5H86 A;  2ODF A;  4KOR A;  3H5Z A;  2PJC A;  3QAH A;  3PB6 X;  5F49 A;  5THW A;  2AFZ A;  4ONW A;  2OZH A;  1KUX A;  2XEG A;  3V38 A;  1PUA A;  4F8Z A;  2CF4 A;  4H6U A;  4KLV A;  4OP4 A;  4ZYQ A;  1M4D A;  1ZG9 A;  2R98 A;  4J3G A;  4Y49 C;  1IB1 E;  2IL4 A;  1Z9U A;  2Q7S A;  3FXT A;  4CYQ A;  2PRQ A;  3MGD A;  3T9Y A;  4F0Y A;  1L0C A;  1HDQ A;  3PB4 X;  4P44 A;  5FVJ A;  2AFU A;  1QMU A;  2BEI A;  3NFZ A;  4DJL A;  1EE3 P;  2PIZ A;  3IU2 A;  4B10 A;  4BD9 A;  2HUZ A;  4MMO A;  2JBK A;  1F57 A;  4CAE A;  4CS0 B;  3R96 A;  3ZJ0 A;  5AG7 A;  2CXA A;  1XE4 A;  4R7M A;  3FED A;  2ZEP A;  4MFJ A;  2EBJ A;  2FXF A;  3IC1 A;  2RC4 A;  3S6G A;  5K8P A;  3RBU A;  2Z3P A;  4E2A A;  1XF8 A;  4AVA A;  1RTQ A;  4XPD B;  2PR1 A;  4NSQ A;  4DYO A;  2OU2 A;  3DSB A;  4UIB A;  3IEH A;  3SI2 A;  4U9Y A;  3D7D A;  3D7G A;  2ABZ A;  3IU1 A;  3FNC A;  2EVN A;  2A4N A;  2YND A;  4Q7A A;  4GS4 A;  4AG9 A;  1KUV A;  1YK3 A;  2BO9 A;  2WZN A;  3LMS A;  3LAC A;  3KQZ A;  3N7Z A;  4FBE A;  2PRB A;  3GLJ A;  1ARL A;  4NFR A;  1ELL P;  3QB8 A;  3G8W A;  4Z65 A;  1MK4 A;  2Z11 A;  2ZEH A;  5IV0 A;  2J8N A;  3B35 A;  2VBQ A;  3GY9 A;  2VXK A;  1GYT A;  3I1U A;  1KUY A;  1LAP A;  1IY7 A;  1M4L A;  1S7K A;  2V77 A;  3KR4 A;  1B6B A;  3P2H A;  4WJB A;  1J4J A;  2GE3 A; 
#chains in the Genus database with same CATH homology
 2GIV A;  2JEV A;  1YRE A;  4ZBG A;  3VWE A;  4YFJ A;  5EC4 A;  2Q4V A;  2Z3N A;  4C68 A;  1VHS A;  1OZP A;  4M3S A;  1WK4 A;  5JQ4 A;  4CGP A;  2FT0 A;  2Z0Z A;  4CRZ B;  4FD4 A;  3JVN A;  4ORF A;  1S7F A;  4QB9 A;  4IF5 A;  2P6E A;  2WSA A;  3D2M A;  2G0B A;  3D2P A;  3EY5 A;  1VKC A;  5DWM A;  4LX9 A;  4CYP A;  1XEB A;  3FRM A;  1V0C A;  2J8M A;  2Q4Y A;  2DPS A;  5F47 A;  1QSO A;  2VQY A;  5AG6 A;  3PP9 A;  2FIW A;  3B8G A;  4KVX A;  1S5K A;  4C2X A;  4XPD C;  2C27 A;  2D4O A;  2K5T A;  4QC6 A;  1M1D A;  4A32 A;  1ZO0 A;  2ZPA A;  2Z10 A;  1MJB A;  4HNY B;  2B4B A;  3OWC A;  4KOU A;  1TIQ A;  1YVK A;  5G20 A;  2VEZ A;  1Q2C A;  3C26 A;  3R95 A;  2R1I A;  2CNS A;  1YVO A;  5J8C A;  4UCP A;  2FSR A;  4MFQ A;  4OAD A;  2GAN A;  4KZT A;  4KLW A;  4PSX A;  1WWZ A;  5AGE A;  4L89 A;  4K30 A;  4MJ8 A;  3JUW A;  2VZZ A;  4C2Z A;  5G21 A;  1M4G A;  1NSL A;  3TOB A;  3FIX A;  4UWJ A;  1P0H A;  4DNC A;  3S6F A;  4B5O A;  5BWA B;  2YNC C;  4NEX A;  4XPL A;  3D3S A;  4CGN A;  4R3K A;  4PSW A;  2B3U A;  4C2Y A;  2B4D A;  4CGO A;  2CY2 A;  3P2F A;  4LUA A;  2BL1 A;  4ONU A;  3SXN A;  1P4N A;  4UCN A;  4CGM A;  4C7I A;  3BLN A;  4BBH A;  4EVY A;  3CXQ A;  3SHP A;  4A31 A;  1IYL A;  1Z4R A;  4MBU A;  4R57 A;  4UFW A;  3EFA A;  1CM0 A;  2HQY A;  4M85 A;  3H4Q A;  4UCM A;  4MY3 A;  2FIA A;  4MFP A;  1PU9 A;  4OAE A;  1BO4 A;  2I00 A;  4MFK A;  2Z3L A;  5ISV A;  2QML A;  2AJ6 A;  4HNW B;  2PC1 A;  4PK3 A;  3TE4 A;  2NMT A;  3I9S A;  3W6X A;  4I49 A;  1QSM A;  3S6K A;  3TOA A;  4R3L A;  1YR0 A;  3G3S A;  2B4D B;  4MY0 A;  1Y9K A;  4MFL A;  3IWE A;  3LOD A;  5G22 A;  4KOY A;  4CAV A;  3F5B A;  3GKR A;  1SQH A;  3DR8 A;  3DR6 A;  4CAW A;  2R8V A;  2PSW A;  4R9M A;  4NF1 A;  4UBR A;  2P0W A;  3CXS A;  3R9G A;  5HMN A;  4HNX B;  3FYN A;  4RI1 A;  4E0A A;  5C88 A;  4U5Y A;  2WPX A;  5F48 A;  3IWG A;  2WPW A;  3EC4 A;  2QEC A;  2QIR A;  4KOS A;  5AG5 A;  2FE7 A;  5IX3 A;  3FB3 A;  5F46 A;  4AB7 A;  4KSA A;  3KKW A;  5HH1 A;  4YRH A;  4RS2 A;  3TCV A;  5AG4 A;  1I1D A;  2FL4 A;  4B5P A;  1Z4E A;  3W91 A;  1RO5 A;  4F0X A;  5KTC A;  3BJ7 A;  2Q0Y A;  3RYO A;  4QUS A;  4YGO A;  1YGH A;  1K4J A;  1QSN A;  4X5K A;  4NXY A;  3DNS A;  4A33 A;  4CYO A;  2CNT A;  3R9F A;  4A30 A;  2PR8 A;  1GHE A;  2F5I A;  4CGL A;  2CNM A;  1U6M A;  2Z3M A;  4UWI A;  1IYK A;  2KCW A;  2REE A;  3BJ8 A;  2Z3O A;  5CNP A;  4F6A A;  4JXR A;  1IIC A;  2REF A;  3EO4 A;  3TTH A;  4MI4 A;  1BOB A;  4BMH A;  4L8A A;  5EBV A;  2JDD A;  4C7H A;  4KSF A;  4CYN A;  5C82 A;  5KTD A;  2ZW4 A;  2OH1 A;  4CAX A;  1Q2D A;  3W6S A;  3F8K A;  2Q7B A;  4JXQ A;  4CAF A;  2ZW5 A;  3JTK A;  1RXT A;  1N71 A;  1FY7 A;  1LRZ A;  2X7B A;  2Z3K A;  4B5P B;  4B11 A;  4B12 A;  1Q2Y A;  2AE6 A;  1M4I A;  2FCK A;  3NE7 A;  4PK2 A;  4HKF A;  4II9 A;  2YNC A;  3S6H A;  4CRY B;  5A28 A;  1XIX A;  2BSW A;  4A95 A;  2B5G B;  4KUB A;  1KZF A;  1QSR A;  3WR7 A;  4U9Z A;  2FS5 A;  3ZZI A;  4XNH C;  3SXO A;  1I21 A;  3FBU A;  2ARH A;  4FD5 A;  4KVM E;  2ZW6 A;  4NCZ A;  1R57 A;  1CJW A;  5DWN A;  5JPH A;  3CXP A;  3V8I A;  2P6G A;  2HV2 A;  2JLM A;  4UFX A;  2YNE A;  3EXN A;  4FD7 A;  4MFZ A;  3GYA A;  4R87 A;  2H5M A;  2VZY A;  5E96 A;  2OB0 A;  3TO7 A;  1M44 A;  1MJ9 A;  4OLL A;  4PV6 A;  4AVC A;  2JDC A;  2B58 A;  5GCN A;  1I12 A;  1IID A;  5A27 A;  3VWD A;  3I3G A;  2BUE A;  1YX0 A;  4Q38 A;  3E0K A;  2ZXV A;  4KS9 A;  1MJA A;  4IUS A;  1YLE A;  1NMT A;  4KVO E;  2EUI A;  2DPT A;  4KOX A;  4Y49 B;  3DDD A;  4MHD A;  2PDO A;  2Q04 A;  5I0C A;  3R1K A;  2OZG A;  5J8F A;  4KUA A;  4E8O A;  3PGP A;  4XNH B;  3T90 A;  3TFY A;  2Q44 A;  1Y9W A;  4H89 A;  4AVB A;  4JD6 A;  2G3T A;  3TO6 A;  1S7N A;  4A2Z A;  5H84 A;  3A9L A;  2I79 A;  4UFV A;  2YGW A;  1B87 A;  4QBJ A;  2D4P A;  2DXQ A;  2J8R A;  3IGR A;  4XPK A;  4KOT A;  4QVT A;  2Y0M A;  1XMT A;  1NE9 A;  2O28 A;  2B5G A;  4B14 A;  3D8P A;  3F0A A;  2GE3 A;  4Q36 A;  3TO9 A;  1Y7R A;  5G1Z A;  2VI7 A;  4KOW A;  3R9E A;  4ZGY B;  1ON0 A;  1S7L A;  4H6Z A;  4JLY A;  4FD6 A;  1QST A;  2WUU A;  4JJX A;  2PQ8 A;  3TT2 A;  2G3A A;  4JWP A;  2R7H A;  5IB0 A;  1UFH A;  3LD2 A;  4B13 A;  1S60 A;  4KOV A;  2P6F A;  5KTA A;  3PZJ A;  2ATR A;  4UA3 A;  3UY5 A;  3K9U A;  4AG7 A;  2OZU A;  2B3V A;  1S3Z A;  5H86 A;  4KOR A;  3H5Z A;  3QAH A;  5F49 A;  2OZH A;  1KUX A;  1PUA A;  4H6U A;  4KLV A;  1M4D A;  2R98 A;  4J3G A;  4Y49 C;  1IB1 E;  2IL4 A;  1Z9U A;  3FXT A;  4CYQ A;  3MGD A;  3T9Y A;  4F0Y A;  1L0C A;  5FVJ A;  2BEI A;  3IU2 A;  4B10 A;  4CS0 B;  2HUZ A;  4CAE A;  3R96 A;  3ZJ0 A;  5AG7 A;  2CXA A;  1XE4 A;  4MFJ A;  3S6G A;  2FXF A;  2RC4 A;  2Z3P A;  4E2A A;  1XF8 A;  4AVA A;  4XPD B;  2PR1 A;  4NSQ A;  2OU2 A;  3DSB A;  4U9Y A;  3IU1 A;  3FNC A;  2EVN A;  2A4N A;  2YND A;  4GS4 A;  4AG9 A;  1KUV A;  1YK3 A;  3N7Z A;  2PRB A;  3QB8 A;  3G8W A;  1MK4 A;  2Z11 A;  5IV0 A;  2J8N A;  2VBQ A;  3GY9 A;  2VXK A;  1KUY A;  1S7K A;  1B6B A;  3P2H A;  1J4J A;  2ZW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...