3R96A

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MccE protein
total genus 57
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r96A00
2VZZA 4MI4A 3PP9A 2FIAA 4X5KA 2VBQA 4HKFA 2B5GA 1QSNA 3T9YA 3IGRA 3T90A 2ZPAA 4J3GA 3TO9A 4JD6A 2REFA 4KOYA 3F5BA 1Q2YA 4MY3A 4E8OA 2Q4VA 5DWMA 4MBUA 3V8IA 2VI7A 2B4DB 4PSWA 1SQHA 4I49A 4PK3A 4UWIA 5ISVA 3TCVA 2PRBA 5C82A 1NMTA 1QSTA 2OZUA 2A4NA 1VHSA 4XNHB 2JDDA 3P2FA 3FRMA 5H84A 4JXQA 3JUWA 2WPWA 4OADA 1N71A 4KVME 3JVNA 2JDCA 4KLVA 3EXNA 4UBRA 2AJ6A 4OAEA 3TOAA 4H6ZA 2OZHA 3WR7A 5HH1A 1Z9UA 2R98A 4UWJA 2FT0A 1S7NA 4F6AA 3EFAA 2P6GA 5E96A 3S6FA 3DDDA 4H6UA 4H89A 4KOTA 2Q0YA 4FD5A 4KVOE 3GY9A 1BO4A 2FIWA 3D2MA 3FIXA 1S7FA 1KUXA 2REEA 4CS0B 2J8RA 2JLMA 3CXPA 4JJXA 4Y49B 4NF1A 2I00A 4PV6A 3TE4A 4YRHA 1B6BA 1YR0A 2JEVA 2FE7A 5HMNA 2ZW5A 4B5OA 1R57A 2P0WA 2OH1A 4FD4A 3PZJA 1QSMA 4XPDC 2Q04A 3R1KA 2DXQA 1Y9WA 1UFHA 2Q44A 3P2HA 3W6XA 1MJ9A 4ORFA 2BUEA 2VQYA 1P0HA 2J8NA 3N7ZA 1S60A 2PC1A 2B3UA 3W6SA 1WK4A 2P6EA 1IB1E 1CJWA 4U9ZA 1M4DA 2BSWA 1VKCA 3R9EA 4GS4A 1I1DA 3TO7A 3FNCA 3IWGA 1XEBA 2FS5A 4XNHC 4JWPA 2CNMA 4YGOA 2HV2A 3SHPA 2R1IA 4AVBA 4NEXA 2HQYA 5JQ4A 2IL4A 1Q2DA 2NMTA 3H4QA 4R3KA 2VZYA 5C88A 2PR8A 5EC4A 1IIDA 3CXQA 4U9YA 4OLLA 2FCKA 3MGDA 4R57A 1YLEA 3TFYA 5J8CA 3GKRA 5EBVA 3TO6A 3OWCA 1Q2CA 1KZFA 3DR6A 4NXYA 4ZBGA 4DNCA 2VEZA 2BL1A 4AVCA 4F0YA 2B4BA 3BLNA 5JPHA 1IICA 1RXTA 1KUYA 1FY7A 4L8AA 1PUAA 3R9GA 2G3TA 2ZW4A 1M4GA 2BEIA 3SXNA 4KUBA 4PSXA 2R8VA 3TTHA 2QECA 1PU9A 4KLWA 2WPXA 1CM0A 1LRZA 2GIVA 3KKWA 4AG9A 2O28A 4MJ8A 5J8FA 2C27A 4KOWA 2FSRA 2Z0ZA 2ZXVA 1I21A 5H86A 5DWNA 1Z4EA 4Y49C 2AE6A 5F46A 4KOSA 1S3ZA 1IYKA 1RO5A 3G3SA 4AG7A 1Z4RA 2OZGA 4K30A 1XIXA 2B3VA 2GANA 5F47A 4QVTA 1MK4A 1NSLA 2FXFA 1MJAA 5IX3A 3TT2A 2Y0MA 4KVXA 4KOUA 4JXRA 1MJBA 2QIRA 1TIQA 2PDOA 1S7LA 5I0CA 4FD6A 5KTDA 3QAHA 5GCNA 3CXSA 2GE3A 3E0KA 1OZPA 2H5MA 2P6FA 3EC4A 2KCWA 2RC4A 1ON0A 5F48A 3D2PA 4PK2A 1S7KA 3R9FA 1Y7RA 2G0BA 4QB9A 1XE4A 4MHDA 4B5PA 3FXTA 1YREA 1NE9A 4II9A 1V0CA 3LD2A 4QUSA 3B8GA 1XF8A 4JLYA 4M3SA 2R7HA 3G8WA 5KTAA 5IV0A 4AVAA 4CAXA 4CRZB 4E0AA 1BOBA 2CNTA 2ZW6A 5FVJA 1M44A 3F8KA 4CAWA 1GHEA 3DNSA 3W91A 4CRYB 2EVNA 1Y9KA 2HUZA 1YGHA 4LX9A 4KOVA 2OU2A 2I79A 4RI1A 4HNXB 2PR1A 1M1DA 2PQ8A 1IYLA 3VWDA 3SXOA 4R87A 2Q7BA 1P4NA 2FL4A 4RS2A 3S6HA 4QC6A 2D4OA 4CAVA 5CNPA 3R95A 4LUAA 2Q4YA 4XPLA 1YK3A 3S6KA 4B5PB 2X7BA 3DSBA 4UA3A 2VXKA 2Z11A 3ZZIA 3I9SA 3EY5A 4NSQA 3GYAA 3ZJ0A 4QBJA 3D3SA 4ONUA 2K5TA 1S5KA 4KZTA 1U6MA 2G3AA 4KOXA 3TOBA 4YFJA 3S6GA 3VWEA 1QSOA 2QMLA 2PSWA 1QSRA 1K4JA 4EVYA 4FD7A 2ZW7A 4KUAA 5IB0A 1WWZA 4U5YA 2CY2A 4XPDB 4MY0A 3R96A 2ATRA 2B58A 3NE7A 4HNYB 3FB3A 1YX0A 1M4IA 4IUSA 2EUIA 2OB0A 3BJ8A 5F49A 3PGPA 2B5GB 3EO4A 3BJ7A 1L0CA 3LODA 4E2AA 4XPKA 2F5IA 1XMTA 3DR8A 4M85A 4R3LA 3F0AA 4L89A 3I3GA 2D4PA 2J8MA 3RYOA 4NCZA 5KTCA 4BMHA 4KORA 3C26A 2B4DA 2CNSA 4R9MA 1I12A 3FYNA 1J4JA 1KUVA 3QB8A 2Z10A 3UY5A 3FBUA 2ARHA 3D8PA 4IF5A 1YVKA 4AB7A 4HNWB 1YVOA 3K9UA 1B87A
chains in the Genus database with same CATH superfamily
1JWQA 2CTBA 4F9VA 2VZZA 2ZEEA 4MI4A 4UCNA 3PP9A 3SI1A 2Q51A 2FIAA 4X5KA 3VATA 4B10A 4X8IA 3PEIA 2VBQA 4P4DA 2PJCA 3GLJA 4IAVA 2AFMA 5I4MA 1EE3P 4MFJA 3B3CA 4HKFA 4EWTA 1VHEA 2B5GA 2YNDA 2PJ2A 3FX6A 4C2ZA 1QSNA 3T9YA 3IGRA 3T90A 2ZPAA 3GIUA 1X10A 4J3GA 3KZWA 3TO9A 1XBUA 4JD6A 2REFA 4YU9A 4GXHA 4KOYA 4M6IA 3V38A 3F5BA 5AGEA 2I3CA 4WJBA 4UEFA 1YMEA 1Q2YA 4MY3A 4UCMA 3IWEA 4E8OA 4YWYA 3S9LA 3KASA 2Q4VA 5DWMA 1TKHA 1ZG8A 4MBUA 3PB9X 1VHOA 3V8IA 1AMPA 1CX8A 2VI7A 2B4DB 4CYOA 4PSWA 4Q38A 1SQHA 2Q43A 4I49A 4PK3A 4RN7A 1HDQA 4UWIA 5ISVA 2IJZA 1CP7A 3TCVA 2PRBA 3PB7X 5C82A 2PJBA 1LOKA 1NMTA 1QSTA 2EK8A 2A4NA 2OZUA 1VHSA 4UFVA 4XNHB 2PJ6A 1YQEA 2YNCA 2JDDA 3P2FA 5HXDA 3FRMA 5IB9A 3IU2A 1YLOA 4ZX8A 5H84A 4JXQA 2OR4A 3CDXA 2ZEHA 2JBJA 2F8HA 3JUWA 2WPWA 4OADA 1N71A 2PJ7A 4KVME 3JVNA 2JDCA 4KLVA 3EXNA 1HEEA 2ZENA 4UBRA 5JGFA 2AJ6A 4OAEA 3TOAA 4H6ZA 2OZHA 4MHZA 3KGQA 3WR7A 5HH1A 4C2XA 1Z9UA 2JEWA 2R98A 5D8NA 4UWJA 4B11A 4R6TA 2PJ4A 2FT0A 1S7NA 5AG5A 2XEIA 4F6AA 3EFAA 1YW4A 4ZYQA 2P6GA 4PXDA 5E96A 2AFXA 3S6FA 3SI0A 4CGLA 4ZGYB 5CBMA 3DDDA 4H6UA 3N5FA 4H89A 4KOTA 2Q0YA 3FECA 4FD5A 3QAYA 3GY9A 4KVOE 4NGRA 1BO4A 2FIWA 2CTCA 3D2MA 3FIXA 3MN8A 1ELLP 4P4JA 4Q36A 1S7FA 1KUXA 1LCPA 2REEA 2J8RA 3HUVA 4CS0B 3S9NA 2JLMA 1AYEA 7CPAA 1F2OA 4PXBA 1IGBA 3CXPA 2AFUA 3A9LA 2BOAA 4JJXA 4Y49B 4BINA 4NF1A 2I00A 4PV6A 4ZX9A 3TE4A 4YRHA 1B6BA 2PJ0A 2PE3A 1YR0A 2JEVA 2EWBA 3DGVA 4OIDA 1RTQA 3IFEA 3T8WA 2FE7A 5HMNA 3LWUA 2RB7A 2ZW5A 4B5OA 1IU8A 2OOTA 1R57A 3L2NA 3PB4X 2XEGA 3B3TA 2P0WA 1ARMA 2DF5A 1OBRA 2OH1A 3FJUA 4NGMA 4FD4A 3PZJA 1QSMA 1XOVA 4XPDC 3WC6A 2PJ8A 3B35A 3IC1A 2ZEGA 4P45A 4IHMA 1LAMA 4FAIA 1F57A 2Q04A 3R1KA 2DXQA 3SJFA 1IOFA 2IQ6A 3PB8X 5LRGA 1Y9WA 4MMOA 2C1CA 4R76A 3D7GA 1UFHA 1CG2A 3D67A 2Q44A 2C6GA 3P2HA 4ZY0A 3W6XA 4IK2A 1LANA 2ZEOA 4K3NA 1MJ9A 4UIBA 3RBUA 3IU1A 4BBHA 3S9MA 2F7VA 2Z3NA 4ORFA 5LRJA 2BUEA 2VQYA 3GB0A 1P0HA 4R7MA 2J8NA 2ZOFA 3N7ZA 4CPAA 3SI2A 2ZEPA 1XFOA 4UEZA 3V7ZA 1S60A 5K8OA 2PC1A 2B3UA 5AG7A 4A39A 3W6SA 1WK4A 4C68A 4RUHA 5AG4A 2P6EA 1IB1E 1CJWA 4U9ZA 3K9TA 1M4DA 1Z8WA 1XMBA 2BSWA 1VKCA 3R9EA 4GS4A 2O53A 1I1DA 3D66A 3TO7A 3FNCA 3IWGA 3H8EA 4PPZA 1XEBA 2Z3PA 1Z8LA 2FS5A 4XNHC 4JWPA 4UIAA 2CNMA 4YGOA 1PCAA 4X2TA 2HV2A 4NGNA 3SHPA 3B3WA 4P44A 2CXAA 2PJ1A 2R1IA 4MFPA 5ELYA 3RNZA 4AVBA 2PJAA 4B13A 2V8VA 2Z3MA 5LYLA 4NEXA 2HQYA 3B7IA 5JQ4A 2IL4A 4KSIA 1Q2DA 2G9DA 2NMTA 3H4QA 4MHNA 2VZYA 4R3KA 4OC3A 5G21A 3WABA 2PR8A 5C88A 5EC4A 3BI1A 1ZG7A 1IIDA 3B3VA 4UEEA 4M6GA 2BCOA 2YGWA 3CXQA 4U9YA 4OLLA 2FCKA 3MGDA 2ZEMA 2XEFA 3TC8A 2C6PA 4R57A 2PCUA 1BAVA 1YLEA 2Z3OA 4C7HA 1ARLA 2QYVA 2QVPA 5HVGA 3TFYA 1Z2LA 5J8CA 1R3NA 3GKRA 5EBVA 3TO6A 3RAMA 2RFHA 3OWCA 3CT9A 3FVLA 1BPMA 1Q2CA 1VIXA 3H8GA 1KZFA 1BLLE 3DR6A 3H5ZA 3WC5A 4NXYA 2WZNA 3VH9A 4ZBGA 4PXCA 4A31A 4DNCA 2VEZA 1TKFA 2BL1A 2PIZA 4AVCA 4F0YA 2DPSA 2VL1A 4OC4A 2B4BA 3MRUA 2ZEFA 3BLNA 4UFWA 4ZI6A 5JPHA 4OMEA 1IICA 1RXTA 1FNOA 2HC9A 1KUYA 1FY7A 4L8AA 1PUAA 3H8FA 1DE4C 2AFOA 3R9GA 4MCRA 4A2ZA 3VARA 6CPAA 4TNUA 4OC0A 1TKJA 2G3TA 4P4EA 2AFSA 2V8HA 4CYPA 3RO0A 4O23A 3KR4A 2ZW4A 1F2PA 1M4GA 2BEIA 3SXNA 4KUBA 4PSXA 5LRKA 2R8VA 3TTHA 2QECA 3RZAA 2GLJA 1PU9A 4KLWA 4B14A 4ONWA 4JZ0A 5DS0A 1Q7LA 1PYTB 2WPXA 1CM0A 2WUUA 3PRTA 1LRZA 4HPSA 1GYTA 2GIVA 3KKWA 4AG9A 4Z65A 4LQGA 4MCQA 5G22A 1CP6A 2O28A 4P10A 4KS9A 4MJ8A 5J8FA 2C27A 3FEDA 4KOWA 2FSRA 2Z0ZA 3IWWA 2ZXVA 2J9AA 4A33A 2GU2A 1I21A 1TF9A 1M4LA 5DWNA 1Z4EA 5H86A 1R43A 4Y49C 4CAFA 2AE6A 5F46A 3ISXA 4KOSA 4DJLA 2CF4A 4UCPA 4B12A 1ZG9A 1S3ZA 1IYKA 4MFQA 1RO5A 3G3SA 1KWMA 3NE8A 4AG7A 3IO1A 1Z4RA 2Z3KA 3NH8A 4P6YA 5F09A 2OZGA 2QJ8A 4K30A 1XIXA 2B3VA 2GANA 5F47A 4QVTA 3IJ3A 1MK4A 1NSLA 5AG6A 2FXFA 1AUGA 1MJAA 3WC7A 3JRUA 3TT2A 4P4BA 3FMCA 5IX3A 1Z8XA 2POKA 1Y0RA 2Y0MA 2WYRA 4JXRA 4KOUA 2AFWA 4KVXA 3BHXA 1MJBA 2CIJA 3BI0A 2QIRA 1TIQA 4OC1A 2PDOA 1S7LA 2BO9A 4NJRA 1QMUA 4F0XA 2EK9A 5I0CA 4OC2A 1Z5RA 2V8DA 2ANPA 3PBBA 4FD6A 5KTDA 3FF3A 3BXMA 4NGQA 2PJ9A 4OKOA 5LYIA 3QAHA 2DPTA 1LFWA 5GCNA 3CXSA 2GE3A 2ZEDA 1OZPA 3E0KA 4A30A 2H5MA 2P6FA 1YSJA 3EC4A 2YNEA 2GREA 4MHYA 2KCWA 2RC4A 4OP4A 1ON0A 2PVWA 4F9UA 1BPNA 5F48A 4BD9A 1Y7EA 3D2PA 4PK2A 1XJOA 1S7KA 3R9FA 4P4FA 1Y7RA 5K8MA 1CPSA 3QNVA 4UF4A 2G0BA 4QB9A 5D29A 1YW6A 1X12A 1CBXA 3D7DA 3PBEA 5A27A 1XE4A 5CPAA 4MHDA 3LMSA 3PB6X 3B3SA 4NGTA 4B5PA 3FXTA 1YREA 4KSFA 1NE9A 4CYNA 4II9A 1V0CA 2FVGA 3LD2A 3GUXA 4QUSA 3B8GA 3CPXA 2EBJA 1XF8A 4C2YA 4DYOA 4JLYA 4M3SA 4OC5A 2R7HA 3G8WA 1TF8A 4AXVA 5KTAA 1ZLIA 5IV0A 4JYWA 4AVAA 4CAXA 4C7IA 5K8NA 5LYFA 1ELMP 4A32A 4CRZB 4MXUA 3D7HA 4E0AA 1BOBA 2CNTA 4NGSA 2ZW6A 5FVJA 3CPAA 3D4UA 1M44A 2V8GA 3F8KA 4CAWA 1GHEA 2ZELA 3DNSA 3W91A 3ISZA 4CRYB 2EVNA 4NJQA 1Y9KA 2HUZA 1IY7A 1YGHA 4LX9A 5HVFA 2EO8A 2OU2A 2I79A 2PR1A 2DEAA 1M1DA 2PQ8A 3K2KA 4HNXB 4KOVA 4RI1A 5G1ZA 4MFZA 1IYLA 4MCPA 3CZXA 3SXOA 3VWDA 2PVVA 8CPAA 4R87A 5THWA 4A95A 3TX8A 4MCSA 2Q7BA 1P4NA 2FL4A 3SJEA 4RS2A 3S6HA 4MFLA 4QC6A 2D4OA 4EFDA 4CAVA 5CNPA 3LACA 5J1QA 4F8ZA 3DLJA 3R95A 1TXRA 4LUAA 2Q4YA 4XPLA 1YK3A 3S6KA 4B5PB 4CGMA 2X7BA 3DSBA 4OIWA 3D68A 2VXKA 2ABZA 2V77A 2Z11A 4UA3A 4TWEA 3ZZIA 1Z8TA 3I9SA 3D7FA 3EY5A 4NSQA 2Q4ZA 4PQAA 4P4IA 4R8FA 3GYAA 3ZJ0A 4QBJA 3D3SA 2ZOGA 1HDUA 4CGNA 5BWAB 4ONUA 1QQ9A 2K5TA 5K8PA 3FEEA 5JM6A 1S5KA 2Z3LA 4KZTA 1U6MA 2G3AA 4KOXA 4MHPA 3TOBA 3KQXA 4YFJA 3WT4A 3S6GA 3KHZA 3VWEA 4NGPA 1QSOA 2QMLA 3PFOA 2WSAA 2PRQA 2AFZA 2C6CA 2NSMA 1JQGA 2PSWA 4FUUA 1QSRA 1K4JA 4EVYA 1VGYA 4ZY1A 3HLPA 4FD7A 4G1PA 2ZW7A 2ODFA 1LAPA 3IEHA 4W9YA 4A38A 1UWYA 2XEJA 4CYQA 3I1UA 4A37A 4KUAA 4X3RA 5IB0A 1WWZA 1DTDA 4U5YA 3KHXA 2CY2A 4XPDB 3KI9A 4MY0A 3R96A 4FBEA 2ATRA 2B58A 2NYQA 3KR5A 4MFKA 2HB6A 2PJ5A 3NH4A 1Y0YA 3NE7A 4HNYB 3NFZA 3SJGA 3FB3A 4LQ6A 1YX0A 5LYDA 1M4IA 2YNCC 5HVHA 4IUSA 2EUIA 2OB0A 3BJ8A 4Q7AA 5F49A 3PGPA 4H2KA 1ZO0A 1IOIA 5JH9A 2B5GB 1A2ZA 3EO4A 4ZY2A 4A94A 1FT7A 4GM5A 4KSAA 3BJ7A 1L0CA 2Q7SA 3LODA 4FWUA 4XPKA 4E2AA 2F5IA 5G20A 4B6ZA 1XMTA 3DR8A 4M85A 4R3LA 4UFXA 3F0AA 1XRYA 3JTKA 4MRIA 3KQZA 4L89A 3I3GA 2D4PA 2J8MA 3PFEA 4NCZA 3RYOA 5KTCA 3B2YA 3NH5A 4M6HA 4BMHA 4EMEA 4KORA 4CGPA 2GLFA 2O4HA 1NSAA 2IMOA 3C26A 4WWVA 3NA6A 2B4DA 2CNSA 3FH4A 4R9MA 1CPXA 1I12A 3FYNA 1J4JA 1KUVA 3QB8A 2GFQA 2PIYA 2Z10A 1ZLHA 1H8LA 3UY5A 3IIBA 3FBUA 2PJ3A 2ARHA 3D8PA 4IF5A 3KL9A 3SJXA 1YVKA 5EMIA 4AB7A 4CAEA 4HNWB 4DUKA 2JBKA 5A28A 4CGOA 1YVOA 4PXEA 3K9UA 4NFRA 1B87A
chains in the Genus database with same CATH topology
2VZZA 4UCNA 4MI4A 3PP9A 4B10A 2FIAA 4X5KA 2VBQA 4MFJA 4HKFA 2B5GA 2YNDA 4C2ZA 1QSNA 3T9YA 3IGRA 3T90A 2ZPAA 4J3GA 3TO9A 4JD6A 2REFA 4KOYA 3F5BA 5AGEA 1Q2YA 4MY3A 4UCMA 3IWEA 4E8OA 2Q4VA 5DWMA 4MBUA 3V8IA 2VI7A 2B4DB 4CYOA 4PSWA 4Q38A 1SQHA 4I49A 4PK3A 4UWIA 5ISVA 3TCVA 2PRBA 5C82A 1NMTA 1QSTA 2OZUA 2A4NA 4UFVA 1VHSA 4XNHB 2YNCA 2JDDA 3P2FA 3FRMA 3IU2A 5H84A 4JXQA 3JUWA 2WPWA 4OADA 1N71A 4KVME 3JVNA 2JDCA 4KLVA 3EXNA 4UBRA 2AJ6A 4OAEA 3TOAA 4H6ZA 2OZHA 3WR7A 5HH1A 4C2XA 1Z9UA 2R98A 4B11A 4UWJA 2FT0A 1S7NA 5AG5A 4F6AA 3EFAA 2P6GA 5E96A 3S6FA 4CGLA 4ZGYB 3DDDA 4H6UA 4H89A 4KOTA 2Q0YA 4FD5A 4KVOE 3GY9A 1BO4A 2FIWA 3D2MA 3FIXA 4Q36A 1S7FA 1KUXA 2REEA 4CS0B 2J8RA 2JLMA 3CXPA 3A9LA 4JJXA 4Y49B 4NF1A 2I00A 4PV6A 3TE4A 4YRHA 1B6BA 1YR0A 2JEVA 2FE7A 5HMNA 2ZW5A 4B5OA 1R57A 2P0WA 2OH1A 4FD4A 3PZJA 1QSMA 4XPDC 2Q04A 3R1KA 2DXQA 1Y9WA 1UFHA 2Q44A 3P2HA 3W6XA 1MJ9A 4BBHA 3IU1A 2Z3NA 4ORFA 2BUEA 2VQYA 1P0HA 2J8NA 3N7ZA 1S60A 2PC1A 2B3UA 5AG7A 3W6SA 1WK4A 4C68A 5AG4A 2P6EA 1IB1E 1CJWA 4U9ZA 1M4DA 2BSWA 1VKCA 3R9EA 4GS4A 1I1DA 3TO7A 3FNCA 3IWGA 1XEBA 2Z3PA 2FS5A 4XNHC 4JWPA 2CNMA 4YGOA 2HV2A 3SHPA 2CXAA 4MFPA 2R1IA 4B13A 4AVBA 2Z3MA 4NEXA 2HQYA 5JQ4A 2IL4A 1Q2DA 2NMTA 3H4QA 4R3KA 2VZYA 5G21A 5C88A 2PR8A 5EC4A 1IIDA 2YGWA 3CXQA 4U9YA 4OLLA 2FCKA 3MGDA 4R57A 1YLEA 2Z3OA 4C7HA 3TFYA 5J8CA 3GKRA 5EBVA 3TO6A 3OWCA 1Q2CA 1KZFA 3DR6A 3H5ZA 4NXYA 4ZBGA 4A31A 4DNCA 2VEZA 2BL1A 4AVCA 4F0YA 2DPSA 2B4BA 3BLNA 4UFWA 5JPHA 1IICA 1RXTA 1KUYA 1FY7A 4L8AA 1PUAA 3R9GA 4A2ZA 2G3TA 4CYPA 2ZW4A 1M4GA 2BEIA 3SXNA 4KUBA 4PSXA 2R8VA 3TTHA 2QECA 1PU9A 4KLWA 4B14A 2WPXA 1CM0A 2WUUA 1LRZA 2GIVA 3KKWA 4AG9A 5G22A 2O28A 4KS9A 4MJ8A 5J8FA 2C27A 4KOWA 2FSRA 2Z0ZA 4A33A 2ZXVA 1I21A 5H86A 5DWNA 1Z4EA 4Y49C 4CAFA 2AE6A 5F46A 4KOSA 4UCPA 4B12A 1S3ZA 1IYKA 4MFQA 1RO5A 3G3SA 4AG7A 1Z4RA 2Z3KA 2OZGA 4K30A 1XIXA 2B3VA 2GANA 5F47A 4QVTA 1MK4A 1NSLA 5AG6A 2FXFA 1MJAA 5IX3A 3TT2A 2Y0MA 4KVXA 4KOUA 4JXRA 1MJBA 2QIRA 1TIQA 2PDOA 1S7LA 4F0XA 5I0CA 4FD6A 5KTDA 3QAHA 2DPTA 5GCNA 3CXSA 2GE3A 3E0KA 1OZPA 4A30A 2H5MA 2P6FA 3EC4A 2YNEA 2KCWA 2RC4A 1ON0A 5F48A 3D2PA 4PK2A 1S7KA 3R9FA 1Y7RA 2G0BA 4QB9A 5A27A 1XE4A 4MHDA 4B5PA 3FXTA 1YREA 4KSFA 1NE9A 4CYNA 4II9A 1V0CA 3LD2A 4QUSA 3B8GA 1XF8A 4C2YA 4JLYA 4M3SA 2R7HA 3G8WA 5KTAA 5IV0A 4AVAA 4CAXA 4C7IA 4A32A 4CRZB 4E0AA 1BOBA 2CNTA 2ZW6A 5FVJA 1M44A 3F8KA 4CAWA 1GHEA 3DNSA 3W91A 4CRYB 2EVNA 1Y9KA 2HUZA 1YGHA 4LX9A 4KOVA 2OU2A 2I79A 4HNXB 2PR1A 1M1DA 2PQ8A 4RI1A 5G1ZA 4MFZA 1IYLA 3VWDA 3SXOA 4R87A 4A95A 2Q7BA 1P4NA 2FL4A 4RS2A 3S6HA 4MFLA 4QC6A 2D4OA 4CAVA 5CNPA 3R95A 4LUAA 2Q4YA 4XPLA 1YK3A 3S6KA 4B5PB 4CGMA 2X7BA 3DSBA 4UA3A 2VXKA 2Z11A 3ZZIA 3I9SA 3EY5A 4NSQA 3GYAA 3ZJ0A 4QBJA 3D3SA 4CGNA 5BWAB 4ONUA 2K5TA 1S5KA 2Z3LA 4KZTA 1U6MA 2G3AA 4KOXA 3TOBA 4YFJA 3S6GA 3VWEA 1QSOA 2QMLA 2WSAA 2PSWA 1QSRA 1K4JA 4EVYA 4FD7A 2ZW7A 4CYQA 4KUAA 5IB0A 1WWZA 4U5YA 2CY2A 4XPDB 4MY0A 3R96A 2ATRA 2B58A 4MFKA 3NE7A 4HNYB 3FB3A 1YX0A 1M4IA 2YNCC 4IUSA 2EUIA 2OB0A 3BJ8A 5F49A 3PGPA 1ZO0A 2B5GB 3EO4A 4KSAA 3BJ7A 1L0CA 3LODA 4E2AA 4XPKA 2F5IA 5G20A 1XMTA 3DR8A 4M85A 4R3LA 4UFXA 3F0AA 3JTKA 4L89A 3I3GA 2D4PA 2J8MA 3RYOA 4NCZA 5KTCA 4BMHA 4KORA 4CGPA 3C26A 2B4DA 2CNSA 4R9MA 1I12A 3FYNA 1J4JA 1KUVA 3QB8A 2Z10A 3UY5A 3FBUA 2ARHA 3D8PA 4IF5A 1YVKA 4CAEA 4AB7A 4HNWB 5A28A 4CGOA 1YVOA 3K9UA 1B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZZ A;  4MI4 A;  3PP9 A;  2FIA A;  4X5K A;  2VBQ A;  4HKF A;  2B5G A;  1QSN A;  3T9Y A;  3IGR A;  3T90 A;  2ZPA A;  4J3G A;  3TO9 A;  4JD6 A;  2REF A;  4KOY A;  3F5B A;  1Q2Y A;  4MY3 A;  4E8O A;  2Q4V A;  5DWM A;  4MBU A;  3V8I A;  2VI7 A;  2B4D B;  4PSW A;  1SQH A;  4I49 A;  4PK3 A;  4UWI A;  5ISV A;  3TCV A;  2PRB A;  5C82 A;  1NMT A;  1QST A;  2OZU A;  2A4N A;  1VHS A;  4XNH B;  2JDD A;  3P2F A;  3FRM A;  5H84 A;  4JXQ A;  3JUW A;  2WPW A;  4OAD A;  1N71 A;  4KVM E;  3JVN A;  2JDC A;  4KLV A;  3EXN A;  4UBR A;  2AJ6 A;  4OAE A;  3TOA A;  4H6Z A;  2OZH A;  3WR7 A;  5HH1 A;  1Z9U A;  2R98 A;  4UWJ A;  2FT0 A;  1S7N A;  4F6A A;  3EFA A;  2P6G A;  5E96 A;  3S6F A;  3DDD A;  4H6U A;  4H89 A;  4KOT A;  2Q0Y A;  4FD5 A;  4KVO E;  3GY9 A;  1BO4 A;  2FIW A;  3D2M A;  3FIX A;  1S7F A;  1KUX A;  2REE A;  4CS0 B;  2J8R A;  2JLM A;  3CXP A;  4JJX A;  4Y49 B;  4NF1 A;  2I00 A;  4PV6 A;  3TE4 A;  4YRH A;  1B6B A;  1YR0 A;  2JEV A;  2FE7 A;  5HMN A;  2ZW5 A;  4B5O A;  1R57 A;  2P0W A;  2OH1 A;  4FD4 A;  3PZJ A;  1QSM A;  4XPD C;  2Q04 A;  3R1K A;  2DXQ A;  1Y9W A;  1UFH A;  2Q44 A;  3P2H A;  3W6X A;  1MJ9 A;  4ORF A;  2BUE A;  2VQY A;  1P0H A;  2J8N A;  3N7Z A;  1S60 A;  2PC1 A;  2B3U A;  3W6S A;  1WK4 A;  2P6E A;  1IB1 E;  1CJW A;  4U9Z A;  1M4D A;  2BSW A;  1VKC A;  3R9E A;  4GS4 A;  1I1D A;  3TO7 A;  3FNC A;  3IWG A;  1XEB A;  2FS5 A;  4XNH C;  4JWP A;  2CNM A;  4YGO A;  2HV2 A;  3SHP A;  2R1I A;  4AVB A;  4NEX A;  2HQY A;  5JQ4 A;  2IL4 A;  1Q2D A;  2NMT A;  3H4Q A;  4R3K A;  2VZY A;  5C88 A;  2PR8 A;  5EC4 A;  1IID A;  3CXQ A;  4U9Y A;  4OLL A;  2FCK A;  3MGD A;  4R57 A;  1YLE A;  3TFY A;  5J8C A;  3GKR A;  5EBV A;  3TO6 A;  3OWC A;  1Q2C A;  1KZF A;  3DR6 A;  4NXY A;  4ZBG A;  4DNC A;  2VEZ A;  2BL1 A;  4AVC A;  4F0Y A;  2B4B A;  3BLN A;  5JPH A;  1IIC A;  1RXT A;  1KUY A;  1FY7 A;  4L8A A;  1PUA A;  3R9G A;  2G3T A;  2ZW4 A;  1M4G A;  2BEI A;  3SXN A;  4KUB A;  4PSX A;  2R8V A;  3TTH A;  2QEC A;  1PU9 A;  4KLW A;  2WPX A;  1CM0 A;  1LRZ A;  2GIV A;  3KKW A;  4AG9 A;  2O28 A;  4MJ8 A;  5J8F A;  2C27 A;  4KOW A;  2FSR A;  2Z0Z A;  2ZXV A;  1I21 A;  5H86 A;  5DWN A;  1Z4E A;  4Y49 C;  2AE6 A;  5F46 A;  4KOS A;  1S3Z A;  1IYK A;  1RO5 A;  3G3S A;  4AG7 A;  1Z4R A;  2OZG A;  4K30 A;  1XIX A;  2B3V A;  2GAN A;  5F47 A;  4QVT A;  1MK4 A;  1NSL A;  2FXF A;  1MJA A;  5IX3 A;  3TT2 A;  2Y0M A;  4KVX A;  4KOU A;  4JXR A;  1MJB A;  2QIR A;  1TIQ A;  2PDO A;  1S7L A;  5I0C A;  4FD6 A;  5KTD A;  3QAH A;  5GCN A;  3CXS A;  2GE3 A;  3E0K A;  1OZP A;  2H5M A;  2P6F A;  3EC4 A;  2KCW A;  2RC4 A;  1ON0 A;  5F48 A;  3D2P A;  4PK2 A;  1S7K A;  3R9F A;  1Y7R A;  2G0B A;  4QB9 A;  1XE4 A;  4MHD A;  4B5P A;  3FXT A;  1YRE A;  1NE9 A;  4II9 A;  1V0C A;  3LD2 A;  4QUS A;  3B8G A;  1XF8 A;  4JLY A;  4M3S A;  2R7H A;  3G8W A;  5KTA A;  5IV0 A;  4AVA A;  4CAX A;  4CRZ B;  4E0A A;  1BOB A;  2CNT A;  2ZW6 A;  5FVJ A;  1M44 A;  3F8K A;  4CAW A;  1GHE A;  3DNS A;  3W91 A;  4CRY B;  2EVN A;  1Y9K A;  2HUZ A;  1YGH A;  4LX9 A;  4KOV A;  2OU2 A;  2I79 A;  4RI1 A;  4HNX B;  2PR1 A;  1M1D A;  2PQ8 A;  1IYL A;  3VWD A;  3SXO A;  4R87 A;  2Q7B A;  1P4N A;  2FL4 A;  4RS2 A;  3S6H A;  4QC6 A;  2D4O A;  4CAV A;  5CNP A;  3R95 A;  4LUA A;  2Q4Y A;  4XPL A;  1YK3 A;  3S6K A;  4B5P B;  2X7B A;  3DSB A;  4UA3 A;  2VXK A;  2Z11 A;  3ZZI A;  3I9S A;  3EY5 A;  4NSQ A;  3GYA A;  3ZJ0 A;  4QBJ A;  3D3S A;  4ONU A;  2K5T A;  1S5K A;  4KZT A;  1U6M A;  2G3A A;  4KOX A;  3TOB A;  4YFJ A;  3S6G A;  3VWE A;  1QSO A;  2QML A;  2PSW A;  1QSR A;  1K4J A;  4EVY A;  4FD7 A;  2ZW7 A;  4KUA A;  5IB0 A;  1WWZ A;  4U5Y A;  2CY2 A;  4XPD B;  4MY0 A;  3R96 A;  2ATR A;  2B58 A;  3NE7 A;  4HNY B;  3FB3 A;  1YX0 A;  1M4I A;  4IUS A;  2EUI A;  2OB0 A;  3BJ8 A;  5F49 A;  3PGP A;  2B5G B;  3EO4 A;  3BJ7 A;  1L0C A;  3LOD A;  4E2A A;  4XPK A;  2F5I A;  1XMT A;  3DR8 A;  4M85 A;  4R3L A;  3F0A A;  4L89 A;  3I3G A;  2D4P A;  2J8M A;  3RYO A;  4NCZ A;  5KTC A;  4BMH A;  4KOR A;  3C26 A;  2B4D A;  2CNS A;  4R9M A;  1I12 A;  3FYN A;  1J4J A;  1KUV A;  3QB8 A;  2Z10 A;  3UY5 A;  3FBU A;  2ARH A;  3D8P A;  4IF5 A;  1YVK A;  4AB7 A;  4HNW B;  1YVO A;  3K9U A;  1B87 A; 
#chains in the Genus database with same CATH topology
 1JWQ A;  2CTB A;  4F9V A;  2VZZ A;  2ZEE A;  4MI4 A;  4UCN A;  3PP9 A;  3SI1 A;  2Q51 A;  2FIA A;  4X5K A;  3VAT A;  4B10 A;  4X8I A;  3PEI A;  2VBQ A;  4P4D A;  2PJC A;  3GLJ A;  4IAV A;  2AFM A;  5I4M A;  1EE3 P;  4MFJ A;  3B3C A;  4HKF A;  4EWT A;  1VHE A;  2B5G A;  2YND A;  2PJ2 A;  3FX6 A;  4C2Z A;  1QSN A;  3T9Y A;  3IGR A;  3T90 A;  2ZPA A;  3GIU A;  1X10 A;  4J3G A;  3KZW A;  3TO9 A;  1XBU A;  4JD6 A;  2REF A;  4YU9 A;  4GXH A;  4KOY A;  4M6I A;  3V38 A;  3F5B A;  5AGE A;  2I3C A;  4WJB A;  4UEF A;  1YME A;  1Q2Y A;  4MY3 A;  4UCM A;  3IWE A;  4E8O A;  4YWY A;  3S9L A;  3KAS A;  2Q4V A;  5DWM A;  1TKH A;  1ZG8 A;  4MBU A;  3PB9 X;  1VHO A;  3V8I A;  1AMP A;  1CX8 A;  2VI7 A;  2B4D B;  4CYO A;  4PSW A;  4Q38 A;  1SQH A;  2Q43 A;  4I49 A;  4PK3 A;  4RN7 A;  1HDQ A;  4UWI A;  5ISV A;  2IJZ A;  1CP7 A;  3TCV A;  2PRB A;  3PB7 X;  5C82 A;  2PJB A;  1LOK A;  1NMT A;  1QST A;  2EK8 A;  2A4N A;  2OZU A;  1VHS A;  4UFV A;  4XNH B;  2PJ6 A;  1YQE A;  2YNC A;  2JDD A;  3P2F A;  5HXD A;  3FRM A;  5IB9 A;  3IU2 A;  1YLO A;  4ZX8 A;  5H84 A;  4JXQ A;  2OR4 A;  3CDX A;  2ZEH A;  2JBJ A;  2F8H A;  3JUW A;  2WPW A;  4OAD A;  1N71 A;  2PJ7 A;  4KVM E;  3JVN A;  2JDC A;  4KLV A;  3EXN A;  1HEE A;  2ZEN A;  4UBR A;  5JGF A;  2AJ6 A;  4OAE A;  3TOA A;  4H6Z A;  2OZH A;  4MHZ A;  3KGQ A;  3WR7 A;  5HH1 A;  4C2X A;  1Z9U A;  2JEW A;  2R98 A;  5D8N A;  4UWJ A;  4B11 A;  4R6T A;  2PJ4 A;  2FT0 A;  1S7N A;  5AG5 A;  2XEI A;  4F6A A;  3EFA A;  1YW4 A;  4ZYQ A;  2P6G A;  4PXD A;  5E96 A;  2AFX A;  3S6F A;  3SI0 A;  4CGL A;  4ZGY B;  5CBM A;  3DDD A;  4H6U A;  3N5F A;  4H89 A;  4KOT A;  2Q0Y A;  3FEC A;  4FD5 A;  3QAY A;  3GY9 A;  4KVO E;  4NGR A;  1BO4 A;  2FIW A;  2CTC A;  3D2M A;  3FIX A;  3MN8 A;  1ELL P;  4P4J A;  4Q36 A;  1S7F A;  1KUX A;  1LCP A;  2REE A;  2J8R A;  3HUV A;  4CS0 B;  3S9N A;  2JLM A;  1AYE A;  7CPA A;  1F2O A;  4PXB A;  1IGB A;  3CXP A;  2AFU A;  3A9L A;  2BOA A;  4JJX A;  4Y49 B;  4BIN A;  4NF1 A;  2I00 A;  4PV6 A;  4ZX9 A;  3TE4 A;  4YRH A;  1B6B A;  2PJ0 A;  2PE3 A;  1YR0 A;  2JEV A;  2EWB A;  3DGV A;  4OID A;  1RTQ A;  3IFE A;  3T8W A;  2FE7 A;  5HMN A;  3LWU A;  2RB7 A;  2ZW5 A;  4B5O A;  1IU8 A;  2OOT A;  1R57 A;  3L2N A;  3PB4 X;  2XEG A;  3B3T A;  2P0W A;  1ARM A;  2DF5 A;  1OBR A;  2OH1 A;  3FJU A;  4NGM A;  4FD4 A;  3PZJ A;  1QSM A;  1XOV A;  4XPD C;  3WC6 A;  2PJ8 A;  3B35 A;  3IC1 A;  2ZEG A;  4P45 A;  4IHM A;  1LAM A;  4FAI A;  1F57 A;  2Q04 A;  3R1K A;  2DXQ A;  3SJF A;  1IOF A;  2IQ6 A;  3PB8 X;  5LRG A;  1Y9W A;  4MMO A;  2C1C A;  4R76 A;  3D7G A;  1UFH A;  1CG2 A;  3D67 A;  2Q44 A;  2C6G A;  3P2H A;  4ZY0 A;  3W6X A;  4IK2 A;  1LAN A;  2ZEO A;  4K3N A;  1MJ9 A;  4UIB A;  3RBU A;  3IU1 A;  4BBH A;  3S9M A;  2F7V A;  2Z3N A;  4ORF A;  5LRJ A;  2BUE A;  2VQY A;  3GB0 A;  1P0H A;  4R7M A;  2J8N A;  2ZOF A;  3N7Z A;  4CPA A;  3SI2 A;  2ZEP A;  1XFO A;  4UEZ A;  3V7Z A;  1S60 A;  5K8O A;  2PC1 A;  2B3U A;  5AG7 A;  4A39 A;  3W6S A;  1WK4 A;  4C68 A;  4RUH A;  5AG4 A;  2P6E A;  1IB1 E;  1CJW A;  4U9Z A;  3K9T A;  1M4D A;  1Z8W A;  1XMB A;  2BSW A;  1VKC A;  3R9E A;  4GS4 A;  2O53 A;  1I1D A;  3D66 A;  3TO7 A;  3FNC A;  3IWG A;  3H8E A;  4PPZ A;  1XEB A;  2Z3P A;  1Z8L A;  2FS5 A;  4XNH C;  4JWP A;  4UIA A;  2CNM A;  4YGO A;  1PCA A;  4X2T A;  2HV2 A;  4NGN A;  3SHP A;  3B3W A;  4P44 A;  2CXA A;  2PJ1 A;  2R1I A;  4MFP A;  5ELY A;  3RNZ A;  4AVB A;  2PJA A;  4B13 A;  2V8V A;  2Z3M A;  5LYL A;  4NEX A;  2HQY A;  3B7I A;  5JQ4 A;  2IL4 A;  4KSI A;  1Q2D A;  2G9D A;  2NMT A;  3H4Q A;  4MHN A;  2VZY A;  4R3K A;  4OC3 A;  5G21 A;  3WAB A;  2PR8 A;  5C88 A;  5EC4 A;  3BI1 A;  1ZG7 A;  1IID A;  3B3V A;  4UEE A;  4M6G A;  2BCO A;  2YGW A;  3CXQ A;  4U9Y A;  4OLL A;  2FCK A;  3MGD A;  2ZEM A;  2XEF A;  3TC8 A;  2C6P A;  4R57 A;  2PCU A;  1BAV A;  1YLE A;  2Z3O A;  4C7H A;  1ARL A;  2QYV A;  2QVP A;  5HVG A;  3TFY A;  1Z2L A;  5J8C A;  1R3N A;  3GKR A;  5EBV A;  3TO6 A;  3RAM A;  2RFH A;  3OWC A;  3CT9 A;  3FVL A;  1BPM A;  1Q2C A;  1VIX A;  3H8G A;  1KZF A;  1BLL E;  3DR6 A;  3H5Z A;  3WC5 A;  4NXY A;  2WZN A;  3VH9 A;  4ZBG A;  4PXC A;  4A31 A;  4DNC A;  2VEZ A;  1TKF A;  2BL1 A;  2PIZ A;  4AVC A;  4F0Y A;  2DPS A;  2VL1 A;  4OC4 A;  2B4B A;  3MRU A;  2ZEF A;  3BLN A;  4UFW A;  4ZI6 A;  5JPH A;  4OME A;  1IIC A;  1RXT A;  1FNO A;  2HC9 A;  1KUY A;  1FY7 A;  4L8A A;  1PUA A;  3H8F A;  1DE4 C;  2AFO A;  3R9G A;  4MCR A;  4A2Z A;  3VAR A;  6CPA A;  4TNU A;  4OC0 A;  1TKJ A;  2G3T A;  4P4E A;  2AFS A;  2V8H A;  4CYP A;  3RO0 A;  4O23 A;  3KR4 A;  2ZW4 A;  1F2P A;  1M4G A;  2BEI A;  3SXN A;  4KUB A;  4PSX A;  5LRK A;  2R8V A;  3TTH A;  2QEC A;  3RZA A;  2GLJ A;  1PU9 A;  4KLW A;  4B14 A;  4ONW A;  4JZ0 A;  5DS0 A;  1Q7L A;  1PYT B;  2WPX A;  1CM0 A;  2WUU A;  3PRT A;  1LRZ A;  4HPS A;  1GYT A;  2GIV A;  3KKW A;  4AG9 A;  4Z65 A;  4LQG A;  4MCQ A;  5G22 A;  1CP6 A;  2O28 A;  4P10 A;  4KS9 A;  4MJ8 A;  5J8F A;  2C27 A;  3FED A;  4KOW A;  2FSR A;  2Z0Z A;  3IWW A;  2ZXV A;  2J9A A;  4A33 A;  2GU2 A;  1I21 A;  1TF9 A;  1M4L A;  5DWN A;  1Z4E A;  5H86 A;  1R43 A;  4Y49 C;  4CAF A;  2AE6 A;  5F46 A;  3ISX A;  4KOS A;  4DJL A;  2CF4 A;  4UCP A;  4B12 A;  1ZG9 A;  1S3Z A;  1IYK A;  4MFQ A;  1RO5 A;  3G3S A;  1KWM A;  3NE8 A;  4AG7 A;  3IO1 A;  1Z4R A;  2Z3K A;  3NH8 A;  4P6Y A;  5F09 A;  2OZG A;  2QJ8 A;  4K30 A;  1XIX A;  2B3V A;  2GAN A;  5F47 A;  4QVT A;  3IJ3 A;  1MK4 A;  1NSL A;  5AG6 A;  2FXF A;  1AUG A;  1MJA A;  3WC7 A;  3JRU A;  3TT2 A;  4P4B A;  3FMC A;  5IX3 A;  1Z8X A;  2POK A;  1Y0R A;  2Y0M A;  2WYR A;  4JXR A;  4KOU A;  2AFW A;  4KVX A;  3BHX A;  1MJB A;  2CIJ A;  3BI0 A;  2QIR A;  1TIQ A;  4OC1 A;  2PDO A;  1S7L A;  2BO9 A;  4NJR A;  1QMU A;  4F0X A;  2EK9 A;  5I0C A;  4OC2 A;  1Z5R A;  2V8D A;  2ANP A;  3PBB A;  4FD6 A;  5KTD A;  3FF3 A;  3BXM A;  4NGQ A;  2PJ9 A;  4OKO A;  5LYI A;  3QAH A;  2DPT A;  1LFW A;  5GCN A;  3CXS A;  2GE3 A;  2ZED A;  1OZP A;  3E0K A;  4A30 A;  2H5M A;  2P6F A;  1YSJ A;  3EC4 A;  2YNE A;  2GRE A;  4MHY A;  2KCW A;  2RC4 A;  4OP4 A;  1ON0 A;  2PVW A;  4F9U A;  1BPN A;  5F48 A;  4BD9 A;  1Y7E A;  3D2P A;  4PK2 A;  1XJO A;  1S7K A;  3R9F A;  4P4F A;  1Y7R A;  5K8M A;  1CPS A;  3QNV A;  4UF4 A;  2G0B A;  4QB9 A;  5D29 A;  1YW6 A;  1X12 A;  1CBX A;  3D7D A;  3PBE A;  5A27 A;  1XE4 A;  5CPA A;  4MHD A;  3LMS A;  3PB6 X;  3B3S A;  4NGT A;  4B5P A;  3FXT A;  1YRE A;  4KSF A;  1NE9 A;  4CYN A;  4II9 A;  1V0C A;  2FVG A;  3LD2 A;  3GUX A;  4QUS A;  3B8G A;  3CPX A;  2EBJ A;  1XF8 A;  4C2Y A;  4DYO A;  4JLY A;  4M3S A;  4OC5 A;  2R7H A;  3G8W A;  1TF8 A;  4AXV A;  5KTA A;  1ZLI A;  5IV0 A;  4JYW A;  4AVA A;  4CAX A;  4C7I A;  5K8N A;  5LYF A;  1ELM P;  4A32 A;  4CRZ B;  4MXU A;  3D7H A;  4E0A A;  1BOB A;  2CNT A;  4NGS A;  2ZW6 A;  5FVJ A;  3CPA A;  3D4U A;  1M44 A;  2V8G A;  3F8K A;  4CAW A;  1GHE A;  2ZEL A;  3DNS A;  3W91 A;  3ISZ A;  4CRY B;  2EVN A;  4NJQ A;  1Y9K A;  2HUZ A;  1IY7 A;  1YGH A;  4LX9 A;  5HVF A;  2EO8 A;  2OU2 A;  2I79 A;  2PR1 A;  2DEA A;  1M1D A;  2PQ8 A;  3K2K A;  4HNX B;  4KOV A;  4RI1 A;  5G1Z A;  4MFZ A;  1IYL A;  4MCP A;  3CZX A;  3SXO A;  3VWD A;  2PVV A;  8CPA A;  4R87 A;  5THW A;  4A95 A;  3TX8 A;  4MCS A;  2Q7B A;  1P4N A;  2FL4 A;  3SJE A;  4RS2 A;  3S6H A;  4MFL A;  4QC6 A;  2D4O A;  4EFD A;  4CAV A;  5CNP A;  3LAC A;  5J1Q A;  4F8Z A;  3DLJ A;  3R95 A;  1TXR A;  4LUA A;  2Q4Y A;  4XPL A;  1YK3 A;  3S6K A;  4B5P B;  4CGM A;  2X7B A;  3DSB A;  4OIW A;  3D68 A;  2VXK A;  2ABZ A;  2V77 A;  2Z11 A;  4UA3 A;  4TWE A;  3ZZI A;  1Z8T A;  3I9S A;  3D7F A;  3EY5 A;  4NSQ A;  2Q4Z A;  4PQA A;  4P4I A;  4R8F A;  3GYA A;  3ZJ0 A;  4QBJ A;  3D3S A;  2ZOG A;  1HDU A;  4CGN A;  5BWA B;  4ONU A;  1QQ9 A;  2K5T A;  5K8P A;  3FEE A;  5JM6 A;  1S5K A;  2Z3L A;  4KZT A;  1U6M A;  2G3A A;  4KOX A;  4MHP A;  3TOB A;  3KQX A;  4YFJ A;  3WT4 A;  3S6G A;  3KHZ A;  3VWE A;  4NGP A;  1QSO A;  2QML A;  3PFO A;  2WSA A;  2PRQ A;  2AFZ A;  2C6C A;  2NSM A;  1JQG A;  2PSW A;  4FUU A;  1QSR A;  1K4J A;  4EVY A;  1VGY A;  4ZY1 A;  3HLP A;  4FD7 A;  4G1P A;  2ZW7 A;  2ODF A;  1LAP A;  3IEH A;  4W9Y A;  4A38 A;  1UWY A;  2XEJ A;  4CYQ A;  3I1U A;  4A37 A;  4KUA A;  4X3R A;  5IB0 A;  1WWZ A;  1DTD A;  4U5Y A;  3KHX A;  2CY2 A;  4XPD B;  3KI9 A;  4MY0 A;  3R96 A;  4FBE A;  2ATR A;  2B58 A;  2NYQ A;  3KR5 A;  4MFK A;  2HB6 A;  2PJ5 A;  3NH4 A;  1Y0Y A;  3NE7 A;  4HNY B;  3NFZ A;  3SJG A;  3FB3 A;  4LQ6 A;  1YX0 A;  5LYD A;  1M4I A;  2YNC C;  5HVH A;  4IUS A;  2EUI A;  2OB0 A;  3BJ8 A;  4Q7A A;  5F49 A;  3PGP A;  4H2K A;  1ZO0 A;  1IOI A;  5JH9 A;  2B5G B;  1A2Z A;  3EO4 A;  4ZY2 A;  4A94 A;  1FT7 A;  4GM5 A;  4KSA A;  3BJ7 A;  1L0C A;  2Q7S A;  3LOD A;  4FWU A;  4XPK A;  4E2A A;  2F5I A;  5G20 A;  4B6Z A;  1XMT A;  3DR8 A;  4M85 A;  4R3L A;  4UFX A;  3F0A A;  1XRY A;  3JTK A;  4MRI A;  3KQZ A;  4L89 A;  3I3G A;  2D4P A;  2J8M A;  3PFE A;  4NCZ A;  3RYO A;  5KTC A;  3B2Y A;  3NH5 A;  4M6H A;  4BMH A;  4EME A;  4KOR A;  4CGP A;  2GLF A;  2O4H A;  1NSA A;  2IMO A;  3C26 A;  4WWV A;  3NA6 A;  2B4D A;  2CNS A;  3FH4 A;  4R9M A;  1CPX A;  1I12 A;  3FYN A;  1J4J A;  1KUV A;  3QB8 A;  2GFQ A;  2PIY A;  2Z10 A;  1ZLH A;  1H8L A;  3UY5 A;  3IIB A;  3FBU A;  2PJ3 A;  2ARH A;  3D8P A;  4IF5 A;  3KL9 A;  3SJX A;  1YVK A;  5EMI A;  4AB7 A;  4CAE A;  4HNW B;  4DUK A;  2JBK A;  5A28 A;  4CGO A;  1YVO A;  4PXE A;  3K9U A;  4NFR A;  1B87 A; 
#chains in the Genus database with same CATH homology
 2VZZ A;  4UCN A;  4MI4 A;  3PP9 A;  4B10 A;  2FIA A;  4X5K A;  2VBQ A;  4MFJ A;  4HKF A;  2B5G A;  2YND A;  4C2Z A;  1QSN A;  3T9Y A;  3IGR A;  3T90 A;  2ZPA A;  4J3G A;  3TO9 A;  4JD6 A;  2REF A;  4KOY A;  3F5B A;  5AGE A;  1Q2Y A;  4MY3 A;  4UCM A;  3IWE A;  4E8O A;  2Q4V A;  5DWM A;  4MBU A;  3V8I A;  2VI7 A;  2B4D B;  4CYO A;  4PSW A;  4Q38 A;  1SQH A;  4I49 A;  4PK3 A;  4UWI A;  5ISV A;  3TCV A;  2PRB A;  5C82 A;  1NMT A;  1QST A;  2OZU A;  2A4N A;  4UFV A;  1VHS A;  4XNH B;  2YNC A;  2JDD A;  3P2F A;  3FRM A;  3IU2 A;  5H84 A;  4JXQ A;  3JUW A;  2WPW A;  4OAD A;  1N71 A;  4KVM E;  3JVN A;  2JDC A;  4KLV A;  3EXN A;  4UBR A;  2AJ6 A;  4OAE A;  3TOA A;  4H6Z A;  2OZH A;  3WR7 A;  5HH1 A;  4C2X A;  1Z9U A;  2R98 A;  4B11 A;  4UWJ A;  2FT0 A;  1S7N A;  5AG5 A;  4F6A A;  3EFA A;  2P6G A;  5E96 A;  3S6F A;  4CGL A;  4ZGY B;  3DDD A;  4H6U A;  4H89 A;  4KOT A;  2Q0Y A;  4FD5 A;  4KVO E;  3GY9 A;  1BO4 A;  2FIW A;  3D2M A;  3FIX A;  4Q36 A;  1S7F A;  1KUX A;  2REE A;  4CS0 B;  2J8R A;  2JLM A;  3CXP A;  3A9L A;  4JJX A;  4Y49 B;  4NF1 A;  2I00 A;  4PV6 A;  3TE4 A;  4YRH A;  1B6B A;  1YR0 A;  2JEV A;  2FE7 A;  5HMN A;  2ZW5 A;  4B5O A;  1R57 A;  2P0W A;  2OH1 A;  4FD4 A;  3PZJ A;  1QSM A;  4XPD C;  2Q04 A;  3R1K A;  2DXQ A;  1Y9W A;  1UFH A;  2Q44 A;  3P2H A;  3W6X A;  1MJ9 A;  4BBH A;  3IU1 A;  2Z3N A;  4ORF A;  2BUE A;  2VQY A;  1P0H A;  2J8N A;  3N7Z A;  1S60 A;  2PC1 A;  2B3U A;  5AG7 A;  3W6S A;  1WK4 A;  4C68 A;  5AG4 A;  2P6E A;  1IB1 E;  1CJW A;  4U9Z A;  1M4D A;  2BSW A;  1VKC A;  3R9E A;  4GS4 A;  1I1D A;  3TO7 A;  3FNC A;  3IWG A;  1XEB A;  2Z3P A;  2FS5 A;  4XNH C;  4JWP A;  2CNM A;  4YGO A;  2HV2 A;  3SHP A;  2CXA A;  4MFP A;  2R1I A;  4B13 A;  4AVB A;  2Z3M A;  4NEX A;  2HQY A;  5JQ4 A;  2IL4 A;  1Q2D A;  2NMT A;  3H4Q A;  4R3K A;  2VZY A;  5G21 A;  5C88 A;  2PR8 A;  5EC4 A;  1IID A;  2YGW A;  3CXQ A;  4U9Y A;  4OLL A;  2FCK A;  3MGD A;  4R57 A;  1YLE A;  2Z3O A;  4C7H A;  3TFY A;  5J8C A;  3GKR A;  5EBV A;  3TO6 A;  3OWC A;  1Q2C A;  1KZF A;  3DR6 A;  3H5Z A;  4NXY A;  4ZBG A;  4A31 A;  4DNC A;  2VEZ A;  2BL1 A;  4AVC A;  4F0Y A;  2DPS A;  2B4B A;  3BLN A;  4UFW A;  5JPH A;  1IIC A;  1RXT A;  1KUY A;  1FY7 A;  4L8A A;  1PUA A;  3R9G A;  4A2Z A;  2G3T A;  4CYP A;  2ZW4 A;  1M4G A;  2BEI A;  3SXN A;  4KUB A;  4PSX A;  2R8V A;  3TTH A;  2QEC A;  1PU9 A;  4KLW A;  4B14 A;  2WPX A;  1CM0 A;  2WUU A;  1LRZ A;  2GIV A;  3KKW A;  4AG9 A;  5G22 A;  2O28 A;  4KS9 A;  4MJ8 A;  5J8F A;  2C27 A;  4KOW A;  2FSR A;  2Z0Z A;  4A33 A;  2ZXV A;  1I21 A;  5H86 A;  5DWN A;  1Z4E A;  4Y49 C;  4CAF A;  2AE6 A;  5F46 A;  4KOS A;  4UCP A;  4B12 A;  1S3Z A;  1IYK A;  4MFQ A;  1RO5 A;  3G3S A;  4AG7 A;  1Z4R A;  2Z3K A;  2OZG A;  4K30 A;  1XIX A;  2B3V A;  2GAN A;  5F47 A;  4QVT A;  1MK4 A;  1NSL A;  5AG6 A;  2FXF A;  1MJA A;  5IX3 A;  3TT2 A;  2Y0M A;  4KVX A;  4KOU A;  4JXR A;  1MJB A;  2QIR A;  1TIQ A;  2PDO A;  1S7L A;  4F0X A;  5I0C A;  4FD6 A;  5KTD A;  3QAH A;  2DPT A;  5GCN A;  3CXS A;  2GE3 A;  3E0K A;  1OZP A;  4A30 A;  2H5M A;  2P6F A;  3EC4 A;  2YNE A;  2KCW A;  2RC4 A;  1ON0 A;  5F48 A;  3D2P A;  4PK2 A;  1S7K A;  3R9F A;  1Y7R A;  2G0B A;  4QB9 A;  5A27 A;  1XE4 A;  4MHD A;  4B5P A;  3FXT A;  1YRE A;  4KSF A;  1NE9 A;  4CYN A;  4II9 A;  1V0C A;  3LD2 A;  4QUS A;  3B8G A;  1XF8 A;  4C2Y A;  4JLY A;  4M3S A;  2R7H A;  3G8W A;  5KTA A;  5IV0 A;  4AVA A;  4CAX A;  4C7I A;  4A32 A;  4CRZ B;  4E0A A;  1BOB A;  2CNT A;  2ZW6 A;  5FVJ A;  1M44 A;  3F8K A;  4CAW A;  1GHE A;  3DNS A;  3W91 A;  4CRY B;  2EVN A;  1Y9K A;  2HUZ A;  1YGH A;  4LX9 A;  4KOV A;  2OU2 A;  2I79 A;  4HNX B;  2PR1 A;  1M1D A;  2PQ8 A;  4RI1 A;  5G1Z A;  4MFZ A;  1IYL A;  3VWD A;  3SXO A;  4R87 A;  4A95 A;  2Q7B A;  1P4N A;  2FL4 A;  4RS2 A;  3S6H A;  4MFL A;  4QC6 A;  2D4O A;  4CAV A;  5CNP A;  3R95 A;  4LUA A;  2Q4Y A;  4XPL A;  1YK3 A;  3S6K A;  4B5P B;  4CGM A;  2X7B A;  3DSB A;  4UA3 A;  2VXK A;  2Z11 A;  3ZZI A;  3I9S A;  3EY5 A;  4NSQ A;  3GYA A;  3ZJ0 A;  4QBJ A;  3D3S A;  4CGN A;  5BWA B;  4ONU A;  2K5T A;  1S5K A;  2Z3L A;  4KZT A;  1U6M A;  2G3A A;  4KOX A;  3TOB A;  4YFJ A;  3S6G A;  3VWE A;  1QSO A;  2QML A;  2WSA A;  2PSW A;  1QSR A;  1K4J A;  4EVY A;  4FD7 A;  2ZW7 A;  4CYQ A;  4KUA A;  5IB0 A;  1WWZ A;  4U5Y A;  2CY2 A;  4XPD B;  4MY0 A;  3R96 A;  2ATR A;  2B58 A;  4MFK A;  3NE7 A;  4HNY B;  3FB3 A;  1YX0 A;  1M4I A;  2YNC C;  4IUS A;  2EUI A;  2OB0 A;  3BJ8 A;  5F49 A;  3PGP A;  1ZO0 A;  2B5G B;  3EO4 A;  4KSA A;  3BJ7 A;  1L0C A;  3LOD A;  4E2A A;  4XPK A;  2F5I A;  5G20 A;  1XMT A;  3DR8 A;  4M85 A;  4R3L A;  4UFX A;  3F0A A;  3JTK A;  4L89 A;  3I3G A;  2D4P A;  2J8M A;  3RYO A;  4NCZ A;  5KTC A;  4BMH A;  4KOR A;  4CGP A;  3C26 A;  2B4D A;  2CNS A;  4R9M A;  1I12 A;  3FYN A;  1J4J A;  1KUV A;  3QB8 A;  2Z10 A;  3UY5 A;  3FBU A;  2ARH A;  3D8P A;  4IF5 A;  1YVK A;  4CAE A;  4AB7 A;  4HNW B;  5A28 A;  4CGO A;  1YVO A;  3K9U A;  1B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...