2P6GA

Crystal structures of saccharomyces cerevisiae n-myristoyltransferase with bound myristoyl-coa and inhibitors
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
451
structure length
435
Chain Sequence
b'DKAKKLENLLKLLQLNNHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 118
structure length 435
sequence length 451
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2007-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6gA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6gA02
2P6GA 1MJBA 1Z4RA 1J4JA 3F8KA 1S3ZA 2FXFA 3DDDA 2G3AA 3TTHA 2H5MA 3IWGA 4R9MA 1Q2YA 4JXQA 3JUWA 3CXQA 3TO6A 3S6KA 3S6FA 2Q7BA 4KLWA 3UY5A 2IL4A 4E0AA 5KTAA 3R9GA 4HNXB 1YVKA 3IGRA 3G8WA 2REEA 4AVBA 2P6EA 4PSXA 4IUSA 2VZZA 3V8IA 1I21A 4HNYB 2B4DA 5C82A 1LRZA 2ARHA 4BMHA 4L89A 5IX3A 3D3SA 2FCKA 4QBJA 1M44A 1IB1E 2B3VA 1U6MA 4B5PB 3QB8A 2ZXVA 2QMLA 3T90A 3EFAA 2Z0ZA 5F47A 4QVTA 2D4PA 2HQYA 2JDCA 2B3UA 4MI4A 2BL1A 3P2HA 3TFYA 4LUAA 1NSLA 4AVCA 2AE6A 3FB3A 1QSRA 4KOXA 1XE4A 2J8RA 3VWDA 2JLMA 1GHEA 3D2PA 3K9UA 1BOBA 4MY0A 4KORA 4AG9A 1RO5A 2HV2A 3EC4A 1B87A 3BLNA 2ATRA 3B8GA 1P0HA 2FSRA 1CJWA 3R9FA 1KUXA 1Z9UA 1YREA 3BJ7A 2BEIA 1S7NA 4HNWB 1S60A 2R8VA 3VWEA 4XPKA 3JVNA 4FD6A 1OZPA 1L0CA 5CNPA 3S6GA 3GY9A 1I1DA 3SHPA 4MY3A 1TIQA 4RS2A 1IYKA 2AJ6A 2KCWA 4F6AA 2P0WA 2K5TA 4M3SA 2BSWA 2GIVA 2CNMA 3R9EA 2ZW5A 3TT2A 4KUAA 3T9YA 2B5GB 1IYLA 2G3TA 4X5KA 4KLVA 4R87A 1VHSA 1BO4A 1M4DA 3LD2A 4AG7A 2VXKA 4KUBA 4CRZB 4KVOE 4ZBGA 1Z4EA 4AVAA 4KOTA 5EC4A 1WK4A 4I49A 4L8AA 4CAVA 3SXNA 4YFJA 5C88A 4MBUA 1XMTA 2FIAA 2REFA 1KZFA 2FE7A 5H86A 5H84A 4KVME 1WWZA 3DR6A 4PSWA 4XPDB 1PUAA 4H89A 4E8OA 2OH1A 2JEVA 5J8CA 3TCVA 2I79A 4M85A 2B58A 3TE4A 4R57A 3D8PA 1CM0A 1YGHA 2PR8A 4QB9A 4CAXA 2PRBA 2R98A 1QSTA 2FT0A 3W91A 2GE3A 1SQHA 4AB7A 3CXPA 4YRHA 4KZTA 3E0KA 4F0YA 3FNCA 4RI1A 3SXOA 4H6ZA 2VQYA 2OZUA 4Y49B 4LX9A 2C27A 4CAWA 2B5GA 3G3SA 2Q44A 2NMTA 1S7FA 3DSBA 3FXTA 1QSMA 2PDOA 2Q4VA 2PC1A 1V0CA 4XPDC 4OADA 4ONUA 4ORFA 4UWJA 2ZW7A 1KUYA 3GYAA 2WPWA 2O28A 3S6HA 1S5KA 1VKCA 3WR7A 1Y9WA 2PQ8A 5IB0A 5E96A 1NE9A 3R96A 1XF8A 1K4JA 3FBUA 3I9SA 2CY2A 2Q04A 4KOUA 4FD7A 3QAHA 4YGOA 4QUSA 4MJ8A 2HUZA 3RYOA 2CNSA 3FIXA 3TOAA 4KOVA 2GANA 1S7KA 3N7ZA 5FVJA 1S7LA 4E2AA 2B4DB 3GKRA 4NSQA 4JXRA 5J8FA 5KTCA 1RXTA 4B5PA 4K30A 2FS5A 1KUVA 5DWNA 1ON0A 3P2FA 5F48A 2VZYA 1B6BA 2VBQA 4XNHB 1XEBA 3FYNA 4H6UA 4R3KA 3CXSA 4QC6A 3MGDA 3W6SA 2PSWA 2CNTA 4GS4A 1YK3A 3I3GA 2OZHA 2ZPAA 4B5OA 2Z11A 1IICA 2VEZA 1PU9A 1M4IA 4NEXA 3DNSA 3PP9A 4PK2A 2JDDA 1N71A 3F0AA 4FD5A 2D4OA 4U9YA 4OAEA 2BUEA 2OZGA 2F5IA 4KOSA 2J8NA 2VI7A 4OLLA 5HMNA 2ZW4A 4EVYA 2OU2A 3LODA 4JJXA 3NE7A 5GCNA 5KTDA 1YX0A 4XNHC 4R3LA 1MJAA 3D2MA 1YVOA 5IV0A 1Y9KA 5EBVA 1M1DA 1UFHA 1R57A 3BJ8A 3OWCA 3TO7A 3R1KA 1NMTA 5I0CA 1MJ9A 1YR0A 5F46A 5ISVA 3EO4A 4KOWA 4CRYB 2Q4YA 2RC4A 2EVNA 5HH1A 2B4BA 4JWPA 4XPLA 2ZW6A 4II9A 4NXYA 2WPXA 3W6XA 2PR1A 1Y7RA 3ZZIA 4JLYA 3PZJA 3TOBA 4NCZA 3TO9A 2G0BA 1Q2DA 1Q2CA 4UA3A 4MHDA 4NF1A 1I12A 2Q0YA 4CS0B 3PGPA 4KVXA 1XIXA 4UWIA 1MK4A 4FD4A 3C26A 2QECA 2I00A 4PK3A 4Y49C 4JD6A 3FRMA 2X7BA 1IIDA 2Z10A 5JPHA 5F49A 4HKFA 5JQ4A 1M4GA 2A4NA 3F5BA 2FL4A 2FIWA 2OB0A 3KKWA 5DWMA 4U5YA 4DNCA 2J8MA 1P4NA 4PV6A 3DR8A 2P6FA 1QSNA 1FY7A 3EXNA 4KOYA 2Y0MA 2DXQA 2R1IA 3EY5A 4UBRA 4J3GA 3H4QA 4IF5A 3ZJ0A 1QSOA 2R7HA 2EUIA 3R95A 1YLEA 2QIRA 4U9ZA
chains in the Genus database with same CATH superfamily
4M6HA 4WWVA 3KZWA 4DUKA 2P6GA 4PPZA 1MJBA 1Z4RA 1BAVA 4P10A 4X8IA 1J4JA 5CPAA 2DF5A 3F8KA 1NSAA 4A95A 1S3ZA 2FXFA 3DDDA 2G3AA 3TTHA 3BI1A 2H5MA 5LRGA 1HDQA 2WYRA 4JYWA 1ELMP 3D7DA 3IWGA 1OBRA 4C2XA 3CPXA 4R9MA 2EO8A 1Q2YA 1QMUA 1ZLIA 3MRUA 4JXQA 3JUWA 3CXQA 3TO6A 3S6KA 4ZI6A 3S6FA 5K8NA 1IOFA 2Q7BA 5LYFA 4P4DA 4EMEA 2Q4ZA 3A9LA 2GLFA 2IQ6A 4UF4A 4KLWA 3UY5A 2VL1A 2IL4A 1YW6A 4E0AA 4ZY0A 5KTAA 3R9GA 1Z8LA 4HNXB 1YVKA 4YWYA 5HVFA 3IGRA 2XEFA 3RO0A 2ZEFA 2REEA 3G8WA 2P6EA 4MRIA 4AVBA 4PSXA 4IUSA 2VZZA 3CT9A 2QYVA 3V8IA 1I21A 4HNYB 2XEJA 2B4DA 5C82A 1LRZA 2ARHA 3D68A 3LMSA 5AG4A 1XBUA 1Y7EA 4L89A 4BMHA 1PYTB 2JEWA 4MHPA 5IX3A 3D3SA 2FCKA 2ODFA 1M44A 1IB1E 4QBJA 1JQGA 4MHNA 4UFXA 2B3VA 1U6MA 4MCPA 4CAFA 4B5PB 4JZ0A 3QB8A 2ZXVA 2QMLA 3IU1A 3T90A 4B14A 3EFAA 2Z0ZA 5F47A 3LACA 4QVTA 2D4PA 2HQYA 3DLJA 2RB7A 2PJ6A 2JDCA 2B3UA 4MI4A 2BL1A 3P2HA 3TFYA 4M6GA 3NE8A 4LUAA 4F8ZA 2Z3LA 4B6ZA 1CP7A 2CXAA 3KHXA 1NSLA 4AVCA 2AE6A 3FB3A 4C68A 1QSRA 1Z8XA 3H5ZA 3K2KA 4KOXA 1XE4A 2J8RA 3VWDA 2JLMA 4CGLA 1A2ZA 3GB0A 1GHEA 2Z3KA 3D2PA 3K9UA 1BOBA 3WC7A 5AG5A 4RUHA 4MY0A 4KORA 1TKFA 2G9DA 4AG9A 2PCUA 4R76A 1RO5A 2HV2A 3EC4A 1ELLP 1B87A 4KSAA 3BLNA 3WABA 3FMCA 2ATRA 3B8GA 4UIAA 3B35A 1P0HA 2FSRA 1AMPA 1CJWA 3R9FA 4KSIA 1KUXA 1LFWA 1Z9UA 1YREA 1TXRA 3SI0A 3FEDA 4UFVA 3BJ7A 2J9AA 2BEIA 4X3RA 1S7NA 2IJZA 4HNWB 1S60A 1BLLE 1HEEA 3H8EA 5G20A 4CGOA 2R8VA 3VWEA 4XPKA 1H8LA 4F9UA 3JVNA 4FD6A 2AFZA 2PIYA 1OZPA 4RN7A 1L0CA 2XEIA 5CNPA 3SJFA 4ZYQA 3HUVA 1HDUA 2YNEA 3VATA 1CX8A 3RAMA 1Y0YA 3GIUA 3S6GA 3GY9A 1I1DA 4HPSA 3D66A 3SHPA 4R6TA 4MY3A 1TIQA 4RS2A 1IYKA 2AJ6A 2HC9A 4LQGA 3V38A 4A2ZA 2KCWA 4A37A 2IMOA 3HLPA 4F6AA 3BI0A 2QVPA 2PJ4A 2P0WA 3V7ZA 3QAYA 4A33A 2K5TA 4M3SA 3B3WA 2BSWA 2GIVA 4F9VA 2CNMA 3R9EA 2BCOA 4WJBA 3PB4X 2ZW5A 1R3NA 4UEFA 1RTQA 4MFLA 2HB6A 3TT2A 4KUAA 1YMEA 2DEAA 3T9YA 4FAIA 5F09A 5J1QA 2B5GB 1IYLA 3B2YA 2G3TA 3NH4A 2F7VA 1M4LA 4X5KA 4KLVA 4R87A 1VHSA 4CGPA 1KWMA 5HXDA 1BO4A 1M4DA 3LD2A 3S9MA 4AG7A 2VXKA 4CYNA 2ZOFA 4KUBA 4CRZB 4OP4A 4KVOE 2EBJA 4ZBGA 1XRYA 1Z4EA 4AVAA 4BD9A 1F57A 2ABZA 4KOTA 5EC4A 1WK4A 3T8WA 3KR4A 3B3SA 4I49A 4L8AA 4X2TA 1VHEA 4BINA 5LYIA 3FH4A 4ZGYB 2C6CA 4CAVA 3SXNA 1ARMA 2ZEPA 5K8OA 4YFJA 5C88A 4MBUA 4TWEA 1XMBA 3N5FA 1XMTA 2FIAA 1YSJA 1CP6A 5AG6A 2REFA 4P4JA 1KZFA 2FE7A 2ZEEA 3GUXA 4GXHA 5H86A 2WUUA 5H84A 1F2OA 4KVME 1WWZA 4MHZA 3DR6A 4PSWA 3IO1A 4NGQA 3IJ3A 3NFZA 1XJOA 2AFSA 4B12A 3FEEA 4XPDB 1PUAA 5D29A 4ZX8A 1UWYA 4H89A 4E8OA 2OH1A 3DGVA 3NH8A 2EWBA 3PRTA 2JEVA 5J8CA 4OC5A 4MCSA 2AFWA 4MFPA 3TCVA 2I79A 1YLOA 4M85A 2B58A 2PRQA 3FJUA 1GYTA 3MN8A 4NGMA 5IB9A 3TE4A 4R57A 2Q43A 3FECA 4UCMA 3PFEA 4NJRA 4OIWA 3D8PA 3IWWA 1CM0A 3FX6A 2CIJA 2ZENA 1YGHA 4IAVA 2PR8A 4QB9A 3VH9A 3PB7X 4R8FA 2ZEMA 5G1ZA 4CAXA 6CPAA 2PRBA 4CYPA 2R98A 1QSTA 1CPSA 4P44A 2CTCA 3KGQA 2FT0A 3W91A 3PBEA 2GE3A 2GREA 3PBBA 1SQHA 4OKOA 4AB7A 3CXPA 3PFOA 1LOKA 3B3TA 4YRHA 4KZTA 2AFUA 3E0KA 2ZEGA 3FNCA 3K9TA 4RI1A 3SJGA 4B10A 3SXOA 4F0YA 4H6ZA 1DTDA 3SI1A 1CPXA 1Z8WA 5THWA 4CGMA 2VQYA 4Q7AA 5LYDA 4AXVA 2OZUA 4NGRA 4MFZA 4Y49B 4LX9A 2C27A 5LYLA 4CAWA 2B5GA 3D7GA 2Q44A 3G3SA 2NMTA 1S7FA 4A30A 2ANPA 3DSBA 3FXTA 4CPAA 1QSMA 2AFOA 2PDOA 2Q4VA 5A28A 2PC1A 3JRUA 1V0CA 5HVGA 3S9LA 1X10A 4KS9A 4MMOA 4OADA 4ONUA 2F8HA 4ORFA 4UWJA 4XPDC 2ZW7A 1KUYA 2C1CA 2GU2A 2WPWA 2V8GA 3GYAA 1EE3P 2O28A 5LRJA 3KR5A 1LANA 1ZG9A 5EMIA 3S6HA 1S5KA 3KI9A 2YGWA 3B7IA 4FWUA 2Q51A 3KQZA 4NGPA 4P4FA 1VKCA 2JBKA 1FNOA 3RBUA 1XFOA 2PJ0A 3WR7A 1Y0RA 1Y9WA 3D67A 2Z3MA 4UEEA 2PQ8A 4NGSA 1TKHA 5IB0A 1LAPA 5E96A 1NE9A 4C2YA 2ZELA 3R96A 1XF8A 1K4JA 3FBUA 4UEZA 5JM6A 3I9SA 4DJLA 2CY2A 2Q04A 3RNZA 2V8DA 4KOUA 4B13A 4FD7A 3QAHA 4YGOA 2O4HA 2C6PA 4LQ6A 2O53A 3IIBA 2BO9A 2PJ2A 2Z3NA 4G1PA 8CPAA 2PJ1A 3KASA 4P6YA 4QUSA 2YNCC 4MJ8A 2NSMA 2HUZA 2OR4A 3RYOA 1R43A 2CNSA 2PJ5A 4P4EA 5AG7A 3KL9A 3FIXA 3TOAA 4KOVA 2GANA 4R7MA 1S7KA 3N7ZA 5G21A 3WC5A 3LWUA 1S7LA 5FVJA 1IU8A 4E2AA 2B4DB 2GFQA 3GKRA 3IC1A 4NSQA 4CYOA 4W9YA 4NGTA 4JXRA 5J8FA 5KTCA 4TNUA 3IWEA 1TF8A 4A39A 1AYEA 1RXTA 4B5PA 4K30A 4DYOA 4BBHA 4PXCA 2FS5A 1KUVA 5DWNA 1ON0A 5A27A 3P2FA 1QQ9A 2GLJA 1X12A 2PJ7A 2VZYA 5F48A 5G22A 2V8HA 4CGNA 1B6BA 3IFEA 2VBQA 4XNHB 1XEBA 3FYNA 2I3CA 2Z3OA 4H6UA 3H8GA 5JH9A 2XEGA 4B11A 3SJXA 2OOTA 4R3KA 2PJCA 1LAMA 4NFRA 3RZAA 3CXSA 1IY7A 4QC6A 3MGDA 3QNVA 4Q36A 3W6SA 2PSWA 1IOIA 2NYQA 2CNTA 4PXBA 1TKJA 1YK3A 2WZNA 1JWQA 4GS4A 4MFJA 3I3GA 1ZG7A 2OZHA 2ZPAA 4OMEA 4B5OA 3CPAA 2Z11A 1IICA 2EK9A 2VEZA 1PU9A 3TX8A 4C7IA 1M4IA 4NEXA 4GM5A 3DNSA 3BHXA 3PP9A 4PK2A 4MCQA 2JDDA 4KSFA 1N71A 4A38A 2ZEDA 4IHMA 4MFQA 2PIZA 3F0AA 4FD5A 2D4OA 2PVWA 4U9YA 4UIBA 5DS0A 3B3CA 4P45A 1TF9A 3IU2A 4OAEA 5AGEA 2BUEA 2OZGA 1PCAA 2F5IA 1Z8TA 4KOSA 2J8NA 2VI7A 4OLLA 5HMNA 2ZEOA 4FUUA 4H2KA 1XOVA 2ZW4A 4EVYA 4UFWA 2PJ8A 2OU2A 2ZEHA 2AFMA 3PEIA 4NJQA 3LODA 4JJXA 3NE7A 5GCNA 4CYQA 4PXEA 3VARA 1YX0A 3KHZA 4XNHC 5KTDA 5LRKA 1ZLHA 4ONWA 1IGBA 4R3LA 1MJAA 3D2MA 1VHOA 1VGYA 4UCPA 5BWAB 2FVGA 2CTBA 3NH5A 4P4BA 1YVOA 5ELYA 5IV0A 5K8PA 3PB9X 3PB8X 4A31A 1Y9KA 5EBVA 1M1DA 1UFHA 1YW4A 2AFXA 1R57A 2ZOGA 3BJ8A 3OWCA 1YQEA 3TO7A 2RFHA 3R1KA 3TC8A 1F2PA 1NMTA 4OC1A 5I0CA 3KQXA 4C2ZA 3WT4A 4OC3A 4EFDA 1MJ9A 1YR0A 1Z5RA 1ZG8A 5F46A 5ISVA 3EO4A 5JGFA 4KOWA 3IEHA 4ZY1A 3WC6A 4CRYB 2Q4YA 2RC4A 2EVNA 5HH1A 2B4BA 4JWPA 1CBXA 2QJ8A 2ZW6A 4P4IA 4XPLA 4II9A 2Z3PA 4F0XA 3GLJA 4NXYA 2WPXA 3W6XA 2PR1A 1Y7RA 3ISZA 3ZZIA 4MCRA 4A94A 5HVHA 4PQAA 4ZX9A 4ZY2A 1Z2LA 4JLYA 2PVVA 3PZJA 3TOBA 4NCZA 3D7HA 4K3NA 3TO9A 3B3VA 2G0BA 1Q2DA 1Q2CA 4UA3A 3SJEA 3D7FA 4MHDA 4NF1A 1I12A 2V8VA 1DE4C 2C6GA 2Q0YA 4CS0B 2PJBA 4UCNA 2PJ3A 3PGPA 3ISXA 4O23A 4KVXA 1Q7LA 1XIXA 4UWIA 1MK4A 4FD4A 3CZXA 1ARLA 1ZO0A 3C26A 4MFKA 3FVLA 2PE3A 2QECA 2I00A 4PK3A 4Y49C 4JD6A 3H8FA 5K8MA 1VIXA 4OC2A 7CPAA 1BPNA 3FRMA 4YU9A 4FBEA 2X7BA 1IIDA 2Z10A 5JPHA 5F49A 4IK2A 2BOAA 4HKFA 5JQ4A 4Z65A 5I4MA 1M4GA 2A4NA 2DPTA 3F5BA 2FL4A 4M6IA 5CBMA 2FIWA 2POKA 2JBJA 2OB0A 3KKWA 4NGNA 4PXDA 4MXUA 5DWMA 4EWTA 2Q7SA 4MHYA 3S9NA 2DPSA 4U5YA 4DNCA 2J8MA 2CF4A 1P4NA 4PV6A 3DR8A 2P6FA 3FF3A 3PB6X 1QSNA 2V77A 1FY7A 2PJ9A 3EXNA 1AUGA 4KOYA 3CDXA 2YNDA 2WSAA 3SI2A 2YNCA 3I1UA 4C7HA 2EK8A 3D4UA 2Y0MA 4A32A 2DXQA 2R1IA 4Q38A 1FT7A 1LCPA 3EY5A 3L2NA 4OC0A 4OIDA 4UBRA 4J3GA 3H4QA 4CAEA 3NA6A 5D8NA 3JTKA 4IF5A 3ZJ0A 1CG2A 1QSOA 2R7HA 2PJAA 2EUIA 3R95A 1YLEA 4OC4A 1BPMA 2QIRA 3BXMA 4U9ZA
chains in the Genus database with same CATH topology
2P6GA 1MJBA 1Z4RA 1J4JA 3F8KA 4A95A 1S3ZA 2FXFA 3DDDA 2G3AA 3TTHA 2H5MA 4C2XA 3IWGA 4R9MA 1Q2YA 4JXQA 3JUWA 3CXQA 3TO6A 3S6KA 3S6FA 2Q7BA 3A9LA 4KLWA 3UY5A 2IL4A 4E0AA 5KTAA 3R9GA 4HNXB 1YVKA 3IGRA 3G8WA 2REEA 4AVBA 2P6EA 4PSXA 4IUSA 2VZZA 3V8IA 1I21A 4HNYB 2B4DA 5C82A 1LRZA 2ARHA 5AG4A 4BMHA 4L89A 5IX3A 3D3SA 2FCKA 4QBJA 1M44A 1IB1E 4UFXA 2B3VA 1U6MA 4CAFA 4B5PB 3QB8A 2ZXVA 2QMLA 3IU1A 3T90A 4B14A 3EFAA 2Z0ZA 5F47A 4QVTA 2D4PA 2HQYA 2JDCA 2B3UA 4MI4A 2BL1A 3P2HA 3TFYA 4LUAA 2Z3LA 2CXAA 1NSLA 4AVCA 2AE6A 3FB3A 4C68A 1QSRA 3H5ZA 4KOXA 1XE4A 2J8RA 3VWDA 2JLMA 4CGLA 1GHEA 2Z3KA 3D2PA 3K9UA 1BOBA 5AG5A 4MY0A 4KORA 4AG9A 1RO5A 2HV2A 3EC4A 1B87A 4KSAA 3BLNA 2ATRA 3B8GA 1P0HA 2FSRA 1CJWA 3R9FA 1KUXA 1Z9UA 1YREA 4UFVA 3BJ7A 2BEIA 1S7NA 4HNWB 1S60A 5G20A 4CGOA 2R8VA 3VWEA 4XPKA 3JVNA 4FD6A 1OZPA 1L0CA 5CNPA 2YNEA 3S6GA 3GY9A 1I1DA 3SHPA 4MY3A 1TIQA 4RS2A 1IYKA 2AJ6A 4A2ZA 2KCWA 4F6AA 2P0WA 4A33A 2K5TA 4M3SA 2BSWA 2GIVA 2CNMA 3R9EA 2ZW5A 4MFLA 3TT2A 4KUAA 3T9YA 2B5GB 1IYLA 2G3TA 4X5KA 4KLVA 4R87A 1VHSA 4CGPA 1BO4A 1M4DA 3LD2A 4AG7A 2VXKA 4CYNA 4KUBA 4CRZB 4KVOE 4ZBGA 1Z4EA 4AVAA 4KOTA 5EC4A 1WK4A 4I49A 4L8AA 4ZGYB 4CAVA 3SXNA 4YFJA 5C88A 4MBUA 5AG6A 1XMTA 2FIAA 2REFA 1KZFA 2FE7A 5H86A 2WUUA 5H84A 4KVME 1WWZA 3DR6A 4PSWA 4B12A 4XPDB 1PUAA 4H89A 4E8OA 2OH1A 2JEVA 5J8CA 4MFPA 3TCVA 2I79A 4M85A 2B58A 3TE4A 4R57A 4UCMA 3D8PA 1CM0A 1YGHA 2PR8A 4QB9A 5G1ZA 4CAXA 2PRBA 4CYPA 2R98A 1QSTA 2FT0A 3W91A 2GE3A 1SQHA 4AB7A 3CXPA 4YRHA 4KZTA 3E0KA 4B10A 3FNCA 4RI1A 4F0YA 3SXOA 4H6ZA 4CGMA 2VQYA 2OZUA 4MFZA 4Y49B 4LX9A 2C27A 4CAWA 2B5GA 3G3SA 2Q44A 2NMTA 1S7FA 4A30A 3DSBA 3FXTA 5A28A 1QSMA 2PDOA 2Q4VA 2PC1A 1V0CA 4KS9A 4OADA 4ONUA 4XPDC 4ORFA 4UWJA 2ZW7A 1KUYA 3GYAA 2WPWA 2O28A 3S6HA 1S5KA 2YGWA 1VKCA 3WR7A 1Y9WA 2Z3MA 2PQ8A 5IB0A 5E96A 1NE9A 4C2YA 3R96A 1XF8A 1K4JA 3FBUA 3I9SA 2CY2A 2Q04A 4KOUA 4B13A 4FD7A 3QAHA 4YGOA 2Z3NA 4QUSA 2YNCC 4MJ8A 2HUZA 3RYOA 2CNSA 5AG7A 3FIXA 3TOAA 4KOVA 2GANA 1S7KA 3N7ZA 5G21A 5FVJA 1S7LA 4E2AA 2B4DB 3GKRA 4CYOA 4NSQA 4JXRA 5J8FA 5KTCA 3IWEA 1RXTA 4B5PA 4K30A 4BBHA 2FS5A 1KUVA 5DWNA 1ON0A 5A27A 3P2FA 5F48A 2VZYA 5G22A 4CGNA 1B6BA 2VBQA 4XNHB 1XEBA 3FYNA 2Z3OA 4H6UA 4B11A 4R3KA 3CXSA 4QC6A 3MGDA 4Q36A 3W6SA 2PSWA 2CNTA 4GS4A 1YK3A 4MFJA 3I3GA 2OZHA 2ZPAA 4B5OA 2Z11A 1IICA 2VEZA 1PU9A 4C7IA 1M4IA 4NEXA 3DNSA 3PP9A 4PK2A 2JDDA 4KSFA 1N71A 4MFQA 3F0AA 4FD5A 2D4OA 4U9YA 3IU2A 4OAEA 5AGEA 2BUEA 2OZGA 2F5IA 4KOSA 2J8NA 2VI7A 4OLLA 5HMNA 2ZW4A 4EVYA 4UFWA 2OU2A 3LODA 4JJXA 3NE7A 5GCNA 4CYQA 5KTDA 1YX0A 4XNHC 4R3LA 1MJAA 3D2MA 4UCPA 5BWAB 1YVOA 5IV0A 4A31A 1Y9KA 5EBVA 1M1DA 1UFHA 1R57A 3BJ8A 3OWCA 3TO7A 3R1KA 1NMTA 5I0CA 4C2ZA 1MJ9A 1YR0A 5F46A 5ISVA 3EO4A 4KOWA 4CRYB 2Q4YA 2RC4A 2EVNA 5HH1A 2B4BA 4JWPA 4XPLA 2ZW6A 4II9A 2Z3PA 4F0XA 4NXYA 2WPXA 3W6XA 2PR1A 1Y7RA 3ZZIA 4JLYA 3PZJA 3TOBA 4NCZA 3TO9A 2G0BA 1Q2DA 1Q2CA 4UA3A 4MHDA 4NF1A 1I12A 2Q0YA 4CS0B 4UCNA 3PGPA 4KVXA 1XIXA 4UWIA 1MK4A 4FD4A 1ZO0A 3C26A 4MFKA 2QECA 2I00A 4PK3A 4Y49C 4JD6A 3FRMA 2X7BA 1IIDA 2Z10A 5JPHA 5F49A 4HKFA 5JQ4A 1M4GA 2A4NA 2DPTA 3F5BA 2FL4A 2FIWA 2OB0A 3KKWA 5DWMA 2DPSA 4U5YA 4DNCA 2J8MA 1P4NA 4PV6A 3DR8A 2P6FA 1QSNA 1FY7A 3EXNA 4KOYA 2YNDA 2WSAA 2YNCA 4C7HA 4A32A 2Y0MA 2DXQA 2R1IA 4Q38A 3EY5A 4CAEA 4UBRA 4J3GA 3H4QA 3JTKA 4IF5A 3ZJ0A 1QSOA 2R7HA 2EUIA 3R95A 1YLEA 2QIRA 4U9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6G A;  1MJB A;  1Z4R A;  1J4J A;  3F8K A;  1S3Z A;  2FXF A;  3DDD A;  2G3A A;  3TTH A;  2H5M A;  3IWG A;  4R9M A;  1Q2Y A;  4JXQ A;  3JUW A;  3CXQ A;  3TO6 A;  3S6K A;  3S6F A;  2Q7B A;  4KLW A;  3UY5 A;  2IL4 A;  4E0A A;  5KTA A;  3R9G A;  4HNX B;  1YVK A;  3IGR A;  3G8W A;  2REE A;  4AVB A;  2P6E A;  4PSX A;  4IUS A;  2VZZ A;  3V8I A;  1I21 A;  4HNY B;  2B4D A;  5C82 A;  1LRZ A;  2ARH A;  4BMH A;  4L89 A;  5IX3 A;  3D3S A;  2FCK A;  4QBJ A;  1M44 A;  1IB1 E;  2B3V A;  1U6M A;  4B5P B;  3QB8 A;  2ZXV A;  2QML A;  3T90 A;  3EFA A;  2Z0Z A;  5F47 A;  4QVT A;  2D4P A;  2HQY A;  2JDC A;  2B3U A;  4MI4 A;  2BL1 A;  3P2H A;  3TFY A;  4LUA A;  1NSL A;  4AVC A;  2AE6 A;  3FB3 A;  1QSR A;  4KOX A;  1XE4 A;  2J8R A;  3VWD A;  2JLM A;  1GHE A;  3D2P A;  3K9U A;  1BOB A;  4MY0 A;  4KOR A;  4AG9 A;  1RO5 A;  2HV2 A;  3EC4 A;  1B87 A;  3BLN A;  2ATR A;  3B8G A;  1P0H A;  2FSR A;  1CJW A;  3R9F A;  1KUX A;  1Z9U A;  1YRE A;  3BJ7 A;  2BEI A;  1S7N A;  4HNW B;  1S60 A;  2R8V A;  3VWE A;  4XPK A;  3JVN A;  4FD6 A;  1OZP A;  1L0C A;  5CNP A;  3S6G A;  3GY9 A;  1I1D A;  3SHP A;  4MY3 A;  1TIQ A;  4RS2 A;  1IYK A;  2AJ6 A;  2KCW A;  4F6A A;  2P0W A;  2K5T A;  4M3S A;  2BSW A;  2GIV A;  2CNM A;  3R9E A;  2ZW5 A;  3TT2 A;  4KUA A;  3T9Y A;  2B5G B;  1IYL A;  2G3T A;  4X5K A;  4KLV A;  4R87 A;  1VHS A;  1BO4 A;  1M4D A;  3LD2 A;  4AG7 A;  2VXK A;  4KUB A;  4CRZ B;  4KVO E;  4ZBG A;  1Z4E A;  4AVA A;  4KOT A;  5EC4 A;  1WK4 A;  4I49 A;  4L8A A;  4CAV A;  3SXN A;  4YFJ A;  5C88 A;  4MBU A;  1XMT A;  2FIA A;  2REF A;  1KZF A;  2FE7 A;  5H86 A;  5H84 A;  4KVM E;  1WWZ A;  3DR6 A;  4PSW A;  4XPD B;  1PUA A;  4H89 A;  4E8O A;  2OH1 A;  2JEV A;  5J8C A;  3TCV A;  2I79 A;  4M85 A;  2B58 A;  3TE4 A;  4R57 A;  3D8P A;  1CM0 A;  1YGH A;  2PR8 A;  4QB9 A;  4CAX A;  2PRB A;  2R98 A;  1QST A;  2FT0 A;  3W91 A;  2GE3 A;  1SQH A;  4AB7 A;  3CXP A;  4YRH A;  4KZT A;  3E0K A;  4F0Y A;  3FNC A;  4RI1 A;  3SXO A;  4H6Z A;  2VQY A;  2OZU A;  4Y49 B;  4LX9 A;  2C27 A;  4CAW A;  2B5G A;  3G3S A;  2Q44 A;  2NMT A;  1S7F A;  3DSB A;  3FXT A;  1QSM A;  2PDO A;  2Q4V A;  2PC1 A;  1V0C A;  4XPD C;  4OAD A;  4ONU A;  4ORF A;  4UWJ A;  2ZW7 A;  1KUY A;  3GYA A;  2WPW A;  2O28 A;  3S6H A;  1S5K A;  1VKC A;  3WR7 A;  1Y9W A;  2PQ8 A;  5IB0 A;  5E96 A;  1NE9 A;  3R96 A;  1XF8 A;  1K4J A;  3FBU A;  3I9S A;  2CY2 A;  2Q04 A;  4KOU A;  4FD7 A;  3QAH A;  4YGO A;  4QUS A;  4MJ8 A;  2HUZ A;  3RYO A;  2CNS A;  3FIX A;  3TOA A;  4KOV A;  2GAN A;  1S7K A;  3N7Z A;  5FVJ A;  1S7L A;  4E2A A;  2B4D B;  3GKR A;  4NSQ A;  4JXR A;  5J8F A;  5KTC A;  1RXT A;  4B5P A;  4K30 A;  2FS5 A;  1KUV A;  5DWN A;  1ON0 A;  3P2F A;  5F48 A;  2VZY A;  1B6B A;  2VBQ A;  4XNH B;  1XEB A;  3FYN A;  4H6U A;  4R3K A;  3CXS A;  4QC6 A;  3MGD A;  3W6S A;  2PSW A;  2CNT A;  4GS4 A;  1YK3 A;  3I3G A;  2OZH A;  2ZPA A;  4B5O A;  2Z11 A;  1IIC A;  2VEZ A;  1PU9 A;  1M4I A;  4NEX A;  3DNS A;  3PP9 A;  4PK2 A;  2JDD A;  1N71 A;  3F0A A;  4FD5 A;  2D4O A;  4U9Y A;  4OAE A;  2BUE A;  2OZG A;  2F5I A;  4KOS A;  2J8N A;  2VI7 A;  4OLL A;  5HMN A;  2ZW4 A;  4EVY A;  2OU2 A;  3LOD A;  4JJX A;  3NE7 A;  5GCN A;  5KTD A;  1YX0 A;  4XNH C;  4R3L A;  1MJA A;  3D2M A;  1YVO A;  5IV0 A;  1Y9K A;  5EBV A;  1M1D A;  1UFH A;  1R57 A;  3BJ8 A;  3OWC A;  3TO7 A;  3R1K A;  1NMT A;  5I0C A;  1MJ9 A;  1YR0 A;  5F46 A;  5ISV A;  3EO4 A;  4KOW A;  4CRY B;  2Q4Y A;  2RC4 A;  2EVN A;  5HH1 A;  2B4B A;  4JWP A;  4XPL A;  2ZW6 A;  4II9 A;  4NXY A;  2WPX A;  3W6X A;  2PR1 A;  1Y7R A;  3ZZI A;  4JLY A;  3PZJ A;  3TOB A;  4NCZ A;  3TO9 A;  2G0B A;  1Q2D A;  1Q2C A;  4UA3 A;  4MHD A;  4NF1 A;  1I12 A;  2Q0Y A;  4CS0 B;  3PGP A;  4KVX A;  1XIX A;  4UWI A;  1MK4 A;  4FD4 A;  3C26 A;  2QEC A;  2I00 A;  4PK3 A;  4Y49 C;  4JD6 A;  3FRM A;  2X7B A;  1IID A;  2Z10 A;  5JPH A;  5F49 A;  4HKF A;  5JQ4 A;  1M4G A;  2A4N A;  3F5B A;  2FL4 A;  2FIW A;  2OB0 A;  3KKW A;  5DWM A;  4U5Y A;  4DNC A;  2J8M A;  1P4N A;  4PV6 A;  3DR8 A;  2P6F A;  1QSN A;  1FY7 A;  3EXN A;  4KOY A;  2Y0M A;  2DXQ A;  2R1I A;  3EY5 A;  4UBR A;  4J3G A;  3H4Q A;  4IF5 A;  3ZJ0 A;  1QSO A;  2R7H A;  2EUI A;  3R95 A;  1YLE A;  2QIR A;  4U9Z A; 
#chains in the Genus database with same CATH topology
 4M6H A;  4WWV A;  3KZW A;  4DUK A;  2P6G A;  4PPZ A;  1MJB A;  1Z4R A;  1BAV A;  4P10 A;  4X8I A;  1J4J A;  5CPA A;  2DF5 A;  3F8K A;  1NSA A;  4A95 A;  1S3Z A;  2FXF A;  3DDD A;  2G3A A;  3TTH A;  3BI1 A;  2H5M A;  5LRG A;  1HDQ A;  2WYR A;  4JYW A;  1ELM P;  3D7D A;  3IWG A;  1OBR A;  4C2X A;  3CPX A;  4R9M A;  2EO8 A;  1Q2Y A;  1QMU A;  1ZLI A;  3MRU A;  4JXQ A;  3JUW A;  3CXQ A;  3TO6 A;  3S6K A;  4ZI6 A;  3S6F A;  5K8N A;  1IOF A;  2Q7B A;  5LYF A;  4P4D A;  4EME A;  2Q4Z A;  3A9L A;  2GLF A;  2IQ6 A;  4UF4 A;  4KLW A;  3UY5 A;  2VL1 A;  2IL4 A;  1YW6 A;  4E0A A;  4ZY0 A;  5KTA A;  3R9G A;  1Z8L A;  4HNX B;  1YVK A;  4YWY A;  5HVF A;  3IGR A;  2XEF A;  3RO0 A;  2ZEF A;  2REE A;  3G8W A;  2P6E A;  4MRI A;  4AVB A;  4PSX A;  4IUS A;  2VZZ A;  3CT9 A;  2QYV A;  3V8I A;  1I21 A;  4HNY B;  2XEJ A;  2B4D A;  5C82 A;  1LRZ A;  2ARH A;  3D68 A;  3LMS A;  5AG4 A;  1XBU A;  1Y7E A;  4L89 A;  4BMH A;  1PYT B;  2JEW A;  4MHP A;  5IX3 A;  3D3S A;  2FCK A;  2ODF A;  1M44 A;  1IB1 E;  4QBJ A;  1JQG A;  4MHN A;  4UFX A;  2B3V A;  1U6M A;  4MCP A;  4CAF A;  4B5P B;  4JZ0 A;  3QB8 A;  2ZXV A;  2QML A;  3IU1 A;  3T90 A;  4B14 A;  3EFA A;  2Z0Z A;  5F47 A;  3LAC A;  4QVT A;  2D4P A;  2HQY A;  3DLJ A;  2RB7 A;  2PJ6 A;  2JDC A;  2B3U A;  4MI4 A;  2BL1 A;  3P2H A;  3TFY A;  4M6G A;  3NE8 A;  4LUA A;  4F8Z A;  2Z3L A;  4B6Z A;  1CP7 A;  2CXA A;  3KHX A;  1NSL A;  4AVC A;  2AE6 A;  3FB3 A;  4C68 A;  1QSR A;  1Z8X A;  3H5Z A;  3K2K A;  4KOX A;  1XE4 A;  2J8R A;  3VWD A;  2JLM A;  4CGL A;  1A2Z A;  3GB0 A;  1GHE A;  2Z3K A;  3D2P A;  3K9U A;  1BOB A;  3WC7 A;  5AG5 A;  4RUH A;  4MY0 A;  4KOR A;  1TKF A;  2G9D A;  4AG9 A;  2PCU A;  4R76 A;  1RO5 A;  2HV2 A;  3EC4 A;  1ELL P;  1B87 A;  4KSA A;  3BLN A;  3WAB A;  3FMC A;  2ATR A;  3B8G A;  4UIA A;  3B35 A;  1P0H A;  2FSR A;  1AMP A;  1CJW A;  3R9F A;  4KSI A;  1KUX A;  1LFW A;  1Z9U A;  1YRE A;  1TXR A;  3SI0 A;  3FED A;  4UFV A;  3BJ7 A;  2J9A A;  2BEI A;  4X3R A;  1S7N A;  2IJZ A;  4HNW B;  1S60 A;  1BLL E;  1HEE A;  3H8E A;  5G20 A;  4CGO A;  2R8V A;  3VWE A;  4XPK A;  1H8L A;  4F9U A;  3JVN A;  4FD6 A;  2AFZ A;  2PIY A;  1OZP A;  4RN7 A;  1L0C A;  2XEI A;  5CNP A;  3SJF A;  4ZYQ A;  3HUV A;  1HDU A;  2YNE A;  3VAT A;  1CX8 A;  3RAM A;  1Y0Y A;  3GIU A;  3S6G A;  3GY9 A;  1I1D A;  4HPS A;  3D66 A;  3SHP A;  4R6T A;  4MY3 A;  1TIQ A;  4RS2 A;  1IYK A;  2AJ6 A;  2HC9 A;  4LQG A;  3V38 A;  4A2Z A;  2KCW A;  4A37 A;  2IMO A;  3HLP A;  4F6A A;  3BI0 A;  2QVP A;  2PJ4 A;  2P0W A;  3V7Z A;  3QAY A;  4A33 A;  2K5T A;  4M3S A;  3B3W A;  2BSW A;  2GIV A;  4F9V A;  2CNM A;  3R9E A;  2BCO A;  4WJB A;  3PB4 X;  2ZW5 A;  1R3N A;  4UEF A;  1RTQ A;  4MFL A;  2HB6 A;  3TT2 A;  4KUA A;  1YME A;  2DEA A;  3T9Y A;  4FAI A;  5F09 A;  5J1Q A;  2B5G B;  1IYL A;  3B2Y A;  2G3T A;  3NH4 A;  2F7V A;  1M4L A;  4X5K A;  4KLV A;  4R87 A;  1VHS A;  4CGP A;  1KWM A;  5HXD A;  1BO4 A;  1M4D A;  3LD2 A;  3S9M A;  4AG7 A;  2VXK A;  4CYN A;  2ZOF A;  4KUB A;  4CRZ B;  4OP4 A;  4KVO E;  2EBJ A;  4ZBG A;  1XRY A;  1Z4E A;  4AVA A;  4BD9 A;  1F57 A;  2ABZ A;  4KOT A;  5EC4 A;  1WK4 A;  3T8W A;  3KR4 A;  3B3S A;  4I49 A;  4L8A A;  4X2T A;  1VHE A;  4BIN A;  5LYI A;  3FH4 A;  4ZGY B;  2C6C A;  4CAV A;  3SXN A;  1ARM A;  2ZEP A;  5K8O A;  4YFJ A;  5C88 A;  4MBU A;  4TWE A;  1XMB A;  3N5F A;  1XMT A;  2FIA A;  1YSJ A;  1CP6 A;  5AG6 A;  2REF A;  4P4J A;  1KZF A;  2FE7 A;  2ZEE A;  3GUX A;  4GXH A;  5H86 A;  2WUU A;  5H84 A;  1F2O A;  4KVM E;  1WWZ A;  4MHZ A;  3DR6 A;  4PSW A;  3IO1 A;  4NGQ A;  3IJ3 A;  3NFZ A;  1XJO A;  2AFS A;  4B12 A;  3FEE A;  4XPD B;  1PUA A;  5D29 A;  4ZX8 A;  1UWY A;  4H89 A;  4E8O A;  2OH1 A;  3DGV A;  3NH8 A;  2EWB A;  3PRT A;  2JEV A;  5J8C A;  4OC5 A;  4MCS A;  2AFW A;  4MFP A;  3TCV A;  2I79 A;  1YLO A;  4M85 A;  2B58 A;  2PRQ A;  3FJU A;  1GYT A;  3MN8 A;  4NGM A;  5IB9 A;  3TE4 A;  4R57 A;  2Q43 A;  3FEC A;  4UCM A;  3PFE A;  4NJR A;  4OIW A;  3D8P A;  3IWW A;  1CM0 A;  3FX6 A;  2CIJ A;  2ZEN A;  1YGH A;  4IAV A;  2PR8 A;  4QB9 A;  3VH9 A;  3PB7 X;  4R8F A;  2ZEM A;  5G1Z A;  4CAX A;  6CPA A;  2PRB A;  4CYP A;  2R98 A;  1QST A;  1CPS A;  4P44 A;  2CTC A;  3KGQ A;  2FT0 A;  3W91 A;  3PBE A;  2GE3 A;  2GRE A;  3PBB A;  1SQH A;  4OKO A;  4AB7 A;  3CXP A;  3PFO A;  1LOK A;  3B3T A;  4YRH A;  4KZT A;  2AFU A;  3E0K A;  2ZEG A;  3FNC A;  3K9T A;  4RI1 A;  3SJG A;  4B10 A;  3SXO A;  4F0Y A;  4H6Z A;  1DTD A;  3SI1 A;  1CPX A;  1Z8W A;  5THW A;  4CGM A;  2VQY A;  4Q7A A;  5LYD A;  4AXV A;  2OZU A;  4NGR A;  4MFZ A;  4Y49 B;  4LX9 A;  2C27 A;  5LYL A;  4CAW A;  2B5G A;  3D7G A;  2Q44 A;  3G3S A;  2NMT A;  1S7F A;  4A30 A;  2ANP A;  3DSB A;  3FXT A;  4CPA A;  1QSM A;  2AFO A;  2PDO A;  2Q4V A;  5A28 A;  2PC1 A;  3JRU A;  1V0C A;  5HVG A;  3S9L A;  1X10 A;  4KS9 A;  4MMO A;  4OAD A;  4ONU A;  2F8H A;  4ORF A;  4UWJ A;  4XPD C;  2ZW7 A;  1KUY A;  2C1C A;  2GU2 A;  2WPW A;  2V8G A;  3GYA A;  1EE3 P;  2O28 A;  5LRJ A;  3KR5 A;  1LAN A;  1ZG9 A;  5EMI A;  3S6H A;  1S5K A;  3KI9 A;  2YGW A;  3B7I A;  4FWU A;  2Q51 A;  3KQZ A;  4NGP A;  4P4F A;  1VKC A;  2JBK A;  1FNO A;  3RBU A;  1XFO A;  2PJ0 A;  3WR7 A;  1Y0R A;  1Y9W A;  3D67 A;  2Z3M A;  4UEE A;  2PQ8 A;  4NGS A;  1TKH A;  5IB0 A;  1LAP A;  5E96 A;  1NE9 A;  4C2Y A;  2ZEL A;  3R96 A;  1XF8 A;  1K4J A;  3FBU A;  4UEZ A;  5JM6 A;  3I9S A;  4DJL A;  2CY2 A;  2Q04 A;  3RNZ A;  2V8D A;  4KOU A;  4B13 A;  4FD7 A;  3QAH A;  4YGO A;  2O4H A;  2C6P A;  4LQ6 A;  2O53 A;  3IIB A;  2BO9 A;  2PJ2 A;  2Z3N A;  4G1P A;  8CPA A;  2PJ1 A;  3KAS A;  4P6Y A;  4QUS A;  2YNC C;  4MJ8 A;  2NSM A;  2HUZ A;  2OR4 A;  3RYO A;  1R43 A;  2CNS A;  2PJ5 A;  4P4E A;  5AG7 A;  3KL9 A;  3FIX A;  3TOA A;  4KOV A;  2GAN A;  4R7M A;  1S7K A;  3N7Z A;  5G21 A;  3WC5 A;  3LWU A;  1S7L A;  5FVJ A;  1IU8 A;  4E2A A;  2B4D B;  2GFQ A;  3GKR A;  3IC1 A;  4NSQ A;  4CYO A;  4W9Y A;  4NGT A;  4JXR A;  5J8F A;  5KTC A;  4TNU A;  3IWE A;  1TF8 A;  4A39 A;  1AYE A;  1RXT A;  4B5P A;  4K30 A;  4DYO A;  4BBH A;  4PXC A;  2FS5 A;  1KUV A;  5DWN A;  1ON0 A;  5A27 A;  3P2F A;  1QQ9 A;  2GLJ A;  1X12 A;  2PJ7 A;  2VZY A;  5F48 A;  5G22 A;  2V8H A;  4CGN A;  1B6B A;  3IFE A;  2VBQ A;  4XNH B;  1XEB A;  3FYN A;  2I3C A;  2Z3O A;  4H6U A;  3H8G A;  5JH9 A;  2XEG A;  4B11 A;  3SJX A;  2OOT A;  4R3K A;  2PJC A;  1LAM A;  4NFR A;  3RZA A;  3CXS A;  1IY7 A;  4QC6 A;  3MGD A;  3QNV A;  4Q36 A;  3W6S A;  2PSW A;  1IOI A;  2NYQ A;  2CNT A;  4PXB A;  1TKJ A;  1YK3 A;  2WZN A;  1JWQ A;  4GS4 A;  4MFJ A;  3I3G A;  1ZG7 A;  2OZH A;  2ZPA A;  4OME A;  4B5O A;  3CPA A;  2Z11 A;  1IIC A;  2EK9 A;  2VEZ A;  1PU9 A;  3TX8 A;  4C7I A;  1M4I A;  4NEX A;  4GM5 A;  3DNS A;  3BHX A;  3PP9 A;  4PK2 A;  4MCQ A;  2JDD A;  4KSF A;  1N71 A;  4A38 A;  2ZED A;  4IHM A;  4MFQ A;  2PIZ A;  3F0A A;  4FD5 A;  2D4O A;  2PVW A;  4U9Y A;  4UIB A;  5DS0 A;  3B3C A;  4P45 A;  1TF9 A;  3IU2 A;  4OAE A;  5AGE A;  2BUE A;  2OZG A;  1PCA A;  2F5I A;  1Z8T A;  4KOS A;  2J8N A;  2VI7 A;  4OLL A;  5HMN A;  2ZEO A;  4FUU A;  4H2K A;  1XOV A;  2ZW4 A;  4EVY A;  4UFW A;  2PJ8 A;  2OU2 A;  2ZEH A;  2AFM A;  3PEI A;  4NJQ A;  3LOD A;  4JJX A;  3NE7 A;  5GCN A;  4CYQ A;  4PXE A;  3VAR A;  1YX0 A;  3KHZ A;  4XNH C;  5KTD A;  5LRK A;  1ZLH A;  4ONW A;  1IGB A;  4R3L A;  1MJA A;  3D2M A;  1VHO A;  1VGY A;  4UCP A;  5BWA B;  2FVG A;  2CTB A;  3NH5 A;  4P4B A;  1YVO A;  5ELY A;  5IV0 A;  5K8P A;  3PB9 X;  3PB8 X;  4A31 A;  1Y9K A;  5EBV A;  1M1D A;  1UFH A;  1YW4 A;  2AFX A;  1R57 A;  2ZOG A;  3BJ8 A;  3OWC A;  1YQE A;  3TO7 A;  2RFH A;  3R1K A;  3TC8 A;  1F2P A;  1NMT A;  4OC1 A;  5I0C A;  3KQX A;  4C2Z A;  3WT4 A;  4OC3 A;  4EFD A;  1MJ9 A;  1YR0 A;  1Z5R A;  1ZG8 A;  5F46 A;  5ISV A;  3EO4 A;  5JGF A;  4KOW A;  3IEH A;  4ZY1 A;  3WC6 A;  4CRY B;  2Q4Y A;  2RC4 A;  2EVN A;  5HH1 A;  2B4B A;  4JWP A;  1CBX A;  2QJ8 A;  2ZW6 A;  4P4I A;  4XPL A;  4II9 A;  2Z3P A;  4F0X A;  3GLJ A;  4NXY A;  2WPX A;  3W6X A;  2PR1 A;  1Y7R A;  3ISZ A;  3ZZI A;  4MCR A;  4A94 A;  5HVH A;  4PQA A;  4ZX9 A;  4ZY2 A;  1Z2L A;  4JLY A;  2PVV A;  3PZJ A;  3TOB A;  4NCZ A;  3D7H A;  4K3N A;  3TO9 A;  3B3V A;  2G0B A;  1Q2D A;  1Q2C A;  4UA3 A;  3SJE A;  3D7F A;  4MHD A;  4NF1 A;  1I12 A;  2V8V A;  1DE4 C;  2C6G A;  2Q0Y A;  4CS0 B;  2PJB A;  4UCN A;  2PJ3 A;  3PGP A;  3ISX A;  4O23 A;  4KVX A;  1Q7L A;  1XIX A;  4UWI A;  1MK4 A;  4FD4 A;  3CZX A;  1ARL A;  1ZO0 A;  3C26 A;  4MFK A;  3FVL A;  2PE3 A;  2QEC A;  2I00 A;  4PK3 A;  4Y49 C;  4JD6 A;  3H8F A;  5K8M A;  1VIX A;  4OC2 A;  7CPA A;  1BPN A;  3FRM A;  4YU9 A;  4FBE A;  2X7B A;  1IID A;  2Z10 A;  5JPH A;  5F49 A;  4IK2 A;  2BOA A;  4HKF A;  5JQ4 A;  4Z65 A;  5I4M A;  1M4G A;  2A4N A;  2DPT A;  3F5B A;  2FL4 A;  4M6I A;  5CBM A;  2FIW A;  2POK A;  2JBJ A;  2OB0 A;  3KKW A;  4NGN A;  4PXD A;  4MXU A;  5DWM A;  4EWT A;  2Q7S A;  4MHY A;  3S9N A;  2DPS A;  4U5Y A;  4DNC A;  2J8M A;  2CF4 A;  1P4N A;  4PV6 A;  3DR8 A;  2P6F A;  3FF3 A;  3PB6 X;  1QSN A;  2V77 A;  1FY7 A;  2PJ9 A;  3EXN A;  1AUG A;  4KOY A;  3CDX A;  2YND A;  2WSA A;  3SI2 A;  2YNC A;  3I1U A;  4C7H A;  2EK8 A;  3D4U A;  2Y0M A;  4A32 A;  2DXQ A;  2R1I A;  4Q38 A;  1FT7 A;  1LCP A;  3EY5 A;  3L2N A;  4OC0 A;  4OID A;  4UBR A;  4J3G A;  3H4Q A;  4CAE A;  3NA6 A;  5D8N A;  3JTK A;  4IF5 A;  3ZJ0 A;  1CG2 A;  1QSO A;  2R7H A;  2PJA A;  2EUI A;  3R95 A;  1YLE A;  4OC4 A;  1BPM A;  2QIR A;  3BXM A;  4U9Z A; 
#chains in the Genus database with same CATH homology
 2P6G A;  1MJB A;  1Z4R A;  1J4J A;  3F8K A;  4A95 A;  1S3Z A;  2FXF A;  3DDD A;  2G3A A;  3TTH A;  2H5M A;  4C2X A;  3IWG A;  4R9M A;  1Q2Y A;  4JXQ A;  3JUW A;  3CXQ A;  3TO6 A;  3S6K A;  3S6F A;  2Q7B A;  3A9L A;  4KLW A;  3UY5 A;  2IL4 A;  4E0A A;  5KTA A;  3R9G A;  4HNX B;  1YVK A;  3IGR A;  3G8W A;  2REE A;  4AVB A;  2P6E A;  4PSX A;  4IUS A;  2VZZ A;  3V8I A;  1I21 A;  4HNY B;  2B4D A;  5C82 A;  1LRZ A;  2ARH A;  5AG4 A;  4BMH A;  4L89 A;  5IX3 A;  3D3S A;  2FCK A;  4QBJ A;  1M44 A;  1IB1 E;  4UFX A;  2B3V A;  1U6M A;  4CAF A;  4B5P B;  3QB8 A;  2ZXV A;  2QML A;  3IU1 A;  3T90 A;  4B14 A;  3EFA A;  2Z0Z A;  5F47 A;  4QVT A;  2D4P A;  2HQY A;  2JDC A;  2B3U A;  4MI4 A;  2BL1 A;  3P2H A;  3TFY A;  4LUA A;  2Z3L A;  2CXA A;  1NSL A;  4AVC A;  2AE6 A;  3FB3 A;  4C68 A;  1QSR A;  3H5Z A;  4KOX A;  1XE4 A;  2J8R A;  3VWD A;  2JLM A;  4CGL A;  1GHE A;  2Z3K A;  3D2P A;  3K9U A;  1BOB A;  5AG5 A;  4MY0 A;  4KOR A;  4AG9 A;  1RO5 A;  2HV2 A;  3EC4 A;  1B87 A;  4KSA A;  3BLN A;  2ATR A;  3B8G A;  1P0H A;  2FSR A;  1CJW A;  3R9F A;  1KUX A;  1Z9U A;  1YRE A;  4UFV A;  3BJ7 A;  2BEI A;  1S7N A;  4HNW B;  1S60 A;  5G20 A;  4CGO A;  2R8V A;  3VWE A;  4XPK A;  3JVN A;  4FD6 A;  1OZP A;  1L0C A;  5CNP A;  2YNE A;  3S6G A;  3GY9 A;  1I1D A;  3SHP A;  4MY3 A;  1TIQ A;  4RS2 A;  1IYK A;  2AJ6 A;  4A2Z A;  2KCW A;  4F6A A;  2P0W A;  4A33 A;  2K5T A;  4M3S A;  2BSW A;  2GIV A;  2CNM A;  3R9E A;  2ZW5 A;  4MFL A;  3TT2 A;  4KUA A;  3T9Y A;  2B5G B;  1IYL A;  2G3T A;  4X5K A;  4KLV A;  4R87 A;  1VHS A;  4CGP A;  1BO4 A;  1M4D A;  3LD2 A;  4AG7 A;  2VXK A;  4CYN A;  4KUB A;  4CRZ B;  4KVO E;  4ZBG A;  1Z4E A;  4AVA A;  4KOT A;  5EC4 A;  1WK4 A;  4I49 A;  4L8A A;  4ZGY B;  4CAV A;  3SXN A;  4YFJ A;  5C88 A;  4MBU A;  5AG6 A;  1XMT A;  2FIA A;  2REF A;  1KZF A;  2FE7 A;  5H86 A;  2WUU A;  5H84 A;  4KVM E;  1WWZ A;  3DR6 A;  4PSW A;  4B12 A;  4XPD B;  1PUA A;  4H89 A;  4E8O A;  2OH1 A;  2JEV A;  5J8C A;  4MFP A;  3TCV A;  2I79 A;  4M85 A;  2B58 A;  3TE4 A;  4R57 A;  4UCM A;  3D8P A;  1CM0 A;  1YGH A;  2PR8 A;  4QB9 A;  5G1Z A;  4CAX A;  2PRB A;  4CYP A;  2R98 A;  1QST A;  2FT0 A;  3W91 A;  2GE3 A;  1SQH A;  4AB7 A;  3CXP A;  4YRH A;  4KZT A;  3E0K A;  4B10 A;  3FNC A;  4RI1 A;  4F0Y A;  3SXO A;  4H6Z A;  4CGM A;  2VQY A;  2OZU A;  4MFZ A;  4Y49 B;  4LX9 A;  2C27 A;  4CAW A;  2B5G A;  3G3S A;  2Q44 A;  2NMT A;  1S7F A;  4A30 A;  3DSB A;  3FXT A;  5A28 A;  1QSM A;  2PDO A;  2Q4V A;  2PC1 A;  1V0C A;  4KS9 A;  4OAD A;  4ONU A;  4XPD C;  4ORF A;  4UWJ A;  2ZW7 A;  1KUY A;  3GYA A;  2WPW A;  2O28 A;  3S6H A;  1S5K A;  2YGW A;  1VKC A;  3WR7 A;  1Y9W A;  2Z3M A;  2PQ8 A;  5IB0 A;  5E96 A;  1NE9 A;  4C2Y A;  3R96 A;  1XF8 A;  1K4J A;  3FBU A;  3I9S A;  2CY2 A;  2Q04 A;  4KOU A;  4B13 A;  4FD7 A;  3QAH A;  4YGO A;  2Z3N A;  4QUS A;  2YNC C;  4MJ8 A;  2HUZ A;  3RYO A;  2CNS A;  5AG7 A;  3FIX A;  3TOA A;  4KOV A;  2GAN A;  1S7K A;  3N7Z A;  5G21 A;  5FVJ A;  1S7L A;  4E2A A;  2B4D B;  3GKR A;  4CYO A;  4NSQ A;  4JXR A;  5J8F A;  5KTC A;  3IWE A;  1RXT A;  4B5P A;  4K30 A;  4BBH A;  2FS5 A;  1KUV A;  5DWN A;  1ON0 A;  5A27 A;  3P2F A;  5F48 A;  2VZY A;  5G22 A;  4CGN A;  1B6B A;  2VBQ A;  4XNH B;  1XEB A;  3FYN A;  2Z3O A;  4H6U A;  4B11 A;  4R3K A;  3CXS A;  4QC6 A;  3MGD A;  4Q36 A;  3W6S A;  2PSW A;  2CNT A;  4GS4 A;  1YK3 A;  4MFJ A;  3I3G A;  2OZH A;  2ZPA A;  4B5O A;  2Z11 A;  1IIC A;  2VEZ A;  1PU9 A;  4C7I A;  1M4I A;  4NEX A;  3DNS A;  3PP9 A;  4PK2 A;  2JDD A;  4KSF A;  1N71 A;  4MFQ A;  3F0A A;  4FD5 A;  2D4O A;  4U9Y A;  3IU2 A;  4OAE A;  5AGE A;  2BUE A;  2OZG A;  2F5I A;  4KOS A;  2J8N A;  2VI7 A;  4OLL A;  5HMN A;  2ZW4 A;  4EVY A;  4UFW A;  2OU2 A;  3LOD A;  4JJX A;  3NE7 A;  5GCN A;  4CYQ A;  5KTD A;  1YX0 A;  4XNH C;  4R3L A;  1MJA A;  3D2M A;  4UCP A;  5BWA B;  1YVO A;  5IV0 A;  4A31 A;  1Y9K A;  5EBV A;  1M1D A;  1UFH A;  1R57 A;  3BJ8 A;  3OWC A;  3TO7 A;  3R1K A;  1NMT A;  5I0C A;  4C2Z A;  1MJ9 A;  1YR0 A;  5F46 A;  5ISV A;  3EO4 A;  4KOW A;  4CRY B;  2Q4Y A;  2RC4 A;  2EVN A;  5HH1 A;  2B4B A;  4JWP A;  4XPL A;  2ZW6 A;  4II9 A;  2Z3P A;  4F0X A;  4NXY A;  2WPX A;  3W6X A;  2PR1 A;  1Y7R A;  3ZZI A;  4JLY A;  3PZJ A;  3TOB A;  4NCZ A;  3TO9 A;  2G0B A;  1Q2D A;  1Q2C A;  4UA3 A;  4MHD A;  4NF1 A;  1I12 A;  2Q0Y A;  4CS0 B;  4UCN A;  3PGP A;  4KVX A;  1XIX A;  4UWI A;  1MK4 A;  4FD4 A;  1ZO0 A;  3C26 A;  4MFK A;  2QEC A;  2I00 A;  4PK3 A;  4Y49 C;  4JD6 A;  3FRM A;  2X7B A;  1IID A;  2Z10 A;  5JPH A;  5F49 A;  4HKF A;  5JQ4 A;  1M4G A;  2A4N A;  2DPT A;  3F5B A;  2FL4 A;  2FIW A;  2OB0 A;  3KKW A;  5DWM A;  2DPS A;  4U5Y A;  4DNC A;  2J8M A;  1P4N A;  4PV6 A;  3DR8 A;  2P6F A;  1QSN A;  1FY7 A;  3EXN A;  4KOY A;  2YND A;  2WSA A;  2YNC A;  4C7H A;  4A32 A;  2Y0M A;  2DXQ A;  2R1I A;  4Q38 A;  3EY5 A;  4CAE A;  4UBR A;  4J3G A;  3H4Q A;  3JTK A;  4IF5 A;  3ZJ0 A;  1QSO A;  2R7H A;  2EUI A;  3R95 A;  1YLE A;  2QIR A;  4U9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...