2P6GA

Crystal structures of saccharomyces cerevisiae n-myristoyltransferase with bound myristoyl-coa and inhibitors
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
451
structure length
435
Chain Sequence
DKAKKLENLLKLLQLNNHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 118
structure length 435
sequence length 451
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2007-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6gA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6gA02
1IYLA 1Q2YA 2B5GA 2A4NA 3F8KA 1NE9A 4PSWA 4U9YA 3QB8A 4KLWA 2GIVA 4ORFA 3EXNA 2K5TA 5GCNA 3FIXA 1LRZA 1R57A 1QSOA 4B5OA 1YVOA 5F47A 4XNHB 2FIAA 1B6BA 3F5BA 4YFJA 5KTDA 1S3ZA 4H6UA 3TTHA 4R87A 4OADA 2REFA 4NEXA 2BL1A 4KLVA 2JDDA 4AB7A 3K9UA 2GANA 4Y49B 2JDCA 3W91A 2FL4A 2CNMA 4JLYA 4HNYB 5KTCA 4RI1A 1UFHA 2GE3A 2QECA 4U5YA 4XPKA 2VBQA 3FNCA 2OU2A 1S7KA 4R57A 2WPWA 2ZW4A 1Q2CA 2FXFA 4JWPA 4UWJA 4QBJA 3S6KA 2AJ6A 1OZPA 3V8IA 4R3LA 5DWNA 3NE7A 5JQ4A 3TO6A 1XMTA 3S6FA 3G8WA 2EUIA 2Y0MA 4XPDB 5IB0A 4KUAA 1WK4A 4KORA 3TO7A 2Q4YA 2J8MA 4QB9A 4MI4A 1QSMA 2P6EA 2ZW6A 4MY3A 5C88A 2F5IA 2FE7A 2B4DB 5H86A 3T9YA 4KOXA 4KOYA 3WR7A 3EY5A 2R8VA 2B3VA 4CS0B 2X7BA 4OLLA 1B87A 4PV6A 5F46A 1MK4A 3SXOA 4UWIA 3IGRA 2Q7BA 2OB0A 2G3TA 2VZYA 3DSBA 3DDDA 4KVXA 2P6FA 4LX9A 4X5KA 5I0CA 2B5GB 3FRMA 3R9GA 4AVAA 4HNXB 2J8NA 3S6GA 3EO4A 4FD6A 4J3GA 2FS5A 2ZPAA 3GY9A 1XIXA 4YGOA 4R9MA 1RXTA 4E8OA 4CRYB 3TOAA 2WPXA 3S6HA 3R95A 1YK3A 2D4OA 3ZJ0A 4FD5A 1VHSA 3D2MA 2B4BA 1PUAA 4PK3A 2OZUA 1N71A 2OZHA 3CXSA 1XF8A 4QVTA 1IYKA 3D8PA 5IX3A 2O28A 4FD7A 3FXTA 3EFAA 5CNPA 1S5KA 3IWGA 4GS4A 2PR1A 3F0AA 2PDOA 3PP9A 1U6MA 1M44A 4II9A 3TE4A 1YVKA 4EVYA 4AG9A 4KOSA 1KZFA 2ATRA 1K4JA 4DNCA 3JVNA 5JPHA 2P6GA 2HV2A 3TCVA 3GKRA 1P0HA 3VWEA 2ZXVA 3MGDA 3P2FA 4NF1A 4E2AA 3RYOA 3FB3A 5F49A 1MJ9A 5J8FA 1IB1E 3BJ8A 3SHPA 4HKFA 4CAVA 2CY2A 4XNHC 3I9SA 2Z0ZA 2VQYA 2H5MA 2ZW5A 4NSQA 3UY5A 2CNSA 2C27A 2Q0YA 2PSWA 1IICA 1VKCA 4Y49C 1L0CA 1I12A 4U9ZA 4XPLA 1GHEA 2PC1A 1P4NA 4MJ8A 1RO5A 2FSRA 4PK2A 3DR6A 3I3GA 5E96A 2Q44A 3TOBA 3FYNA 2FT0A 2JLMA 2R98A 3GYAA 4IUSA 4M85A 4K30A 2VXKA 1MJBA 1QSNA 2HUZA 4BMHA 2IL4A 2PRBA 3ZZIA 5HMNA 4B5PA 1S60A 4R3KA 1PU9A 3TFYA 3QAHA 2Q4VA 4LUAA 4NCZA 3TO9A 2B4DA 2FIWA 4KUBA 2I00A 4L89A 5H84A 1NMTA 2B3UA 3C26A 1S7NA 4AG7A 3D2PA 3JUWA 5EC4A 1YLEA 3VWDA 1TIQA 2D4PA 2Z10A 4KOWA 1S7LA 3PZJA 1S7FA 4KOTA 4QC6A 2QIRA 2EVNA 4UBRA 1Z4EA 1SQHA 2FCKA 4KVOE 5J8CA 1BO4A 1Y9WA 1QSTA 3CXPA 3SXNA 2PQ8A 1M4DA 1YR0A 1CM0A 4QUSA 1YX0A 4JD6A 1Y7RA 3EC4A 5KTAA 3W6XA 2ZW7A 4NXYA 1XE4A 1MJAA 2BSWA 1Y9KA 1ON0A 2AE6A 3DR8A 1YGHA 3LD2A 4H89A 3B8GA 3LODA 4L8AA 1M4GA 1QSRA 4MHDA 3BLNA 2J8RA 4UA3A 1I1DA 4OAEA 4KOVA 3H4QA 4AVBA 2NMTA 5C82A 2PR8A 3W6SA 4E0AA 1XEBA 5EBVA 1KUYA 2DXQA 2KCWA 3FBUA 2REEA 2Z11A 4CRZB 1V0CA 1KUVA 3E0KA 3N7ZA 5DWMA 4M3SA 4ZBGA 4HNWB 4F6AA 2CNTA 2QMLA 1Z9UA 2VZZA 2BEIA 3P2HA 2B58A 2Q04A 5FVJA 1J4JA 2G0BA 4B5PB 2P0WA 4AVCA 1BOBA 2OZGA 2ARHA 3G3SA 4CAXA 2RC4A 3TT2A 4CAWA 5ISVA 1CJWA 4PSXA 2HQYA 3BJ7A 1M1DA 3D3SA 4I49A 5F48A 2R7HA 2VI7A 4IF5A 3T90A 1I21A 4RS2A 3KKWA 4KOUA 3PGPA 1IIDA 3R1KA 2JEVA 2OH1A 2R1IA 1M4IA 3R9EA 1YREA 4F0YA 4YRHA 4XPDC 4KZTA 2G3AA 2I79A 1KUXA 4KVME 4FD4A 5HH1A 4JJXA 3DNSA 4MBUA 4JXQA 3R9FA 1FY7A 4ONUA 1WWZA 2BUEA 3CXQA 3R96A 3OWCA 2VEZA 1NSLA 1Z4RA 4H6ZA 1Q2DA 4JXRA 4MY0A 5IV0A
chains in the Genus database with same CATH superfamily
4UEFA 3H8FA 2ZEOA 1LFWA 1IYLA 1Q2YA 4A39A 4ZY1A 2B5GA 2Z3KA 3V38A 4DUKA 5I4MA 2A4NA 4P44A 5CBMA 4CGOA 3F8KA 1NE9A 4PSWA 4U9YA 1LAPA 2OOTA 4EFDA 3WC6A 3IIBA 3QB8A 4KLWA 2GIVA 4ORFA 3EXNA 2K5TA 4ZY2A 5GCNA 3FIXA 1LRZA 3SJGA 3RBUA 1R57A 1QSOA 4LQ6A 4B5OA 1YVOA 2YNCA 5F47A 1F57A 4XNHB 2FIAA 4OP4A 2V8GA 4ZY0A 4P4IA 1ELLP 2QVPA 4ZYQA 1B6BA 2RFHA 3F5BA 4YFJA 5KTDA 1ZG8A 1S3ZA 4H6UA 3TTHA 3GUXA 2RB7A 2YNEA 3HLPA 4R87A 4UF4A 5LYFA 4OADA 2YNCC 3RNZA 2PJCA 2REFA 2ZEDA 2BL1A 2HB6A 3FEEA 4NEXA 4PXEA 4KLVA 2CTCA 2JDDA 2JEWA 4AB7A 8CPAA 3K9UA 2GANA 4AXVA 3PB4X 5AG4A 4Y49B 1IY7A 3FMCA 2JDCA 3W91A 2Q4ZA 5G1ZA 4F9UA 2FL4A 2PVWA 4BBHA 4YU9A 2CNMA 4JLYA 5IB9A 2WUUA 4HNYB 1CPXA 1DTDA 3B3TA 1UFHA 2GE3A 2ZEMA 4P45A 4RI1A 2QECA 2AFUA 4U5YA 4WJBA 1Z8XA 2C6GA 2VBQA 4KSFA 4XPKA 4CYNA 3FNCA 3FF3A 4Q38A 2V8HA 2OU2A 1S7KA 2PVVA 2WPWA 2ZW4A 4R57A 1DE4C 5HVHA 1TKHA 1Q2CA 2FXFA 4R8FA 5F09A 4JWPA 4UWJA 4QBJA 4B14A 3S6KA 3NH8A 2GU2A 5D29A 4C68A 1ELMP 3D7FA 2AJ6A 1OZPA 3PBEA 4MXUA 3V8IA 2J9AA 4R3LA 5DWNA 1ZLHA 2AFZA 3NE7A 1JWQA 4MFZA 5THWA 1HEEA 3RAMA 3TO6A 1XMTA 3S6FA 5JQ4A 3MN8A 3G8WA 3LACA 2EUIA 3CPXA 4OC3A 2Y0MA 4XPDB 2CXAA 5IB0A 5LYIA 4A38A 1YQEA 5D8NA 4ZI6A 4KUAA 2PJ7A 3K2KA 1WK4A 2HC9A 4UEEA 4KORA 3TO7A 2Q4YA 3CZXA 2J8MA 2PJ0A 4QB9A 4MI4A 3RO0A 1QSMA 4UCPA 1HDQA 3WC7A 4DYOA 3DGVA 2P6EA 2ZW6A 4MY3A 1XFOA 3B2YA 5C88A 4KSIA 2F5IA 2FE7A 3PBBA 2ZEFA 3NH5A 4BD9A 2B4DB 2PJAA 5H86A 4A30A 2V77A 4MRIA 3T9YA 4GM5A 4KOXA 2ODFA 4KOYA 4NGQA 3WR7A 3VATA 3EY5A 4B13A 1Z2LA 2R8VA 2B3VA 4CS0B 3PEIA 2X7BA 4OLLA 1B87A 3D7DA 2PJ1A 4PV6A 4CPAA 2PJ4A 5F46A 1FNOA 1MK4A 3H8EA 1OBRA 1Y0RA 3SXOA 4UWIA 3IGRA 2Q7BA 2OB0A 2G3TA 4MFPA 4OC1A 2VZYA 3DSBA 3DDDA 4KVXA 2O53A 3VH9A 2P6FA 3WT4A 4LX9A 1F2PA 1ZLIA 4X5KA 1VGYA 4MFLA 5I0CA 2B5GB 3FRMA 3R9GA 2AFOA 3D66A 3QNVA 2AFMA 2BCOA 1LAMA 1F2OA 2EK8A 4Q36A 2Q7SA 4AVAA 4HNXB 2J8NA 3S6GA 3EO4A 4FD6A 4P4BA 4OMEA 4J3GA 1EE3P 2FS5A 2O4HA 2ZPAA 3IJ3A 3GY9A 4NGMA 4F0XA 4NGNA 1XIXA 2WZNA 4YGOA 4R9MA 1RXTA 2Q43A 5AG6A 1X12A 4E8OA 4YWYA 4CRYB 3TOAA 5A27A 4B6ZA 2WPXA 3WABA 1VHOA 5HVFA 4P4DA 3S6HA 5G20A 4M6IA 1YK3A 3R95A 3T8WA 4R76A 2D4OA 3SI0A 2C1CA 3ZJ0A 2DF5A 4FD5A 4MCPA 3IC1A 4UFVA 3SJFA 1VHSA 3D2MA 2B4BA 1PUAA 2PJ3A 4TWEA 5JGFA 4P4FA 1FT7A 4PK3A 3D67A 2OZUA 4R7MA 1N71A 3S9LA 2OZHA 3CXSA 1XF8A 3D4UA 4FWUA 4UCMA 4QVTA 6CPAA 2GREA 4NGPA 1IYKA 3D8PA 3B7IA 3SI1A 2O28A 2EWBA 3CPAA 5IX3A 4FD7A 3H5ZA 3MRUA 2ZENA 3FXTA 3EFAA 5CNPA 3JTKA 1S5KA 1YSJA 3IWGA 2YGWA 2PR1A 3F0AA 4GS4A 4CYOA 2BOAA 2PDOA 3PP9A 1PYTB 2WYRA 3FEDA 1HDUA 1U6MA 1M44A 3D7HA 3KHZA 3KR4A 4II9A 3NA6A 5LRKA 1YW6A 3TE4A 1YVKA 4A37A 2GLFA 1VHEA 4EVYA 4AG9A 4KOSA 1KZFA 2ATRA 1K4JA 4HPSA 4DNCA 3JVNA 3D7GA 1Y0YA 5EMIA 5LYDA 4MFQA 5JPHA 2P6GA 4CAFA 2HV2A 3B3SA 4RUHA 4R6TA 3TCVA 2POKA 5A28A 1QMUA 2PIZA 3GKRA 2G9DA 1P0HA 3IU2A 3HUVA 3VWEA 2ZXVA 3MGDA 1Y7EA 3IWEA 4MHNA 2AFXA 2DEAA 3P2FA 4M6HA 2ZEPA 4LQGA 1XBUA 3ISXA 5KTCA 4NF1A 1KWMA 1IGBA 2CTBA 3RYOA 3FB3A 4E2AA 5F49A 1MJ9A 5J8FA 1IB1E 3BJ8A 3SHPA 4MHYA 1XOVA 2Z3NA 3S9MA 4HKFA 4CAVA 2CY2A 4KS9A 2XEIA 3H8GA 4P4JA 2GLJA 3IFEA 4XNHC 2ZEEA 3I9SA 2Z0ZA 2VQYA 3KZWA 2YNDA 2Z3PA 4C2YA 4EMEA 1CPSA 3IEHA 2H5MA 3RZAA 2ZW5A 4MFJA 4NSQA 3UY5A 2CNSA 3JRUA 4UIAA 2Z3LA 1BLLE 3GLJA 4H2KA 2C27A 4OKOA 2Q0YA 4IK2A 2PSWA 4PPZA 5ELYA 4DJLA 1AMPA 2WSAA 1IICA 3BXMA 1VKCA 4CGLA 4NFRA 1Z8WA 1CP6A 5K8PA 3FJUA 4Y49C 1L0CA 3A9LA 1I12A 1LCPA 4U9ZA 4XPLA 1GHEA 2PC1A 4B12A 4F8ZA 1P4NA 7CPAA 1IOIA 2EO8A 4MJ8A 3D68A 1RO5A 2FSRA 4PK2A 3DR6A 3I3GA 5E96A 2Q44A 3FVLA 3TOBA 2CIJA 3FYNA 4X3RA 2FT0A 4OC2A 4Q7AA 2JLMA 4W9YA 2R98A 3GYAA 3S9NA 4CGMA 1BPNA 4NGTA 2XEGA 4IUSA 4M85A 4K30A 2VXKA 1CG2A 1MJBA 2Z3OA 1QSNA 3PB6X 2C6CA 2NSMA 2HUZA 4C7IA 1BAVA 1TKJA 3B3WA 4OC5A 3B3CA 4WWVA 5K8OA 2PRQA 4TNUA 5K8NA 4P10A 4BMHA 2IL4A 2PRBA 3ZZIA 1YMEA 4NJRA 5HMNA 3CT9A 4B5PA 1S60A 2ZELA 1M4LA 4R3KA 1PU9A 3TFYA 1CP7A 1R3NA 3QAHA 1LANA 2Q4VA 1LOKA 4LUAA 4UFXA 4NCZA 3TO9A 2QJ8A 2B4DA 1GYTA 4CYPA 1Z8TA 3KQXA 2EBJA 2FIWA 2IQ6A 4KUBA 3TX8A 2I00A 2NYQA 4L89A 4ONWA 5J1QA 1RTQA 5H84A 1NMTA 1PCAA 4CGNA 2B3UA 1R43A 2FVGA 3C26A 1S7NA 4X2TA 2PJ5A 3D2PA 1YLOA 4AG7A 3JUWA 5EC4A 4UFWA 1Z5RA 1YLEA 3VWDA 4Z65A 2VL1A 1TIQA 3TC8A 2V8VA 2D4PA 3VARA 2Z10A 4BINA 4FBEA 4KOWA 1S7LA 1JQGA 4ZX9A 2QYVA 4PXDA 3WC5A 4ZX8A 3PB8X 3PZJA 1XJOA 1TF9A 1S7FA 2Z3MA 4KOTA 3PFOA 4QC6A 1Q7LA 2IJZA 4CAEA 3BI1A 1ZG7A 2QIRA 2EVNA 4MFKA 4UBRA 1Z4EA 4G1PA 3N5FA 5JH9A 1SQHA 3KGQA 2FCKA 4A95A 4IAVA 2ZOGA 4KVOE 4OC4A 2PJ2A 5J8CA 1BO4A 2IMOA 4M6GA 1Y9WA 1QSTA 3KL9A 5JM6A 2XEFA 4MY0A 3CXPA 4NJQA 3SXNA 4X8IA 3KHXA 2PQ8A 1M4DA 1YR0A 2PJ9A 3PB7X 1CM0A 4KSAA 2ABZA 4QUSA 4CGPA 3KASA 1YX0A 1Y7RA 4JD6A 1VIXA 3EC4A 5KTAA 3W6XA 2ZW7A 3V7ZA 4MHPA 4NXYA 5AG5A 1XE4A 1MJAA 2BSWA 3GB0A 5LRJA 5CPAA 1Y9KA 5G21A 4EWTA 1ON0A 2AE6A 3DR8A 4O23A 1YGHA 3B3VA 3LD2A 2C6PA 2F8HA 3B8GA 4H89A 4P4EA 3LODA 4A33A 4L8AA 1M4GA 1QSRA 4MHDA 1AUGA 3BLNA 3I1UA 4MCSA 2J8RA 4UA3A 3LWUA 5AG7A 4NGRA 3PB9X 1I1DA 1IU8A 4OAEA 5LYLA 5HVGA 4KOVA 4MMOA 3H4QA 4AVBA 4OIDA 2PCUA 5IV0A 2NMTA 3BI0A 1CBXA 5C82A 2AFWA 2PR8A 4PXCA 3W6SA 4E0AA 1XEBA 5AGEA 5EBVA 1KUYA 2DXQA 2EK9A 1YW4A 5K8MA 3KQZA 2KCWA 3FBUA 1Z8LA 2REEA 4P6YA 1ZG9A 1CX8A 1XRYA 2Z11A 4B10A 4OC0A 2PJBA 3FX6A 1V0CA 3IWWA 3KR5A 3L2NA 1KUVA 4CRZB 1ARLA 3E0KA 3GIUA 1AYEA 3N7ZA 2XEJA 2ZEHA 4FUUA 5DS0A 5G22A 5DWMA 4C2ZA 2CF4A 2GFQA 1XMBA 4M3SA 4NGSA 4ZBGA 4C7HA 1BPMA 4HNWB 2DPSA 4F6AA 2CNTA 3PFEA 3CDXA 3LMSA 4A32A 1NSAA 2QMLA 1Z9UA 3NFZA 4A31A 2JBJA 2VZZA 2PJ8A 2BEIA 3P2HA 4UEZA 2B58A 2Q04A 4GXHA 3FH4A 4UIBA 3B35A 4F9VA 3IO1A 3KI9A 4IHMA 1A2ZA 5FVJA 1J4JA 1TXRA 2BO9A 2G0BA 4MCRA 3IU1A 4FAIA 4B5PB 2P0WA 4AVCA 1BOBA 2OZGA 2ARHA 3G3SA 2V8DA 4CAXA 2RC4A 4PXBA 1H8LA 3TT2A 2ZEGA 4CAWA 2ZOFA 1CJWA 1QQ9A 5ISVA 1IOFA 4PSXA 2HQYA 3BJ7A 1M1DA 3D3SA 4I49A 5LRGA 5F48A 4A2ZA 2R7HA 2VI7A 4IF5A 3T90A 1I21A 1ARMA 3K9TA 4RS2A 3KKWA 1UWYA 4KOUA 3PGPA 1IIDA 3R1KA 3SJEA 2I3CA 2JEVA 2OH1A 2PE3A 2R1IA 3FECA 3SI2A 1M4IA 4JYWA 3DLJA 2AFSA 3R9EA 2F7VA 3NE8A 4JZ0A 1YREA 1ZO0A 4MCQA 4C2XA 2Q51A 3SJXA 4F0YA 4YRHA 4MHZA 4XPDC 5BWAB 4KZTA 1TKFA 2G3AA 3QAYA 4K3NA 2I79A 1KUXA 4KVME 4FD4A 5HH1A 4ZGYB 3PRTA 2OR4A 1TF8A 4JJXA 3DNSA 3NH4A 4A94A 4B11A 5HXDA 4MBUA 4CYQA 4JXQA 4UCNA 3R9FA 4PQAA 1FY7A 2DPTA 2PJ6A 1WWZA 2BUEA 3CXQA 3BHXA 4ONUA 3R96A 4RN7A 3OWCA 2ANPA 2VEZA 1NSLA 1Z4RA 4H6ZA 1Q2DA 3ISZA 4JXRA 1X10A 2JBKA 2PIYA 4OIWA
chains in the Genus database with same CATH topology
1IYLA 1Q2YA 2B5GA 2Z3KA 2A4NA 4CGOA 3F8KA 1NE9A 4PSWA 4U9YA 3QB8A 4KLWA 2GIVA 4ORFA 3EXNA 2K5TA 5GCNA 3FIXA 1LRZA 1R57A 1QSOA 4B5OA 1YVOA 2YNCA 5F47A 4XNHB 2FIAA 1B6BA 3F5BA 4YFJA 5KTDA 1S3ZA 4H6UA 3TTHA 2YNEA 4R87A 4OADA 2YNCC 2REFA 4NEXA 2BL1A 4KLVA 2JDDA 4AB7A 3K9UA 2GANA 5AG4A 4Y49B 2JDCA 3W91A 5G1ZA 2FL4A 4BBHA 2CNMA 4JLYA 2WUUA 4HNYB 5KTCA 4RI1A 1UFHA 2GE3A 2QECA 4U5YA 4XPKA 4CYNA 4KSFA 2VBQA 3FNCA 4Q38A 2OU2A 1S7KA 4R57A 2WPWA 2ZW4A 1Q2CA 2FXFA 4JWPA 4UWJA 4QBJA 4B14A 3S6KA 4C68A 2AJ6A 1OZPA 3V8IA 4R3LA 5DWNA 3NE7A 4MFZA 5JQ4A 3TO6A 1XMTA 3S6FA 3G8WA 2EUIA 2Y0MA 4XPDB 2CXAA 5IB0A 4KUAA 1WK4A 4KORA 3TO7A 2Q4YA 2J8MA 4QB9A 4MI4A 1QSMA 4UCPA 2P6EA 2ZW6A 4MY3A 5C88A 2F5IA 2FE7A 2B4DB 5H86A 4A30A 3T9YA 4KOXA 4KOYA 3WR7A 4B13A 3EY5A 2R8VA 2B3VA 4CS0B 2X7BA 4OLLA 1B87A 4PV6A 5F46A 1MK4A 3SXOA 4UWIA 3IGRA 2Q7BA 2OB0A 2G3TA 4MFPA 2VZYA 3DSBA 3DDDA 4KVXA 2P6FA 4LX9A 4X5KA 4MFLA 5I0CA 2B5GB 3FRMA 3R9GA 4Q36A 4AVAA 4HNXB 2J8NA 3S6GA 3EO4A 4FD6A 4J3GA 2FS5A 2ZPAA 4F0XA 3GY9A 1XIXA 4YGOA 4R9MA 1RXTA 5AG6A 4E8OA 4CRYB 5A27A 3TOAA 2WPXA 3S6HA 5G20A 3R95A 1YK3A 2D4OA 3ZJ0A 4FD5A 4UFVA 1VHSA 3D2MA 2B4BA 1PUAA 4PK3A 2OZUA 1N71A 2OZHA 3CXSA 1XF8A 4UCMA 4QVTA 1IYKA 3D8PA 5IX3A 2O28A 4FD7A 3H5ZA 3FXTA 3EFAA 5CNPA 3JTKA 1S5KA 3IWGA 2YGWA 2PR1A 3F0AA 4GS4A 4CYOA 2PDOA 3PP9A 1U6MA 1M44A 4II9A 3TE4A 1YVKA 4EVYA 4AG9A 4KOSA 1KZFA 2ATRA 1K4JA 4DNCA 3JVNA 4MFQA 5JPHA 2P6GA 4CAFA 2HV2A 3TCVA 5A28A 3GKRA 1P0HA 3IU2A 3VWEA 2ZXVA 3MGDA 3IWEA 3P2FA 4NF1A 4E2AA 3RYOA 3FB3A 5F49A 1MJ9A 5J8FA 1IB1E 3BJ8A 3SHPA 2Z3NA 4HKFA 4CAVA 2CY2A 4KS9A 4XNHC 3I9SA 2Z0ZA 2VQYA 2YNDA 2Z3PA 4C2YA 2H5MA 2ZW5A 4MFJA 4NSQA 3UY5A 2CNSA 2Z3LA 2C27A 2Q0YA 2PSWA 2WSAA 1IICA 4CGLA 1VKCA 4Y49C 1L0CA 3A9LA 1I12A 4U9ZA 4XPLA 4B12A 1GHEA 2PC1A 1P4NA 4MJ8A 1RO5A 2FSRA 4PK2A 3DR6A 3I3GA 5E96A 2Q44A 3TOBA 3FYNA 2FT0A 2JLMA 2R98A 3GYAA 4CGMA 4IUSA 4M85A 4K30A 2VXKA 1MJBA 2Z3OA 1QSNA 2HUZA 4C7IA 4BMHA 2IL4A 2PRBA 3ZZIA 5HMNA 4B5PA 1S60A 4R3KA 1PU9A 3TFYA 3QAHA 2Q4VA 4LUAA 4UFXA 4NCZA 3TO9A 2B4DA 4CYPA 2FIWA 4KUBA 2I00A 4L89A 5H84A 1NMTA 4CGNA 2B3UA 3C26A 1S7NA 4AG7A 3D2PA 3JUWA 5EC4A 4UFWA 1YLEA 3VWDA 1TIQA 2D4PA 2Z10A 4KOWA 1S7LA 3PZJA 2Z3MA 1S7FA 4KOTA 4QC6A 4CAEA 2QIRA 2EVNA 4MFKA 4UBRA 1Z4EA 1SQHA 2FCKA 4A95A 4KVOE 5J8CA 1BO4A 1Y9WA 1QSTA 3CXPA 3SXNA 2PQ8A 1M4DA 1YR0A 1CM0A 4KSAA 4QUSA 4CGPA 1YX0A 4JD6A 1Y7RA 3EC4A 5KTAA 3W6XA 2ZW7A 4NXYA 5AG5A 1XE4A 1MJAA 2BSWA 1Y9KA 5G21A 1ON0A 2AE6A 3DR8A 1YGHA 3LD2A 4H89A 3B8GA 3LODA 4A33A 4L8AA 1M4GA 1QSRA 4MHDA 5AG7A 3BLNA 2J8RA 4UA3A 1I1DA 4OAEA 4KOVA 3H4QA 4AVBA 2NMTA 5C82A 2PR8A 3W6SA 4E0AA 1XEBA 5AGEA 5EBVA 1KUYA 2DXQA 2KCWA 3FBUA 2REEA 2Z11A 4B10A 4CRZB 1V0CA 1KUVA 3E0KA 3N7ZA 5G22A 5DWMA 4C2ZA 4M3SA 4C7HA 4ZBGA 4HNWB 2DPSA 4F6AA 2CNTA 4A32A 2QMLA 1Z9UA 4A31A 2VZZA 2BEIA 3P2HA 2B58A 2Q04A 5FVJA 1J4JA 2G0BA 3IU1A 4B5PB 2P0WA 4AVCA 1BOBA 2OZGA 2ARHA 3G3SA 4CAXA 2RC4A 3TT2A 4CAWA 5ISVA 1CJWA 4PSXA 2HQYA 3BJ7A 1M1DA 3D3SA 4I49A 5F48A 4A2ZA 2R7HA 2VI7A 4IF5A 3T90A 1I21A 4RS2A 3KKWA 4KOUA 3PGPA 1IIDA 3R1KA 2JEVA 2OH1A 2R1IA 1M4IA 3R9EA 4C2XA 1YREA 1ZO0A 4F0YA 4YRHA 4XPDC 5BWAB 4KZTA 2G3AA 2I79A 1KUXA 4KVME 4FD4A 5HH1A 4ZGYB 4JJXA 3DNSA 4B11A 4MBUA 4CYQA 4JXQA 4UCNA 3R9FA 1FY7A 2DPTA 4ONUA 1WWZA 2BUEA 3CXQA 3R96A 3OWCA 2VEZA 1NSLA 1Z4RA 4H6ZA 1Q2DA 4JXRA 4MY0A 5IV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYL A;  1Q2Y A;  2B5G A;  2A4N A;  3F8K A;  1NE9 A;  4PSW A;  4U9Y A;  3QB8 A;  4KLW A;  2GIV A;  4ORF A;  3EXN A;  2K5T A;  5GCN A;  3FIX A;  1LRZ A;  1R57 A;  1QSO A;  4B5O A;  1YVO A;  5F47 A;  4XNH B;  2FIA A;  1B6B A;  3F5B A;  4YFJ A;  5KTD A;  1S3Z A;  4H6U A;  3TTH A;  4R87 A;  4OAD A;  2REF A;  4NEX A;  2BL1 A;  4KLV A;  2JDD A;  4AB7 A;  3K9U A;  2GAN A;  4Y49 B;  2JDC A;  3W91 A;  2FL4 A;  2CNM A;  4JLY A;  4HNY B;  5KTC A;  4RI1 A;  1UFH A;  2GE3 A;  2QEC A;  4U5Y A;  4XPK A;  2VBQ A;  3FNC A;  2OU2 A;  1S7K A;  4R57 A;  2WPW A;  2ZW4 A;  1Q2C A;  2FXF A;  4JWP A;  4UWJ A;  4QBJ A;  3S6K A;  2AJ6 A;  1OZP A;  3V8I A;  4R3L A;  5DWN A;  3NE7 A;  5JQ4 A;  3TO6 A;  1XMT A;  3S6F A;  3G8W A;  2EUI A;  2Y0M A;  4XPD B;  5IB0 A;  4KUA A;  1WK4 A;  4KOR A;  3TO7 A;  2Q4Y A;  2J8M A;  4QB9 A;  4MI4 A;  1QSM A;  2P6E A;  2ZW6 A;  4MY3 A;  5C88 A;  2F5I A;  2FE7 A;  2B4D B;  5H86 A;  3T9Y A;  4KOX A;  4KOY A;  3WR7 A;  3EY5 A;  2R8V A;  2B3V A;  4CS0 B;  2X7B A;  4OLL A;  1B87 A;  4PV6 A;  5F46 A;  1MK4 A;  3SXO A;  4UWI A;  3IGR A;  2Q7B A;  2OB0 A;  2G3T A;  2VZY A;  3DSB A;  3DDD A;  4KVX A;  2P6F A;  4LX9 A;  4X5K A;  5I0C A;  2B5G B;  3FRM A;  3R9G A;  4AVA A;  4HNX B;  2J8N A;  3S6G A;  3EO4 A;  4FD6 A;  4J3G A;  2FS5 A;  2ZPA A;  3GY9 A;  1XIX A;  4YGO A;  4R9M A;  1RXT A;  4E8O A;  4CRY B;  3TOA A;  2WPX A;  3S6H A;  3R95 A;  1YK3 A;  2D4O A;  3ZJ0 A;  4FD5 A;  1VHS A;  3D2M A;  2B4B A;  1PUA A;  4PK3 A;  2OZU A;  1N71 A;  2OZH A;  3CXS A;  1XF8 A;  4QVT A;  1IYK A;  3D8P A;  5IX3 A;  2O28 A;  4FD7 A;  3FXT A;  3EFA A;  5CNP A;  1S5K A;  3IWG A;  4GS4 A;  2PR1 A;  3F0A A;  2PDO A;  3PP9 A;  1U6M A;  1M44 A;  4II9 A;  3TE4 A;  1YVK A;  4EVY A;  4AG9 A;  4KOS A;  1KZF A;  2ATR A;  1K4J A;  4DNC A;  3JVN A;  5JPH A;  2P6G A;  2HV2 A;  3TCV A;  3GKR A;  1P0H A;  3VWE A;  2ZXV A;  3MGD A;  3P2F A;  4NF1 A;  4E2A A;  3RYO A;  3FB3 A;  5F49 A;  1MJ9 A;  5J8F A;  1IB1 E;  3BJ8 A;  3SHP A;  4HKF A;  4CAV A;  2CY2 A;  4XNH C;  3I9S A;  2Z0Z A;  2VQY A;  2H5M A;  2ZW5 A;  4NSQ A;  3UY5 A;  2CNS A;  2C27 A;  2Q0Y A;  2PSW A;  1IIC A;  1VKC A;  4Y49 C;  1L0C A;  1I12 A;  4U9Z A;  4XPL A;  1GHE A;  2PC1 A;  1P4N A;  4MJ8 A;  1RO5 A;  2FSR A;  4PK2 A;  3DR6 A;  3I3G A;  5E96 A;  2Q44 A;  3TOB A;  3FYN A;  2FT0 A;  2JLM A;  2R98 A;  3GYA A;  4IUS A;  4M85 A;  4K30 A;  2VXK A;  1MJB A;  1QSN A;  2HUZ A;  4BMH A;  2IL4 A;  2PRB A;  3ZZI A;  5HMN A;  4B5P A;  1S60 A;  4R3K A;  1PU9 A;  3TFY A;  3QAH A;  2Q4V A;  4LUA A;  4NCZ A;  3TO9 A;  2B4D A;  2FIW A;  4KUB A;  2I00 A;  4L89 A;  5H84 A;  1NMT A;  2B3U A;  3C26 A;  1S7N A;  4AG7 A;  3D2P A;  3JUW A;  5EC4 A;  1YLE A;  3VWD A;  1TIQ A;  2D4P A;  2Z10 A;  4KOW A;  1S7L A;  3PZJ A;  1S7F A;  4KOT A;  4QC6 A;  2QIR A;  2EVN A;  4UBR A;  1Z4E A;  1SQH A;  2FCK A;  4KVO E;  5J8C A;  1BO4 A;  1Y9W A;  1QST A;  3CXP A;  3SXN A;  2PQ8 A;  1M4D A;  1YR0 A;  1CM0 A;  4QUS A;  1YX0 A;  4JD6 A;  1Y7R A;  3EC4 A;  5KTA A;  3W6X A;  2ZW7 A;  4NXY A;  1XE4 A;  1MJA A;  2BSW A;  1Y9K A;  1ON0 A;  2AE6 A;  3DR8 A;  1YGH A;  3LD2 A;  4H89 A;  3B8G A;  3LOD A;  4L8A A;  1M4G A;  1QSR A;  4MHD A;  3BLN A;  2J8R A;  4UA3 A;  1I1D A;  4OAE A;  4KOV A;  3H4Q A;  4AVB A;  2NMT A;  5C82 A;  2PR8 A;  3W6S A;  4E0A A;  1XEB A;  5EBV A;  1KUY A;  2DXQ A;  2KCW A;  3FBU A;  2REE A;  2Z11 A;  4CRZ B;  1V0C A;  1KUV A;  3E0K A;  3N7Z A;  5DWM A;  4M3S A;  4ZBG A;  4HNW B;  4F6A A;  2CNT A;  2QML A;  1Z9U A;  2VZZ A;  2BEI A;  3P2H A;  2B58 A;  2Q04 A;  5FVJ A;  1J4J A;  2G0B A;  4B5P B;  2P0W A;  4AVC A;  1BOB A;  2OZG A;  2ARH A;  3G3S A;  4CAX A;  2RC4 A;  3TT2 A;  4CAW A;  5ISV A;  1CJW A;  4PSX A;  2HQY A;  3BJ7 A;  1M1D A;  3D3S A;  4I49 A;  5F48 A;  2R7H A;  2VI7 A;  4IF5 A;  3T90 A;  1I21 A;  4RS2 A;  3KKW A;  4KOU A;  3PGP A;  1IID A;  3R1K A;  2JEV A;  2OH1 A;  2R1I A;  1M4I A;  3R9E A;  1YRE A;  4F0Y A;  4YRH A;  4XPD C;  4KZT A;  2G3A A;  2I79 A;  1KUX A;  4KVM E;  4FD4 A;  5HH1 A;  4JJX A;  3DNS A;  4MBU A;  4JXQ A;  3R9F A;  1FY7 A;  4ONU A;  1WWZ A;  2BUE A;  3CXQ A;  3R96 A;  3OWC A;  2VEZ A;  1NSL A;  1Z4R A;  4H6Z A;  1Q2D A;  4JXR A;  4MY0 A;  5IV0 A; 
#chains in the Genus database with same CATH topology
 4UEF A;  3H8F A;  2ZEO A;  1LFW A;  1IYL A;  1Q2Y A;  4A39 A;  4ZY1 A;  2B5G A;  2Z3K A;  3V38 A;  4DUK A;  5I4M A;  2A4N A;  4P44 A;  5CBM A;  4CGO A;  3F8K A;  1NE9 A;  4PSW A;  4U9Y A;  1LAP A;  2OOT A;  4EFD A;  3WC6 A;  3IIB A;  3QB8 A;  4KLW A;  2GIV A;  4ORF A;  3EXN A;  2K5T A;  4ZY2 A;  5GCN A;  3FIX A;  1LRZ A;  3SJG A;  3RBU A;  1R57 A;  1QSO A;  4LQ6 A;  4B5O A;  1YVO A;  2YNC A;  5F47 A;  1F57 A;  4XNH B;  2FIA A;  4OP4 A;  2V8G A;  4ZY0 A;  4P4I A;  1ELL P;  2QVP A;  4ZYQ A;  1B6B A;  2RFH A;  3F5B A;  4YFJ A;  5KTD A;  1ZG8 A;  1S3Z A;  4H6U A;  3TTH A;  3GUX A;  2RB7 A;  2YNE A;  3HLP A;  4R87 A;  4UF4 A;  5LYF A;  4OAD A;  2YNC C;  3RNZ A;  2PJC A;  2REF A;  2ZED A;  2BL1 A;  2HB6 A;  3FEE A;  4NEX A;  4PXE A;  4KLV A;  2CTC A;  2JDD A;  2JEW A;  4AB7 A;  8CPA A;  3K9U A;  2GAN A;  4AXV A;  3PB4 X;  5AG4 A;  4Y49 B;  1IY7 A;  3FMC A;  2JDC A;  3W91 A;  2Q4Z A;  5G1Z A;  4F9U A;  2FL4 A;  2PVW A;  4BBH A;  4YU9 A;  2CNM A;  4JLY A;  5IB9 A;  2WUU A;  4HNY B;  1CPX A;  1DTD A;  3B3T A;  1UFH A;  2GE3 A;  2ZEM A;  4P45 A;  4RI1 A;  2QEC A;  2AFU A;  4U5Y A;  4WJB A;  1Z8X A;  2C6G A;  2VBQ A;  4KSF A;  4XPK A;  4CYN A;  3FNC A;  3FF3 A;  4Q38 A;  2V8H A;  2OU2 A;  1S7K A;  2PVV A;  2WPW A;  2ZW4 A;  4R57 A;  1DE4 C;  5HVH A;  1TKH A;  1Q2C A;  2FXF A;  4R8F A;  5F09 A;  4JWP A;  4UWJ A;  4QBJ A;  4B14 A;  3S6K A;  3NH8 A;  2GU2 A;  5D29 A;  4C68 A;  1ELM P;  3D7F A;  2AJ6 A;  1OZP A;  3PBE A;  4MXU A;  3V8I A;  2J9A A;  4R3L A;  5DWN A;  1ZLH A;  2AFZ A;  3NE7 A;  1JWQ A;  4MFZ A;  5THW A;  1HEE A;  3RAM A;  3TO6 A;  1XMT A;  3S6F A;  5JQ4 A;  3MN8 A;  3G8W A;  3LAC A;  2EUI A;  3CPX A;  4OC3 A;  2Y0M A;  4XPD B;  2CXA A;  5IB0 A;  5LYI A;  4A38 A;  1YQE A;  5D8N A;  4ZI6 A;  4KUA A;  2PJ7 A;  3K2K A;  1WK4 A;  2HC9 A;  4UEE A;  4KOR A;  3TO7 A;  2Q4Y A;  3CZX A;  2J8M A;  2PJ0 A;  4QB9 A;  4MI4 A;  3RO0 A;  1QSM A;  4UCP A;  1HDQ A;  3WC7 A;  4DYO A;  3DGV A;  2P6E A;  2ZW6 A;  4MY3 A;  1XFO A;  3B2Y A;  5C88 A;  4KSI A;  2F5I A;  2FE7 A;  3PBB A;  2ZEF A;  3NH5 A;  4BD9 A;  2B4D B;  2PJA A;  5H86 A;  4A30 A;  2V77 A;  4MRI A;  3T9Y A;  4GM5 A;  4KOX A;  2ODF A;  4KOY A;  4NGQ A;  3WR7 A;  3VAT A;  3EY5 A;  4B13 A;  1Z2L A;  2R8V A;  2B3V A;  4CS0 B;  3PEI A;  2X7B A;  4OLL A;  1B87 A;  3D7D A;  2PJ1 A;  4PV6 A;  4CPA A;  2PJ4 A;  5F46 A;  1FNO A;  1MK4 A;  3H8E A;  1OBR A;  1Y0R A;  3SXO A;  4UWI A;  3IGR A;  2Q7B A;  2OB0 A;  2G3T A;  4MFP A;  4OC1 A;  2VZY A;  3DSB A;  3DDD A;  4KVX A;  2O53 A;  3VH9 A;  2P6F A;  3WT4 A;  4LX9 A;  1F2P A;  1ZLI A;  4X5K A;  1VGY A;  4MFL A;  5I0C A;  2B5G B;  3FRM A;  3R9G A;  2AFO A;  3D66 A;  3QNV A;  2AFM A;  2BCO A;  1LAM A;  1F2O A;  2EK8 A;  4Q36 A;  2Q7S A;  4AVA A;  4HNX B;  2J8N A;  3S6G A;  3EO4 A;  4FD6 A;  4P4B A;  4OME A;  4J3G A;  1EE3 P;  2FS5 A;  2O4H A;  2ZPA A;  3IJ3 A;  3GY9 A;  4NGM A;  4F0X A;  4NGN A;  1XIX A;  2WZN A;  4YGO A;  4R9M A;  1RXT A;  2Q43 A;  5AG6 A;  1X12 A;  4E8O A;  4YWY A;  4CRY B;  3TOA A;  5A27 A;  4B6Z A;  2WPX A;  3WAB A;  1VHO A;  5HVF A;  4P4D A;  3S6H A;  5G20 A;  4M6I A;  1YK3 A;  3R95 A;  3T8W A;  4R76 A;  2D4O A;  3SI0 A;  2C1C A;  3ZJ0 A;  2DF5 A;  4FD5 A;  4MCP A;  3IC1 A;  4UFV A;  3SJF A;  1VHS A;  3D2M A;  2B4B A;  1PUA A;  2PJ3 A;  4TWE A;  5JGF A;  4P4F A;  1FT7 A;  4PK3 A;  3D67 A;  2OZU A;  4R7M A;  1N71 A;  3S9L A;  2OZH A;  3CXS A;  1XF8 A;  3D4U A;  4FWU A;  4UCM A;  4QVT A;  6CPA A;  2GRE A;  4NGP A;  1IYK A;  3D8P A;  3B7I A;  3SI1 A;  2O28 A;  2EWB A;  3CPA A;  5IX3 A;  4FD7 A;  3H5Z A;  3MRU A;  2ZEN A;  3FXT A;  3EFA A;  5CNP A;  3JTK A;  1S5K A;  1YSJ A;  3IWG A;  2YGW A;  2PR1 A;  3F0A A;  4GS4 A;  4CYO A;  2BOA A;  2PDO A;  3PP9 A;  1PYT B;  2WYR A;  3FED A;  1HDU A;  1U6M A;  1M44 A;  3D7H A;  3KHZ A;  3KR4 A;  4II9 A;  3NA6 A;  5LRK A;  1YW6 A;  3TE4 A;  1YVK A;  4A37 A;  2GLF A;  1VHE A;  4EVY A;  4AG9 A;  4KOS A;  1KZF A;  2ATR A;  1K4J A;  4HPS A;  4DNC A;  3JVN A;  3D7G A;  1Y0Y A;  5EMI A;  5LYD A;  4MFQ A;  5JPH A;  2P6G A;  4CAF A;  2HV2 A;  3B3S A;  4RUH A;  4R6T A;  3TCV A;  2POK A;  5A28 A;  1QMU A;  2PIZ A;  3GKR A;  2G9D A;  1P0H A;  3IU2 A;  3HUV A;  3VWE A;  2ZXV A;  3MGD A;  1Y7E A;  3IWE A;  4MHN A;  2AFX A;  2DEA A;  3P2F A;  4M6H A;  2ZEP A;  4LQG A;  1XBU A;  3ISX A;  5KTC A;  4NF1 A;  1KWM A;  1IGB A;  2CTB A;  3RYO A;  3FB3 A;  4E2A A;  5F49 A;  1MJ9 A;  5J8F A;  1IB1 E;  3BJ8 A;  3SHP A;  4MHY A;  1XOV A;  2Z3N A;  3S9M A;  4HKF A;  4CAV A;  2CY2 A;  4KS9 A;  2XEI A;  3H8G A;  4P4J A;  2GLJ A;  3IFE A;  4XNH C;  2ZEE A;  3I9S A;  2Z0Z A;  2VQY A;  3KZW A;  2YND A;  2Z3P A;  4C2Y A;  4EME A;  1CPS A;  3IEH A;  2H5M A;  3RZA A;  2ZW5 A;  4MFJ A;  4NSQ A;  3UY5 A;  2CNS A;  3JRU A;  4UIA A;  2Z3L A;  1BLL E;  3GLJ A;  4H2K A;  2C27 A;  4OKO A;  2Q0Y A;  4IK2 A;  2PSW A;  4PPZ A;  5ELY A;  4DJL A;  1AMP A;  2WSA A;  1IIC A;  3BXM A;  1VKC A;  4CGL A;  4NFR A;  1Z8W A;  1CP6 A;  5K8P A;  3FJU A;  4Y49 C;  1L0C A;  3A9L A;  1I12 A;  1LCP A;  4U9Z A;  4XPL A;  1GHE A;  2PC1 A;  4B12 A;  4F8Z A;  1P4N A;  7CPA A;  1IOI A;  2EO8 A;  4MJ8 A;  3D68 A;  1RO5 A;  2FSR A;  4PK2 A;  3DR6 A;  3I3G A;  5E96 A;  2Q44 A;  3FVL A;  3TOB A;  2CIJ A;  3FYN A;  4X3R A;  2FT0 A;  4OC2 A;  4Q7A A;  2JLM A;  4W9Y A;  2R98 A;  3GYA A;  3S9N A;  4CGM A;  1BPN A;  4NGT A;  2XEG A;  4IUS A;  4M85 A;  4K30 A;  2VXK A;  1CG2 A;  1MJB A;  2Z3O A;  1QSN A;  3PB6 X;  2C6C A;  2NSM A;  2HUZ A;  4C7I A;  1BAV A;  1TKJ A;  3B3W A;  4OC5 A;  3B3C A;  4WWV A;  5K8O A;  2PRQ A;  4TNU A;  5K8N A;  4P10 A;  4BMH A;  2IL4 A;  2PRB A;  3ZZI A;  1YME A;  4NJR A;  5HMN A;  3CT9 A;  4B5P A;  1S60 A;  2ZEL A;  1M4L A;  4R3K A;  1PU9 A;  3TFY A;  1CP7 A;  1R3N A;  3QAH A;  1LAN A;  2Q4V A;  1LOK A;  4LUA A;  4UFX A;  4NCZ A;  3TO9 A;  2QJ8 A;  2B4D A;  1GYT A;  4CYP A;  1Z8T A;  3KQX A;  2EBJ A;  2FIW A;  2IQ6 A;  4KUB A;  3TX8 A;  2I00 A;  2NYQ A;  4L89 A;  4ONW A;  5J1Q A;  1RTQ A;  5H84 A;  1NMT A;  1PCA A;  4CGN A;  2B3U A;  1R43 A;  2FVG A;  3C26 A;  1S7N A;  4X2T A;  2PJ5 A;  3D2P A;  1YLO A;  4AG7 A;  3JUW A;  5EC4 A;  4UFW A;  1Z5R A;  1YLE A;  3VWD A;  4Z65 A;  2VL1 A;  1TIQ A;  3TC8 A;  2V8V A;  2D4P A;  3VAR A;  2Z10 A;  4BIN A;  4FBE A;  4KOW A;  1S7L A;  1JQG A;  4ZX9 A;  2QYV A;  4PXD A;  3WC5 A;  4ZX8 A;  3PB8 X;  3PZJ A;  1XJO A;  1TF9 A;  1S7F A;  2Z3M A;  4KOT A;  3PFO A;  4QC6 A;  1Q7L A;  2IJZ A;  4CAE A;  3BI1 A;  1ZG7 A;  2QIR A;  2EVN A;  4MFK A;  4UBR A;  1Z4E A;  4G1P A;  3N5F A;  5JH9 A;  1SQH A;  3KGQ A;  2FCK A;  4A95 A;  4IAV A;  2ZOG A;  4KVO E;  4OC4 A;  2PJ2 A;  5J8C A;  1BO4 A;  2IMO A;  4M6G A;  1Y9W A;  1QST A;  3KL9 A;  5JM6 A;  2XEF A;  4MY0 A;  3CXP A;  4NJQ A;  3SXN A;  4X8I A;  3KHX A;  2PQ8 A;  1M4D A;  1YR0 A;  2PJ9 A;  3PB7 X;  1CM0 A;  4KSA A;  2ABZ A;  4QUS A;  4CGP A;  3KAS A;  1YX0 A;  1Y7R A;  4JD6 A;  1VIX A;  3EC4 A;  5KTA A;  3W6X A;  2ZW7 A;  3V7Z A;  4MHP A;  4NXY A;  5AG5 A;  1XE4 A;  1MJA A;  2BSW A;  3GB0 A;  5LRJ A;  5CPA A;  1Y9K A;  5G21 A;  4EWT A;  1ON0 A;  2AE6 A;  3DR8 A;  4O23 A;  1YGH A;  3B3V A;  3LD2 A;  2C6P A;  2F8H A;  3B8G A;  4H89 A;  4P4E A;  3LOD A;  4A33 A;  4L8A A;  1M4G A;  1QSR A;  4MHD A;  1AUG A;  3BLN A;  3I1U A;  4MCS A;  2J8R A;  4UA3 A;  3LWU A;  5AG7 A;  4NGR A;  3PB9 X;  1I1D A;  1IU8 A;  4OAE A;  5LYL A;  5HVG A;  4KOV A;  4MMO A;  3H4Q A;  4AVB A;  4OID A;  2PCU A;  5IV0 A;  2NMT A;  3BI0 A;  1CBX A;  5C82 A;  2AFW A;  2PR8 A;  4PXC A;  3W6S A;  4E0A A;  1XEB A;  5AGE A;  5EBV A;  1KUY A;  2DXQ A;  2EK9 A;  1YW4 A;  5K8M A;  3KQZ A;  2KCW A;  3FBU A;  1Z8L A;  2REE A;  4P6Y A;  1ZG9 A;  1CX8 A;  1XRY A;  2Z11 A;  4B10 A;  4OC0 A;  2PJB A;  3FX6 A;  1V0C A;  3IWW A;  3KR5 A;  3L2N A;  1KUV A;  4CRZ B;  1ARL A;  3E0K A;  3GIU A;  1AYE A;  3N7Z A;  2XEJ A;  2ZEH A;  4FUU A;  5DS0 A;  5G22 A;  5DWM A;  4C2Z A;  2CF4 A;  2GFQ A;  1XMB A;  4M3S A;  4NGS A;  4ZBG A;  4C7H A;  1BPM A;  4HNW B;  2DPS A;  4F6A A;  2CNT A;  3PFE A;  3CDX A;  3LMS A;  4A32 A;  1NSA A;  2QML A;  1Z9U A;  3NFZ A;  4A31 A;  2JBJ A;  2VZZ A;  2PJ8 A;  2BEI A;  3P2H A;  4UEZ A;  2B58 A;  2Q04 A;  4GXH A;  3FH4 A;  4UIB A;  3B35 A;  4F9V A;  3IO1 A;  3KI9 A;  4IHM A;  1A2Z A;  5FVJ A;  1J4J A;  1TXR A;  2BO9 A;  2G0B A;  4MCR A;  3IU1 A;  4FAI A;  4B5P B;  2P0W A;  4AVC A;  1BOB A;  2OZG A;  2ARH A;  3G3S A;  2V8D A;  4CAX A;  2RC4 A;  4PXB A;  1H8L A;  3TT2 A;  2ZEG A;  4CAW A;  2ZOF A;  1CJW A;  1QQ9 A;  5ISV A;  1IOF A;  4PSX A;  2HQY A;  3BJ7 A;  1M1D A;  3D3S A;  4I49 A;  5LRG A;  5F48 A;  4A2Z A;  2R7H A;  2VI7 A;  4IF5 A;  3T90 A;  1I21 A;  1ARM A;  3K9T A;  4RS2 A;  3KKW A;  1UWY A;  4KOU A;  3PGP A;  1IID A;  3R1K A;  3SJE A;  2I3C A;  2JEV A;  2OH1 A;  2PE3 A;  2R1I A;  3FEC A;  3SI2 A;  1M4I A;  4JYW A;  3DLJ A;  2AFS A;  3R9E A;  2F7V A;  3NE8 A;  4JZ0 A;  1YRE A;  1ZO0 A;  4MCQ A;  4C2X A;  2Q51 A;  3SJX A;  4F0Y A;  4YRH A;  4MHZ A;  4XPD C;  5BWA B;  4KZT A;  1TKF A;  2G3A A;  3QAY A;  4K3N A;  2I79 A;  1KUX A;  4KVM E;  4FD4 A;  5HH1 A;  4ZGY B;  3PRT A;  2OR4 A;  1TF8 A;  4JJX A;  3DNS A;  3NH4 A;  4A94 A;  4B11 A;  5HXD A;  4MBU A;  4CYQ A;  4JXQ A;  4UCN A;  3R9F A;  4PQA A;  1FY7 A;  2DPT A;  2PJ6 A;  1WWZ A;  2BUE A;  3CXQ A;  3BHX A;  4ONU A;  3R96 A;  4RN7 A;  3OWC A;  2ANP A;  2VEZ A;  1NSL A;  1Z4R A;  4H6Z A;  1Q2D A;  3ISZ A;  4JXR A;  1X10 A;  2JBK A;  2PIY A;  4OIW A; 
#chains in the Genus database with same CATH homology
 1IYL A;  1Q2Y A;  2B5G A;  2Z3K A;  2A4N A;  4CGO A;  3F8K A;  1NE9 A;  4PSW A;  4U9Y A;  3QB8 A;  4KLW A;  2GIV A;  4ORF A;  3EXN A;  2K5T A;  5GCN A;  3FIX A;  1LRZ A;  1R57 A;  1QSO A;  4B5O A;  1YVO A;  2YNC A;  5F47 A;  4XNH B;  2FIA A;  1B6B A;  3F5B A;  4YFJ A;  5KTD A;  1S3Z A;  4H6U A;  3TTH A;  2YNE A;  4R87 A;  4OAD A;  2YNC C;  2REF A;  4NEX A;  2BL1 A;  4KLV A;  2JDD A;  4AB7 A;  3K9U A;  2GAN A;  5AG4 A;  4Y49 B;  2JDC A;  3W91 A;  5G1Z A;  2FL4 A;  4BBH A;  2CNM A;  4JLY A;  2WUU A;  4HNY B;  5KTC A;  4RI1 A;  1UFH A;  2GE3 A;  2QEC A;  4U5Y A;  4XPK A;  4CYN A;  4KSF A;  2VBQ A;  3FNC A;  4Q38 A;  2OU2 A;  1S7K A;  4R57 A;  2WPW A;  2ZW4 A;  1Q2C A;  2FXF A;  4JWP A;  4UWJ A;  4QBJ A;  4B14 A;  3S6K A;  4C68 A;  2AJ6 A;  1OZP A;  3V8I A;  4R3L A;  5DWN A;  3NE7 A;  4MFZ A;  5JQ4 A;  3TO6 A;  1XMT A;  3S6F A;  3G8W A;  2EUI A;  2Y0M A;  4XPD B;  2CXA A;  5IB0 A;  4KUA A;  1WK4 A;  4KOR A;  3TO7 A;  2Q4Y A;  2J8M A;  4QB9 A;  4MI4 A;  1QSM A;  4UCP A;  2P6E A;  2ZW6 A;  4MY3 A;  5C88 A;  2F5I A;  2FE7 A;  2B4D B;  5H86 A;  4A30 A;  3T9Y A;  4KOX A;  4KOY A;  3WR7 A;  4B13 A;  3EY5 A;  2R8V A;  2B3V A;  4CS0 B;  2X7B A;  4OLL A;  1B87 A;  4PV6 A;  5F46 A;  1MK4 A;  3SXO A;  4UWI A;  3IGR A;  2Q7B A;  2OB0 A;  2G3T A;  4MFP A;  2VZY A;  3DSB A;  3DDD A;  4KVX A;  2P6F A;  4LX9 A;  4X5K A;  4MFL A;  5I0C A;  2B5G B;  3FRM A;  3R9G A;  4Q36 A;  4AVA A;  4HNX B;  2J8N A;  3S6G A;  3EO4 A;  4FD6 A;  4J3G A;  2FS5 A;  2ZPA A;  4F0X A;  3GY9 A;  1XIX A;  4YGO A;  4R9M A;  1RXT A;  5AG6 A;  4E8O A;  4CRY B;  5A27 A;  3TOA A;  2WPX A;  3S6H A;  5G20 A;  3R95 A;  1YK3 A;  2D4O A;  3ZJ0 A;  4FD5 A;  4UFV A;  1VHS A;  3D2M A;  2B4B A;  1PUA A;  4PK3 A;  2OZU A;  1N71 A;  2OZH A;  3CXS A;  1XF8 A;  4UCM A;  4QVT A;  1IYK A;  3D8P A;  5IX3 A;  2O28 A;  4FD7 A;  3H5Z A;  3FXT A;  3EFA A;  5CNP A;  3JTK A;  1S5K A;  3IWG A;  2YGW A;  2PR1 A;  3F0A A;  4GS4 A;  4CYO A;  2PDO A;  3PP9 A;  1U6M A;  1M44 A;  4II9 A;  3TE4 A;  1YVK A;  4EVY A;  4AG9 A;  4KOS A;  1KZF A;  2ATR A;  1K4J A;  4DNC A;  3JVN A;  4MFQ A;  5JPH A;  2P6G A;  4CAF A;  2HV2 A;  3TCV A;  5A28 A;  3GKR A;  1P0H A;  3IU2 A;  3VWE A;  2ZXV A;  3MGD A;  3IWE A;  3P2F A;  4NF1 A;  4E2A A;  3RYO A;  3FB3 A;  5F49 A;  1MJ9 A;  5J8F A;  1IB1 E;  3BJ8 A;  3SHP A;  2Z3N A;  4HKF A;  4CAV A;  2CY2 A;  4KS9 A;  4XNH C;  3I9S A;  2Z0Z A;  2VQY A;  2YND A;  2Z3P A;  4C2Y A;  2H5M A;  2ZW5 A;  4MFJ A;  4NSQ A;  3UY5 A;  2CNS A;  2Z3L A;  2C27 A;  2Q0Y A;  2PSW A;  2WSA A;  1IIC A;  4CGL A;  1VKC A;  4Y49 C;  1L0C A;  3A9L A;  1I12 A;  4U9Z A;  4XPL A;  4B12 A;  1GHE A;  2PC1 A;  1P4N A;  4MJ8 A;  1RO5 A;  2FSR A;  4PK2 A;  3DR6 A;  3I3G A;  5E96 A;  2Q44 A;  3TOB A;  3FYN A;  2FT0 A;  2JLM A;  2R98 A;  3GYA A;  4CGM A;  4IUS A;  4M85 A;  4K30 A;  2VXK A;  1MJB A;  2Z3O A;  1QSN A;  2HUZ A;  4C7I A;  4BMH A;  2IL4 A;  2PRB A;  3ZZI A;  5HMN A;  4B5P A;  1S60 A;  4R3K A;  1PU9 A;  3TFY A;  3QAH A;  2Q4V A;  4LUA A;  4UFX A;  4NCZ A;  3TO9 A;  2B4D A;  4CYP A;  2FIW A;  4KUB A;  2I00 A;  4L89 A;  5H84 A;  1NMT A;  4CGN A;  2B3U A;  3C26 A;  1S7N A;  4AG7 A;  3D2P A;  3JUW A;  5EC4 A;  4UFW A;  1YLE A;  3VWD A;  1TIQ A;  2D4P A;  2Z10 A;  4KOW A;  1S7L A;  3PZJ A;  2Z3M A;  1S7F A;  4KOT A;  4QC6 A;  4CAE A;  2QIR A;  2EVN A;  4MFK A;  4UBR A;  1Z4E A;  1SQH A;  2FCK A;  4A95 A;  4KVO E;  5J8C A;  1BO4 A;  1Y9W A;  1QST A;  3CXP A;  3SXN A;  2PQ8 A;  1M4D A;  1YR0 A;  1CM0 A;  4KSA A;  4QUS A;  4CGP A;  1YX0 A;  4JD6 A;  1Y7R A;  3EC4 A;  5KTA A;  3W6X A;  2ZW7 A;  4NXY A;  5AG5 A;  1XE4 A;  1MJA A;  2BSW A;  1Y9K A;  5G21 A;  1ON0 A;  2AE6 A;  3DR8 A;  1YGH A;  3LD2 A;  4H89 A;  3B8G A;  3LOD A;  4A33 A;  4L8A A;  1M4G A;  1QSR A;  4MHD A;  5AG7 A;  3BLN A;  2J8R A;  4UA3 A;  1I1D A;  4OAE A;  4KOV A;  3H4Q A;  4AVB A;  2NMT A;  5C82 A;  2PR8 A;  3W6S A;  4E0A A;  1XEB A;  5AGE A;  5EBV A;  1KUY A;  2DXQ A;  2KCW A;  3FBU A;  2REE A;  2Z11 A;  4B10 A;  4CRZ B;  1V0C A;  1KUV A;  3E0K A;  3N7Z A;  5G22 A;  5DWM A;  4C2Z A;  4M3S A;  4C7H A;  4ZBG A;  4HNW B;  2DPS A;  4F6A A;  2CNT A;  4A32 A;  2QML A;  1Z9U A;  4A31 A;  2VZZ A;  2BEI A;  3P2H A;  2B58 A;  2Q04 A;  5FVJ A;  1J4J A;  2G0B A;  3IU1 A;  4B5P B;  2P0W A;  4AVC A;  1BOB A;  2OZG A;  2ARH A;  3G3S A;  4CAX A;  2RC4 A;  3TT2 A;  4CAW A;  5ISV A;  1CJW A;  4PSX A;  2HQY A;  3BJ7 A;  1M1D A;  3D3S A;  4I49 A;  5F48 A;  4A2Z A;  2R7H A;  2VI7 A;  4IF5 A;  3T90 A;  1I21 A;  4RS2 A;  3KKW A;  4KOU A;  3PGP A;  1IID A;  3R1K A;  2JEV A;  2OH1 A;  2R1I A;  1M4I A;  3R9E A;  4C2X A;  1YRE A;  1ZO0 A;  4F0Y A;  4YRH A;  4XPD C;  5BWA B;  4KZT A;  2G3A A;  2I79 A;  1KUX A;  4KVM E;  4FD4 A;  5HH1 A;  4ZGY B;  4JJX A;  3DNS A;  4B11 A;  4MBU A;  4CYQ A;  4JXQ A;  4UCN A;  3R9F A;  1FY7 A;  2DPT A;  4ONU A;  1WWZ A;  2BUE A;  3CXQ A;  3R96 A;  3OWC A;  2VEZ A;  1NSL A;  1Z4R A;  4H6Z A;  1Q2D A;  4JXR A;  4MY0 A;  5IV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...