1S3ZA

Aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and ribostamycin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
147
structure length
147
Chain Sequence
SHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aminoglycoside 6'-N-acetyltransferase
publication title A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
pubmed doi rcsb
source organism Salmonella enteritidis
total genus 41
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2004-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s3zA00
4XPLA 3D2MA 1IB1E 2CNTA 2G3AA 4YGOA 2ARHA 2Q4YA 5FVJA 4NCZA 2AE6A 1U6MA 2Q0YA 5F46A 5DWMA 4AG7A 1YVOA 2BL1A 2FXFA 4MY3A 3CXPA 1BO4A 2A4NA 2PC1A 3EFAA 4KUBA 1XMTA 3SXNA 2Z10A 1ON0A 1QSOA 1YLEA 4YFJA 1OZPA 1KUYA 2DXQA 5IX3A 2P0WA 4FD7A 1P4NA 3JUWA 1L0CA 3EXNA 3E0KA 1XF8A 1IICA 2VEZA 4KOUA 3JVNA 2P6GA 1QSNA 4R57A 4AG9A 3PGPA 4UWIA 3PZJA 2VQYA 3I9SA 3TT2A 5EBVA 3W91A 4ZBGA 4Y49B 4I49A 4GS4A 5ISVA 4YRHA 4XPDC 1UFHA 4FD6A 4AVBA 2R98A 3T9YA 3C26A 1RXTA 5C88A 2P6EA 3V8IA 1J4JA 2GANA 4IUSA 2KCWA 4KOWA 5HMNA 1BOBA 2P6FA 1M4IA 3W6SA 2VZYA 3DNSA 1YVKA 3R96A 1IYLA 4B5PB 1Z4RA 4XPKA 2OB0A 2ATRA 1M44A 4OADA 2H5MA 3TE4A 3FNCA 3NE7A 3G8WA 2VBQA 5CNPA 2B5GA 4QBJA 5KTDA 2OU2A 2JEVA 3KKWA 3WR7A 2VZZA 3IGRA 4JLYA 1NMTA 2D4OA 1K4JA 4HNWB 4KZTA 2B3VA 2FIAA 3TO6A 3OWCA 4ORFA 1GHEA 2PQ8A 2X7BA 1Y9KA 4F0YA 3F0AA 2ZW5A 1MK4A 3S6GA 4M85A 2BUEA 4PK2A 5GCNA 2BEIA 4JD6A 4NF1A 1QSTA 4PSXA 4NSQA 3TCVA 2OH1A 3QAHA 4HNXB 3TFYA 1Q2DA 1KUXA 2OZGA 3EY5A 2NMTA 3S6HA 4L89A 4KOSA 2O28A 3LD2A 5HH1A 3IWGA 4CAXA 3H4QA 3DDDA 1Y7RA 4DNCA 2CNSA 4XPDB 2FE7A 2I79A 2REFA 3DR8A 4MHDA 5JPHA 3BJ8A 1I12A 1MJBA 4MJ8A 1S3ZA 1N71A 1Z4EA 2J8NA 1QSMA 2HV2A 5H86A 3R1KA 4MI4A 4UA3A 1Y9WA 1XE4A 2REEA 2B5GB 2PR1A 1S7LA 2G3TA 4R87A 4EVYA 4MBUA 1M4DA 4XNHB 3DSBA 4UBRA 2PSWA 1XEBA 4CRYB 4E2AA 1MJ9A 4JXQA 1KUVA 1CM0A 4KVXA 2FT0A 4B5OA 2HUZA 4E0AA 1R57A 5C82A 3FIXA 5E96A 3D2PA 5I0CA 4HNYB 1CJWA 4AVCA 3F8KA 2Q7BA 3TOAA 2ZW7A 3B8GA 1WWZA 1NE9A 5F49A 2PR8A 2B58A 4QB9A 1Q2CA 2B4DB 3CXQA 2Z11A 5IB0A 4H6ZA 2B3UA 4PSWA 2JLMA 3EC4A 2J8MA 2I00A 3FRMA 1IYKA 4KOTA 3TO7A 2GIVA 2WPWA 5J8CA 1S7FA 3D8PA 4FD5A 2QIRA 2WPXA 4Y49C 1I1DA 2FIWA 2FL4A 4KLWA 3D3SA 1PUAA 3PP9A 4KOXA 2CNMA 2GE3A 4R3KA 4AVAA 1YGHA 3GYAA 2JDCA 3S6FA 3FYNA 4HKFA 3VWDA 3QB8A 3T90A 4KVOE 3BJ7A 4NXYA 5F48A 2PRBA 5IV0A 4PK3A 4L8AA 3R9EA 3BLNA 3R95A 4KVME 2PDOA 4RS2A 1V0CA 1XIXA 4RI1A 1KZFA 2R1IA 4OLLA 3P2HA 2OZHA 2QMLA 2F5IA 1Q2YA 5F47A 2Q4VA 2RC4A 1B6BA 4X5KA 3TTHA 3ZJ0A 1S7NA 4H6UA 4J3GA 4JWPA 1YREA 3LODA 4KOVA 5DWNA 2AJ6A 1YK3A 1YR0A 3ZZIA 1M1DA 3S6KA 2B4BA 2ZXVA 1PU9A 4LUAA 4KLVA 2R8VA 2C27A 3K9UA 3P2FA 4ONUA 5J8FA 3EO4A 1IIDA 4R9MA 4FD4A 1P0HA 5KTAA 1S5KA 3I3GA 2K5TA 3GY9A 4KORA 4PV6A 1SQHA 1B87A 2VI7A 3F5BA 3SXOA 5H84A 2EVNA 4CAWA 2ZW4A 4QVTA 1TIQA 4LX9A 2QECA 2VXKA 3R9GA 2JDDA 3GKRA 1RO5A 5EC4A 2OZUA 1WK4A 4OAEA 2HQYA 1M4GA 4E8OA 4K30A 2D4PA 4M3SA 2R7HA 3R9FA 5JQ4A 3G3SA 2EUIA 1VHSA 4CAVA 1S60A 1VKCA 2Z0ZA 1NSLA 2Y0MA 1Z9UA 2Q04A 1FY7A 4AB7A 1YX0A 3N7ZA 4U9ZA 5KTCA 4KUAA 2FCKA 3DR6A 4IF5A 4MY0A 3FB3A 1MJAA 3CXSA 1I21A 2CY2A 4II9A 4H89A 4U5YA 4JXRA 4XNHC 3RYOA 3UY5A 3SHPA 3FBUA 4F6AA 2FSRA 2J8RA 2FS5A 3VWEA 4R3LA 3TO9A 4U9YA 4QUSA 4NEXA 3FXTA 2Q44A 4UWJA 2ZW6A 4KOYA 4QC6A 2BSWA 1S7KA 2IL4A 3W6XA 4B5PA 4CS0B 4BMHA 3MGDA 3TOBA 2B4DA 1LRZA 1QSRA 2G0BA 2ZPAA 4CRZB 4JJXA
chains in the Genus database with same CATH superfamily
1Y7EA 4XPLA 2ZEGA 3D2MA 1IB1E 2CNTA 2G3AA 2PJ6A 4YGOA 2ARHA 1F2PA 2Q4YA 5FVJA 3FF3A 4MFPA 4NCZA 4UEZA 2NSMA 2AE6A 1U6MA 2Q0YA 5F46A 3QAYA 4TNUA 5DWMA 5AG5A 2FXFA 1YVOA 2BL1A 2ZEDA 4AG7A 4MY3A 3CXPA 5EMIA 1BO4A 3D7HA 4Z65A 1HEEA 2PJBA 2A4NA 2PC1A 3EFAA 4KUBA 4WWVA 4NGSA 1XMTA 3SJEA 3TX8A 1BPNA 3DLJA 1R43A 3KASA 4Q38A 4NJQA 3SXNA 6CPAA 2PJAA 2Z10A 1ON0A 4MXUA 1QSOA 4H2KA 4X3RA 1YLEA 1XRYA 4YFJA 1OZPA 4A38A 1KUYA 2DXQA 3FX6A 5IX3A 4FWUA 4WJBA 3WT4A 1FT7A 5K8OA 3RO0A 3CT9A 2P0WA 1XBUA 4OC1A 3H8FA 4FD7A 1P4NA 4KS9A 2AFXA 2WUUA 3JUWA 3KHZA 3K2KA 4CGLA 1L0CA 3EXNA 5JH9A 3E0KA 2ZEHA 1XF8A 1HDUA 1IICA 3KR5A 2AFSA 1LAMA 3VH9A 2ABZA 2VEZA 1TKHA 3KI9A 5G1ZA 4KOUA 2Q51A 4A37A 3JVNA 4EWTA 2P6GA 3CPAA 1QSNA 4GXHA 1LCPA 4R57A 4AG9A 3PGPA 4Q7AA 3PZJA 2VQYA 4UWIA 1ELLP 1ZO0A 4CYPA 2XEJA 4CGPA 1ZLHA 3I9SA 3TT2A 4OC2A 5EBVA 3W91A 4ZBGA 4Y49B 4I49A 5IB9A 4GS4A 5ISVA 4B11A 4UIBA 4YRHA 4XPDC 4EMEA 2ODFA 1UFHA 4YU9A 4FD6A 4AVBA 1ZG9A 4CPAA 2R98A 3T9YA 3C26A 1RXTA 4C7HA 3D67A 5C88A 2P6EA 1Q7LA 2V8HA 5AG7A 4A95A 4MCQA 4GM5A 1J4JA 2GANA 4IUSA 2KCWA 4KOWA 3V8IA 5HMNA 1ARMA 1BOBA 2P6FA 3BI0A 1M4IA 4CYQA 1TF8A 4ZI6A 4CYNA 3W6SA 4BINA 2VZYA 3DNSA 1GYTA 1X12A 1R3NA 1YVKA 3R96A 2GLFA 5D29A 2F8HA 1IYLA 3D66A 4B5PB 1Z4RA 4A30A 4XPKA 2OB0A 1FNOA 2QVPA 4P4JA 3PBEA 2HC9A 2Q7SA 1YQEA 4RN7A 2ATRA 1ELMP 5THWA 1M44A 2JEWA 5AG4A 2C6CA 4OADA 2Q4ZA 4JYWA 2H5MA 1Z8XA 1VIXA 3TE4A 3FNCA 3NE7A 3G8WA 2Z3MA 2VBQA 5CNPA 2B5GA 4QBJA 5KTDA 3SJXA 2OU2A 4UCMA 2JEVA 2XEGA 2IJZA 1VHEA 3KKWA 2XEFA 3WR7A 4OKOA 2VZZA 4G1PA 3TC8A 4MRIA 1XMBA 3IGRA 3WC5A 1IU8A 2EWBA 4NGQA 2GREA 1A2ZA 3PB9X 3H5ZA 4JLYA 1NMTA 2D4OA 1K4JA 2EBJA 4HNWB 3B7IA 2DPTA 5G20A 3K9TA 4KZTA 1IOIA 2B3VA 2FIAA 5JM6A 3TO6A 3OWCA 5LYIA 4ORFA 1GHEA 2PQ8A 2X7BA 1Y9KA 2PIZA 1VHOA 3F0AA 1PCAA 2ZW5A 4NJRA 5LRGA 4F0YA 2DF5A 1MK4A 2EO8A 2AFOA 2Q43A 3B2YA 1YSJA 3S6GA 2HB6A 4M85A 4MFJA 1JQGA 2BUEA 2BO9A 2PJCA 4TWEA 4CAFA 4PK2A 5GCNA 2BEIA 4JD6A 1IGBA 4NF1A 1QSTA 2F7VA 4PSXA 4UEFA 1CP6A 2EK9A 3KR4A 1PYTB 4NSQA 2WSAA 3NH5A 4MCRA 3TCVA 4CYOA 4A31A 2OH1A 2PJ8A 4ZY1A 3CZXA 3IWWA 4UCNA 4OC4A 1YMEA 3QAHA 4HNXB 4FBEA 1Q2DA 3TFYA 1KUXA 2OZGA 2Z3OA 3B3CA 3EY5A 2NMTA 4JZ0A 3FVLA 4LQ6A 3S6HA 5K8PA 1VGYA 4L89A 1Z5RA 4YWYA 1KWMA 3KZWA 4KOSA 4R8FA 2CIJA 2FVGA 2O28A 3LD2A 5HH1A 1ZG7A 3IWGA 4CAXA 3H4QA 4DJLA 3DDDA 3IWEA 1Y7RA 2XEIA 4DNCA 2CNSA 3QNVA 4XPDB 2FE7A 2I79A 2REFA 3DR8A 2ZEEA 4MHDA 2QYVA 3IFEA 3PB4X 5JPHA 5D8NA 5LYFA 3BJ8A 3JRUA 1I12A 1MJBA 4OP4A 5G22A 2Z3LA 4MJ8A 2V8VA 4P6YA 2RB7A 1S3ZA 1N71A 1Z4EA 4F0XA 2J8NA 3D7GA 3H8GA 3IU2A 1QSMA 4JJXA 4UCPA 3VATA 2G9DA 1YW4A 1AMPA 1YW6A 2PVVA 2HV2A 3NA6A 3FEDA 5H86A 3R1KA 2YNEA 3RAMA 3KHXA 4MI4A 4MCSA 4UA3A 4X2TA 1Y0RA 1Y9WA 2AFUA 1XE4A 1Z8TA 4NGRA 2REEA 2B5GB 2PR1A 1S7LA 2G3TA 4R87A 3D7DA 4EVYA 4MBUA 5G21A 4B12A 1CBXA 1M4DA 4XNHB 5CBMA 3WC7A 4DYOA 2ZEMA 2C6PA 1RTQA 3DSBA 4C68A 4UBRA 2PSWA 1XEBA 4OC5A 4A39A 1MJ9A 1Z2LA 4JXQA 4CRYB 3D4UA 1KUVA 4E2AA 1CM0A 4UIAA 4KVXA 2FT0A 3B3WA 4B5OA 3D7FA 2HUZA 4PXDA 3KGQA 4E0AA 5DS0A 1R57A 5C82A 3FIXA 5E96A 3D2PA 5I0CA 2PJ2A 3FH4A 4HNYB 2ANPA 2WZNA 1AYEA 4NFRA 2BCOA 1CJWA 2YGWA 2ZELA 4AVCA 4BBHA 3CDXA 2V77A 3F8KA 1QMUA 2Q7BA 3TOAA 2ZW7A 3B8GA 1WWZA 2V8GA 3MRUA 1NE9A 5F49A 2PR8A 3LWUA 2B58A 4UF4A 4QB9A 5LRKA 1Q2CA 3KQZA 2B4DB 3CXQA 2ZEOA 3GIUA 2Z11A 2C6GA 3WC6A 4H6ZA 5IB0A 2QJ8A 2B3UA 4C2ZA 4PSWA 2JLMA 1BAVA 3EC4A 1JWQA 2I00A 2J8MA 4A33A 4MFLA 3FRMA 5LYLA 1IYKA 4MHYA 2V8DA 4CAEA 4KOTA 3TO7A 2Z3KA 2EK8A 2GIVA 2WPWA 4ZYQA 5J8CA 1S7FA 2PJ9A 4MCPA 3D8PA 5K8MA 4FD5A 2QIRA 4IK2A 2ZENA 2WPXA 4Y49C 5LRJA 1I1DA 2FIWA 2FL4A 2J9AA 2JBKA 4KLWA 3D3SA 1PUAA 3PP9A 3PRTA 2CNMA 4KOXA 4UFWA 2GE3A 4R3KA 1ZLIA 3SJFA 1YGHA 3GYAA 2JDCA 4AVAA 3NE8A 2POKA 3S6FA 3FYNA 5A27A 4HKFA 3VWDA 4IAVA 4W9YA 3QB8A 5CPAA 3T90A 3PB7X 4KVOE 4MHNA 4PXEA 3BHXA 1HDQA 3B3TA 3BJ7A 3ISXA 4NXYA 5F48A 2CF4A 3RBUA 4FAIA 2PRBA 5IV0A 4PK3A 3ISZA 4L8AA 3R9EA 3SI0A 4P4IA 3BLNA 4MHZA 4KVME 2PDOA 3L2NA 3R95A 2DEAA 5HVHA 3HLPA 2Z3NA 4RS2A 1V0CA 2IQ6A 1XIXA 3IEHA 3IO1A 1KZFA 4RI1A 2YNCC 4NGMA 2R1IA 4NGNA 4OLLA 4R6TA 3FMCA 1CPSA 2Z3PA 2GLJA 1IY7A 2CTCA 3P2HA 2OZHA 4MMOA 4P10A 3S9LA 4IHMA 2QMLA 2YNCA 3GUXA 2F5IA 1Q2YA 5F47A 2Q4VA 2RC4A 1B6BA 2DPSA 4X5KA 3TTHA 1LAPA 3ZJ0A 2I3CA 2CXAA 1CX8A 4KSFA 4P4DA 5K8NA 1S7NA 2AFMA 1NSAA 3HUVA 4H6UA 4J3GA 4JWPA 1YREA 3MN8A 2VL1A 5HXDA 3LODA 3PB6X 4KOVA 2AJ6A 5DWNA 2PCUA 1CPXA 4ONWA 4ZY0A 4P4BA 3V7ZA 4AXVA 1YK3A 1YR0A 2CTBA 4KSAA 1ARLA 1M1DA 3ZZIA 3S6KA 5I4MA 2PJ3A 4R7MA 4B13A 1Z8WA 1LOKA 2B4BA 2O4HA 2PVWA 2ZXVA 1PU9A 4ZX9A 4LUAA 1BLLE 8CPAA 2ZOGA 2PJ5A 3FEEA 4KLVA 2R8VA 2C27A 2NYQA 4BD9A 5JGFA 3K9UA 3PB8X 5ELYA 2BOAA 3A9LA 3P2FA 3PBBA 4ONUA 5J8FA 1F57A 1IIDA 2ZOFA 3EO4A 4FD4A 4R9MA 2OR4A 4A2ZA 4A94A 1P0HA 5KTAA 1S5KA 3I3GA 1EE3P 4M6GA 3WABA 2K5TA 1H8LA 3GY9A 4HPSA 4KORA 4DUKA 4MFKA 4O23A 3D68A 2PE3A 3S9NA 3PEIA 4PV6A 1SQHA 1B87A 3LMSA 4P45A 2VI7A 3F5BA 4PXCA 3SXOA 5H84A 2EVNA 4C7IA 4CAWA 2ZW4A 4UEEA 3IJ3A 4QVTA 3I1UA 1TIQA 2PJ0A 3IC1A 4LX9A 2QECA 2VXKA 1UWYA 3SI2A 3R9GA 1TXRA 2JDDA 2PRQA 1RO5A 3GKRA 3PFOA 2JBJA 5EC4A 4ZX8A 4CGOA 2OZUA 5HVGA 1Y0YA 4MHPA 1WK4A 3IIBA 4OAEA 2HQYA 4MFQA 2PJ7A 1M4GA 4M6HA 4UFXA 4F8ZA 4E8OA 4K30A 3FECA 4A32A 2D4PA 4M3SA 3GB0A 4B14A 2R7HA 4B6ZA 3N5FA 3R9FA 5JQ4A 2PJ1A 3G3SA 2EUIA 1VHSA 5HVFA 3FJUA 2ZEFA 1YLOA 4CAVA 1S60A 1VKCA 1CP7A 2Z0ZA 1NSLA 2Y0MA 1Z9UA 3VARA 2ZEPA 2Q04A 1FY7A 4X8IA 2AFZA 4CGMA 4AB7A 4OMEA 4PQAA 1YX0A 3KL9A 3IU1A 3N7ZA 4U9ZA 3S9MA 5KTCA 4KUAA 4MFZA 1DE4C 2FCKA 3DR6A 3GLJA 4C2YA 3KQXA 3NH8A 3JTKA 5AG6A 4F9UA 4IF5A 4P4FA 4MY0A 3RNZA 3FB3A 3T8WA 4P4EA 1MJAA 4FUUA 2GU2A 3CXSA 2IMOA 4OIDA 4ZGYB 4OC0A 2GFQA 5A28A 3SI1A 4OIWA 4K3NA 1I21A 2YNDA 3B3SA 4NGTA 3BXMA 1TKJA 3CPXA 2CY2A 3SJGA 4II9A 1ZG8A 1TKFA 4H89A 4U5YA 4JXRA 4XNHC 1QQ9A 3RYOA 3UY5A 3V38A 3SHPA 3FBUA 5F09A 1X10A 3NFZA 4F9VA 4F6AA 4Q36A 3H8EA 3B3VA 3PFEA 1XJOA 2FSRA 1LFWA 2FS5A 2J8RA 3VWEA 5BWAB 4R3LA 1BPMA 3TO9A 4M6IA 4U9YA 2AFWA 2O53A 3DGVA 4LQGA 4NGPA 2C1CA 4QUSA 4CGNA 4EFDA 4NEXA 3FXTA 2OOTA 1XFOA 2Q44A 7CPAA 2WYRA 2PIYA 4R76A 2RFHA 4KSIA 4RUHA 4UWJA 4B10A 2ZW6A 3B35A 1CG2A 4KOYA 4QC6A 2BSWA 1S7KA 5AGEA 4C2XA 2IL4A 1TF9A 4OC3A 3W6XA 1OBRA 4B5PA 1AUGA 4PPZA 2PJ4A 4UFVA 4CS0B 4P44A 4BMHA 4PXBA 5LYDA 3BI1A 3MGDA 1Z8LA 1IOFA 1M4LA 3RZAA 3TOBA 3NH4A 5J1QA 2B4DA 4ZY2A 1LANA 1LRZA 1DTDA 1QSRA 2G0BA 1XOVA 2ZPAA 4CRZB 3LACA 1F2OA
chains in the Genus database with same CATH topology
4XPLA 3D2MA 1IB1E 2CNTA 2G3AA 4YGOA 2ARHA 2Q4YA 5FVJA 4MFPA 4NCZA 2AE6A 1U6MA 2Q0YA 5F46A 5DWMA 5AG5A 1YVOA 2BL1A 2FXFA 4AG7A 4MY3A 3CXPA 1BO4A 2A4NA 2PC1A 3EFAA 4KUBA 1XMTA 4Q38A 3SXNA 2Z10A 1ON0A 1QSOA 1YLEA 4YFJA 1OZPA 1KUYA 2DXQA 5IX3A 2P0WA 4FD7A 1P4NA 4KS9A 2WUUA 4CGLA 3JUWA 1L0CA 3EXNA 3E0KA 1XF8A 1IICA 2VEZA 5G1ZA 4KOUA 3JVNA 2P6GA 1QSNA 4R57A 4AG9A 3PGPA 4UWIA 3PZJA 2VQYA 1ZO0A 4CYPA 4CGPA 3I9SA 3TT2A 5EBVA 3W91A 4ZBGA 4Y49B 4I49A 4GS4A 5ISVA 4B11A 4YRHA 4XPDC 1UFHA 4FD6A 4AVBA 2R98A 3T9YA 3C26A 1RXTA 4C7HA 5C88A 2P6EA 5AG7A 4A95A 3V8IA 1J4JA 2GANA 4IUSA 2KCWA 4KOWA 5HMNA 1BOBA 2P6FA 4CYQA 1M4IA 4CYNA 3W6SA 2VZYA 3DNSA 1YVKA 3R96A 1IYLA 4B5PB 1Z4RA 4A30A 4XPKA 2OB0A 2ATRA 1M44A 5AG4A 4OADA 2H5MA 3TE4A 3FNCA 3NE7A 3G8WA 2Z3MA 2VBQA 5CNPA 2B5GA 4QBJA 5KTDA 2OU2A 4UCMA 2JEVA 3KKWA 3WR7A 2VZZA 3IGRA 3H5ZA 4JLYA 1NMTA 2D4OA 1K4JA 4HNWB 2DPTA 5G20A 4KZTA 2B3VA 2FIAA 3TO6A 3OWCA 4ORFA 1GHEA 2PQ8A 2X7BA 1Y9KA 4F0YA 3F0AA 2ZW5A 1MK4A 3S6GA 4M85A 4MFJA 2BUEA 4CAFA 4PK2A 5GCNA 2BEIA 4JD6A 4NF1A 1QSTA 4PSXA 4NSQA 2WSAA 3TCVA 4CYOA 4A31A 2OH1A 4UCNA 3QAHA 4HNXB 3TFYA 1Q2DA 1KUXA 2OZGA 2Z3OA 3EY5A 2NMTA 3S6HA 4L89A 4KOSA 2O28A 3LD2A 5HH1A 3IWGA 4CAXA 3H4QA 3DDDA 3IWEA 1Y7RA 4DNCA 2CNSA 4XPDB 2FE7A 2I79A 2REFA 3DR8A 4MHDA 5JPHA 3BJ8A 1I12A 1MJBA 5G22A 2Z3LA 4MJ8A 1S3ZA 1N71A 1Z4EA 4F0XA 2J8NA 3IU2A 4UCPA 1QSMA 2HV2A 5H86A 3R1KA 2YNEA 4MI4A 4UA3A 1Y9WA 1XE4A 2REEA 2B5GB 2PR1A 1S7LA 2G3TA 4R87A 4EVYA 4MBUA 5G21A 4B12A 1M4DA 4XNHB 4C68A 3DSBA 4UBRA 2PSWA 1XEBA 4CRYB 4E2AA 1MJ9A 4JXQA 1KUVA 1CM0A 4KVXA 2FT0A 4B5OA 2HUZA 4E0AA 1R57A 5C82A 3FIXA 5E96A 3D2PA 5I0CA 4HNYB 1CJWA 2YGWA 4AVCA 4BBHA 3F8KA 2Q7BA 3TOAA 2ZW7A 3B8GA 1WWZA 1NE9A 5F49A 2PR8A 2B58A 4QB9A 1Q2CA 2B4DB 3CXQA 2Z11A 5IB0A 4H6ZA 4C2ZA 2B3UA 4PSWA 2JLMA 3EC4A 2J8MA 2I00A 4A33A 4MFLA 3FRMA 1IYKA 4CAEA 4KOTA 3TO7A 2Z3KA 2GIVA 2WPWA 5J8CA 1S7FA 3D8PA 4FD5A 2QIRA 2WPXA 4Y49C 1I1DA 2FIWA 2FL4A 4KLWA 3D3SA 1PUAA 3PP9A 4KOXA 2CNMA 4UFWA 2GE3A 4R3KA 4AVAA 1YGHA 3GYAA 2JDCA 3S6FA 3FYNA 5A27A 4HKFA 3VWDA 3QB8A 3T90A 4KVOE 3BJ7A 4NXYA 5F48A 2PRBA 5IV0A 4PK3A 4L8AA 3R9EA 3BLNA 3R95A 4KVME 2PDOA 2Z3NA 4RS2A 1V0CA 1XIXA 4RI1A 1KZFA 2YNCC 2R1IA 4OLLA 2Z3PA 3P2HA 2OZHA 2QMLA 2YNCA 2F5IA 1Q2YA 5F47A 2Q4VA 2RC4A 1B6BA 2DPSA 4X5KA 3TTHA 3ZJ0A 2CXAA 4KSFA 1S7NA 4H6UA 4J3GA 4JWPA 1YREA 3LODA 4KOVA 5DWNA 2AJ6A 1YK3A 1YR0A 4KSAA 3ZZIA 1M1DA 3S6KA 4B13A 2B4BA 2ZXVA 1PU9A 4LUAA 4KLVA 2R8VA 2C27A 3K9UA 3A9LA 3P2FA 4ONUA 5J8FA 3EO4A 1IIDA 4R9MA 4FD4A 4A2ZA 1P0HA 5KTAA 1S5KA 3I3GA 2K5TA 3GY9A 4KORA 4MFKA 4PV6A 1SQHA 1B87A 2VI7A 3F5BA 3SXOA 5H84A 2EVNA 4C7IA 4CAWA 2ZW4A 4QVTA 1TIQA 4LX9A 2QECA 2VXKA 3R9GA 2JDDA 3GKRA 4CGOA 1RO5A 5EC4A 2OZUA 1WK4A 4OAEA 2HQYA 4MFQA 1M4GA 4UFXA 4E8OA 4K30A 4A32A 2D4PA 4M3SA 4B14A 2R7HA 3R9FA 5JQ4A 3G3SA 2EUIA 1VHSA 4CAVA 1S60A 1VKCA 2Z0ZA 1NSLA 2Y0MA 1Z9UA 2Q04A 1FY7A 4CGMA 4AB7A 1YX0A 3IU1A 3N7ZA 4U9ZA 5KTCA 4KUAA 4MFZA 2FCKA 3DR6A 4C2YA 3JTKA 5AG6A 4IF5A 4MY0A 3FB3A 1MJAA 3CXSA 4ZGYB 5A28A 1I21A 2YNDA 2CY2A 4II9A 4H89A 4U5YA 4JXRA 4XNHC 3RYOA 3UY5A 3SHPA 3FBUA 4F6AA 4Q36A 2FSRA 2J8RA 2FS5A 3VWEA 5BWAB 4R3LA 3TO9A 4U9YA 4QUSA 4CGNA 4NEXA 3FXTA 2Q44A 4UWJA 4B10A 2ZW6A 4KOYA 4QC6A 5AGEA 2BSWA 1S7KA 4C2XA 2IL4A 3W6XA 4B5PA 4CS0B 4UFVA 4BMHA 3MGDA 3TOBA 2B4DA 1LRZA 1QSRA 2G0BA 2ZPAA 4CRZB 4JJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPL A;  3D2M A;  1IB1 E;  2CNT A;  2G3A A;  4YGO A;  2ARH A;  2Q4Y A;  5FVJ A;  4NCZ A;  2AE6 A;  1U6M A;  2Q0Y A;  5F46 A;  5DWM A;  4AG7 A;  1YVO A;  2BL1 A;  2FXF A;  4MY3 A;  3CXP A;  1BO4 A;  2A4N A;  2PC1 A;  3EFA A;  4KUB A;  1XMT A;  3SXN A;  2Z10 A;  1ON0 A;  1QSO A;  1YLE A;  4YFJ A;  1OZP A;  1KUY A;  2DXQ A;  5IX3 A;  2P0W A;  4FD7 A;  1P4N A;  3JUW A;  1L0C A;  3EXN A;  3E0K A;  1XF8 A;  1IIC A;  2VEZ A;  4KOU A;  3JVN A;  2P6G A;  1QSN A;  4R57 A;  4AG9 A;  3PGP A;  4UWI A;  3PZJ A;  2VQY A;  3I9S A;  3TT2 A;  5EBV A;  3W91 A;  4ZBG A;  4Y49 B;  4I49 A;  4GS4 A;  5ISV A;  4YRH A;  4XPD C;  1UFH A;  4FD6 A;  4AVB A;  2R98 A;  3T9Y A;  3C26 A;  1RXT A;  5C88 A;  2P6E A;  3V8I A;  1J4J A;  2GAN A;  4IUS A;  2KCW A;  4KOW A;  5HMN A;  1BOB A;  2P6F A;  1M4I A;  3W6S A;  2VZY A;  3DNS A;  1YVK A;  3R96 A;  1IYL A;  4B5P B;  1Z4R A;  4XPK A;  2OB0 A;  2ATR A;  1M44 A;  4OAD A;  2H5M A;  3TE4 A;  3FNC A;  3NE7 A;  3G8W A;  2VBQ A;  5CNP A;  2B5G A;  4QBJ A;  5KTD A;  2OU2 A;  2JEV A;  3KKW A;  3WR7 A;  2VZZ A;  3IGR A;  4JLY A;  1NMT A;  2D4O A;  1K4J A;  4HNW B;  4KZT A;  2B3V A;  2FIA A;  3TO6 A;  3OWC A;  4ORF A;  1GHE A;  2PQ8 A;  2X7B A;  1Y9K A;  4F0Y A;  3F0A A;  2ZW5 A;  1MK4 A;  3S6G A;  4M85 A;  2BUE A;  4PK2 A;  5GCN A;  2BEI A;  4JD6 A;  4NF1 A;  1QST A;  4PSX A;  4NSQ A;  3TCV A;  2OH1 A;  3QAH A;  4HNX B;  3TFY A;  1Q2D A;  1KUX A;  2OZG A;  3EY5 A;  2NMT A;  3S6H A;  4L89 A;  4KOS A;  2O28 A;  3LD2 A;  5HH1 A;  3IWG A;  4CAX A;  3H4Q A;  3DDD A;  1Y7R A;  4DNC A;  2CNS A;  4XPD B;  2FE7 A;  2I79 A;  2REF A;  3DR8 A;  4MHD A;  5JPH A;  3BJ8 A;  1I12 A;  1MJB A;  4MJ8 A;  1S3Z A;  1N71 A;  1Z4E A;  2J8N A;  1QSM A;  2HV2 A;  5H86 A;  3R1K A;  4MI4 A;  4UA3 A;  1Y9W A;  1XE4 A;  2REE A;  2B5G B;  2PR1 A;  1S7L A;  2G3T A;  4R87 A;  4EVY A;  4MBU A;  1M4D A;  4XNH B;  3DSB A;  4UBR A;  2PSW A;  1XEB A;  4CRY B;  4E2A A;  1MJ9 A;  4JXQ A;  1KUV A;  1CM0 A;  4KVX A;  2FT0 A;  4B5O A;  2HUZ A;  4E0A A;  1R57 A;  5C82 A;  3FIX A;  5E96 A;  3D2P A;  5I0C A;  4HNY B;  1CJW A;  4AVC A;  3F8K A;  2Q7B A;  3TOA A;  2ZW7 A;  3B8G A;  1WWZ A;  1NE9 A;  5F49 A;  2PR8 A;  2B58 A;  4QB9 A;  1Q2C A;  2B4D B;  3CXQ A;  2Z11 A;  5IB0 A;  4H6Z A;  2B3U A;  4PSW A;  2JLM A;  3EC4 A;  2J8M A;  2I00 A;  3FRM A;  1IYK A;  4KOT A;  3TO7 A;  2GIV A;  2WPW A;  5J8C A;  1S7F A;  3D8P A;  4FD5 A;  2QIR A;  2WPX A;  4Y49 C;  1I1D A;  2FIW A;  2FL4 A;  4KLW A;  3D3S A;  1PUA A;  3PP9 A;  4KOX A;  2CNM A;  2GE3 A;  4R3K A;  4AVA A;  1YGH A;  3GYA A;  2JDC A;  3S6F A;  3FYN A;  4HKF A;  3VWD A;  3QB8 A;  3T90 A;  4KVO E;  3BJ7 A;  4NXY A;  5F48 A;  2PRB A;  5IV0 A;  4PK3 A;  4L8A A;  3R9E A;  3BLN A;  3R95 A;  4KVM E;  2PDO A;  4RS2 A;  1V0C A;  1XIX A;  4RI1 A;  1KZF A;  2R1I A;  4OLL A;  3P2H A;  2OZH A;  2QML A;  2F5I A;  1Q2Y A;  5F47 A;  2Q4V A;  2RC4 A;  1B6B A;  4X5K A;  3TTH A;  3ZJ0 A;  1S7N A;  4H6U A;  4J3G A;  4JWP A;  1YRE A;  3LOD A;  4KOV A;  5DWN A;  2AJ6 A;  1YK3 A;  1YR0 A;  3ZZI A;  1M1D A;  3S6K A;  2B4B A;  2ZXV A;  1PU9 A;  4LUA A;  4KLV A;  2R8V A;  2C27 A;  3K9U A;  3P2F A;  4ONU A;  5J8F A;  3EO4 A;  1IID A;  4R9M A;  4FD4 A;  1P0H A;  5KTA A;  1S5K A;  3I3G A;  2K5T A;  3GY9 A;  4KOR A;  4PV6 A;  1SQH A;  1B87 A;  2VI7 A;  3F5B A;  3SXO A;  5H84 A;  2EVN A;  4CAW A;  2ZW4 A;  4QVT A;  1TIQ A;  4LX9 A;  2QEC A;  2VXK A;  3R9G A;  2JDD A;  3GKR A;  1RO5 A;  5EC4 A;  2OZU A;  1WK4 A;  4OAE A;  2HQY A;  1M4G A;  4E8O A;  4K30 A;  2D4P A;  4M3S A;  2R7H A;  3R9F A;  5JQ4 A;  3G3S A;  2EUI A;  1VHS A;  4CAV A;  1S60 A;  1VKC A;  2Z0Z A;  1NSL A;  2Y0M A;  1Z9U A;  2Q04 A;  1FY7 A;  4AB7 A;  1YX0 A;  3N7Z A;  4U9Z A;  5KTC A;  4KUA A;  2FCK A;  3DR6 A;  4IF5 A;  4MY0 A;  3FB3 A;  1MJA A;  3CXS A;  1I21 A;  2CY2 A;  4II9 A;  4H89 A;  4U5Y A;  4JXR A;  4XNH C;  3RYO A;  3UY5 A;  3SHP A;  3FBU A;  4F6A A;  2FSR A;  2J8R A;  2FS5 A;  3VWE A;  4R3L A;  3TO9 A;  4U9Y A;  4QUS A;  4NEX A;  3FXT A;  2Q44 A;  4UWJ A;  2ZW6 A;  4KOY A;  4QC6 A;  2BSW A;  1S7K A;  2IL4 A;  3W6X A;  4B5P A;  4CS0 B;  4BMH A;  3MGD A;  3TOB A;  2B4D A;  1LRZ A;  1QSR A;  2G0B A;  2ZPA A;  4CRZ B;  4JJX A; 
#chains in the Genus database with same CATH topology
 1Y7E A;  4XPL A;  2ZEG A;  3D2M A;  1IB1 E;  2CNT A;  2G3A A;  2PJ6 A;  4YGO A;  2ARH A;  1F2P A;  2Q4Y A;  5FVJ A;  3FF3 A;  4MFP A;  4NCZ A;  4UEZ A;  2NSM A;  2AE6 A;  1U6M A;  2Q0Y A;  5F46 A;  3QAY A;  4TNU A;  5DWM A;  5AG5 A;  2FXF A;  1YVO A;  2BL1 A;  2ZED A;  4AG7 A;  4MY3 A;  3CXP A;  5EMI A;  1BO4 A;  3D7H A;  4Z65 A;  1HEE A;  2PJB A;  2A4N A;  2PC1 A;  3EFA A;  4KUB A;  4WWV A;  4NGS A;  1XMT A;  3SJE A;  3TX8 A;  1BPN A;  3DLJ A;  1R43 A;  3KAS A;  4Q38 A;  4NJQ A;  3SXN A;  6CPA A;  2PJA A;  2Z10 A;  1ON0 A;  4MXU A;  1QSO A;  4H2K A;  4X3R A;  1YLE A;  1XRY A;  4YFJ A;  1OZP A;  4A38 A;  1KUY A;  2DXQ A;  3FX6 A;  5IX3 A;  4FWU A;  4WJB A;  3WT4 A;  1FT7 A;  5K8O A;  3RO0 A;  3CT9 A;  2P0W A;  1XBU A;  4OC1 A;  3H8F A;  4FD7 A;  1P4N A;  4KS9 A;  2AFX A;  2WUU A;  3JUW A;  3KHZ A;  3K2K A;  4CGL A;  1L0C A;  3EXN A;  5JH9 A;  3E0K A;  2ZEH A;  1XF8 A;  1HDU A;  1IIC A;  3KR5 A;  2AFS A;  1LAM A;  3VH9 A;  2ABZ A;  2VEZ A;  1TKH A;  3KI9 A;  5G1Z A;  4KOU A;  2Q51 A;  4A37 A;  3JVN A;  4EWT A;  2P6G A;  3CPA A;  1QSN A;  4GXH A;  1LCP A;  4R57 A;  4AG9 A;  3PGP A;  4Q7A A;  3PZJ A;  2VQY A;  4UWI A;  1ELL P;  1ZO0 A;  4CYP A;  2XEJ A;  4CGP A;  1ZLH A;  3I9S A;  3TT2 A;  4OC2 A;  5EBV A;  3W91 A;  4ZBG A;  4Y49 B;  4I49 A;  5IB9 A;  4GS4 A;  5ISV A;  4B11 A;  4UIB A;  4YRH A;  4XPD C;  4EME A;  2ODF A;  1UFH A;  4YU9 A;  4FD6 A;  4AVB A;  1ZG9 A;  4CPA A;  2R98 A;  3T9Y A;  3C26 A;  1RXT A;  4C7H A;  3D67 A;  5C88 A;  2P6E A;  1Q7L A;  2V8H A;  5AG7 A;  4A95 A;  4MCQ A;  4GM5 A;  1J4J A;  2GAN A;  4IUS A;  2KCW A;  4KOW A;  3V8I A;  5HMN A;  1ARM A;  1BOB A;  2P6F A;  3BI0 A;  1M4I A;  4CYQ A;  1TF8 A;  4ZI6 A;  4CYN A;  3W6S A;  4BIN A;  2VZY A;  3DNS A;  1GYT A;  1X12 A;  1R3N A;  1YVK A;  3R96 A;  2GLF A;  5D29 A;  2F8H A;  1IYL A;  3D66 A;  4B5P B;  1Z4R A;  4A30 A;  4XPK A;  2OB0 A;  1FNO A;  2QVP A;  4P4J A;  3PBE A;  2HC9 A;  2Q7S A;  1YQE A;  4RN7 A;  2ATR A;  1ELM P;  5THW A;  1M44 A;  2JEW A;  5AG4 A;  2C6C A;  4OAD A;  2Q4Z A;  4JYW A;  2H5M A;  1Z8X A;  1VIX A;  3TE4 A;  3FNC A;  3NE7 A;  3G8W A;  2Z3M A;  2VBQ A;  5CNP A;  2B5G A;  4QBJ A;  5KTD A;  3SJX A;  2OU2 A;  4UCM A;  2JEV A;  2XEG A;  2IJZ A;  1VHE A;  3KKW A;  2XEF A;  3WR7 A;  4OKO A;  2VZZ A;  4G1P A;  3TC8 A;  4MRI A;  1XMB A;  3IGR A;  3WC5 A;  1IU8 A;  2EWB A;  4NGQ A;  2GRE A;  1A2Z A;  3PB9 X;  3H5Z A;  4JLY A;  1NMT A;  2D4O A;  1K4J A;  2EBJ A;  4HNW B;  3B7I A;  2DPT A;  5G20 A;  3K9T A;  4KZT A;  1IOI A;  2B3V A;  2FIA A;  5JM6 A;  3TO6 A;  3OWC A;  5LYI A;  4ORF A;  1GHE A;  2PQ8 A;  2X7B A;  1Y9K A;  2PIZ A;  1VHO A;  3F0A A;  1PCA A;  2ZW5 A;  4NJR A;  5LRG A;  4F0Y A;  2DF5 A;  1MK4 A;  2EO8 A;  2AFO A;  2Q43 A;  3B2Y A;  1YSJ A;  3S6G A;  2HB6 A;  4M85 A;  4MFJ A;  1JQG A;  2BUE A;  2BO9 A;  2PJC A;  4TWE A;  4CAF A;  4PK2 A;  5GCN A;  2BEI A;  4JD6 A;  1IGB A;  4NF1 A;  1QST A;  2F7V A;  4PSX A;  4UEF A;  1CP6 A;  2EK9 A;  3KR4 A;  1PYT B;  4NSQ A;  2WSA A;  3NH5 A;  4MCR A;  3TCV A;  4CYO A;  4A31 A;  2OH1 A;  2PJ8 A;  4ZY1 A;  3CZX A;  3IWW A;  4UCN A;  4OC4 A;  1YME A;  3QAH A;  4HNX B;  4FBE A;  1Q2D A;  3TFY A;  1KUX A;  2OZG A;  2Z3O A;  3B3C A;  3EY5 A;  2NMT A;  4JZ0 A;  3FVL A;  4LQ6 A;  3S6H A;  5K8P A;  1VGY A;  4L89 A;  1Z5R A;  4YWY A;  1KWM A;  3KZW A;  4KOS A;  4R8F A;  2CIJ A;  2FVG A;  2O28 A;  3LD2 A;  5HH1 A;  1ZG7 A;  3IWG A;  4CAX A;  3H4Q A;  4DJL A;  3DDD A;  3IWE A;  1Y7R A;  2XEI A;  4DNC A;  2CNS A;  3QNV A;  4XPD B;  2FE7 A;  2I79 A;  2REF A;  3DR8 A;  2ZEE A;  4MHD A;  2QYV A;  3IFE A;  3PB4 X;  5JPH A;  5D8N A;  5LYF A;  3BJ8 A;  3JRU A;  1I12 A;  1MJB A;  4OP4 A;  5G22 A;  2Z3L A;  4MJ8 A;  2V8V A;  4P6Y A;  2RB7 A;  1S3Z A;  1N71 A;  1Z4E A;  4F0X A;  2J8N A;  3D7G A;  3H8G A;  3IU2 A;  1QSM A;  4JJX A;  4UCP A;  3VAT A;  2G9D A;  1YW4 A;  1AMP A;  1YW6 A;  2PVV A;  2HV2 A;  3NA6 A;  3FED A;  5H86 A;  3R1K A;  2YNE A;  3RAM A;  3KHX A;  4MI4 A;  4MCS A;  4UA3 A;  4X2T A;  1Y0R A;  1Y9W A;  2AFU A;  1XE4 A;  1Z8T A;  4NGR A;  2REE A;  2B5G B;  2PR1 A;  1S7L A;  2G3T A;  4R87 A;  3D7D A;  4EVY A;  4MBU A;  5G21 A;  4B12 A;  1CBX A;  1M4D A;  4XNH B;  5CBM A;  3WC7 A;  4DYO A;  2ZEM A;  2C6P A;  1RTQ A;  3DSB A;  4C68 A;  4UBR A;  2PSW A;  1XEB A;  4OC5 A;  4A39 A;  1MJ9 A;  1Z2L A;  4JXQ A;  4CRY B;  3D4U A;  1KUV A;  4E2A A;  1CM0 A;  4UIA A;  4KVX A;  2FT0 A;  3B3W A;  4B5O A;  3D7F A;  2HUZ A;  4PXD A;  3KGQ A;  4E0A A;  5DS0 A;  1R57 A;  5C82 A;  3FIX A;  5E96 A;  3D2P A;  5I0C A;  2PJ2 A;  3FH4 A;  4HNY B;  2ANP A;  2WZN A;  1AYE A;  4NFR A;  2BCO A;  1CJW A;  2YGW A;  2ZEL A;  4AVC A;  4BBH A;  3CDX A;  2V77 A;  3F8K A;  1QMU A;  2Q7B A;  3TOA A;  2ZW7 A;  3B8G A;  1WWZ A;  2V8G A;  3MRU A;  1NE9 A;  5F49 A;  2PR8 A;  3LWU A;  2B58 A;  4UF4 A;  4QB9 A;  5LRK A;  1Q2C A;  3KQZ A;  2B4D B;  3CXQ A;  2ZEO A;  3GIU A;  2Z11 A;  2C6G A;  3WC6 A;  4H6Z A;  5IB0 A;  2QJ8 A;  2B3U A;  4C2Z A;  4PSW A;  2JLM A;  1BAV A;  3EC4 A;  1JWQ A;  2I00 A;  2J8M A;  4A33 A;  4MFL A;  3FRM A;  5LYL A;  1IYK A;  4MHY A;  2V8D A;  4CAE A;  4KOT A;  3TO7 A;  2Z3K A;  2EK8 A;  2GIV A;  2WPW A;  4ZYQ A;  5J8C A;  1S7F A;  2PJ9 A;  4MCP A;  3D8P A;  5K8M A;  4FD5 A;  2QIR A;  4IK2 A;  2ZEN A;  2WPX A;  4Y49 C;  5LRJ A;  1I1D A;  2FIW A;  2FL4 A;  2J9A A;  2JBK A;  4KLW A;  3D3S A;  1PUA A;  3PP9 A;  3PRT A;  2CNM A;  4KOX A;  4UFW A;  2GE3 A;  4R3K A;  1ZLI A;  3SJF A;  1YGH A;  3GYA A;  2JDC A;  4AVA A;  3NE8 A;  2POK A;  3S6F A;  3FYN A;  5A27 A;  4HKF A;  3VWD A;  4IAV A;  4W9Y A;  3QB8 A;  5CPA A;  3T90 A;  3PB7 X;  4KVO E;  4MHN A;  4PXE A;  3BHX A;  1HDQ A;  3B3T A;  3BJ7 A;  3ISX A;  4NXY A;  5F48 A;  2CF4 A;  3RBU A;  4FAI A;  2PRB A;  5IV0 A;  4PK3 A;  3ISZ A;  4L8A A;  3R9E A;  3SI0 A;  4P4I A;  3BLN A;  4MHZ A;  4KVM E;  2PDO A;  3L2N A;  3R95 A;  2DEA A;  5HVH A;  3HLP A;  2Z3N A;  4RS2 A;  1V0C A;  2IQ6 A;  1XIX A;  3IEH A;  3IO1 A;  1KZF A;  4RI1 A;  2YNC C;  4NGM A;  2R1I A;  4NGN A;  4OLL A;  4R6T A;  3FMC A;  1CPS A;  2Z3P A;  2GLJ A;  1IY7 A;  2CTC A;  3P2H A;  2OZH A;  4MMO A;  4P10 A;  3S9L A;  4IHM A;  2QML A;  2YNC A;  3GUX A;  2F5I A;  1Q2Y A;  5F47 A;  2Q4V A;  2RC4 A;  1B6B A;  2DPS A;  4X5K A;  3TTH A;  1LAP A;  3ZJ0 A;  2I3C A;  2CXA A;  1CX8 A;  4KSF A;  4P4D A;  5K8N A;  1S7N A;  2AFM A;  1NSA A;  3HUV A;  4H6U A;  4J3G A;  4JWP A;  1YRE A;  3MN8 A;  2VL1 A;  5HXD A;  3LOD A;  3PB6 X;  4KOV A;  2AJ6 A;  5DWN A;  2PCU A;  1CPX A;  4ONW A;  4ZY0 A;  4P4B A;  3V7Z A;  4AXV A;  1YK3 A;  1YR0 A;  2CTB A;  4KSA A;  1ARL A;  1M1D A;  3ZZI A;  3S6K A;  5I4M A;  2PJ3 A;  4R7M A;  4B13 A;  1Z8W A;  1LOK A;  2B4B A;  2O4H A;  2PVW A;  2ZXV A;  1PU9 A;  4ZX9 A;  4LUA A;  1BLL E;  8CPA A;  2ZOG A;  2PJ5 A;  3FEE A;  4KLV A;  2R8V A;  2C27 A;  2NYQ A;  4BD9 A;  5JGF A;  3K9U A;  3PB8 X;  5ELY A;  2BOA A;  3A9L A;  3P2F A;  3PBB A;  4ONU A;  5J8F A;  1F57 A;  1IID A;  2ZOF A;  3EO4 A;  4FD4 A;  4R9M A;  2OR4 A;  4A2Z A;  4A94 A;  1P0H A;  5KTA A;  1S5K A;  3I3G A;  1EE3 P;  4M6G A;  3WAB A;  2K5T A;  1H8L A;  3GY9 A;  4HPS A;  4KOR A;  4DUK A;  4MFK A;  4O23 A;  3D68 A;  2PE3 A;  3S9N A;  3PEI A;  4PV6 A;  1SQH A;  1B87 A;  3LMS A;  4P45 A;  2VI7 A;  3F5B A;  4PXC A;  3SXO A;  5H84 A;  2EVN A;  4C7I A;  4CAW A;  2ZW4 A;  4UEE A;  3IJ3 A;  4QVT A;  3I1U A;  1TIQ A;  2PJ0 A;  3IC1 A;  4LX9 A;  2QEC A;  2VXK A;  1UWY A;  3SI2 A;  3R9G A;  1TXR A;  2JDD A;  2PRQ A;  1RO5 A;  3GKR A;  3PFO A;  2JBJ A;  5EC4 A;  4ZX8 A;  4CGO A;  2OZU A;  5HVG A;  1Y0Y A;  4MHP A;  1WK4 A;  3IIB A;  4OAE A;  2HQY A;  4MFQ A;  2PJ7 A;  1M4G A;  4M6H A;  4UFX A;  4F8Z A;  4E8O A;  4K30 A;  3FEC A;  4A32 A;  2D4P A;  4M3S A;  3GB0 A;  4B14 A;  2R7H A;  4B6Z A;  3N5F A;  3R9F A;  5JQ4 A;  2PJ1 A;  3G3S A;  2EUI A;  1VHS A;  5HVF A;  3FJU A;  2ZEF A;  1YLO A;  4CAV A;  1S60 A;  1VKC A;  1CP7 A;  2Z0Z A;  1NSL A;  2Y0M A;  1Z9U A;  3VAR A;  2ZEP A;  2Q04 A;  1FY7 A;  4X8I A;  2AFZ A;  4CGM A;  4AB7 A;  4OME A;  4PQA A;  1YX0 A;  3KL9 A;  3IU1 A;  3N7Z A;  4U9Z A;  3S9M A;  5KTC A;  4KUA A;  4MFZ A;  1DE4 C;  2FCK A;  3DR6 A;  3GLJ A;  4C2Y A;  3KQX A;  3NH8 A;  3JTK A;  5AG6 A;  4F9U A;  4IF5 A;  4P4F A;  4MY0 A;  3RNZ A;  3FB3 A;  3T8W A;  4P4E A;  1MJA A;  4FUU A;  2GU2 A;  3CXS A;  2IMO A;  4OID A;  4ZGY B;  4OC0 A;  2GFQ A;  5A28 A;  3SI1 A;  4OIW A;  4K3N A;  1I21 A;  2YND A;  3B3S A;  4NGT A;  3BXM A;  1TKJ A;  3CPX A;  2CY2 A;  3SJG A;  4II9 A;  1ZG8 A;  1TKF A;  4H89 A;  4U5Y A;  4JXR A;  4XNH C;  1QQ9 A;  3RYO A;  3UY5 A;  3V38 A;  3SHP A;  3FBU A;  5F09 A;  1X10 A;  3NFZ A;  4F9V A;  4F6A A;  4Q36 A;  3H8E A;  3B3V A;  3PFE A;  1XJO A;  2FSR A;  1LFW A;  2FS5 A;  2J8R A;  3VWE A;  5BWA B;  4R3L A;  1BPM A;  3TO9 A;  4M6I A;  4U9Y A;  2AFW A;  2O53 A;  3DGV A;  4LQG A;  4NGP A;  2C1C A;  4QUS A;  4CGN A;  4EFD A;  4NEX A;  3FXT A;  2OOT A;  1XFO A;  2Q44 A;  7CPA A;  2WYR A;  2PIY A;  4R76 A;  2RFH A;  4KSI A;  4RUH A;  4UWJ A;  4B10 A;  2ZW6 A;  3B35 A;  1CG2 A;  4KOY A;  4QC6 A;  2BSW A;  1S7K A;  5AGE A;  4C2X A;  2IL4 A;  1TF9 A;  4OC3 A;  3W6X A;  1OBR A;  4B5P A;  1AUG A;  4PPZ A;  2PJ4 A;  4UFV A;  4CS0 B;  4P44 A;  4BMH A;  4PXB A;  5LYD A;  3BI1 A;  3MGD A;  1Z8L A;  1IOF A;  1M4L A;  3RZA A;  3TOB A;  3NH4 A;  5J1Q A;  2B4D A;  4ZY2 A;  1LAN A;  1LRZ A;  1DTD A;  1QSR A;  2G0B A;  1XOV A;  2ZPA A;  4CRZ B;  3LAC A;  1F2O A; 
#chains in the Genus database with same CATH homology
 4XPL A;  3D2M A;  1IB1 E;  2CNT A;  2G3A A;  4YGO A;  2ARH A;  2Q4Y A;  5FVJ A;  4MFP A;  4NCZ A;  2AE6 A;  1U6M A;  2Q0Y A;  5F46 A;  5DWM A;  5AG5 A;  1YVO A;  2BL1 A;  2FXF A;  4AG7 A;  4MY3 A;  3CXP A;  1BO4 A;  2A4N A;  2PC1 A;  3EFA A;  4KUB A;  1XMT A;  4Q38 A;  3SXN A;  2Z10 A;  1ON0 A;  1QSO A;  1YLE A;  4YFJ A;  1OZP A;  1KUY A;  2DXQ A;  5IX3 A;  2P0W A;  4FD7 A;  1P4N A;  4KS9 A;  2WUU A;  4CGL A;  3JUW A;  1L0C A;  3EXN A;  3E0K A;  1XF8 A;  1IIC A;  2VEZ A;  5G1Z A;  4KOU A;  3JVN A;  2P6G A;  1QSN A;  4R57 A;  4AG9 A;  3PGP A;  4UWI A;  3PZJ A;  2VQY A;  1ZO0 A;  4CYP A;  4CGP A;  3I9S A;  3TT2 A;  5EBV A;  3W91 A;  4ZBG A;  4Y49 B;  4I49 A;  4GS4 A;  5ISV A;  4B11 A;  4YRH A;  4XPD C;  1UFH A;  4FD6 A;  4AVB A;  2R98 A;  3T9Y A;  3C26 A;  1RXT A;  4C7H A;  5C88 A;  2P6E A;  5AG7 A;  4A95 A;  3V8I A;  1J4J A;  2GAN A;  4IUS A;  2KCW A;  4KOW A;  5HMN A;  1BOB A;  2P6F A;  4CYQ A;  1M4I A;  4CYN A;  3W6S A;  2VZY A;  3DNS A;  1YVK A;  3R96 A;  1IYL A;  4B5P B;  1Z4R A;  4A30 A;  4XPK A;  2OB0 A;  2ATR A;  1M44 A;  5AG4 A;  4OAD A;  2H5M A;  3TE4 A;  3FNC A;  3NE7 A;  3G8W A;  2Z3M A;  2VBQ A;  5CNP A;  2B5G A;  4QBJ A;  5KTD A;  2OU2 A;  4UCM A;  2JEV A;  3KKW A;  3WR7 A;  2VZZ A;  3IGR A;  3H5Z A;  4JLY A;  1NMT A;  2D4O A;  1K4J A;  4HNW B;  2DPT A;  5G20 A;  4KZT A;  2B3V A;  2FIA A;  3TO6 A;  3OWC A;  4ORF A;  1GHE A;  2PQ8 A;  2X7B A;  1Y9K A;  4F0Y A;  3F0A A;  2ZW5 A;  1MK4 A;  3S6G A;  4M85 A;  4MFJ A;  2BUE A;  4CAF A;  4PK2 A;  5GCN A;  2BEI A;  4JD6 A;  4NF1 A;  1QST A;  4PSX A;  4NSQ A;  2WSA A;  3TCV A;  4CYO A;  4A31 A;  2OH1 A;  4UCN A;  3QAH A;  4HNX B;  3TFY A;  1Q2D A;  1KUX A;  2OZG A;  2Z3O A;  3EY5 A;  2NMT A;  3S6H A;  4L89 A;  4KOS A;  2O28 A;  3LD2 A;  5HH1 A;  3IWG A;  4CAX A;  3H4Q A;  3DDD A;  3IWE A;  1Y7R A;  4DNC A;  2CNS A;  4XPD B;  2FE7 A;  2I79 A;  2REF A;  3DR8 A;  4MHD A;  5JPH A;  3BJ8 A;  1I12 A;  1MJB A;  5G22 A;  2Z3L A;  4MJ8 A;  1S3Z A;  1N71 A;  1Z4E A;  4F0X A;  2J8N A;  3IU2 A;  4UCP A;  1QSM A;  2HV2 A;  5H86 A;  3R1K A;  2YNE A;  4MI4 A;  4UA3 A;  1Y9W A;  1XE4 A;  2REE A;  2B5G B;  2PR1 A;  1S7L A;  2G3T A;  4R87 A;  4EVY A;  4MBU A;  5G21 A;  4B12 A;  1M4D A;  4XNH B;  4C68 A;  3DSB A;  4UBR A;  2PSW A;  1XEB A;  4CRY B;  4E2A A;  1MJ9 A;  4JXQ A;  1KUV A;  1CM0 A;  4KVX A;  2FT0 A;  4B5O A;  2HUZ A;  4E0A A;  1R57 A;  5C82 A;  3FIX A;  5E96 A;  3D2P A;  5I0C A;  4HNY B;  1CJW A;  2YGW A;  4AVC A;  4BBH A;  3F8K A;  2Q7B A;  3TOA A;  2ZW7 A;  3B8G A;  1WWZ A;  1NE9 A;  5F49 A;  2PR8 A;  2B58 A;  4QB9 A;  1Q2C A;  2B4D B;  3CXQ A;  2Z11 A;  5IB0 A;  4H6Z A;  4C2Z A;  2B3U A;  4PSW A;  2JLM A;  3EC4 A;  2J8M A;  2I00 A;  4A33 A;  4MFL A;  3FRM A;  1IYK A;  4CAE A;  4KOT A;  3TO7 A;  2Z3K A;  2GIV A;  2WPW A;  5J8C A;  1S7F A;  3D8P A;  4FD5 A;  2QIR A;  2WPX A;  4Y49 C;  1I1D A;  2FIW A;  2FL4 A;  4KLW A;  3D3S A;  1PUA A;  3PP9 A;  4KOX A;  2CNM A;  4UFW A;  2GE3 A;  4R3K A;  4AVA A;  1YGH A;  3GYA A;  2JDC A;  3S6F A;  3FYN A;  5A27 A;  4HKF A;  3VWD A;  3QB8 A;  3T90 A;  4KVO E;  3BJ7 A;  4NXY A;  5F48 A;  2PRB A;  5IV0 A;  4PK3 A;  4L8A A;  3R9E A;  3BLN A;  3R95 A;  4KVM E;  2PDO A;  2Z3N A;  4RS2 A;  1V0C A;  1XIX A;  4RI1 A;  1KZF A;  2YNC C;  2R1I A;  4OLL A;  2Z3P A;  3P2H A;  2OZH A;  2QML A;  2YNC A;  2F5I A;  1Q2Y A;  5F47 A;  2Q4V A;  2RC4 A;  1B6B A;  2DPS A;  4X5K A;  3TTH A;  3ZJ0 A;  2CXA A;  4KSF A;  1S7N A;  4H6U A;  4J3G A;  4JWP A;  1YRE A;  3LOD A;  4KOV A;  5DWN A;  2AJ6 A;  1YK3 A;  1YR0 A;  4KSA A;  3ZZI A;  1M1D A;  3S6K A;  4B13 A;  2B4B A;  2ZXV A;  1PU9 A;  4LUA A;  4KLV A;  2R8V A;  2C27 A;  3K9U A;  3A9L A;  3P2F A;  4ONU A;  5J8F A;  3EO4 A;  1IID A;  4R9M A;  4FD4 A;  4A2Z A;  1P0H A;  5KTA A;  1S5K A;  3I3G A;  2K5T A;  3GY9 A;  4KOR A;  4MFK A;  4PV6 A;  1SQH A;  1B87 A;  2VI7 A;  3F5B A;  3SXO A;  5H84 A;  2EVN A;  4C7I A;  4CAW A;  2ZW4 A;  4QVT A;  1TIQ A;  4LX9 A;  2QEC A;  2VXK A;  3R9G A;  2JDD A;  3GKR A;  4CGO A;  1RO5 A;  5EC4 A;  2OZU A;  1WK4 A;  4OAE A;  2HQY A;  4MFQ A;  1M4G A;  4UFX A;  4E8O A;  4K30 A;  4A32 A;  2D4P A;  4M3S A;  4B14 A;  2R7H A;  3R9F A;  5JQ4 A;  3G3S A;  2EUI A;  1VHS A;  4CAV A;  1S60 A;  1VKC A;  2Z0Z A;  1NSL A;  2Y0M A;  1Z9U A;  2Q04 A;  1FY7 A;  4CGM A;  4AB7 A;  1YX0 A;  3IU1 A;  3N7Z A;  4U9Z A;  5KTC A;  4KUA A;  4MFZ A;  2FCK A;  3DR6 A;  4C2Y A;  3JTK A;  5AG6 A;  4IF5 A;  4MY0 A;  3FB3 A;  1MJA A;  3CXS A;  4ZGY B;  5A28 A;  1I21 A;  2YND A;  2CY2 A;  4II9 A;  4H89 A;  4U5Y A;  4JXR A;  4XNH C;  3RYO A;  3UY5 A;  3SHP A;  3FBU A;  4F6A A;  4Q36 A;  2FSR A;  2J8R A;  2FS5 A;  3VWE A;  5BWA B;  4R3L A;  3TO9 A;  4U9Y A;  4QUS A;  4CGN A;  4NEX A;  3FXT A;  2Q44 A;  4UWJ A;  4B10 A;  2ZW6 A;  4KOY A;  4QC6 A;  5AGE A;  2BSW A;  1S7K A;  4C2X A;  2IL4 A;  3W6X A;  4B5P A;  4CS0 B;  4UFV A;  4BMH A;  3MGD A;  3TOB A;  2B4D A;  1LRZ A;  1QSR A;  2G0B A;  2ZPA A;  4CRZ B;  4JJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...