1S3ZA

Aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and ribostamycin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
147
structure length
147
Chain Sequence
SHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside 6'-N-acetyltransferase
publication title A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
pubmed doi rcsb
source organism Salmonella enteritidis
molecule tags Transferase
total genus 41
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2004-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s3zA00
2Q4YA 5EC4A 2ARHA 3DR8A 2FS5A 4H89A 5E96A 5J8CA 4MY3A 2FE7A 1MJBA 3FRMA 2B5GB 4XPDB 2D4PA 4PK3A 1QSTA 2IL4A 2B3VA 3D8PA 3R9EA 2VI7A 3FXTA 1IYKA 3I3GA 1YK3A 2EUIA 2AJ6A 4CS0B 3R95A 4OADA 4OLLA 4FD5A 4YGOA 4MY0A 2CY2A 1MJ9A 3BJ7A 4F6AA 1M1DA 4KOSA 1KUVA 2REFA 1IIDA 1Q2DA 1IICA 4YRHA 2Q7BA 1I1DA 2G3AA 1IB1E 2Z0ZA 1S7FA 2F5IA 4U9ZA 4PSWA 2G3TA 3IGRA 4LUAA 1BO4A 3C26A 4JD6A 3ZZIA 2X7BA 4OAEA 2VQYA 5C88A 2Q4VA 2ZXVA 3WR7A 2BEIA 2OU2A 3TT2A 1I21A 4MJ8A 2G0BA 2J8RA 1KUXA 4E2AA 3NE7A 3CXSA 3T90A 3S6KA 5KTDA 2PSWA 3LD2A 2OZHA 3W6SA 4J3GA 1MJAA 3GYAA 4UBRA 1VKCA 5IV0A 3TO7A 5H84A 1Z4EA 1YLEA 4F0YA 3VWEA 3T9YA 4UA3A 4RI1A 2R1IA 1YX0A 4X5KA 1B87A 1S7NA 2VZZA 4B5OA 3F8KA 4MBUA 5CNPA 3S6HA 3TE4A 3LODA 5IX3A 1YREA 5DWNA 2ZW5A 2C27A 5EBVA 3GKRA 2I79A 4L89A 4AVCA 4XPKA 4R3LA 4XPDC 2GE3A 4KOXA 4UWJA 1L0CA 1VHSA 1NE9A 4NSQA 5F49A 2OZGA 4MHDA 2QIRA 3PP9A 2R98A 2ZW6A 2FXFA 1XE4A 1Z4RA 2PR1A 3EC4A 3E0KA 4KVOE 1PU9A 3FB3A 3GY9A 1I12A 3QB8A 3FYNA 2R8VA 3V8IA 3JVNA 4HNYB 4AB7A 3G8WA 3K9UA 4NXYA 3FBUA 2ZW4A 4HNXB 2B3UA 4L8AA 4AG9A 1YVOA 4PSXA 5KTAA 4JJXA 2B4DB 4AG7A 3TCVA 2P6GA 3P2HA 1J4JA 1Y9KA 4R87A 4U9YA 3G3SA 2Z11A 2EVNA 4RS2A 2Q04A 4JWPA 2QECA 4QC6A 3EY5A 4Y49C 4FD6A 3KKWA 3W6XA 1V0CA 5JQ4A 4JXRA 1TIQA 4XNHC 1YVKA 2PDOA 2JEVA 3R1KA 1Q2CA 3DNSA 4XPLA 4CAWA 1NSLA 1IYLA 1K4JA 1MK4A 2OZUA 4JLYA 1B6BA 4E0AA 1WK4A 5IB0A 4E8OA 4KLWA 2BUEA 2B58A 3F0AA 2B5GA 4CRZB 2FT0A 1QSMA 4B5PA 2J8MA 1CJWA 3IWGA 3S6GA 4M3SA 5C82A 1KUYA 2JDDA 1LRZA 4YFJA 1S3ZA 2P6FA 2OH1A 1XMTA 4KOTA 5FVJA 4MI4A 1SQHA 3OWCA 4ZBGA 4NF1A 2HUZA 2CNMA 3TFYA 2ATRA 3R96A 5I0CA 2CNTA 4HNWB 5HH1A 2WPXA 1WWZA 2B4BA 3DDDA 5HMNA 2PR8A 1QSOA 4H6UA 1M4DA 4R9MA 4KOUA 1XIXA 3MGDA 1M44A 4UWIA 3F5BA 3TOAA 4AVAA 4R57A 1PUAA 4QBJA 1YGHA 2AE6A 3CXQA 4R3KA 1P0HA 1RO5A 2DXQA 3TTHA 3EFAA 3H4QA 3D2MA 4II9A 1KZFA 2Q44A 1S5KA 2BL1A 3DSBA 3VWDA 3EXNA 4KZTA 4LX9A 4EVYA 3ZJ0A 3S6FA 4CAVA 3D2PA 1N71A 4K30A 1GHEA 4DNCA 4FD4A 2HQYA 2H5MA 2FL4A 2GIVA 1CM0A 3FNCA 3D3SA 2JLMA 2QMLA 2K5TA 5KTCA 4IUSA 3BLNA 3SXNA 3PZJA 4B5PB 1QSRA 2P6EA 4KUAA 3DR6A 2Q0YA 1FY7A 1U6MA 4KOYA 2CNSA 4QB9A 3QAHA 2VEZA 4ORFA 4HKFA 5JPHA 4KUBA 5F47A 2KCWA 4GS4A 3TOBA 1M4GA 1BOBA 2I00A 3SHPA 4H6ZA 3B8GA 2FSRA 4QVTA 2JDCA 2GANA 5GCNA 4NEXA 2ZW7A 1RXTA 4KOVA 4FD7A 2FIAA 4U5YA 3FIXA 1Y9WA 1UFHA 4I49A 3N7ZA 4PV6A 2PRBA 5DWMA 3R9GA 3UY5A 4IF5A 2PQ8A 2VBQA 3TO9A 1Q2YA 4Y49B 4KVME 3EO4A 4CRYB 2D4OA 4KOWA 2B4DA 4XNHB 1YR0A 2ZPAA 3SXOA 5H86A 2OB0A 4KVXA 1XF8A 3W91A 1S7LA 5F46A 1M4IA 1Z9UA 4NCZA 2R7HA 3BJ8A 5J8FA 2HV2A 1R57A 4ONUA 1S60A 1XEBA 4CAXA 3PGPA 2REEA 4KORA 2A4NA 2NMTA 2PC1A 3TO6A 3I9SA 2J8NA 1OZPA 3P2FA 2VXKA 2Y0MA 4QUSA 2FCKA 2BSWA 4AVBA 5F48A 1P4NA 4PK2A 3RYOA 1Y7RA 5ISVA 3R9FA 2WPWA 2FIWA 1ON0A 2Z10A 1S7KA 4M85A 2VZYA 2RC4A 2P0WA 3CXPA 1NMTA 4KLVA 3JUWA 2O28A 4JXQA 1QSNA 4BMHA
chains in the Genus database with same CATH superfamily
1XJOA 4P4DA 2Q4YA 5HVFA 3SJEA 1DTDA 2IMOA 2PRQA 4R7MA 5EC4A 2ARHA 3DR8A 4LQGA 1R3NA 2FS5A 3K2KA 4H89A 5E96A 5J8CA 4MY3A 4NJQA 2FE7A 1MJBA 2PJ3A 2XEGA 4UCPA 3FRMA 2B5GB 4XPDB 4DYOA 3S9LA 4R76A 2D4PA 4PK3A 1QSTA 5F09A 1ELLP 1TKJA 2IQ6A 3IEHA 2IL4A 4XNHC 1ZO0A 4Q38A 3JRUA 2B3VA 3D8PA 3PBBA 3SJGA 4OP4A 3R9EA 2EK9A 4OMEA 2VI7A 2HB6A 2CTBA 4P4FA 3FXTA 3RAMA 1XRYA 3BHXA 3I1UA 1IYKA 4A2ZA 3I3GA 4AXVA 3KASA 3V7ZA 1YK3A 2EUIA 1IOIA 4FAIA 1YW6A 3WABA 2AJ6A 1R43A 3N5FA 1Z8WA 4CS0B 3IJ3A 4OC5A 3R95A 4OADA 4OLLA 4FD5A 4DUKA 4YGOA 2DEAA 4UFWA 4MY0A 2CY2A 1MJ9A 3BJ7A 4F6AA 1M1DA 2WYRA 4KOSA 1KUVA 2PCUA 2REFA 2J9AA 5HVHA 1IIDA 4M6GA 3CZXA 1Q2DA 1IICA 2C6PA 4YRHA 2Q7BA 1I1DA 2G3AA 3ISZA 1IB1E 3FJUA 3B3TA 4UEZA 2Z0ZA 1S7FA 4PXBA 2ABZA 2F5IA 4MFPA 3QAYA 3B3SA 3NH5A 5D29A 2ODFA 4U9ZA 4ONWA 4PSWA 2G3TA 4TWEA 1YW4A 5G1ZA 3MN8A 1BPNA 3IGRA 1BO4A 3C26A 4JD6A 4LUAA 3ZZIA 2X7BA 4OAEA 2YNCA 4X2TA 2VQYA 2AFZA 1JQGA 5C88A 3SI2A 4E2AA 2Q4VA 2ZXVA 3WR7A 2BEIA 2OU2A 3TT2A 1I21A 4MJ8A 2G0BA 4CGMA 1X10A 1HEEA 4F0XA 1JWQA 3NA6A 2J8RA 5LRJA 2EWBA 4YU9A 5HVGA 1KUXA 3KL9A 4ZX9A 1VIXA 3NE7A 1CG2A 3CXSA 3T90A 3S6KA 1IGBA 1PCAA 1FNOA 2PJ8A 4F9UA 1BPMA 3HLPA 2PSWA 4CYNA 5KTDA 3LD2A 3D66A 4IK2A 2OZHA 3SJXA 2EK8A 1XFOA 3W6SA 5EMIA 1PYTB 4J3GA 4TNUA 1DE4C 2WUUA 2ZEGA 4ZX8A 3S9NA 1MJAA 3GYAA 3H8FA 1VKCA 4UBRA 1GYTA 4KS9A 5IV0A 3IO1A 3KI9A 1ZG9A 3PB8X 3TO7A 1ZG8A 1Y0RA 5H84A 3GUXA 2Q7SA 4MFQA 1Z4EA 1YLEA 4CGOA 1F57A 3WC5A 1ZLIA 3VWEA 4F0YA 4B6ZA 3H8GA 3T9YA 2YNCC 4UA3A 2BO9A 4A31A 4RI1A 3KHZA 2R1IA 1YX0A 1X12A 2QJ8A 4X5KA 5LRGA 2ZENA 4A38A 1B87A 1S7NA 2RB7A 2VZZA 4F8ZA 2Q4ZA 4B5OA 1CPXA 3F8KA 1FT7A 4MBUA 5CNPA 3S6HA 3TE4A 3LODA 5IX3A 1YREA 5DWNA 3FX6A 2ZW5A 2C27A 5EBVA 3GKRA 4A30A 3PFEA 2I79A 4L89A 4CGLA 4AVCA 4XPKA 4R3LA 5A28A 4OIDA 4UCMA 1RTQA 4PXCA 4XPDC 4MCRA 4WWVA 2GE3A 4KOXA 4UWJA 4BD9A 3PB7X 1L0CA 1VHSA 4O23A 4P4JA 1NE9A 4NSQA 5F49A 3S9MA 2OZGA 4NGSA 4OIWA 4MHDA 2QIRA 3PP9A 2R98A 2ZW6A 2FXFA 1XE4A 1Z4RA 3TC8A 2PR1A 3EC4A 3E0KA 3ISXA 3KGQA 4KVOE 1CPSA 5AG7A 1PU9A 2V77A 3FB3A 3FMCA 4MFJA 3GY9A 1I12A 5AG6A 3QB8A 3FYNA 5IB9A 2O4HA 2PIZA 2R8VA 1LFWA 3JVNA 3PEIA 2CXAA 4HNYB 2PJ4A 2FVGA 3HUVA 4AB7A 3SI1A 2I3CA 3G8WA 2C6CA 3K9UA 4NXYA 4BBHA 4C2YA 2ZOFA 3FBUA 2ZW4A 4HNXB 3LWUA 1BAVA 5AG5A 4NGNA 2PJ1A 2B3UA 4FUUA 3LACA 4L8AA 5HXDA 4AG9A 3KHXA 4JYWA 1TF8A 2XEFA 3FEEA 1YVOA 2GFQA 2AFWA 4BINA 4PSXA 4P44A 2V8DA 5JGFA 5KTAA 4JJXA 2B4DB 1CX8A 3TCVA 4AG7A 2P6GA 2AFMA 4PXEA 3PFOA 3P2HA 5ELYA 1J4JA 5D8NA 2CF4A 1Y9KA 3GB0A 4R87A 2IJZA 1YSJA 2JBKA 2NYQA 4MCPA 4OC3A 4U9YA 2VL1A 4B14A 3G3SA 3D7GA 4YWYA 2Z11A 2EVNA 4RS2A 4HPSA 5JH9A 2Q04A 4B11A 4Q36A 4RN7A 4JWPA 2QECA 4QC6A 4UCNA 1TKFA 3EY5A 4GXHA 4JZ0A 4Y49C 4ZY0A 5CBMA 4FD6A 3KKWA 2C6GA 1OBRA 1LAPA 1M4LA 4IHMA 5G20A 4LQ6A 3W6XA 3FH4A 1V0CA 3NH4A 5JQ4A 4FBEA 4A33A 3D7HA 3PBEA 5G22A 4JXRA 1TIQA 2PIYA 1YVKA 2PDOA 2XEJA 2PVWA 2JEVA 3H8EA 3R1KA 4IAVA 3CPAA 4CGNA 4CPAA 2ZEEA 1Q2CA 3IU1A 2PJ2A 3JTKA 3DNSA 4XPLA 4NGRA 4RUHA 1Z5RA 4CAWA 4EMEA 1NSLA 1IYLA 4P4EA 1ZG7A 4K3NA 1K4JA 1MK4A 3CPXA 2OZUA 3IWEA 4X8IA 4Z65A 2EBJA 4JLYA 1B6BA 2POKA 1KWMA 4CAEA 1F2OA 2Q51A 2Z3MA 4MCQA 4EFDA 4OKOA 4MFKA 2OOTA 4E0AA 1WK4A 2V8GA 4ZY1A 2F7VA 2HC9A 4P10A 5K8MA 1H8LA 5IB0A 4E8OA 4KLWA 2BUEA 2B58A 3TX8A 5A27A 4NGTA 1XBUA 3PB9X 3F0AA 4R8FA 3BXMA 1TXRA 2B5GA 4CRZB 3RNZA 3B7IA 1CP6A 2FT0A 4C68A 3KQZA 2PJBA 3D67A 1QSMA 2QVPA 4B5PA 4CAFA 2J8MA 1CJWA 4X3RA 3IWGA 3S6GA 4B10A 2AFOA 3BI1A 4MHZA 2AFSA 5K8OA 4M3SA 5C82A 1KUYA 2DPSA 2Z3PA 3FF3A 2JDDA 1LRZA 4YFJA 2EO8A 5AG4A 1S3ZA 4NJRA 1HDQA 1Z8LA 2P6FA 2ZEPA 2OH1A 5K8NA 5LYDA 1XMTA 4KOTA 5FVJA 3D7DA 1SQHA 3OWCA 4MI4A 4ZBGA 4NF1A 2JEWA 4P6YA 2HUZA 1LCPA 2CNMA 3IWWA 4MRIA 4OC0A 3TFYA 2ATRA 3R96A 5I0CA 1Y7EA 2GLFA 1ZLHA 2CNTA 3V8IA 4HNWB 5HH1A 3BI0A 4OC1A 1IU8A 3NE8A 4PPZA 4UFVA 2WPXA 4A94A 3NH8A 1WWZA 2B4BA 2PJ5A 3DDDA 5HMNA 1NSAA 2PR8A 3DGVA 1QSOA 2QYVA 4H6UA 1M4DA 5G21A 1VHOA 2G9DA 4NGPA 4R9MA 2DPTA 4KOUA 1XIXA 5AGEA 4MFLA 4F9VA 4ZGYB 3MGDA 2ZEMA 1M44A 4UWIA 3F5BA 3TOAA 1LANA 4NFRA 4AVAA 1LAMA 3KZWA 4CGPA 5BWAB 2GREA 4KSAA 4R57A 2Z3OA 1PUAA 3WT4A 1VGYA 4QBJA 4WJBA 4CYPA 1YGHA 3SJFA 2AE6A 3CXQA 4R3KA 4C7HA 1P0HA 3SI0A 1RO5A 2DXQA 3KQXA 3TTHA 3EFAA 3H4QA 3D2MA 3B3VA 4II9A 1KZFA 2Q44A 1UWYA 4A32A 3IFEA 1S5KA 2BL1A 3VATA 3IC1A 2PJ0A 4A95A 3DSBA 3MRUA 4P4IA 3VWDA 2BOAA 3EXNA 4KZTA 4MHNA 4LX9A 4EVYA 1QQ9A 3ZJ0A 1EE3P 2GLJA 3S6FA 3WC7A 2C1CA 4CAVA 3D4UA 3NFZA 1AUGA 4B12A 2O53A 3D2PA 1N71A 4K30A 4UIAA 2F8HA 1GHEA 1XOVA 4DNCA 4FD4A 2HQYA 2H5MA 3L2NA 4FWUA 2FL4A 2GIVA 4NGMA 1CM0A 3FNCA 4MXUA 3D3SA 4NGQA 3GLJA 1Q7LA 1TF9A 1Z8XA 2JLMA 2QMLA 2K5TA 1IOFA 5KTCA 3D7FA 4IUSA 3BLNA 2JBJA 3SXNA 2ZEDA 4OC2A 3PZJA 4B5PB 1QSRA 2P6EA 2ZEHA 2ANPA 4KUAA 3DR6A 4MMOA 2Q0YA 4Q7AA 5LYLA 1QMUA 1YQEA 1FY7A 1U6MA 4KOYA 1ARMA 2WZNA 2CNSA 4QB9A 2YNDA 3QAHA 2VEZA 4ORFA 4P45A 4B13A 2ZEFA 4DJLA 3GIUA 4HKFA 5JPHA 4C7IA 4KUBA 5F47A 2KCWA 4UF4A 3B2YA 2PVVA 4GS4A 3TOBA 1M4GA 1BOBA 2I00A 4CYOA 3SHPA 4H6ZA 3DLJA 3B8GA 2FSRA 2OR4A 4QVTA 2PJ6A 3KR5A 2JDCA 2GANA 3FECA 5GCNA 4NEXA 1Z8TA 2ZW7A 1RXTA 3KR4A 3RBUA 6CPAA 4KOVA 3H5ZA 3B35A 4FD7A 1CBXA 2CIJA 5JM6A 1A2ZA 3B3CA 3CDXA 2FIAA 5I4MA 4U5YA 3FIXA 1Y9WA 1UFHA 3B3WA 2ZOGA 4I49A 3RZAA 3N7ZA 1HDUA 4W9YA 2DF5A 4C2XA 2CTCA 4PV6A 1CP7A 3PRTA 3QNVA 2PRBA 2PE3A 2WSAA 2Z3KA 5DWMA 4UIBA 3R9GA 3UY5A 2V8VA 4IF5A 4R6TA 3WC6A 2PJ7A 2PQ8A 2VBQA 5DS0A 4UFXA 3TO9A 1Q2YA 4M6HA 1IY7A 2RFHA 4Y49B 1F2PA 2Z3NA 4KVME 2ZELA 3EO4A 3RO0A 4CYQA 4CRYB 2D4OA 4MFZA 4P4BA 2NSMA 3IU2A 2V8HA 1Y0YA 4KOWA 2B4DA 4MCSA 4XNHB 3VH9A 8CPAA 4A37A 1YR0A 2ZPAA 3SXOA 5H86A 1LOKA 1YMEA 2OB0A 4KVXA 1XF8A 5THWA 4ZYQA 3W91A 4GM5A 4KSFA 4A39A 2BCOA 3V38A 1S7LA 2Z3LA 5F46A 1M4IA 1Z9UA 2AFUA 4NCZA 3CT9A 4ZI6A 2R7HA 2ZEOA 3K9TA 2PJ9A 2YNEA 3BJ8A 4KSIA 5J8FA 2HV2A 1ARLA 1R57A 4ONUA 3FEDA 2PJAA 1S60A 4MHYA 1ELMP 1XEBA 2YGWA 1XMBA 3IIBA 4H2KA 4CAXA 3PGPA 2REEA 3FVLA 2XEIA 1YLOA 2A4NA 4G1PA 2NMTA 4KORA 1TKHA 2PC1A 3TO6A 1BLLE 3T8WA 1Z2LA 3I9SA 4MHPA 2J8NA 1OZPA 3P2FA 1AYEA 2VXKA 2Y0MA 1AMPA 1VHEA 3PB6X 4QUSA 2FCKA 4PXDA 4UEFA 2BSWA 3D68A 5F48A 3VARA 4AVBA 1P4NA 3PB4X 4PK2A 3RYOA 1Y7RA 2GU2A 5ISVA 3R9FA 4C2ZA 4EWTA 2WPWA 2FIWA 2Q43A 1ON0A 4M6IA 2Z10A 1S7KA 4M85A 4PQAA 2VZYA 4OC4A 4UEEA 2RC4A 2P0WA 3CXPA 5LYFA 5J1QA 5CPAA 1NMTA 4KLVA 2AFXA 4ZY2A 2PJCA 3JUWA 2O28A 5LYIA 3A9LA 5K8PA 4JXQA 1QSNA 5LRKA 7CPAA 4BMHA 3LMSA
chains in the Genus database with same CATH topology
2Q4YA 5EC4A 2ARHA 3DR8A 2FS5A 4H89A 5E96A 5J8CA 4MY3A 2FE7A 1MJBA 4UCPA 3FRMA 2B5GB 4XPDB 2D4PA 4PK3A 1QSTA 2IL4A 1ZO0A 4Q38A 2B3VA 3D8PA 3R9EA 2VI7A 3FXTA 4A2ZA 1IYKA 3I3GA 1YK3A 2EUIA 2AJ6A 4CS0B 3R95A 4OADA 4OLLA 4FD5A 4YGOA 4UFWA 4MY0A 2CY2A 1MJ9A 3BJ7A 4F6AA 1M1DA 4KOSA 1KUVA 2REFA 1IIDA 1Q2DA 1IICA 4YRHA 2Q7BA 1I1DA 2G3AA 1IB1E 2Z0ZA 1S7FA 2F5IA 4MFPA 4U9ZA 5G1ZA 4PSWA 2G3TA 3IGRA 4LUAA 1BO4A 3C26A 4JD6A 3ZZIA 2X7BA 4OAEA 2YNCA 2VQYA 5C88A 2Q4VA 2ZXVA 3WR7A 2BEIA 2OU2A 3TT2A 1I21A 4MJ8A 2G0BA 4CGMA 4F0XA 2J8RA 1KUXA 4E2AA 3NE7A 3CXSA 3T90A 3S6KA 5KTDA 4CYNA 2PSWA 3LD2A 2OZHA 3W6SA 4J3GA 2WUUA 1MJAA 3GYAA 4UBRA 1VKCA 4KS9A 5IV0A 3TO7A 5H84A 4MFQA 1Z4EA 1YLEA 4CGOA 4F0YA 3VWEA 3T9YA 2YNCC 4UA3A 4A31A 4RI1A 2R1IA 1YX0A 4X5KA 1B87A 1S7NA 2VZZA 4B5OA 3F8KA 4MBUA 5CNPA 3S6HA 3TE4A 3LODA 5IX3A 1YREA 5DWNA 2ZW5A 2C27A 5EBVA 3GKRA 4A30A 2I79A 4L89A 4CGLA 4AVCA 4XPKA 4R3LA 5A28A 4UCMA 4XPDC 2GE3A 4KOXA 4UWJA 1L0CA 1VHSA 1NE9A 4NSQA 5F49A 2OZGA 4MHDA 2QIRA 3PP9A 2R98A 2ZW6A 2FXFA 1XE4A 1Z4RA 2PR1A 3EC4A 3E0KA 4KVOE 5AG7A 1PU9A 3FB3A 4MFJA 3GY9A 1I12A 5AG6A 3QB8A 3FYNA 2R8VA 3V8IA 3JVNA 2CXAA 4HNYB 4AB7A 3G8WA 3K9UA 4NXYA 4BBHA 4C2YA 3FBUA 2ZW4A 4HNXB 5AG5A 2B3UA 4L8AA 4AG9A 1YVOA 4PSXA 5KTAA 4JJXA 2B4DB 4AG7A 3TCVA 2P6GA 3P2HA 1J4JA 1Y9KA 4R87A 4U9YA 4B14A 3G3SA 2Z11A 2EVNA 4RS2A 2Q04A 4B11A 4Q36A 4JWPA 2QECA 4QC6A 4UCNA 3EY5A 4Y49C 4FD6A 3KKWA 5G20A 3W6XA 1V0CA 5JQ4A 4A33A 5G22A 4JXRA 1TIQA 4XNHC 1YVKA 2PDOA 2JEVA 3R1KA 1Q2CA 3IU1A 3JTKA 3DNSA 4XPLA 4CAWA 1NSLA 1IYLA 1K4JA 1MK4A 3IWEA 2OZUA 4JLYA 1B6BA 4CAEA 2Z3MA 4MFKA 4E0AA 1WK4A 5IB0A 4E8OA 4KLWA 2BUEA 2B58A 5A27A 3F0AA 2B5GA 4CRZB 2FT0A 4C68A 1QSMA 4B5PA 4CAFA 2J8MA 1CJWA 3IWGA 3S6GA 4B10A 4M3SA 5C82A 1KUYA 2DPSA 2Z3PA 2JDDA 1LRZA 4YFJA 5AG4A 1S3ZA 2P6FA 2OH1A 1XMTA 4KOTA 5FVJA 4MI4A 1SQHA 3OWCA 4ZBGA 4NF1A 2HUZA 2CNMA 3TFYA 2ATRA 3R96A 5I0CA 2CNTA 4HNWB 5HH1A 4UFVA 2WPXA 1WWZA 2B4BA 3DDDA 5HMNA 2PR8A 1QSOA 4H6UA 1M4DA 5G21A 4R9MA 2DPTA 4KOUA 1XIXA 5AGEA 4MFLA 4ZGYB 3MGDA 1M44A 4UWIA 3F5BA 3TOAA 4AVAA 4CGPA 5BWAB 4KSAA 4R57A 2Z3OA 1PUAA 4QBJA 4CYPA 1YGHA 2AE6A 3CXQA 4R3KA 4C7HA 1P0HA 1RO5A 2DXQA 3TTHA 3EFAA 3H4QA 3D2MA 4II9A 1KZFA 2Q44A 4A32A 1S5KA 2BL1A 4A95A 3DSBA 3VWDA 3EXNA 4KZTA 4LX9A 4EVYA 3ZJ0A 3S6FA 4CAVA 4B12A 3D2PA 1N71A 4K30A 1GHEA 4DNCA 4FD4A 2HQYA 2H5MA 4CGNA 2FL4A 2GIVA 1CM0A 3FNCA 3D3SA 2JLMA 2QMLA 2K5TA 5KTCA 4IUSA 3BLNA 3SXNA 3PZJA 4B5PB 1QSRA 2P6EA 4KUAA 3DR6A 2Q0YA 1FY7A 1U6MA 4KOYA 2CNSA 4QB9A 2YNDA 3QAHA 2VEZA 4ORFA 4B13A 4HKFA 5JPHA 4C7IA 4KUBA 5F47A 2KCWA 4GS4A 3TOBA 1M4GA 1BOBA 2I00A 4CYOA 3SHPA 4H6ZA 3B8GA 2FSRA 4QVTA 2JDCA 2GANA 5GCNA 4NEXA 2ZW7A 1RXTA 4KOVA 3H5ZA 4FD7A 2FIAA 4U5YA 3FIXA 1Y9WA 1UFHA 4I49A 3N7ZA 4C2XA 4PV6A 2PRBA 2WSAA 5DWMA 2Z3KA 3R9GA 3UY5A 4IF5A 2PQ8A 2VBQA 4UFXA 3TO9A 1Q2YA 4Y49B 2Z3NA 4KVME 3EO4A 4CYQA 4CRYB 2D4OA 4MFZA 3IU2A 4KOWA 2B4DA 4XNHB 1YR0A 2ZPAA 3SXOA 5H86A 2OB0A 4KVXA 1XF8A 3W91A 4KSFA 1S7LA 2Z3LA 5F46A 1M4IA 1Z9UA 4NCZA 2R7HA 2YNEA 3BJ8A 5J8FA 2HV2A 1R57A 4ONUA 1S60A 1XEBA 2YGWA 4CAXA 3PGPA 2REEA 4KORA 2A4NA 2NMTA 2PC1A 3TO6A 3I9SA 2J8NA 1OZPA 3P2FA 2VXKA 2Y0MA 4QUSA 2FCKA 2BSWA 4AVBA 5F48A 1P4NA 4PK2A 3RYOA 1Y7RA 5ISVA 3R9FA 4C2ZA 2WPWA 2FIWA 1ON0A 2Z10A 1S7KA 4M85A 2VZYA 2RC4A 2P0WA 3CXPA 1NMTA 4KLVA 3JUWA 2O28A 3A9LA 4JXQA 1QSNA 4BMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4Y A;  5EC4 A;  2ARH A;  3DR8 A;  2FS5 A;  4H89 A;  5E96 A;  5J8C A;  4MY3 A;  2FE7 A;  1MJB A;  3FRM A;  2B5G B;  4XPD B;  2D4P A;  4PK3 A;  1QST A;  2IL4 A;  2B3V A;  3D8P A;  3R9E A;  2VI7 A;  3FXT A;  1IYK A;  3I3G A;  1YK3 A;  2EUI A;  2AJ6 A;  4CS0 B;  3R95 A;  4OAD A;  4OLL A;  4FD5 A;  4YGO A;  4MY0 A;  2CY2 A;  1MJ9 A;  3BJ7 A;  4F6A A;  1M1D A;  4KOS A;  1KUV A;  2REF A;  1IID A;  1Q2D A;  1IIC A;  4YRH A;  2Q7B A;  1I1D A;  2G3A A;  1IB1 E;  2Z0Z A;  1S7F A;  2F5I A;  4U9Z A;  4PSW A;  2G3T A;  3IGR A;  4LUA A;  1BO4 A;  3C26 A;  4JD6 A;  3ZZI A;  2X7B A;  4OAE A;  2VQY A;  5C88 A;  2Q4V A;  2ZXV A;  3WR7 A;  2BEI A;  2OU2 A;  3TT2 A;  1I21 A;  4MJ8 A;  2G0B A;  2J8R A;  1KUX A;  4E2A A;  3NE7 A;  3CXS A;  3T90 A;  3S6K A;  5KTD A;  2PSW A;  3LD2 A;  2OZH A;  3W6S A;  4J3G A;  1MJA A;  3GYA A;  4UBR A;  1VKC A;  5IV0 A;  3TO7 A;  5H84 A;  1Z4E A;  1YLE A;  4F0Y A;  3VWE A;  3T9Y A;  4UA3 A;  4RI1 A;  2R1I A;  1YX0 A;  4X5K A;  1B87 A;  1S7N A;  2VZZ A;  4B5O A;  3F8K A;  4MBU A;  5CNP A;  3S6H A;  3TE4 A;  3LOD A;  5IX3 A;  1YRE A;  5DWN A;  2ZW5 A;  2C27 A;  5EBV A;  3GKR A;  2I79 A;  4L89 A;  4AVC A;  4XPK A;  4R3L A;  4XPD C;  2GE3 A;  4KOX A;  4UWJ A;  1L0C A;  1VHS A;  1NE9 A;  4NSQ A;  5F49 A;  2OZG A;  4MHD A;  2QIR A;  3PP9 A;  2R98 A;  2ZW6 A;  2FXF A;  1XE4 A;  1Z4R A;  2PR1 A;  3EC4 A;  3E0K A;  4KVO E;  1PU9 A;  3FB3 A;  3GY9 A;  1I12 A;  3QB8 A;  3FYN A;  2R8V A;  3V8I A;  3JVN A;  4HNY B;  4AB7 A;  3G8W A;  3K9U A;  4NXY A;  3FBU A;  2ZW4 A;  4HNX B;  2B3U A;  4L8A A;  4AG9 A;  1YVO A;  4PSX A;  5KTA A;  4JJX A;  2B4D B;  4AG7 A;  3TCV A;  2P6G A;  3P2H A;  1J4J A;  1Y9K A;  4R87 A;  4U9Y A;  3G3S A;  2Z11 A;  2EVN A;  4RS2 A;  2Q04 A;  4JWP A;  2QEC A;  4QC6 A;  3EY5 A;  4Y49 C;  4FD6 A;  3KKW A;  3W6X A;  1V0C A;  5JQ4 A;  4JXR A;  1TIQ A;  4XNH C;  1YVK A;  2PDO A;  2JEV A;  3R1K A;  1Q2C A;  3DNS A;  4XPL A;  4CAW A;  1NSL A;  1IYL A;  1K4J A;  1MK4 A;  2OZU A;  4JLY A;  1B6B A;  4E0A A;  1WK4 A;  5IB0 A;  4E8O A;  4KLW A;  2BUE A;  2B58 A;  3F0A A;  2B5G A;  4CRZ B;  2FT0 A;  1QSM A;  4B5P A;  2J8M A;  1CJW A;  3IWG A;  3S6G A;  4M3S A;  5C82 A;  1KUY A;  2JDD A;  1LRZ A;  4YFJ A;  1S3Z A;  2P6F A;  2OH1 A;  1XMT A;  4KOT A;  5FVJ A;  4MI4 A;  1SQH A;  3OWC A;  4ZBG A;  4NF1 A;  2HUZ A;  2CNM A;  3TFY A;  2ATR A;  3R96 A;  5I0C A;  2CNT A;  4HNW B;  5HH1 A;  2WPX A;  1WWZ A;  2B4B A;  3DDD A;  5HMN A;  2PR8 A;  1QSO A;  4H6U A;  1M4D A;  4R9M A;  4KOU A;  1XIX A;  3MGD A;  1M44 A;  4UWI A;  3F5B A;  3TOA A;  4AVA A;  4R57 A;  1PUA A;  4QBJ A;  1YGH A;  2AE6 A;  3CXQ A;  4R3K A;  1P0H A;  1RO5 A;  2DXQ A;  3TTH A;  3EFA A;  3H4Q A;  3D2M A;  4II9 A;  1KZF A;  2Q44 A;  1S5K A;  2BL1 A;  3DSB A;  3VWD A;  3EXN A;  4KZT A;  4LX9 A;  4EVY A;  3ZJ0 A;  3S6F A;  4CAV A;  3D2P A;  1N71 A;  4K30 A;  1GHE A;  4DNC A;  4FD4 A;  2HQY A;  2H5M A;  2FL4 A;  2GIV A;  1CM0 A;  3FNC A;  3D3S A;  2JLM A;  2QML A;  2K5T A;  5KTC A;  4IUS A;  3BLN A;  3SXN A;  3PZJ A;  4B5P B;  1QSR A;  2P6E A;  4KUA A;  3DR6 A;  2Q0Y A;  1FY7 A;  1U6M A;  4KOY A;  2CNS A;  4QB9 A;  3QAH A;  2VEZ A;  4ORF A;  4HKF A;  5JPH A;  4KUB A;  5F47 A;  2KCW A;  4GS4 A;  3TOB A;  1M4G A;  1BOB A;  2I00 A;  3SHP A;  4H6Z A;  3B8G A;  2FSR A;  4QVT A;  2JDC A;  2GAN A;  5GCN A;  4NEX A;  2ZW7 A;  1RXT A;  4KOV A;  4FD7 A;  2FIA A;  4U5Y A;  3FIX A;  1Y9W A;  1UFH A;  4I49 A;  3N7Z A;  4PV6 A;  2PRB A;  5DWM A;  3R9G A;  3UY5 A;  4IF5 A;  2PQ8 A;  2VBQ A;  3TO9 A;  1Q2Y A;  4Y49 B;  4KVM E;  3EO4 A;  4CRY B;  2D4O A;  4KOW A;  2B4D A;  4XNH B;  1YR0 A;  2ZPA A;  3SXO A;  5H86 A;  2OB0 A;  4KVX A;  1XF8 A;  3W91 A;  1S7L A;  5F46 A;  1M4I A;  1Z9U A;  4NCZ A;  2R7H A;  3BJ8 A;  5J8F A;  2HV2 A;  1R57 A;  4ONU A;  1S60 A;  1XEB A;  4CAX A;  3PGP A;  2REE A;  4KOR A;  2A4N A;  2NMT A;  2PC1 A;  3TO6 A;  3I9S A;  2J8N A;  1OZP A;  3P2F A;  2VXK A;  2Y0M A;  4QUS A;  2FCK A;  2BSW A;  4AVB A;  5F48 A;  1P4N A;  4PK2 A;  3RYO A;  1Y7R A;  5ISV A;  3R9F A;  2WPW A;  2FIW A;  1ON0 A;  2Z10 A;  1S7K A;  4M85 A;  2VZY A;  2RC4 A;  2P0W A;  3CXP A;  1NMT A;  4KLV A;  3JUW A;  2O28 A;  4JXQ A;  1QSN A;  4BMH A; 
#chains in the Genus database with same CATH topology
 1XJO A;  4P4D A;  2Q4Y A;  5HVF A;  3SJE A;  1DTD A;  2IMO A;  2PRQ A;  4R7M A;  5EC4 A;  2ARH A;  3DR8 A;  4LQG A;  1R3N A;  2FS5 A;  3K2K A;  4H89 A;  5E96 A;  5J8C A;  4MY3 A;  4NJQ A;  2FE7 A;  1MJB A;  2PJ3 A;  2XEG A;  4UCP A;  3FRM A;  2B5G B;  4XPD B;  4DYO A;  3S9L A;  4R76 A;  2D4P A;  4PK3 A;  1QST A;  5F09 A;  1ELL P;  1TKJ A;  2IQ6 A;  3IEH A;  2IL4 A;  4XNH C;  1ZO0 A;  4Q38 A;  3JRU A;  2B3V A;  3D8P A;  3PBB A;  3SJG A;  4OP4 A;  3R9E A;  2EK9 A;  4OME A;  2VI7 A;  2HB6 A;  2CTB A;  4P4F A;  3FXT A;  3RAM A;  1XRY A;  3BHX A;  3I1U A;  1IYK A;  4A2Z A;  3I3G A;  4AXV A;  3KAS A;  3V7Z A;  1YK3 A;  2EUI A;  1IOI A;  4FAI A;  1YW6 A;  3WAB A;  2AJ6 A;  1R43 A;  3N5F A;  1Z8W A;  4CS0 B;  3IJ3 A;  4OC5 A;  3R95 A;  4OAD A;  4OLL A;  4FD5 A;  4DUK A;  4YGO A;  2DEA A;  4UFW A;  4MY0 A;  2CY2 A;  1MJ9 A;  3BJ7 A;  4F6A A;  1M1D A;  2WYR A;  4KOS A;  1KUV A;  2PCU A;  2REF A;  2J9A A;  5HVH A;  1IID A;  4M6G A;  3CZX A;  1Q2D A;  1IIC A;  2C6P A;  4YRH A;  2Q7B A;  1I1D A;  2G3A A;  3ISZ A;  1IB1 E;  3FJU A;  3B3T A;  4UEZ A;  2Z0Z A;  1S7F A;  4PXB A;  2ABZ A;  2F5I A;  4MFP A;  3QAY A;  3B3S A;  3NH5 A;  5D29 A;  2ODF A;  4U9Z A;  4ONW A;  4PSW A;  2G3T A;  4TWE A;  1YW4 A;  5G1Z A;  3MN8 A;  1BPN A;  3IGR A;  1BO4 A;  3C26 A;  4JD6 A;  4LUA A;  3ZZI A;  2X7B A;  4OAE A;  2YNC A;  4X2T A;  2VQY A;  2AFZ A;  1JQG A;  5C88 A;  3SI2 A;  4E2A A;  2Q4V A;  2ZXV A;  3WR7 A;  2BEI A;  2OU2 A;  3TT2 A;  1I21 A;  4MJ8 A;  2G0B A;  4CGM A;  1X10 A;  1HEE A;  4F0X A;  1JWQ A;  3NA6 A;  2J8R A;  5LRJ A;  2EWB A;  4YU9 A;  5HVG A;  1KUX A;  3KL9 A;  4ZX9 A;  1VIX A;  3NE7 A;  1CG2 A;  3CXS A;  3T90 A;  3S6K A;  1IGB A;  1PCA A;  1FNO A;  2PJ8 A;  4F9U A;  1BPM A;  3HLP A;  2PSW A;  4CYN A;  5KTD A;  3LD2 A;  3D66 A;  4IK2 A;  2OZH A;  3SJX A;  2EK8 A;  1XFO A;  3W6S A;  5EMI A;  1PYT B;  4J3G A;  4TNU A;  1DE4 C;  2WUU A;  2ZEG A;  4ZX8 A;  3S9N A;  1MJA A;  3GYA A;  3H8F A;  1VKC A;  4UBR A;  1GYT A;  4KS9 A;  5IV0 A;  3IO1 A;  3KI9 A;  1ZG9 A;  3PB8 X;  3TO7 A;  1ZG8 A;  1Y0R A;  5H84 A;  3GUX A;  2Q7S A;  4MFQ A;  1Z4E A;  1YLE A;  4CGO A;  1F57 A;  3WC5 A;  1ZLI A;  3VWE A;  4F0Y A;  4B6Z A;  3H8G A;  3T9Y A;  2YNC C;  4UA3 A;  2BO9 A;  4A31 A;  4RI1 A;  3KHZ A;  2R1I A;  1YX0 A;  1X12 A;  2QJ8 A;  4X5K A;  5LRG A;  2ZEN A;  4A38 A;  1B87 A;  1S7N A;  2RB7 A;  2VZZ A;  4F8Z A;  2Q4Z A;  4B5O A;  1CPX A;  3F8K A;  1FT7 A;  4MBU A;  5CNP A;  3S6H A;  3TE4 A;  3LOD A;  5IX3 A;  1YRE A;  5DWN A;  3FX6 A;  2ZW5 A;  2C27 A;  5EBV A;  3GKR A;  4A30 A;  3PFE A;  2I79 A;  4L89 A;  4CGL A;  4AVC A;  4XPK A;  4R3L A;  5A28 A;  4OID A;  4UCM A;  1RTQ A;  4PXC A;  4XPD C;  4MCR A;  4WWV A;  2GE3 A;  4KOX A;  4UWJ A;  4BD9 A;  3PB7 X;  1L0C A;  1VHS A;  4O23 A;  4P4J A;  1NE9 A;  4NSQ A;  5F49 A;  3S9M A;  2OZG A;  4NGS A;  4OIW A;  4MHD A;  2QIR A;  3PP9 A;  2R98 A;  2ZW6 A;  2FXF A;  1XE4 A;  1Z4R A;  3TC8 A;  2PR1 A;  3EC4 A;  3E0K A;  3ISX A;  3KGQ A;  4KVO E;  1CPS A;  5AG7 A;  1PU9 A;  2V77 A;  3FB3 A;  3FMC A;  4MFJ A;  3GY9 A;  1I12 A;  5AG6 A;  3QB8 A;  3FYN A;  5IB9 A;  2O4H A;  2PIZ A;  2R8V A;  1LFW A;  3JVN A;  3PEI A;  2CXA A;  4HNY B;  2PJ4 A;  2FVG A;  3HUV A;  4AB7 A;  3SI1 A;  2I3C A;  3G8W A;  2C6C A;  3K9U A;  4NXY A;  4BBH A;  4C2Y A;  2ZOF A;  3FBU A;  2ZW4 A;  4HNX B;  3LWU A;  1BAV A;  5AG5 A;  4NGN A;  2PJ1 A;  2B3U A;  4FUU A;  3LAC A;  4L8A A;  5HXD A;  4AG9 A;  3KHX A;  4JYW A;  1TF8 A;  2XEF A;  3FEE A;  1YVO A;  2GFQ A;  2AFW A;  4BIN A;  4PSX A;  4P44 A;  2V8D A;  5JGF A;  5KTA A;  4JJX A;  2B4D B;  1CX8 A;  3TCV A;  4AG7 A;  2P6G A;  2AFM A;  4PXE A;  3PFO A;  3P2H A;  5ELY A;  1J4J A;  5D8N A;  2CF4 A;  1Y9K A;  3GB0 A;  4R87 A;  2IJZ A;  1YSJ A;  2JBK A;  2NYQ A;  4MCP A;  4OC3 A;  4U9Y A;  2VL1 A;  4B14 A;  3G3S A;  3D7G A;  4YWY A;  2Z11 A;  2EVN A;  4RS2 A;  4HPS A;  5JH9 A;  2Q04 A;  4B11 A;  4Q36 A;  4RN7 A;  4JWP A;  2QEC A;  4QC6 A;  4UCN A;  1TKF A;  3EY5 A;  4GXH A;  4JZ0 A;  4Y49 C;  4ZY0 A;  5CBM A;  4FD6 A;  3KKW A;  2C6G A;  1OBR A;  1LAP A;  1M4L A;  4IHM A;  5G20 A;  4LQ6 A;  3W6X A;  3FH4 A;  1V0C A;  3NH4 A;  5JQ4 A;  4FBE A;  4A33 A;  3D7H A;  3PBE A;  5G22 A;  4JXR A;  1TIQ A;  2PIY A;  1YVK A;  2PDO A;  2XEJ A;  2PVW A;  2JEV A;  3H8E A;  3R1K A;  4IAV A;  3CPA A;  4CGN A;  4CPA A;  2ZEE A;  1Q2C A;  3IU1 A;  2PJ2 A;  3JTK A;  3DNS A;  4XPL A;  4NGR A;  4RUH A;  1Z5R A;  4CAW A;  4EME A;  1NSL A;  1IYL A;  4P4E A;  1ZG7 A;  4K3N A;  1K4J A;  1MK4 A;  3CPX A;  2OZU A;  3IWE A;  4X8I A;  4Z65 A;  2EBJ A;  4JLY A;  1B6B A;  2POK A;  1KWM A;  4CAE A;  1F2O A;  2Q51 A;  2Z3M A;  4MCQ A;  4EFD A;  4OKO A;  4MFK A;  2OOT A;  4E0A A;  1WK4 A;  2V8G A;  4ZY1 A;  2F7V A;  2HC9 A;  4P10 A;  5K8M A;  1H8L A;  5IB0 A;  4E8O A;  4KLW A;  2BUE A;  2B58 A;  3TX8 A;  5A27 A;  4NGT A;  1XBU A;  3PB9 X;  3F0A A;  4R8F A;  3BXM A;  1TXR A;  2B5G A;  4CRZ B;  3RNZ A;  3B7I A;  1CP6 A;  2FT0 A;  4C68 A;  3KQZ A;  2PJB A;  3D67 A;  1QSM A;  2QVP A;  4B5P A;  4CAF A;  2J8M A;  1CJW A;  4X3R A;  3IWG A;  3S6G A;  4B10 A;  2AFO A;  3BI1 A;  4MHZ A;  2AFS A;  5K8O A;  4M3S A;  5C82 A;  1KUY A;  2DPS A;  2Z3P A;  3FF3 A;  2JDD A;  1LRZ A;  4YFJ A;  2EO8 A;  5AG4 A;  1S3Z A;  4NJR A;  1HDQ A;  1Z8L A;  2P6F A;  2ZEP A;  2OH1 A;  5K8N A;  5LYD A;  1XMT A;  4KOT A;  5FVJ A;  3D7D A;  1SQH A;  3OWC A;  4MI4 A;  4ZBG A;  4NF1 A;  2JEW A;  4P6Y A;  2HUZ A;  1LCP A;  2CNM A;  3IWW A;  4MRI A;  4OC0 A;  3TFY A;  2ATR A;  3R96 A;  5I0C A;  1Y7E A;  2GLF A;  1ZLH A;  2CNT A;  3V8I A;  4HNW B;  5HH1 A;  3BI0 A;  4OC1 A;  1IU8 A;  3NE8 A;  4PPZ A;  4UFV A;  2WPX A;  4A94 A;  3NH8 A;  1WWZ A;  2B4B A;  2PJ5 A;  3DDD A;  5HMN A;  1NSA A;  2PR8 A;  3DGV A;  1QSO A;  2QYV A;  4H6U A;  1M4D A;  5G21 A;  1VHO A;  2G9D A;  4NGP A;  4R9M A;  2DPT A;  4KOU A;  1XIX A;  5AGE A;  4MFL A;  4F9V A;  4ZGY B;  3MGD A;  2ZEM A;  1M44 A;  4UWI A;  3F5B A;  3TOA A;  1LAN A;  4NFR A;  4AVA A;  1LAM A;  3KZW A;  4CGP A;  5BWA B;  2GRE A;  4KSA A;  4R57 A;  2Z3O A;  1PUA A;  3WT4 A;  1VGY A;  4QBJ A;  4WJB A;  4CYP A;  1YGH A;  3SJF A;  2AE6 A;  3CXQ A;  4R3K A;  4C7H A;  1P0H A;  3SI0 A;  1RO5 A;  2DXQ A;  3KQX A;  3TTH A;  3EFA A;  3H4Q A;  3D2M A;  3B3V A;  4II9 A;  1KZF A;  2Q44 A;  1UWY A;  4A32 A;  3IFE A;  1S5K A;  2BL1 A;  3VAT A;  3IC1 A;  2PJ0 A;  4A95 A;  3DSB A;  3MRU A;  4P4I A;  3VWD A;  2BOA A;  3EXN A;  4KZT A;  4MHN A;  4LX9 A;  4EVY A;  1QQ9 A;  3ZJ0 A;  1EE3 P;  2GLJ A;  3S6F A;  3WC7 A;  2C1C A;  4CAV A;  3D4U A;  3NFZ A;  1AUG A;  4B12 A;  2O53 A;  3D2P A;  1N71 A;  4K30 A;  4UIA A;  2F8H A;  1GHE A;  1XOV A;  4DNC A;  4FD4 A;  2HQY A;  2H5M A;  3L2N A;  4FWU A;  2FL4 A;  2GIV A;  4NGM A;  1CM0 A;  3FNC A;  4MXU A;  3D3S A;  4NGQ A;  3GLJ A;  1Q7L A;  1TF9 A;  1Z8X A;  2JLM A;  2QML A;  2K5T A;  1IOF A;  5KTC A;  3D7F A;  4IUS A;  3BLN A;  2JBJ A;  3SXN A;  2ZED A;  4OC2 A;  3PZJ A;  4B5P B;  1QSR A;  2P6E A;  2ZEH A;  2ANP A;  4KUA A;  3DR6 A;  4MMO A;  2Q0Y A;  4Q7A A;  5LYL A;  1QMU A;  1YQE A;  1FY7 A;  1U6M A;  4KOY A;  1ARM A;  2WZN A;  2CNS A;  4QB9 A;  2YND A;  3QAH A;  2VEZ A;  4ORF A;  4P45 A;  4B13 A;  2ZEF A;  4DJL A;  3GIU A;  4HKF A;  5JPH A;  4C7I A;  4KUB A;  5F47 A;  2KCW A;  4UF4 A;  3B2Y A;  2PVV A;  4GS4 A;  3TOB A;  1M4G A;  1BOB A;  2I00 A;  4CYO A;  3SHP A;  4H6Z A;  3DLJ A;  3B8G A;  2FSR A;  2OR4 A;  4QVT A;  2PJ6 A;  3KR5 A;  2JDC A;  2GAN A;  3FEC A;  5GCN A;  4NEX A;  1Z8T A;  2ZW7 A;  1RXT A;  3KR4 A;  3RBU A;  6CPA A;  4KOV A;  3H5Z A;  3B35 A;  4FD7 A;  1CBX A;  2CIJ A;  5JM6 A;  1A2Z A;  3B3C A;  3CDX A;  2FIA A;  5I4M A;  4U5Y A;  3FIX A;  1Y9W A;  1UFH A;  3B3W A;  2ZOG A;  4I49 A;  3RZA A;  3N7Z A;  1HDU A;  4W9Y A;  2DF5 A;  4C2X A;  2CTC A;  4PV6 A;  1CP7 A;  3PRT A;  3QNV A;  2PRB A;  2PE3 A;  2WSA A;  2Z3K A;  5DWM A;  4UIB A;  3R9G A;  3UY5 A;  2V8V A;  4IF5 A;  4R6T A;  3WC6 A;  2PJ7 A;  2PQ8 A;  2VBQ A;  5DS0 A;  4UFX A;  3TO9 A;  1Q2Y A;  4M6H A;  1IY7 A;  2RFH A;  4Y49 B;  1F2P A;  2Z3N A;  4KVM E;  2ZEL A;  3EO4 A;  3RO0 A;  4CYQ A;  4CRY B;  2D4O A;  4MFZ A;  4P4B A;  2NSM A;  3IU2 A;  2V8H A;  1Y0Y A;  4KOW A;  2B4D A;  4MCS A;  4XNH B;  3VH9 A;  8CPA A;  4A37 A;  1YR0 A;  2ZPA A;  3SXO A;  5H86 A;  1LOK A;  1YME A;  2OB0 A;  4KVX A;  1XF8 A;  5THW A;  4ZYQ A;  3W91 A;  4GM5 A;  4KSF A;  4A39 A;  2BCO A;  3V38 A;  1S7L A;  2Z3L A;  5F46 A;  1M4I A;  1Z9U A;  2AFU A;  4NCZ A;  3CT9 A;  4ZI6 A;  2R7H A;  2ZEO A;  3K9T A;  2PJ9 A;  2YNE A;  3BJ8 A;  4KSI A;  5J8F A;  2HV2 A;  1ARL A;  1R57 A;  4ONU A;  3FED A;  2PJA A;  1S60 A;  4MHY A;  1ELM P;  1XEB A;  2YGW A;  1XMB A;  3IIB A;  4H2K A;  4CAX A;  3PGP A;  2REE A;  3FVL A;  2XEI A;  1YLO A;  2A4N A;  4G1P A;  2NMT A;  4KOR A;  1TKH A;  2PC1 A;  3TO6 A;  1BLL E;  3T8W A;  1Z2L A;  3I9S A;  4MHP A;  2J8N A;  1OZP A;  3P2F A;  1AYE A;  2VXK A;  2Y0M A;  1AMP A;  1VHE A;  3PB6 X;  4QUS A;  2FCK A;  4PXD A;  4UEF A;  2BSW A;  3D68 A;  5F48 A;  3VAR A;  4AVB A;  1P4N A;  3PB4 X;  4PK2 A;  3RYO A;  1Y7R A;  2GU2 A;  5ISV A;  3R9F A;  4C2Z A;  4EWT A;  2WPW A;  2FIW A;  2Q43 A;  1ON0 A;  4M6I A;  2Z10 A;  1S7K A;  4M85 A;  4PQA A;  2VZY A;  4OC4 A;  4UEE A;  2RC4 A;  2P0W A;  3CXP A;  5LYF A;  5J1Q A;  5CPA A;  1NMT A;  4KLV A;  2AFX A;  4ZY2 A;  2PJC A;  3JUW A;  2O28 A;  5LYI A;  3A9L A;  5K8P A;  4JXQ A;  1QSN A;  5LRK A;  7CPA A;  4BMH A;  3LMS A; 
#chains in the Genus database with same CATH homology
 2Q4Y A;  5EC4 A;  2ARH A;  3DR8 A;  2FS5 A;  4H89 A;  5E96 A;  5J8C A;  4MY3 A;  2FE7 A;  1MJB A;  4UCP A;  3FRM A;  2B5G B;  4XPD B;  2D4P A;  4PK3 A;  1QST A;  2IL4 A;  1ZO0 A;  4Q38 A;  2B3V A;  3D8P A;  3R9E A;  2VI7 A;  3FXT A;  4A2Z A;  1IYK A;  3I3G A;  1YK3 A;  2EUI A;  2AJ6 A;  4CS0 B;  3R95 A;  4OAD A;  4OLL A;  4FD5 A;  4YGO A;  4UFW A;  4MY0 A;  2CY2 A;  1MJ9 A;  3BJ7 A;  4F6A A;  1M1D A;  4KOS A;  1KUV A;  2REF A;  1IID A;  1Q2D A;  1IIC A;  4YRH A;  2Q7B A;  1I1D A;  2G3A A;  1IB1 E;  2Z0Z A;  1S7F A;  2F5I A;  4MFP A;  4U9Z A;  5G1Z A;  4PSW A;  2G3T A;  3IGR A;  4LUA A;  1BO4 A;  3C26 A;  4JD6 A;  3ZZI A;  2X7B A;  4OAE A;  2YNC A;  2VQY A;  5C88 A;  2Q4V A;  2ZXV A;  3WR7 A;  2BEI A;  2OU2 A;  3TT2 A;  1I21 A;  4MJ8 A;  2G0B A;  4CGM A;  4F0X A;  2J8R A;  1KUX A;  4E2A A;  3NE7 A;  3CXS A;  3T90 A;  3S6K A;  5KTD A;  4CYN A;  2PSW A;  3LD2 A;  2OZH A;  3W6S A;  4J3G A;  2WUU A;  1MJA A;  3GYA A;  4UBR A;  1VKC A;  4KS9 A;  5IV0 A;  3TO7 A;  5H84 A;  4MFQ A;  1Z4E A;  1YLE A;  4CGO A;  4F0Y A;  3VWE A;  3T9Y A;  2YNC C;  4UA3 A;  4A31 A;  4RI1 A;  2R1I A;  1YX0 A;  4X5K A;  1B87 A;  1S7N A;  2VZZ A;  4B5O A;  3F8K A;  4MBU A;  5CNP A;  3S6H A;  3TE4 A;  3LOD A;  5IX3 A;  1YRE A;  5DWN A;  2ZW5 A;  2C27 A;  5EBV A;  3GKR A;  4A30 A;  2I79 A;  4L89 A;  4CGL A;  4AVC A;  4XPK A;  4R3L A;  5A28 A;  4UCM A;  4XPD C;  2GE3 A;  4KOX A;  4UWJ A;  1L0C A;  1VHS A;  1NE9 A;  4NSQ A;  5F49 A;  2OZG A;  4MHD A;  2QIR A;  3PP9 A;  2R98 A;  2ZW6 A;  2FXF A;  1XE4 A;  1Z4R A;  2PR1 A;  3EC4 A;  3E0K A;  4KVO E;  5AG7 A;  1PU9 A;  3FB3 A;  4MFJ A;  3GY9 A;  1I12 A;  5AG6 A;  3QB8 A;  3FYN A;  2R8V A;  3V8I A;  3JVN A;  2CXA A;  4HNY B;  4AB7 A;  3G8W A;  3K9U A;  4NXY A;  4BBH A;  4C2Y A;  3FBU A;  2ZW4 A;  4HNX B;  5AG5 A;  2B3U A;  4L8A A;  4AG9 A;  1YVO A;  4PSX A;  5KTA A;  4JJX A;  2B4D B;  4AG7 A;  3TCV A;  2P6G A;  3P2H A;  1J4J A;  1Y9K A;  4R87 A;  4U9Y A;  4B14 A;  3G3S A;  2Z11 A;  2EVN A;  4RS2 A;  2Q04 A;  4B11 A;  4Q36 A;  4JWP A;  2QEC A;  4QC6 A;  4UCN A;  3EY5 A;  4Y49 C;  4FD6 A;  3KKW A;  5G20 A;  3W6X A;  1V0C A;  5JQ4 A;  4A33 A;  5G22 A;  4JXR A;  1TIQ A;  4XNH C;  1YVK A;  2PDO A;  2JEV A;  3R1K A;  1Q2C A;  3IU1 A;  3JTK A;  3DNS A;  4XPL A;  4CAW A;  1NSL A;  1IYL A;  1K4J A;  1MK4 A;  3IWE A;  2OZU A;  4JLY A;  1B6B A;  4CAE A;  2Z3M A;  4MFK A;  4E0A A;  1WK4 A;  5IB0 A;  4E8O A;  4KLW A;  2BUE A;  2B58 A;  5A27 A;  3F0A A;  2B5G A;  4CRZ B;  2FT0 A;  4C68 A;  1QSM A;  4B5P A;  4CAF A;  2J8M A;  1CJW A;  3IWG A;  3S6G A;  4B10 A;  4M3S A;  5C82 A;  1KUY A;  2DPS A;  2Z3P A;  2JDD A;  1LRZ A;  4YFJ A;  5AG4 A;  1S3Z A;  2P6F A;  2OH1 A;  1XMT A;  4KOT A;  5FVJ A;  4MI4 A;  1SQH A;  3OWC A;  4ZBG A;  4NF1 A;  2HUZ A;  2CNM A;  3TFY A;  2ATR A;  3R96 A;  5I0C A;  2CNT A;  4HNW B;  5HH1 A;  4UFV A;  2WPX A;  1WWZ A;  2B4B A;  3DDD A;  5HMN A;  2PR8 A;  1QSO A;  4H6U A;  1M4D A;  5G21 A;  4R9M A;  2DPT A;  4KOU A;  1XIX A;  5AGE A;  4MFL A;  4ZGY B;  3MGD A;  1M44 A;  4UWI A;  3F5B A;  3TOA A;  4AVA A;  4CGP A;  5BWA B;  4KSA A;  4R57 A;  2Z3O A;  1PUA A;  4QBJ A;  4CYP A;  1YGH A;  2AE6 A;  3CXQ A;  4R3K A;  4C7H A;  1P0H A;  1RO5 A;  2DXQ A;  3TTH A;  3EFA A;  3H4Q A;  3D2M A;  4II9 A;  1KZF A;  2Q44 A;  4A32 A;  1S5K A;  2BL1 A;  4A95 A;  3DSB A;  3VWD A;  3EXN A;  4KZT A;  4LX9 A;  4EVY A;  3ZJ0 A;  3S6F A;  4CAV A;  4B12 A;  3D2P A;  1N71 A;  4K30 A;  1GHE A;  4DNC A;  4FD4 A;  2HQY A;  2H5M A;  4CGN A;  2FL4 A;  2GIV A;  1CM0 A;  3FNC A;  3D3S A;  2JLM A;  2QML A;  2K5T A;  5KTC A;  4IUS A;  3BLN A;  3SXN A;  3PZJ A;  4B5P B;  1QSR A;  2P6E A;  4KUA A;  3DR6 A;  2Q0Y A;  1FY7 A;  1U6M A;  4KOY A;  2CNS A;  4QB9 A;  2YND A;  3QAH A;  2VEZ A;  4ORF A;  4B13 A;  4HKF A;  5JPH A;  4C7I A;  4KUB A;  5F47 A;  2KCW A;  4GS4 A;  3TOB A;  1M4G A;  1BOB A;  2I00 A;  4CYO A;  3SHP A;  4H6Z A;  3B8G A;  2FSR A;  4QVT A;  2JDC A;  2GAN A;  5GCN A;  4NEX A;  2ZW7 A;  1RXT A;  4KOV A;  3H5Z A;  4FD7 A;  2FIA A;  4U5Y A;  3FIX A;  1Y9W A;  1UFH A;  4I49 A;  3N7Z A;  4C2X A;  4PV6 A;  2PRB A;  2WSA A;  5DWM A;  2Z3K A;  3R9G A;  3UY5 A;  4IF5 A;  2PQ8 A;  2VBQ A;  4UFX A;  3TO9 A;  1Q2Y A;  4Y49 B;  2Z3N A;  4KVM E;  3EO4 A;  4CYQ A;  4CRY B;  2D4O A;  4MFZ A;  3IU2 A;  4KOW A;  2B4D A;  4XNH B;  1YR0 A;  2ZPA A;  3SXO A;  5H86 A;  2OB0 A;  4KVX A;  1XF8 A;  3W91 A;  4KSF A;  1S7L A;  2Z3L A;  5F46 A;  1M4I A;  1Z9U A;  4NCZ A;  2R7H A;  2YNE A;  3BJ8 A;  5J8F A;  2HV2 A;  1R57 A;  4ONU A;  1S60 A;  1XEB A;  2YGW A;  4CAX A;  3PGP A;  2REE A;  4KOR A;  2A4N A;  2NMT A;  2PC1 A;  3TO6 A;  3I9S A;  2J8N A;  1OZP A;  3P2F A;  2VXK A;  2Y0M A;  4QUS A;  2FCK A;  2BSW A;  4AVB A;  5F48 A;  1P4N A;  4PK2 A;  3RYO A;  1Y7R A;  5ISV A;  3R9F A;  4C2Z A;  2WPW A;  2FIW A;  1ON0 A;  2Z10 A;  1S7K A;  4M85 A;  2VZY A;  2RC4 A;  2P0W A;  3CXP A;  1NMT A;  4KLV A;  3JUW A;  2O28 A;  3A9L A;  4JXQ A;  1QSN A;  4BMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...