1IB1E

Crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
178
Chain Sequence
SGIPGSPGRQRRHLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14-3-3 ZETA ISOFORM
publication title Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 45
structure length 178
sequence length 179
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2001-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ib1E00
1GHEA 2ZW6A 2GE3A 4AB7A 1WK4A 1J4JA 2GIVA 4L89A 1OZPA 2R1IA 1PU9A 2Z0ZA 4JWPA 2ZW5A 4OAEA 4XPDC 1ON0A 2B3UA 5KTAA 2P6EA 1KZFA 4BMHA 4KORA 4E8OA 4QUSA 3SHPA 5F49A 2BEIA 2JLMA 2Q0YA 5FVJA 1BO4A 1FY7A 4NF1A 2JDDA 3N7ZA 2FL4A 1I21A 3IGRA 4MJ8A 4XPKA 1QSTA 4E0AA 2BL1A 4NEXA 5EBVA 2PQ8A 3PP9A 2ZW4A 1Q2YA 4E2AA 5IB0A 2J8MA 1M4IA 4KVOE 1IIDA 3QB8A 4B5PA 2ZXVA 1RXTA 3EFAA 1Q2CA 5H84A 2FIWA 2OZHA 4B5PB 1M4GA 4UA3A 4Y49C 2DXQA 4QC6A 2Q44A 4KOUA 1YREA 4ORFA 1S7FA 5ISVA 4R57A 4KOWA 4JD6A 4R9MA 3VWDA 4EVYA 1Z4EA 3FXTA 1RO5A 4FD4A 2Z11A 1V0CA 2B5GA 3I3GA 4M3SA 2FIAA 2FE7A 3P2HA 4RS2A 5C88A 2P0WA 3QAHA 2FXFA 3S6KA 2FCKA 2FS5A 2Q7BA 4KOSA 3F8KA 2BSWA 1Y7RA 1P4NA 1BOBA 5DWMA 4FD7A 5DWNA 3TT2A 1M1DA 5F48A 1S7NA 2HUZA 3D2MA 2KCWA 2FSRA 1QSOA 2VZYA 2QECA 4H6UA 3W6SA 2IL4A 1MK4A 2AE6A 3D3SA 2ZW7A 1B87A 1UFHA 4FD6A 4F6AA 5KTDA 4OADA 2OZUA 1R57A 1IYLA 1TIQA 5J8CA 5KTCA 1K4JA 2EUIA 2Y0MA 2P6FA 3D8PA 3DR6A 1S60A 4F0YA 3I9SA 5HMNA 1Q2DA 3E0KA 4CAVA 3TO9A 2PDOA 3D2PA 3B8GA 3OWCA 1Z4RA 1L0CA 4XPDB 5GCNA 4H6ZA 2WPWA 5IX3A 5E96A 2K5TA 4CAXA 4HKFA 2VQYA 3BJ8A 3S6GA 1IYKA 3T90A 4PK3A 4H89A 3R95A 3SXNA 4U9YA 2A4NA 1NMTA 3FBUA 3F0AA 4CRZB 3MGDA 2WPXA 2VZZA 2F5IA 3ZJ0A 3GKRA 2B3VA 1XMTA 5CNPA 4CS0B 1CM0A 2C27A 4QB9A 4MY0A 1XE4A 2I79A 3EY5A 2G0BA 2CNMA 1S7LA 2X7BA 1S5KA 3RYOA 4IUSA 4OLLA 3S6HA 2ARHA 2OU2A 3G3SA 1KUXA 2PC1A 2R7HA 4UWJA 3TFYA 2QMLA 2H5MA 2NMTA 4LUAA 1IICA 1M44A 1VHSA 4Y49B 1LRZA 4XNHC 4PSWA 2AJ6A 2P6GA 4KVME 2REEA 1S3ZA 2RC4A 3R96A 3K9UA 1M4DA 2JEVA 2CNSA 2B4BA 1YVKA 3WR7A 3H4QA 4RI1A 2FT0A 4NSQA 1WWZA 1U6MA 3TO6A 2PR1A 4FD5A 4YRHA 2G3AA 4JLYA 4IF5A 1YLEA 3T9YA 5EC4A 4AG7A 1VKCA 2O28A 1XIXA 3GY9A 3P2FA 3SXOA 1S7KA 4I49A 1YR0A 4QBJA 3DR8A 3GYAA 4KOVA 1Y9KA 5H86A 3JUWA 2Q04A 3UY5A 4AG9A 4KOXA 4ONUA 3FNCA 4II9A 3PZJA 1NSLA 1YGHA 4CRYB 1KUYA 2VXKA 4GS4A 1P0HA 3EXNA 2HV2A 2HQYA 4AVBA 2OB0A 2B4DA 2B58A 3BLNA 3EO4A 3IWGA 4MY3A 3V8IA 4YFJA 1Z9UA 4UBRA 2REFA 1PUAA 5F47A 3CXSA 4KUAA 2PSWA 5F46A 4KZTA 3F5BA 4NXYA 2Z10A 4DNCA 4MBUA 2B4DB 4KLVA 4U5YA 1YVOA 4PSXA 4JXQA 4YGOA 5C82A 3R9FA 3TO7A 3EC4A 2J8NA 4ZBGA 2EVNA 1MJAA 1QSRA 2CNTA 3TTHA 4R87A 4M85A 2I00A 1IB1E 2G3TA 4HNWB 2Q4VA 3FIXA 4J3GA 4K30A 3FRMA 3S6FA 1NE9A 1XEBA 3FYNA 4HNYB 4KLWA 3TOBA 3LD2A 3NE7A 3DSBA 2VI7A 4KUBA 3R9GA 1QSNA 2Q4YA 4AVCA 3TE4A 2D4PA 2QIRA 3TCVA 4XPLA 4X5KA 1KUVA 3CXPA 4R3KA 3JVNA 4MHDA 3FB3A 4PK2A 4LX9A 1MJBA 3TOAA 3DNSA 5JPHA 4U9ZA 3C26A 1MJ9A 1Y9WA 4JXRA 4XNHB 2J8RA 1I12A 5JQ4A 5IV0A 5J8FA 4PV6A 3G8WA 1XF8A 1B6BA 2CY2A 4QVTA 3BJ7A 4KVXA 4L8AA 2VBQA 1QSMA 1I1DA 2BUEA 2R98A 1SQHA 2R8VA 2B5GB 2ATRA 3W91A 3ZZIA 5I0CA 3KKWA 1YK3A 4NCZA 2D4OA 2PR8A 2OH1A 4R3LA 2VEZA 4UWIA 3R9EA 2JDCA 3W6XA 4CAWA 3VWEA 4AVAA 1YX0A 3CXQA 3LODA 2OZGA 4KOTA 5HH1A 1N71A 3R1KA 3PGPA 2PRBA 4JJXA 4MI4A 3DDDA 1CJWA 4HNXB 4B5OA 2GANA 4KOYA 2ZPAA
chains in the Genus database with same CATH superfamily
2PCUA 3KR5A 2J9AA 1GHEA 2QYVA 4PXCA 2ZW6A 2GE3A 5LYLA 2DPSA 4AB7A 1M4LA 1WK4A 3WC7A 1J4JA 2EK8A 2BO9A 2GIVA 1Y7EA 4L89A 1OZPA 2R1IA 5IB9A 2PVVA 1PU9A 2Z0ZA 4M6GA 4OIDA 3VARA 3HUVA 4JWPA 2ZW5A 1BPMA 4OAEA 4XPDC 3IFEA 1ON0A 1XBUA 2B3UA 5KTAA 2P6EA 1KZFA 4P4JA 4BMHA 1ZG9A 4KORA 4E8OA 4QUSA 4UCPA 2I3CA 4UEEA 2Z3KA 2AFOA 4C2ZA 2PJ8A 3B2YA 3SHPA 4CYQA 5F49A 2BEIA 4FBEA 2JLMA 1VIXA 2Q0YA 2C6PA 5FVJA 5BWAB 1BO4A 2FVGA 3PB7X 1FY7A 4NF1A 4NGNA 2JDDA 4OP4A 4UFVA 2CTBA 4MCQA 3N7ZA 5HVGA 2AFUA 2FL4A 5DS0A 1Y0YA 3FF3A 1TKJA 1I21A 3IGRA 4MJ8A 3JTKA 4XPKA 4F8ZA 1QSTA 1R3NA 4NGTA 1BAVA 4E0AA 4A33A 2BL1A 2ZEDA 4NEXA 5EBVA 3IWWA 2PQ8A 3QNVA 3PP9A 4CAFA 2ZW4A 1Q2YA 2BCOA 4E2AA 4DYOA 5IB0A 3V38A 4UIBA 2J8MA 2Z3MA 1M4IA 3RO0A 1TXRA 2C1CA 3LACA 4KVOE 1IIDA 3QB8A 5G1ZA 4B5PA 2ZXVA 4NJQA 3KASA 4C2YA 2ABZA 1LANA 5CBMA 1RXTA 3VATA 3EFAA 1LAPA 1Q2CA 3FEDA 5H84A 4DUKA 1KWMA 2FIWA 3FJUA 2OZHA 4ZY2A 2PE3A 1M4GA 3B3TA 4R8FA 4UA3A 3RAMA 4B5PB 5D29A 3S9LA 2Q4ZA 2DF5A 2YGWA 4Y49C 2DXQA 4QC6A 2Q44A 4KOUA 3TC8A 4LQ6A 4P4IA 4OC1A 4A31A 4UF4A 1PYTB 2CXAA 5THWA 1YREA 4ORFA 1S7FA 2DEAA 5ISVA 4R57A 4K3NA 4CYOA 4KOWA 2Z3OA 4JD6A 4R9MA 3VWDA 4EVYA 1Z4EA 4X3RA 3FXTA 1RO5A 4FD4A 3SJXA 3FEEA 1TKFA 2Z11A 1V0CA 2B5GA 4F9VA 1F2OA 4AXVA 1IGBA 2PJ4A 3B3CA 2WUUA 3I3GA 4M3SA 2FIAA 2FE7A 5LYFA 3P2HA 4RS2A 5C88A 4OKOA 5A27A 3DLJA 2ZEFA 2P0WA 3I1UA 3QAHA 2FXFA 2ANPA 3S6KA 2FCKA 4G1PA 2FS5A 2Q7BA 4EWTA 4KOSA 3F8KA 4IAVA 2BSWA 4TNUA 1XMBA 1Y7RA 4UIAA 4UCNA 1PCAA 1P4NA 4NGMA 1BOBA 5DWMA 4FD7A 4GXHA 5DWNA 3TT2A 4MFLA 1M1DA 5AG5A 3PBBA 1TF8A 4IHMA 5F48A 4UEFA 1S7NA 1XJOA 5A28A 3RBUA 4C68A 4M6IA 4B12A 1Y0RA 2PJ9A 1BLLE 2HUZA 5EMIA 4MCRA 3D2MA 2KCWA 2FSRA 1FNOA 1IOIA 1QSOA 2PVWA 2VZYA 2QECA 4H6UA 4PXDA 2IL4A 3W6SA 4KS9A 1X12A 1HDUA 1MK4A 2AE6A 3B7IA 2IMOA 3D3SA 2ZW7A 1B87A 1UFHA 4FD6A 4F6AA 5KTDA 3SJGA 4OADA 4MXUA 1NSAA 4MCSA 4O23A 4MRIA 2OZUA 1R57A 1IYLA 1TIQA 5J8CA 5KTCA 2JBJA 4ONWA 3H8EA 4OIWA 1K4JA 1YW6A 3B3VA 2EUIA 5J1QA 4JYWA 4CGPA 2Y0MA 2P6FA 4CYNA 3D8PA 1Z5RA 5LRKA 5AG7A 3L2NA 3DR6A 4CGMA 1S60A 4F0YA 1JWQA 3I9SA 3D7GA 4A32A 5HMNA 2O53A 1QMUA 1Q2DA 2C6CA 3E0KA 4CAVA 4DJLA 4NJRA 2YNEA 1XOVA 3TO9A 3IU1A 2GU2A 4P4EA 4ZYQA 2PDOA 1LAMA 3D2PA 3B8GA 4CYPA 2EBJA 3OWCA 1Z4RA 4NGPA 4FAIA 1L0CA 4XPDB 5GCNA 3H8GA 4H6ZA 2WPWA 5IX3A 2F8HA 3D7HA 5E96A 2PJBA 3PEIA 2K5TA 3MRUA 4CAXA 4HKFA 2VQYA 3BJ8A 3RZAA 3S6GA 1BPNA 3NA6A 5D8NA 1IYKA 3QAYA 3T90A 5HVFA 4PK3A 5K8NA 4H89A 3R95A 2PIZA 5HVHA 1IU8A 2ODFA 4FUUA 3CDXA 2XEIA 4MCPA 4RN7A 4U9YA 2A4NA 2RFHA 2WZNA 4Q7AA 1NMTA 3FBUA 3F0AA 5AGEA 1CP7A 3NH5A 4P4DA 3MGDA 4CRZB 2WPXA 1LFWA 1LCPA 5JH9A 2VZZA 1Z8XA 3BI0A 2F5IA 3ZJ0A 3FECA 3IIBA 4H2KA 4MFZA 4PXEA 1YQEA 3GKRA 1Z8TA 2B3VA 2GFQA 1XMTA 2CF4A 5CNPA 4CS0B 1CM0A 2C27A 4QB9A 4MY0A 1XE4A 2I79A 3BHXA 3EY5A 2G0BA 1Q7LA 1YMEA 4OMEA 2CNMA 1S7LA 2X7BA 3FVLA 1S5KA 1H8LA 3PFOA 1DE4C 3RYOA 2ZEEA 3CT9A 4IUSA 3VH9A 2PJ5A 3GUXA 3B3SA 4OLLA 5CPAA 2PJ2A 2QVPA 4C7IA 3S6HA 3A9LA 4CPAA 4BD9A 1AMPA 2ARHA 2Z3PA 2AFSA 2DPTA 2OU2A 2V8HA 1KUXA 2PC1A 3G3SA 2R7HA 4UWJA 1JQGA 3FH4A 3TFYA 3BXMA 3NFZA 4A37A 2QMLA 2H5MA 2NMTA 4LUAA 1IICA 3D67A 1M44A 1VHSA 4Y49B 3D7DA 1LRZA 3SI0A 3D66A 3PB4X 3KGQA 4XNHC 5I4MA 4PSWA 2EWBA 4LQGA 3FX6A 2AJ6A 3WC6A 1LOKA 2P6GA 1TKHA 4KVME 4MFJA 4ZY0A 2EO8A 2YNCC 2ZEGA 5JGFA 2REEA 1S3ZA 2O4HA 2RC4A 4OC5A 2PJ6A 3KZWA 3LMSA 4CAEA 5G22A 2GLJA 3R96A 1OBRA 4A39A 2QJ8A 3CPXA 3GLJA 3K9UA 1M4DA 1ARMA 2JEVA 2CNSA 2B4BA 4RUHA 1YVKA 4X2TA 4MFKA 3WR7A 3H4QA 4RI1A 2FT0A 4NSQA 1U6MA 1WWZA 2Z3NA 5AG6A 3TO6A 4A94A 2PR1A 5LYIA 4FD5A 2OR4A 4YRHA 4CGNA 2G3AA 4PPZA 1YSJA 4B13A 4JLYA 1VHOA 1X10A 2F7VA 3MN8A 2PJ1A 4IF5A 3RNZA 2CIJA 1YLEA 4R7MA 1Z8LA 4OC0A 3JRUA 5EC4A 3SI2A 3T9YA 1DTDA 4YU9A 4OC3A 4AG7A 1VKCA 2O28A 1YLOA 3IO1A 1XIXA 4HPSA 4B11A 3GY9A 3P2FA 3SXOA 1S7KA 2Q7SA 4I49A 5G21A 2ZENA 4R76A 1UWYA 3DGVA 1YR0A 4CGLA 4QBJA 3WT4A 3DR8A 3IC1A 3GYAA 4KOVA 1Y9KA 2RB7A 4MHYA 1QQ9A 2V8GA 3JUWA 4Q38A 3CZXA 5H86A 2Q04A 3S9MA 3H8FA 4KSAA 1ELLP 2AFWA 4WWVA 5G20A 3KHXA 3UY5A 4AG9A 4KOXA 1CPSA 3T8WA 4P44A 4A30A 4ONUA 8CPAA 3FNCA 3V7ZA 5K8PA 3S9NA 4II9A 1ZG7A 3HLPA 4MFQA 3PZJA 1NSLA 3PB8X 4B14A 1YGHA 2POKA 4PXBA 2ZEOA 4CRYB 2PJ7A 1CPXA 1KUYA 2VXKA 1ELMP 4GS4A 1P0HA 3EXNA 2HV2A 2EK9A 2HQYA 4B6ZA 1VHEA 1R43A 4AVBA 2OB0A 2V8VA 2B4DA 2B58A 3BLNA 3EO4A 3IWGA 4MY3A 4NGRA 1F57A 3V8IA 4YFJA 1Z9UA 4UBRA 3PFEA 2REFA 1PUAA 4JZ0A 5F47A 4BBHA 3CXSA 2ZEMA 3KHZA 4KUAA 4F9UA 2PSWA 7CPAA 4KZTA 5F46A 3F5BA 1CBXA 3IJ3A 4NXYA 3PB6X 2PJAA 2Z10A 4DNCA 3WABA 4MBUA 4ZGYB 2B4DB 4KLVA 1HDQA 2VL1A 4U5YA 1YVOA 4PSXA 2ZEPA 4JXQA 4A38A 4MHNA 3CPAA 4YGOA 5LRGA 3R9FA 3SXNA 2JEWA 3TO7A 5C82A 3EC4A 2PJ0A 4TWEA 3SI1A 3BI1A 2J8NA 4ZBGA 5K8OA 2EVNA 3WC5A 1MJAA 1QSRA 3D68A 2CNTA 2NYQA 2IJZA 3TTHA 2XEFA 3FMCA 1VGYA 4FWUA 3K2KA 4M85A 2I00A 4R87A 3ISXA 1IB1E 2Q51A 2G3TA 3KI9A 4Z65A 4HNWB 2AFMA 2Q4VA 3FIXA 4ZX9A 3N5FA 4A95A 4J3GA 3ISZA 4K30A 3FRMA 4UCMA 1IOFA 3S6FA 1FT7A 4A2ZA 1NE9A 1XEBA 3FYNA 4HNYB 4P10A 4KLWA 3TOBA 3LD2A 1IY7A 1AUGA 3NE7A 3DSBA 2VI7A 4KUBA 3NH4A 5LRJA 4ZI6A 1EE3P 4KSFA 1RTQA 1QSNA 2XEJA 4R6TA 3R9GA 2PJ3A 2Q4YA 2AFZA 4Q36A 4AVCA 4F0XA 3TE4A 2D4PA 3NE8A 2ZOGA 2QIRA 4OC4A 1Z8WA 4P4FA 3TCVA 4BINA 4XPLA 4X5KA 1A2ZA 1AYEA 1KUVA 3B3WA 2AFXA 3CXPA 3PRTA 4R3KA 1HEEA 3JVNA 4MHDA 3FB3A 4PK2A 4LX9A 2JBKA 4MHZA 1MJBA 3TOAA 3KR4A 3DNSA 4UFXA 5JPHA 4M6HA 2YNCA 4U9ZA 2GREA 3C26A 4MMOA 1MJ9A 1Y9WA 2BOAA 4JXRA 4PQAA 4XNHB 6CPAA 2J8RA 2XEGA 4ZX8A 1I12A 1Z2LA 4ZY1A 5JQ4A 2Q43A 3PB9X 5IV0A 5ELYA 5J8FA 4PV6A 3D7FA 5LYDA 3G8WA 1XF8A 3GB0A 1B6BA 2CY2A 4QVTA 3BJ7A 4KVXA 2V8DA 1CX8A 2PIYA 2ZELA 2ZOFA 2V77A 4L8AA 3IWEA 4UFWA 5JM6A 4NFRA 3D4UA 3B35A 4CGOA 3K9TA 2VBQA 1QSMA 2OOTA 1I1DA 2BUEA 2R98A 1ARLA 1SQHA 2R8VA 4YWYA 3GIUA 3IEHA 2B5GB 2IQ6A 4MFPA 4W9YA 4EMEA 1ZLHA 2ATRA 3W91A 3ZZIA 1ZLIA 5I0CA 1F2PA 2PJCA 5F09A 3IU2A 3KKWA 4P45A 5HXDA 4EFDA 5K8MA 1YK3A 2WSAA 4NCZA 2D4OA 2PR8A 3LWUA 2OH1A 4P4BA 2VEZA 4R3LA 2PRQA 4WJBA 2C6GA 4C7HA 4UWIA 4MHPA 3R9EA 2JDCA 3KQXA 3W6XA 4CAWA 2YNDA 2ZEHA 3VWEA 4IK2A 2WYRA 4AVAA 2GLFA 1YX0A 1ZO0A 3PBEA 4B10A 3TX8A 1XRYA 3CXQA 3LODA 4NGQA 1TF9A 2OZGA 4OC2A 4GM5A 2HB6A 4KOTA 1CP6A 2Z3LA 3KL9A 2G9DA 4NGSA 5HH1A 4C2XA 1N71A 4KSIA 3R1KA 5AG4A 3PGPA 1ZG8A 2NSMA 2HC9A 2PRBA 4JJXA 3SJEA 3H5ZA 3SJFA 1XFOA 3NH8A 1CG2A 4P6YA 4MI4A 1YW4A 3DDDA 1CJWA 4UEZA 4HNXB 4X8IA 4B5OA 3KQZA 2CTCA 2GANA 4KOYA 2ZPAA 1GYTA
chains in the Genus database with same CATH topology
1GHEA 2ZW6A 2GE3A 2DPSA 4AB7A 1WK4A 1J4JA 2GIVA 4L89A 1OZPA 2R1IA 1PU9A 2Z0ZA 4JWPA 2ZW5A 4OAEA 4XPDC 1ON0A 2B3UA 5KTAA 2P6EA 1KZFA 4BMHA 4KORA 4E8OA 4QUSA 4UCPA 2Z3KA 4C2ZA 3SHPA 4CYQA 5F49A 2BEIA 2JLMA 2Q0YA 5FVJA 5BWAB 1BO4A 1FY7A 4NF1A 2JDDA 4UFVA 3N7ZA 2FL4A 1I21A 3IGRA 4MJ8A 3JTKA 4XPKA 1QSTA 4E0AA 4A33A 2BL1A 4NEXA 5EBVA 2PQ8A 4CAFA 3PP9A 2ZW4A 1Q2YA 4E2AA 5IB0A 2J8MA 2Z3MA 1M4IA 4KVOE 1IIDA 3QB8A 5G1ZA 4B5PA 2ZXVA 4C2YA 1RXTA 3EFAA 1Q2CA 5H84A 2FIWA 2OZHA 4B5PB 1M4GA 4UA3A 2YGWA 4Y49C 2DXQA 4QC6A 2Q44A 4KOUA 4A31A 2CXAA 1YREA 4ORFA 1S7FA 5ISVA 4R57A 4CYOA 4KOWA 2Z3OA 4JD6A 4R9MA 3VWDA 4EVYA 1Z4EA 3FXTA 1RO5A 4FD4A 2Z11A 1V0CA 2B5GA 3I3GA 4M3SA 2WUUA 2FIAA 2FE7A 3P2HA 4RS2A 5C88A 5A27A 2P0WA 3QAHA 2FXFA 3S6KA 2FCKA 2FS5A 2Q7BA 4KOSA 3F8KA 2BSWA 1Y7RA 4UCNA 1P4NA 1BOBA 5DWMA 4FD7A 5DWNA 3TT2A 4MFLA 1M1DA 5AG5A 5A28A 5F48A 1S7NA 4C68A 4B12A 2HUZA 3D2MA 2KCWA 2FSRA 1QSOA 2VZYA 2QECA 4H6UA 3W6SA 2IL4A 4KS9A 1MK4A 2AE6A 3D3SA 2ZW7A 1B87A 1UFHA 4FD6A 4F6AA 5KTDA 4OADA 2OZUA 1R57A 1IYLA 1TIQA 5J8CA 5KTCA 1K4JA 2EUIA 4CGPA 2Y0MA 2P6FA 4CYNA 3D8PA 5AG7A 3DR6A 4CGMA 1S60A 4F0YA 3I9SA 4A32A 5HMNA 1Q2DA 3E0KA 4CAVA 2YNEA 3TO9A 3IU1A 2PDOA 3D2PA 3B8GA 4CYPA 3OWCA 1Z4RA 1L0CA 4XPDB 5GCNA 4H6ZA 2WPWA 5IX3A 5E96A 2K5TA 4CAXA 4HKFA 2VQYA 3BJ8A 3S6GA 1IYKA 3T90A 4PK3A 4H89A 3R95A 3SXNA 4U9YA 2A4NA 1NMTA 3FBUA 3F0AA 5AGEA 4CRZB 3MGDA 2WPXA 2VZZA 2F5IA 3ZJ0A 3GKRA 2B3VA 1XMTA 5CNPA 4CS0B 1CM0A 2C27A 4QB9A 4MY0A 1XE4A 2I79A 3EY5A 2G0BA 2CNMA 1S7LA 2X7BA 1S5KA 3RYOA 4IUSA 4OLLA 4C7IA 3S6HA 3A9LA 2ARHA 2Z3PA 2OU2A 2DPTA 3G3SA 1KUXA 2PC1A 2R7HA 4UWJA 3TFYA 2QMLA 2H5MA 2NMTA 4LUAA 1IICA 1M44A 1VHSA 4Y49B 1LRZA 4XNHC 4PSWA 2AJ6A 2P6GA 4KVME 4MFJA 2YNCC 2REEA 1S3ZA 2RC4A 4CAEA 5G22A 3R96A 3K9UA 1M4DA 2JEVA 2CNSA 2B4BA 1YVKA 4MFKA 3WR7A 3H4QA 4RI1A 2FT0A 4NSQA 1WWZA 1U6MA 2Z3NA 5AG6A 3TO6A 2PR1A 4FD5A 4YRHA 4CGNA 2G3AA 4B13A 4JLYA 4IF5A 1YLEA 3T9YA 5EC4A 4AG7A 1VKCA 2O28A 4B11A 1XIXA 3GY9A 3P2FA 3SXOA 1S7KA 4I49A 5G21A 1YR0A 4CGLA 4QBJA 3DR8A 3GYAA 4KOVA 1Y9KA 4Q38A 5H86A 3JUWA 2Q04A 4KSAA 5G20A 3UY5A 4AG9A 4KOXA 4A30A 4ONUA 3FNCA 4II9A 4MFQA 3PZJA 1NSLA 4B14A 1YGHA 4CRYB 1KUYA 2VXKA 4GS4A 1P0HA 3EXNA 2HV2A 2HQYA 4AVBA 2OB0A 2B4DA 2B58A 3BLNA 3EO4A 3IWGA 4MY3A 3V8IA 4YFJA 1Z9UA 4UBRA 2REFA 1PUAA 5F47A 4BBHA 3CXSA 4KUAA 2PSWA 5F46A 4KZTA 3F5BA 4NXYA 2Z10A 4DNCA 4MBUA 4ZGYB 2B4DB 4KLVA 4U5YA 1YVOA 4PSXA 4JXQA 4YGOA 5C82A 3R9FA 3TO7A 3EC4A 2J8NA 4ZBGA 2EVNA 1MJAA 1QSRA 2CNTA 3TTHA 4R87A 4M85A 2I00A 1IB1E 2G3TA 4HNWB 2Q4VA 3FIXA 4A95A 4J3GA 4K30A 3FRMA 4UCMA 3S6FA 4A2ZA 1NE9A 1XEBA 3FYNA 4HNYB 4KLWA 3TOBA 3LD2A 3NE7A 3DSBA 2VI7A 4KUBA 4KSFA 3R9GA 1QSNA 2Q4YA 4Q36A 4AVCA 4F0XA 3TE4A 2D4PA 2QIRA 3TCVA 4XPLA 4X5KA 1KUVA 3CXPA 4R3KA 3JVNA 4MHDA 3FB3A 4PK2A 4LX9A 1MJBA 3TOAA 3DNSA 4UFXA 5JPHA 4U9ZA 2YNCA 3C26A 1MJ9A 1Y9WA 4JXRA 4XNHB 2J8RA 1I12A 5JQ4A 5IV0A 5J8FA 4PV6A 3G8WA 1XF8A 1B6BA 2CY2A 4QVTA 3BJ7A 4KVXA 4L8AA 3IWEA 4UFWA 4CGOA 2VBQA 1QSMA 1I1DA 2BUEA 2R98A 1SQHA 2R8VA 2B5GB 4MFPA 2ATRA 3W91A 3ZZIA 5I0CA 3IU2A 3KKWA 1YK3A 2WSAA 4NCZA 2D4OA 2PR8A 2OH1A 4R3LA 2VEZA 4C7HA 4UWIA 3R9EA 2JDCA 3W6XA 4CAWA 2YNDA 3VWEA 4AVAA 1YX0A 1ZO0A 4B10A 3CXQA 3LODA 2OZGA 4KOTA 2Z3LA 5HH1A 4C2XA 1N71A 3R1KA 5AG4A 3PGPA 2PRBA 4JJXA 3H5ZA 4MI4A 3DDDA 1CJWA 4HNXB 4B5OA 2GANA 4KOYA 2ZPAA 4MFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHE A;  2ZW6 A;  2GE3 A;  4AB7 A;  1WK4 A;  1J4J A;  2GIV A;  4L89 A;  1OZP A;  2R1I A;  1PU9 A;  2Z0Z A;  4JWP A;  2ZW5 A;  4OAE A;  4XPD C;  1ON0 A;  2B3U A;  5KTA A;  2P6E A;  1KZF A;  4BMH A;  4KOR A;  4E8O A;  4QUS A;  3SHP A;  5F49 A;  2BEI A;  2JLM A;  2Q0Y A;  5FVJ A;  1BO4 A;  1FY7 A;  4NF1 A;  2JDD A;  3N7Z A;  2FL4 A;  1I21 A;  3IGR A;  4MJ8 A;  4XPK A;  1QST A;  4E0A A;  2BL1 A;  4NEX A;  5EBV A;  2PQ8 A;  3PP9 A;  2ZW4 A;  1Q2Y A;  4E2A A;  5IB0 A;  2J8M A;  1M4I A;  4KVO E;  1IID A;  3QB8 A;  4B5P A;  2ZXV A;  1RXT A;  3EFA A;  1Q2C A;  5H84 A;  2FIW A;  2OZH A;  4B5P B;  1M4G A;  4UA3 A;  4Y49 C;  2DXQ A;  4QC6 A;  2Q44 A;  4KOU A;  1YRE A;  4ORF A;  1S7F A;  5ISV A;  4R57 A;  4KOW A;  4JD6 A;  4R9M A;  3VWD A;  4EVY A;  1Z4E A;  3FXT A;  1RO5 A;  4FD4 A;  2Z11 A;  1V0C A;  2B5G A;  3I3G A;  4M3S A;  2FIA A;  2FE7 A;  3P2H A;  4RS2 A;  5C88 A;  2P0W A;  3QAH A;  2FXF A;  3S6K A;  2FCK A;  2FS5 A;  2Q7B A;  4KOS A;  3F8K A;  2BSW A;  1Y7R A;  1P4N A;  1BOB A;  5DWM A;  4FD7 A;  5DWN A;  3TT2 A;  1M1D A;  5F48 A;  1S7N A;  2HUZ A;  3D2M A;  2KCW A;  2FSR A;  1QSO A;  2VZY A;  2QEC A;  4H6U A;  3W6S A;  2IL4 A;  1MK4 A;  2AE6 A;  3D3S A;  2ZW7 A;  1B87 A;  1UFH A;  4FD6 A;  4F6A A;  5KTD A;  4OAD A;  2OZU A;  1R57 A;  1IYL A;  1TIQ A;  5J8C A;  5KTC A;  1K4J A;  2EUI A;  2Y0M A;  2P6F A;  3D8P A;  3DR6 A;  1S60 A;  4F0Y A;  3I9S A;  5HMN A;  1Q2D A;  3E0K A;  4CAV A;  3TO9 A;  2PDO A;  3D2P A;  3B8G A;  3OWC A;  1Z4R A;  1L0C A;  4XPD B;  5GCN A;  4H6Z A;  2WPW A;  5IX3 A;  5E96 A;  2K5T A;  4CAX A;  4HKF A;  2VQY A;  3BJ8 A;  3S6G A;  1IYK A;  3T90 A;  4PK3 A;  4H89 A;  3R95 A;  3SXN A;  4U9Y A;  2A4N A;  1NMT A;  3FBU A;  3F0A A;  4CRZ B;  3MGD A;  2WPX A;  2VZZ A;  2F5I A;  3ZJ0 A;  3GKR A;  2B3V A;  1XMT A;  5CNP A;  4CS0 B;  1CM0 A;  2C27 A;  4QB9 A;  4MY0 A;  1XE4 A;  2I79 A;  3EY5 A;  2G0B A;  2CNM A;  1S7L A;  2X7B A;  1S5K A;  3RYO A;  4IUS A;  4OLL A;  3S6H A;  2ARH A;  2OU2 A;  3G3S A;  1KUX A;  2PC1 A;  2R7H A;  4UWJ A;  3TFY A;  2QML A;  2H5M A;  2NMT A;  4LUA A;  1IIC A;  1M44 A;  1VHS A;  4Y49 B;  1LRZ A;  4XNH C;  4PSW A;  2AJ6 A;  2P6G A;  4KVM E;  2REE A;  1S3Z A;  2RC4 A;  3R96 A;  3K9U A;  1M4D A;  2JEV A;  2CNS A;  2B4B A;  1YVK A;  3WR7 A;  3H4Q A;  4RI1 A;  2FT0 A;  4NSQ A;  1WWZ A;  1U6M A;  3TO6 A;  2PR1 A;  4FD5 A;  4YRH A;  2G3A A;  4JLY A;  4IF5 A;  1YLE A;  3T9Y A;  5EC4 A;  4AG7 A;  1VKC A;  2O28 A;  1XIX A;  3GY9 A;  3P2F A;  3SXO A;  1S7K A;  4I49 A;  1YR0 A;  4QBJ A;  3DR8 A;  3GYA A;  4KOV A;  1Y9K A;  5H86 A;  3JUW A;  2Q04 A;  3UY5 A;  4AG9 A;  4KOX A;  4ONU A;  3FNC A;  4II9 A;  3PZJ A;  1NSL A;  1YGH A;  4CRY B;  1KUY A;  2VXK A;  4GS4 A;  1P0H A;  3EXN A;  2HV2 A;  2HQY A;  4AVB A;  2OB0 A;  2B4D A;  2B58 A;  3BLN A;  3EO4 A;  3IWG A;  4MY3 A;  3V8I A;  4YFJ A;  1Z9U A;  4UBR A;  2REF A;  1PUA A;  5F47 A;  3CXS A;  4KUA A;  2PSW A;  5F46 A;  4KZT A;  3F5B A;  4NXY A;  2Z10 A;  4DNC A;  4MBU A;  2B4D B;  4KLV A;  4U5Y A;  1YVO A;  4PSX A;  4JXQ A;  4YGO A;  5C82 A;  3R9F A;  3TO7 A;  3EC4 A;  2J8N A;  4ZBG A;  2EVN A;  1MJA A;  1QSR A;  2CNT A;  3TTH A;  4R87 A;  4M85 A;  2I00 A;  1IB1 E;  2G3T A;  4HNW B;  2Q4V A;  3FIX A;  4J3G A;  4K30 A;  3FRM A;  3S6F A;  1NE9 A;  1XEB A;  3FYN A;  4HNY B;  4KLW A;  3TOB A;  3LD2 A;  3NE7 A;  3DSB A;  2VI7 A;  4KUB A;  3R9G A;  1QSN A;  2Q4Y A;  4AVC A;  3TE4 A;  2D4P A;  2QIR A;  3TCV A;  4XPL A;  4X5K A;  1KUV A;  3CXP A;  4R3K A;  3JVN A;  4MHD A;  3FB3 A;  4PK2 A;  4LX9 A;  1MJB A;  3TOA A;  3DNS A;  5JPH A;  4U9Z A;  3C26 A;  1MJ9 A;  1Y9W A;  4JXR A;  4XNH B;  2J8R A;  1I12 A;  5JQ4 A;  5IV0 A;  5J8F A;  4PV6 A;  3G8W A;  1XF8 A;  1B6B A;  2CY2 A;  4QVT A;  3BJ7 A;  4KVX A;  4L8A A;  2VBQ A;  1QSM A;  1I1D A;  2BUE A;  2R98 A;  1SQH A;  2R8V A;  2B5G B;  2ATR A;  3W91 A;  3ZZI A;  5I0C A;  3KKW A;  1YK3 A;  4NCZ A;  2D4O A;  2PR8 A;  2OH1 A;  4R3L A;  2VEZ A;  4UWI A;  3R9E A;  2JDC A;  3W6X A;  4CAW A;  3VWE A;  4AVA A;  1YX0 A;  3CXQ A;  3LOD A;  2OZG A;  4KOT A;  5HH1 A;  1N71 A;  3R1K A;  3PGP A;  2PRB A;  4JJX A;  4MI4 A;  3DDD A;  1CJW A;  4HNX B;  4B5O A;  2GAN A;  4KOY A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 2PCU A;  3KR5 A;  2J9A A;  1GHE A;  2QYV A;  4PXC A;  2ZW6 A;  2GE3 A;  5LYL A;  2DPS A;  4AB7 A;  1M4L A;  1WK4 A;  3WC7 A;  1J4J A;  2EK8 A;  2BO9 A;  2GIV A;  1Y7E A;  4L89 A;  1OZP A;  2R1I A;  5IB9 A;  2PVV A;  1PU9 A;  2Z0Z A;  4M6G A;  4OID A;  3VAR A;  3HUV A;  4JWP A;  2ZW5 A;  1BPM A;  4OAE A;  4XPD C;  3IFE A;  1ON0 A;  1XBU A;  2B3U A;  5KTA A;  2P6E A;  1KZF A;  4P4J A;  4BMH A;  1ZG9 A;  4KOR A;  4E8O A;  4QUS A;  4UCP A;  2I3C A;  4UEE A;  2Z3K A;  2AFO A;  4C2Z A;  2PJ8 A;  3B2Y A;  3SHP A;  4CYQ A;  5F49 A;  2BEI A;  4FBE A;  2JLM A;  1VIX A;  2Q0Y A;  2C6P A;  5FVJ A;  5BWA B;  1BO4 A;  2FVG A;  3PB7 X;  1FY7 A;  4NF1 A;  4NGN A;  2JDD A;  4OP4 A;  4UFV A;  2CTB A;  4MCQ A;  3N7Z A;  5HVG A;  2AFU A;  2FL4 A;  5DS0 A;  1Y0Y A;  3FF3 A;  1TKJ A;  1I21 A;  3IGR A;  4MJ8 A;  3JTK A;  4XPK A;  4F8Z A;  1QST A;  1R3N A;  4NGT A;  1BAV A;  4E0A A;  4A33 A;  2BL1 A;  2ZED A;  4NEX A;  5EBV A;  3IWW A;  2PQ8 A;  3QNV A;  3PP9 A;  4CAF A;  2ZW4 A;  1Q2Y A;  2BCO A;  4E2A A;  4DYO A;  5IB0 A;  3V38 A;  4UIB A;  2J8M A;  2Z3M A;  1M4I A;  3RO0 A;  1TXR A;  2C1C A;  3LAC A;  4KVO E;  1IID A;  3QB8 A;  5G1Z A;  4B5P A;  2ZXV A;  4NJQ A;  3KAS A;  4C2Y A;  2ABZ A;  1LAN A;  5CBM A;  1RXT A;  3VAT A;  3EFA A;  1LAP A;  1Q2C A;  3FED A;  5H84 A;  4DUK A;  1KWM A;  2FIW A;  3FJU A;  2OZH A;  4ZY2 A;  2PE3 A;  1M4G A;  3B3T A;  4R8F A;  4UA3 A;  3RAM A;  4B5P B;  5D29 A;  3S9L A;  2Q4Z A;  2DF5 A;  2YGW A;  4Y49 C;  2DXQ A;  4QC6 A;  2Q44 A;  4KOU A;  3TC8 A;  4LQ6 A;  4P4I A;  4OC1 A;  4A31 A;  4UF4 A;  1PYT B;  2CXA A;  5THW A;  1YRE A;  4ORF A;  1S7F A;  2DEA A;  5ISV A;  4R57 A;  4K3N A;  4CYO A;  4KOW A;  2Z3O A;  4JD6 A;  4R9M A;  3VWD A;  4EVY A;  1Z4E A;  4X3R A;  3FXT A;  1RO5 A;  4FD4 A;  3SJX A;  3FEE A;  1TKF A;  2Z11 A;  1V0C A;  2B5G A;  4F9V A;  1F2O A;  4AXV A;  1IGB A;  2PJ4 A;  3B3C A;  2WUU A;  3I3G A;  4M3S A;  2FIA A;  2FE7 A;  5LYF A;  3P2H A;  4RS2 A;  5C88 A;  4OKO A;  5A27 A;  3DLJ A;  2ZEF A;  2P0W A;  3I1U A;  3QAH A;  2FXF A;  2ANP A;  3S6K A;  2FCK A;  4G1P A;  2FS5 A;  2Q7B A;  4EWT A;  4KOS A;  3F8K A;  4IAV A;  2BSW A;  4TNU A;  1XMB A;  1Y7R A;  4UIA A;  4UCN A;  1PCA A;  1P4N A;  4NGM A;  1BOB A;  5DWM A;  4FD7 A;  4GXH A;  5DWN A;  3TT2 A;  4MFL A;  1M1D A;  5AG5 A;  3PBB A;  1TF8 A;  4IHM A;  5F48 A;  4UEF A;  1S7N A;  1XJO A;  5A28 A;  3RBU A;  4C68 A;  4M6I A;  4B12 A;  1Y0R A;  2PJ9 A;  1BLL E;  2HUZ A;  5EMI A;  4MCR A;  3D2M A;  2KCW A;  2FSR A;  1FNO A;  1IOI A;  1QSO A;  2PVW A;  2VZY A;  2QEC A;  4H6U A;  4PXD A;  2IL4 A;  3W6S A;  4KS9 A;  1X12 A;  1HDU A;  1MK4 A;  2AE6 A;  3B7I A;  2IMO A;  3D3S A;  2ZW7 A;  1B87 A;  1UFH A;  4FD6 A;  4F6A A;  5KTD A;  3SJG A;  4OAD A;  4MXU A;  1NSA A;  4MCS A;  4O23 A;  4MRI A;  2OZU A;  1R57 A;  1IYL A;  1TIQ A;  5J8C A;  5KTC A;  2JBJ A;  4ONW A;  3H8E A;  4OIW A;  1K4J A;  1YW6 A;  3B3V A;  2EUI A;  5J1Q A;  4JYW A;  4CGP A;  2Y0M A;  2P6F A;  4CYN A;  3D8P A;  1Z5R A;  5LRK A;  5AG7 A;  3L2N A;  3DR6 A;  4CGM A;  1S60 A;  4F0Y A;  1JWQ A;  3I9S A;  3D7G A;  4A32 A;  5HMN A;  2O53 A;  1QMU A;  1Q2D A;  2C6C A;  3E0K A;  4CAV A;  4DJL A;  4NJR A;  2YNE A;  1XOV A;  3TO9 A;  3IU1 A;  2GU2 A;  4P4E A;  4ZYQ A;  2PDO A;  1LAM A;  3D2P A;  3B8G A;  4CYP A;  2EBJ A;  3OWC A;  1Z4R A;  4NGP A;  4FAI A;  1L0C A;  4XPD B;  5GCN A;  3H8G A;  4H6Z A;  2WPW A;  5IX3 A;  2F8H A;  3D7H A;  5E96 A;  2PJB A;  3PEI A;  2K5T A;  3MRU A;  4CAX A;  4HKF A;  2VQY A;  3BJ8 A;  3RZA A;  3S6G A;  1BPN A;  3NA6 A;  5D8N A;  1IYK A;  3QAY A;  3T90 A;  5HVF A;  4PK3 A;  5K8N A;  4H89 A;  3R95 A;  2PIZ A;  5HVH A;  1IU8 A;  2ODF A;  4FUU A;  3CDX A;  2XEI A;  4MCP A;  4RN7 A;  4U9Y A;  2A4N A;  2RFH A;  2WZN A;  4Q7A A;  1NMT A;  3FBU A;  3F0A A;  5AGE A;  1CP7 A;  3NH5 A;  4P4D A;  3MGD A;  4CRZ B;  2WPX A;  1LFW A;  1LCP A;  5JH9 A;  2VZZ A;  1Z8X A;  3BI0 A;  2F5I A;  3ZJ0 A;  3FEC A;  3IIB A;  4H2K A;  4MFZ A;  4PXE A;  1YQE A;  3GKR A;  1Z8T A;  2B3V A;  2GFQ A;  1XMT A;  2CF4 A;  5CNP A;  4CS0 B;  1CM0 A;  2C27 A;  4QB9 A;  4MY0 A;  1XE4 A;  2I79 A;  3BHX A;  3EY5 A;  2G0B A;  1Q7L A;  1YME A;  4OME A;  2CNM A;  1S7L A;  2X7B A;  3FVL A;  1S5K A;  1H8L A;  3PFO A;  1DE4 C;  3RYO A;  2ZEE A;  3CT9 A;  4IUS A;  3VH9 A;  2PJ5 A;  3GUX A;  3B3S A;  4OLL A;  5CPA A;  2PJ2 A;  2QVP A;  4C7I A;  3S6H A;  3A9L A;  4CPA A;  4BD9 A;  1AMP A;  2ARH A;  2Z3P A;  2AFS A;  2DPT A;  2OU2 A;  2V8H A;  1KUX A;  2PC1 A;  3G3S A;  2R7H A;  4UWJ A;  1JQG A;  3FH4 A;  3TFY A;  3BXM A;  3NFZ A;  4A37 A;  2QML A;  2H5M A;  2NMT A;  4LUA A;  1IIC A;  3D67 A;  1M44 A;  1VHS A;  4Y49 B;  3D7D A;  1LRZ A;  3SI0 A;  3D66 A;  3PB4 X;  3KGQ A;  4XNH C;  5I4M A;  4PSW A;  2EWB A;  4LQG A;  3FX6 A;  2AJ6 A;  3WC6 A;  1LOK A;  2P6G A;  1TKH A;  4KVM E;  4MFJ A;  4ZY0 A;  2EO8 A;  2YNC C;  2ZEG A;  5JGF A;  2REE A;  1S3Z A;  2O4H A;  2RC4 A;  4OC5 A;  2PJ6 A;  3KZW A;  3LMS A;  4CAE A;  5G22 A;  2GLJ A;  3R96 A;  1OBR A;  4A39 A;  2QJ8 A;  3CPX A;  3GLJ A;  3K9U A;  1M4D A;  1ARM A;  2JEV A;  2CNS A;  2B4B A;  4RUH A;  1YVK A;  4X2T A;  4MFK A;  3WR7 A;  3H4Q A;  4RI1 A;  2FT0 A;  4NSQ A;  1U6M A;  1WWZ A;  2Z3N A;  5AG6 A;  3TO6 A;  4A94 A;  2PR1 A;  5LYI A;  4FD5 A;  2OR4 A;  4YRH A;  4CGN A;  2G3A A;  4PPZ A;  1YSJ A;  4B13 A;  4JLY A;  1VHO A;  1X10 A;  2F7V A;  3MN8 A;  2PJ1 A;  4IF5 A;  3RNZ A;  2CIJ A;  1YLE A;  4R7M A;  1Z8L A;  4OC0 A;  3JRU A;  5EC4 A;  3SI2 A;  3T9Y A;  1DTD A;  4YU9 A;  4OC3 A;  4AG7 A;  1VKC A;  2O28 A;  1YLO A;  3IO1 A;  1XIX A;  4HPS A;  4B11 A;  3GY9 A;  3P2F A;  3SXO A;  1S7K A;  2Q7S A;  4I49 A;  5G21 A;  2ZEN A;  4R76 A;  1UWY A;  3DGV A;  1YR0 A;  4CGL A;  4QBJ A;  3WT4 A;  3DR8 A;  3IC1 A;  3GYA A;  4KOV A;  1Y9K A;  2RB7 A;  4MHY A;  1QQ9 A;  2V8G A;  3JUW A;  4Q38 A;  3CZX A;  5H86 A;  2Q04 A;  3S9M A;  3H8F A;  4KSA A;  1ELL P;  2AFW A;  4WWV A;  5G20 A;  3KHX A;  3UY5 A;  4AG9 A;  4KOX A;  1CPS A;  3T8W A;  4P44 A;  4A30 A;  4ONU A;  8CPA A;  3FNC A;  3V7Z A;  5K8P A;  3S9N A;  4II9 A;  1ZG7 A;  3HLP A;  4MFQ A;  3PZJ A;  1NSL A;  3PB8 X;  4B14 A;  1YGH A;  2POK A;  4PXB A;  2ZEO A;  4CRY B;  2PJ7 A;  1CPX A;  1KUY A;  2VXK A;  1ELM P;  4GS4 A;  1P0H A;  3EXN A;  2HV2 A;  2EK9 A;  2HQY A;  4B6Z A;  1VHE A;  1R43 A;  4AVB A;  2OB0 A;  2V8V A;  2B4D A;  2B58 A;  3BLN A;  3EO4 A;  3IWG A;  4MY3 A;  4NGR A;  1F57 A;  3V8I A;  4YFJ A;  1Z9U A;  4UBR A;  3PFE A;  2REF A;  1PUA A;  4JZ0 A;  5F47 A;  4BBH A;  3CXS A;  2ZEM A;  3KHZ A;  4KUA A;  4F9U A;  2PSW A;  7CPA A;  4KZT A;  5F46 A;  3F5B A;  1CBX A;  3IJ3 A;  4NXY A;  3PB6 X;  2PJA A;  2Z10 A;  4DNC A;  3WAB A;  4MBU A;  4ZGY B;  2B4D B;  4KLV A;  1HDQ A;  2VL1 A;  4U5Y A;  1YVO A;  4PSX A;  2ZEP A;  4JXQ A;  4A38 A;  4MHN A;  3CPA A;  4YGO A;  5LRG A;  3R9F A;  3SXN A;  2JEW A;  3TO7 A;  5C82 A;  3EC4 A;  2PJ0 A;  4TWE A;  3SI1 A;  3BI1 A;  2J8N A;  4ZBG A;  5K8O A;  2EVN A;  3WC5 A;  1MJA A;  1QSR A;  3D68 A;  2CNT A;  2NYQ A;  2IJZ A;  3TTH A;  2XEF A;  3FMC A;  1VGY A;  4FWU A;  3K2K A;  4M85 A;  2I00 A;  4R87 A;  3ISX A;  1IB1 E;  2Q51 A;  2G3T A;  3KI9 A;  4Z65 A;  4HNW B;  2AFM A;  2Q4V A;  3FIX A;  4ZX9 A;  3N5F A;  4A95 A;  4J3G A;  3ISZ A;  4K30 A;  3FRM A;  4UCM A;  1IOF A;  3S6F A;  1FT7 A;  4A2Z A;  1NE9 A;  1XEB A;  3FYN A;  4HNY B;  4P10 A;  4KLW A;  3TOB A;  3LD2 A;  1IY7 A;  1AUG A;  3NE7 A;  3DSB A;  2VI7 A;  4KUB A;  3NH4 A;  5LRJ A;  4ZI6 A;  1EE3 P;  4KSF A;  1RTQ A;  1QSN A;  2XEJ A;  4R6T A;  3R9G A;  2PJ3 A;  2Q4Y A;  2AFZ A;  4Q36 A;  4AVC A;  4F0X A;  3TE4 A;  2D4P A;  3NE8 A;  2ZOG A;  2QIR A;  4OC4 A;  1Z8W A;  4P4F A;  3TCV A;  4BIN A;  4XPL A;  4X5K A;  1A2Z A;  1AYE A;  1KUV A;  3B3W A;  2AFX A;  3CXP A;  3PRT A;  4R3K A;  1HEE A;  3JVN A;  4MHD A;  3FB3 A;  4PK2 A;  4LX9 A;  2JBK A;  4MHZ A;  1MJB A;  3TOA A;  3KR4 A;  3DNS A;  4UFX A;  5JPH A;  4M6H A;  2YNC A;  4U9Z A;  2GRE A;  3C26 A;  4MMO A;  1MJ9 A;  1Y9W A;  2BOA A;  4JXR A;  4PQA A;  4XNH B;  6CPA A;  2J8R A;  2XEG A;  4ZX8 A;  1I12 A;  1Z2L A;  4ZY1 A;  5JQ4 A;  2Q43 A;  3PB9 X;  5IV0 A;  5ELY A;  5J8F A;  4PV6 A;  3D7F A;  5LYD A;  3G8W A;  1XF8 A;  3GB0 A;  1B6B A;  2CY2 A;  4QVT A;  3BJ7 A;  4KVX A;  2V8D A;  1CX8 A;  2PIY A;  2ZEL A;  2ZOF A;  2V77 A;  4L8A A;  3IWE A;  4UFW A;  5JM6 A;  4NFR A;  3D4U A;  3B35 A;  4CGO A;  3K9T A;  2VBQ A;  1QSM A;  2OOT A;  1I1D A;  2BUE A;  2R98 A;  1ARL A;  1SQH A;  2R8V A;  4YWY A;  3GIU A;  3IEH A;  2B5G B;  2IQ6 A;  4MFP A;  4W9Y A;  4EME A;  1ZLH A;  2ATR A;  3W91 A;  3ZZI A;  1ZLI A;  5I0C A;  1F2P A;  2PJC A;  5F09 A;  3IU2 A;  3KKW A;  4P45 A;  5HXD A;  4EFD A;  5K8M A;  1YK3 A;  2WSA A;  4NCZ A;  2D4O A;  2PR8 A;  3LWU A;  2OH1 A;  4P4B A;  2VEZ A;  4R3L A;  2PRQ A;  4WJB A;  2C6G A;  4C7H A;  4UWI A;  4MHP A;  3R9E A;  2JDC A;  3KQX A;  3W6X A;  4CAW A;  2YND A;  2ZEH A;  3VWE A;  4IK2 A;  2WYR A;  4AVA A;  2GLF A;  1YX0 A;  1ZO0 A;  3PBE A;  4B10 A;  3TX8 A;  1XRY A;  3CXQ A;  3LOD A;  4NGQ A;  1TF9 A;  2OZG A;  4OC2 A;  4GM5 A;  2HB6 A;  4KOT A;  1CP6 A;  2Z3L A;  3KL9 A;  2G9D A;  4NGS A;  5HH1 A;  4C2X A;  1N71 A;  4KSI A;  3R1K A;  5AG4 A;  3PGP A;  1ZG8 A;  2NSM A;  2HC9 A;  2PRB A;  4JJX A;  3SJE A;  3H5Z A;  3SJF A;  1XFO A;  3NH8 A;  1CG2 A;  4P6Y A;  4MI4 A;  1YW4 A;  3DDD A;  1CJW A;  4UEZ A;  4HNX B;  4X8I A;  4B5O A;  3KQZ A;  2CTC A;  2GAN A;  4KOY A;  2ZPA A;  1GYT A; 
#chains in the Genus database with same CATH homology
 1GHE A;  2ZW6 A;  2GE3 A;  2DPS A;  4AB7 A;  1WK4 A;  1J4J A;  2GIV A;  4L89 A;  1OZP A;  2R1I A;  1PU9 A;  2Z0Z A;  4JWP A;  2ZW5 A;  4OAE A;  4XPD C;  1ON0 A;  2B3U A;  5KTA A;  2P6E A;  1KZF A;  4BMH A;  4KOR A;  4E8O A;  4QUS A;  4UCP A;  2Z3K A;  4C2Z A;  3SHP A;  4CYQ A;  5F49 A;  2BEI A;  2JLM A;  2Q0Y A;  5FVJ A;  5BWA B;  1BO4 A;  1FY7 A;  4NF1 A;  2JDD A;  4UFV A;  3N7Z A;  2FL4 A;  1I21 A;  3IGR A;  4MJ8 A;  3JTK A;  4XPK A;  1QST A;  4E0A A;  4A33 A;  2BL1 A;  4NEX A;  5EBV A;  2PQ8 A;  4CAF A;  3PP9 A;  2ZW4 A;  1Q2Y A;  4E2A A;  5IB0 A;  2J8M A;  2Z3M A;  1M4I A;  4KVO E;  1IID A;  3QB8 A;  5G1Z A;  4B5P A;  2ZXV A;  4C2Y A;  1RXT A;  3EFA A;  1Q2C A;  5H84 A;  2FIW A;  2OZH A;  4B5P B;  1M4G A;  4UA3 A;  2YGW A;  4Y49 C;  2DXQ A;  4QC6 A;  2Q44 A;  4KOU A;  4A31 A;  2CXA A;  1YRE A;  4ORF A;  1S7F A;  5ISV A;  4R57 A;  4CYO A;  4KOW A;  2Z3O A;  4JD6 A;  4R9M A;  3VWD A;  4EVY A;  1Z4E A;  3FXT A;  1RO5 A;  4FD4 A;  2Z11 A;  1V0C A;  2B5G A;  3I3G A;  4M3S A;  2WUU A;  2FIA A;  2FE7 A;  3P2H A;  4RS2 A;  5C88 A;  5A27 A;  2P0W A;  3QAH A;  2FXF A;  3S6K A;  2FCK A;  2FS5 A;  2Q7B A;  4KOS A;  3F8K A;  2BSW A;  1Y7R A;  4UCN A;  1P4N A;  1BOB A;  5DWM A;  4FD7 A;  5DWN A;  3TT2 A;  4MFL A;  1M1D A;  5AG5 A;  5A28 A;  5F48 A;  1S7N A;  4C68 A;  4B12 A;  2HUZ A;  3D2M A;  2KCW A;  2FSR A;  1QSO A;  2VZY A;  2QEC A;  4H6U A;  3W6S A;  2IL4 A;  4KS9 A;  1MK4 A;  2AE6 A;  3D3S A;  2ZW7 A;  1B87 A;  1UFH A;  4FD6 A;  4F6A A;  5KTD A;  4OAD A;  2OZU A;  1R57 A;  1IYL A;  1TIQ A;  5J8C A;  5KTC A;  1K4J A;  2EUI A;  4CGP A;  2Y0M A;  2P6F A;  4CYN A;  3D8P A;  5AG7 A;  3DR6 A;  4CGM A;  1S60 A;  4F0Y A;  3I9S A;  4A32 A;  5HMN A;  1Q2D A;  3E0K A;  4CAV A;  2YNE A;  3TO9 A;  3IU1 A;  2PDO A;  3D2P A;  3B8G A;  4CYP A;  3OWC A;  1Z4R A;  1L0C A;  4XPD B;  5GCN A;  4H6Z A;  2WPW A;  5IX3 A;  5E96 A;  2K5T A;  4CAX A;  4HKF A;  2VQY A;  3BJ8 A;  3S6G A;  1IYK A;  3T90 A;  4PK3 A;  4H89 A;  3R95 A;  3SXN A;  4U9Y A;  2A4N A;  1NMT A;  3FBU A;  3F0A A;  5AGE A;  4CRZ B;  3MGD A;  2WPX A;  2VZZ A;  2F5I A;  3ZJ0 A;  3GKR A;  2B3V A;  1XMT A;  5CNP A;  4CS0 B;  1CM0 A;  2C27 A;  4QB9 A;  4MY0 A;  1XE4 A;  2I79 A;  3EY5 A;  2G0B A;  2CNM A;  1S7L A;  2X7B A;  1S5K A;  3RYO A;  4IUS A;  4OLL A;  4C7I A;  3S6H A;  3A9L A;  2ARH A;  2Z3P A;  2OU2 A;  2DPT A;  3G3S A;  1KUX A;  2PC1 A;  2R7H A;  4UWJ A;  3TFY A;  2QML A;  2H5M A;  2NMT A;  4LUA A;  1IIC A;  1M44 A;  1VHS A;  4Y49 B;  1LRZ A;  4XNH C;  4PSW A;  2AJ6 A;  2P6G A;  4KVM E;  4MFJ A;  2YNC C;  2REE A;  1S3Z A;  2RC4 A;  4CAE A;  5G22 A;  3R96 A;  3K9U A;  1M4D A;  2JEV A;  2CNS A;  2B4B A;  1YVK A;  4MFK A;  3WR7 A;  3H4Q A;  4RI1 A;  2FT0 A;  4NSQ A;  1WWZ A;  1U6M A;  2Z3N A;  5AG6 A;  3TO6 A;  2PR1 A;  4FD5 A;  4YRH A;  4CGN A;  2G3A A;  4B13 A;  4JLY A;  4IF5 A;  1YLE A;  3T9Y A;  5EC4 A;  4AG7 A;  1VKC A;  2O28 A;  4B11 A;  1XIX A;  3GY9 A;  3P2F A;  3SXO A;  1S7K A;  4I49 A;  5G21 A;  1YR0 A;  4CGL A;  4QBJ A;  3DR8 A;  3GYA A;  4KOV A;  1Y9K A;  4Q38 A;  5H86 A;  3JUW A;  2Q04 A;  4KSA A;  5G20 A;  3UY5 A;  4AG9 A;  4KOX A;  4A30 A;  4ONU A;  3FNC A;  4II9 A;  4MFQ A;  3PZJ A;  1NSL A;  4B14 A;  1YGH A;  4CRY B;  1KUY A;  2VXK A;  4GS4 A;  1P0H A;  3EXN A;  2HV2 A;  2HQY A;  4AVB A;  2OB0 A;  2B4D A;  2B58 A;  3BLN A;  3EO4 A;  3IWG A;  4MY3 A;  3V8I A;  4YFJ A;  1Z9U A;  4UBR A;  2REF A;  1PUA A;  5F47 A;  4BBH A;  3CXS A;  4KUA A;  2PSW A;  5F46 A;  4KZT A;  3F5B A;  4NXY A;  2Z10 A;  4DNC A;  4MBU A;  4ZGY B;  2B4D B;  4KLV A;  4U5Y A;  1YVO A;  4PSX A;  4JXQ A;  4YGO A;  5C82 A;  3R9F A;  3TO7 A;  3EC4 A;  2J8N A;  4ZBG A;  2EVN A;  1MJA A;  1QSR A;  2CNT A;  3TTH A;  4R87 A;  4M85 A;  2I00 A;  1IB1 E;  2G3T A;  4HNW B;  2Q4V A;  3FIX A;  4A95 A;  4J3G A;  4K30 A;  3FRM A;  4UCM A;  3S6F A;  4A2Z A;  1NE9 A;  1XEB A;  3FYN A;  4HNY B;  4KLW A;  3TOB A;  3LD2 A;  3NE7 A;  3DSB A;  2VI7 A;  4KUB A;  4KSF A;  3R9G A;  1QSN A;  2Q4Y A;  4Q36 A;  4AVC A;  4F0X A;  3TE4 A;  2D4P A;  2QIR A;  3TCV A;  4XPL A;  4X5K A;  1KUV A;  3CXP A;  4R3K A;  3JVN A;  4MHD A;  3FB3 A;  4PK2 A;  4LX9 A;  1MJB A;  3TOA A;  3DNS A;  4UFX A;  5JPH A;  4U9Z A;  2YNC A;  3C26 A;  1MJ9 A;  1Y9W A;  4JXR A;  4XNH B;  2J8R A;  1I12 A;  5JQ4 A;  5IV0 A;  5J8F A;  4PV6 A;  3G8W A;  1XF8 A;  1B6B A;  2CY2 A;  4QVT A;  3BJ7 A;  4KVX A;  4L8A A;  3IWE A;  4UFW A;  4CGO A;  2VBQ A;  1QSM A;  1I1D A;  2BUE A;  2R98 A;  1SQH A;  2R8V A;  2B5G B;  4MFP A;  2ATR A;  3W91 A;  3ZZI A;  5I0C A;  3IU2 A;  3KKW A;  1YK3 A;  2WSA A;  4NCZ A;  2D4O A;  2PR8 A;  2OH1 A;  4R3L A;  2VEZ A;  4C7H A;  4UWI A;  3R9E A;  2JDC A;  3W6X A;  4CAW A;  2YND A;  3VWE A;  4AVA A;  1YX0 A;  1ZO0 A;  4B10 A;  3CXQ A;  3LOD A;  2OZG A;  4KOT A;  2Z3L A;  5HH1 A;  4C2X A;  1N71 A;  3R1K A;  5AG4 A;  3PGP A;  2PRB A;  4JJX A;  3H5Z A;  4MI4 A;  3DDD A;  1CJW A;  4HNX B;  4B5O A;  2GAN A;  4KOY A;  2ZPA A;  4MFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...