1IB1E

Crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
178
Chain Sequence
SGIPGSPGRQRRHLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/transferase
molecule keywords 14-3-3 ZETA ISOFORM
publication title Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 178
sequence length 179
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2001-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ib1E00
2FL4A 3CXPA 3G8WA 1M1DA 3K9UA 4CRYB 3FXTA 1KUYA 2ZPAA 1N71A 3FIXA 4IUSA 2GE3A 3BJ8A 4HKFA 4RS2A 2FT0A 1Q2DA 1RO5A 4XPDB 4JD6A 4KUBA 2BEIA 3TTHA 4MBUA 4L89A 3W6XA 4AG7A 2P6GA 4MY3A 4KVXA 4AVAA 4PV6A 2KCWA 2QIRA 2P6FA 4U9ZA 2OZHA 3VWEA 4KOSA 1BOBA 2Z10A 3D8PA 2HUZA 3VWDA 3DNSA 1M4DA 2R98A 3S6FA 1B87A 2G3TA 2A4NA 2DXQA 2D4PA 4ZBGA 3SXOA 5JPHA 3DDDA 3JUWA 2OZUA 5ISVA 3DSBA 1TIQA 3R1KA 5J8CA 4UWIA 1XIXA 5HH1A 4HNXB 4XPKA 4II9A 4E8OA 2G3AA 4AVBA 2ZW4A 4E0AA 5I0CA 4EVYA 2VZZA 3D2MA 2Z11A 2OH1A 4NCZA 4B5PA 5CNPA 2AJ6A 4QB9A 1OZPA 2JLMA 3FNCA 3GKRA 2FIAA 5KTDA 3S6HA 1Y7RA 3H4QA 3F0AA 3R95A 3DR8A 3TOAA 2B58A 5KTCA 2ARHA 4R57A 4CAVA 3KKWA 4ORFA 4CAWA 4KOVA 2H5MA 4JLYA 1IIDA 3V8IA 4KORA 1CM0A 4MHDA 2PR1A 4UA3A 3LODA 2K5TA 4ONUA 2Q04A 1WK4A 3CXQA 2FXFA 2AE6A 2B5GB 4YFJA 2IL4A 4F0YA 3BJ7A 3FYNA 5F48A 3PGPA 2C27A 4OAEA 4NF1A 1YK3A 2ZXVA 2Z0ZA 4YGOA 1QSOA 4AB7A 4K30A 1I21A 4CAXA 2B4DB 3WR7A 2VI7A 1Z4RA 1YR0A 3E0KA 1NSLA 2GANA 1VHSA 2J8RA 3SHPA 4Y49C 1CJWA 3IGRA 4FD7A 5EC4A 4KVME 2F5IA 1Q2YA 2FSRA 5GCNA 1R57A 2PR8A 3EFAA 1QSNA 2O28A 1IYKA 3F5BA 4QVTA 1ON0A 1PUAA 4J3GA 1QSRA 2EVNA 5DWMA 2R8VA 4JJXA 3R9GA 3GYAA 1BO4A 3MGDA 1Z9UA 4CS0B 4R3LA 4KOUA 3P2HA 2OB0A 1L0CA 5F49A 4QUSA 2CY2A 4JXRA 1S7NA 1PU9A 1S7FA 4E2AA 2Q0YA 2CNSA 3D3SA 3W91A 1XEBA 1YVOA 2HV2A 4YRHA 2BL1A 2J8NA 2ZW6A 4MY0A 2I79A 4XNHC 2BUEA 4M85A 1M44A 2J8MA 3W6SA 4H6ZA 4R87A 3TO7A 3R9FA 3B8GA 3ZZIA 4Y49B 1KUVA 1Y9WA 2P6EA 4NXYA 1I12A 1S7KA 3CXSA 2FCKA 2VBQA 5C88A 4FD6A 3LD2A 4AG9A 3I9SA 4R3KA 2JEVA 1RXTA 3EO4A 1NMTA 3PP9A 4MJ8A 3TFYA 4H6UA 1QSTA 1U6MA 5HMNA 3FRMA 2VZYA 2OU2A 4DNCA 3D2PA 1SQHA 4KLVA 2BSWA 4M3SA 5KTAA 4F6AA 3N7ZA 4GS4A 4XPLA 4L8AA 2P0WA 5H86A 2B4BA 4FD4A 4KVOE 5F46A 3QAHA 1M4GA 3T9YA 4KUAA 1MJAA 2PRBA 4PK3A 4I49A 2B5GA 2R7HA 3R96A 4R9MA 5H84A 2PC1A 4PSWA 1MJBA 4LX9A 4KOWA 1MJ9A 1MK4A 3EC4A 4PK2A 2B4DA 1FY7A 3TCVA 5JQ4A 2ATRA 2B3UA 1IICA 3F8KA 3IWGA 1P0HA 4U9YA 5C82A 3P2FA 5FVJA 2FE7A 2ZW5A 4AVCA 1S5KA 1VKCA 4RI1A 3R9EA 1S7LA 2VXKA 2RC4A 2VQYA 3BLNA 1XMTA 1Y9KA 4MI4A 2PQ8A 1KUXA 4X5KA 4UWJA 5E96A 2REEA 3DR6A 3TT2A 5IB0A 1B6BA 1YX0A 1Z4EA 3TO6A 4KZTA 2X7BA 4QC6A 2NMTA 4B5OA 4OADA 3SXNA 2Q44A 1LRZA 1QSMA 2GIVA 3GY9A 3RYOA 2VEZA 4BMHA 5F47A 4LUAA 2PSWA 1YREA 4KLWA 3TOBA 2Q4VA 2PDOA 1V0CA 5IV0A 2JDDA 5J8FA 4QBJA 4PSXA 4CRZB 1Q2CA 3I3GA 1IB1E 4FD5A 4NEXA 4H89A 3UY5A 2Y0MA 1J4JA 4UBRA 1NE9A 3FB3A 2Q4YA 4OLLA 1UFHA 3QB8A 2QECA 4JXQA 1XE4A 3JVNA 2FS5A 3C26A 3EY5A 1XF8A 1P4NA 5DWNA 3ZJ0A 1WWZA 1IYLA 1GHEA 2Q7BA 1M4IA 1S60A 4KOYA 1YVKA 2JDCA 4HNWB 3EXNA 4U5YA 4IF5A 3TE4A 4B5PB 2REFA 4KOXA 4JWPA 4NSQA 2I00A 2WPWA 5IX3A 4XPDC 2EUIA 3PZJA 3S6GA 3FBUA 3OWCA 2WPXA 2FIWA 2R1IA 1K4JA 2QMLA 4HNYB 2D4OA 2G0BA 5EBVA 4XNHB 3G3SA 3TO9A 1YLEA 4KOTA 3NE7A 3T90A 2CNTA 1S3ZA 2ZW7A 1KZFA 1YGHA 1I1DA 2B3VA 3S6KA 2HQYA 2OZGA 2CNMA
chains in the Genus database with same CATH superfamily
4O23A 4B11A 2V8HA 5G22A 2F7VA 2FL4A 3SJGA 4K3NA 3KQXA 3CXPA 3G8WA 1Z5RA 1LAMA 1M1DA 2RFHA 3K9UA 3D7DA 3RZAA 3FXTA 4CRYB 3S9MA 4F0XA 7CPAA 1KUYA 3JRUA 3QNVA 2O4HA 5A27A 4UIBA 2YGWA 2ZPAA 1N71A 3NH8A 2V8VA 3WT4A 4P10A 2BO9A 3FIXA 3LMSA 3KR5A 1XOVA 5LYFA 3D7FA 3BI1A 4NJQA 4IUSA 2GE3A 3H5ZA 1FT7A 4CYNA 3BJ8A 4RN7A 4PXBA 4HKFA 4RS2A 4DUKA 2FVGA 2POKA 3D66A 2FT0A 1TXRA 1Q2DA 1RO5A 1A2ZA 2Z3OA 4JD6A 4XPDB 3WC5A 2BEIA 4KUBA 3TTHA 4MBUA 2AFOA 4L89A 3W6XA 4AG7A 4DJLA 1YW4A 3HUVA 2PVVA 2P6GA 2JBKA 4MY3A 2ZOFA 2XEJA 3NE8A 1F2OA 2JEWA 4KVXA 4AVAA 4PV6A 4PXDA 3PBEA 2KCWA 4B6ZA 2QIRA 2DPSA 2PJBA 4NFRA 1X10A 2P6FA 4U9ZA 3K2KA 5LRJA 2OZHA 3VWEA 4KOSA 4PPZA 4ZI6A 1H8LA 5THWA 1BOBA 2Z10A 2EBJA 3D8PA 2HUZA 3VWDA 3DNSA 1M4DA 2R98A 1Z2LA 4LQ6A 3S6FA 4NGPA 2AFWA 3KZWA 5HVGA 5AG4A 2WZNA 1QMUA 4P4DA 2AFSA 2DEAA 2XEFA 2AFUA 5AG7A 4Q38A 4A33A 1B87A 2Z3NA 2G3TA 2A4NA 3RAMA 2DXQA 2D4PA 4ZBGA 1R3NA 3SXOA 5JPHA 2Z3PA 3DDDA 5HVFA 3JUWA 2OZUA 1X12A 4ONWA 4UFVA 4C2YA 5ISVA 5D29A 5JM6A 3DSBA 1TIQA 3FH4A 3SJFA 5A28A 3R1KA 5J8CA 1BPNA 4UWIA 2PJ4A 4CAFA 2OR4A 4JYWA 1XIXA 5HH1A 4HNXB 1YQEA 4XPKA 4II9A 4CYPA 1TKHA 3WC7A 4MFPA 4E8OA 4A39A 2G3AA 4MFKA 2ZW4A 4AVBA 3NFZA 4E0AA 2ZENA 3B3TA 5I0CA 3MRUA 4EVYA 5JH9A 2VZZA 3D2MA 3KQZA 1ZG8A 2Z11A 2OH1A 1BAVA 4ZY2A 4B14A 5DS0A 4NCZA 2PJCA 3IU1A 4B5PA 4MHNA 3FMCA 2AJ6A 5CNPA 4QB9A 3RO0A 1OZPA 4KSIA 1AMPA 2JLMA 1QQ9A 1RTQA 3FNCA 1F2PA 3CZXA 3H8EA 1Q7LA 2CXAA 3GKRA 2PIZA 2FIAA 4PXEA 4OC0A 5KTDA 3S6HA 4OIDA 1Y7RA 4CGMA 3H4QA 3F0AA 1BPMA 3LWUA 3R95A 3V38A 3DR8A 3N5FA 3TOAA 2B58A 3FX6A 5KTCA 1GYTA 1CPSA 2ARHA 4R57A 3KL9A 2GFQA 3KKWA 4ORFA 4CAVA 4KOVA 4MMOA 2H5MA 4CAWA 4RUHA 4OKOA 4JLYA 1ZG9A 3VH9A 3IIBA 1IIDA 3V8IA 4KORA 2I3CA 1CM0A 4X3RA 4A31A 4MHDA 1DTDA 1OBRA 3JTKA 2AFZA 2PR1A 1VHOA 4UA3A 4CGPA 2ZEHA 4NGNA 8CPAA 2QVPA 3LODA 2HC9A 2O53A 1CP6A 2K5TA 4ONUA 2YNDA 2Q04A 5EMIA 1WK4A 4DYOA 5HVHA 3KHZA 2G9DA 3CXQA 2FXFA 4UEEA 1EE3P 2AE6A 1IY7A 2B5GB 4YFJA 2IL4A 2Z3MA 2F8HA 3BJ7A 3KASA 4P6YA 3FYNA 2XEIA 4R6TA 5F48A 2PJ8A 3PGPA 2C27A 4OAEA 3VARA 4A95A 4NF1A 2C6GA 3FEEA 4BD9A 4X8IA 1YK3A 2ZXVA 2Z0ZA 4CPAA 4ZYQA 1XJOA 4YGOA 1QSOA 3SJXA 4X2TA 3H8FA 4AB7A 3I1UA 1I21A 3PB6X 2B4DB 3BXMA 4K30A 3PEIA 3DGVA 2VI7A 4R8FA 1Z4RA 3SI1A 3A9LA 3WR7A 1YR0A 2RB7A 5IB9A 3E0KA 2Q4ZA 1IOIA 2GANA 1NSLA 1VHSA 2J8RA 4M6GA 2WSAA 3SHPA 3K9TA 4Y49C 5AG6A 2CIJA 2PJ1A 1CJWA 4NGMA 1Y0YA 3D68A 3KR4A 1TKFA 3IGRA 1ARMA 3ISZA 4FD7A 5EC4A 4C68A 4KVME 4C7IA 2QJ8A 2F5IA 1Q2YA 4AXVA 2FSRA 3GLJA 5GCNA 4C7HA 2ABZA 1R57A 2PR8A 4ZY0A 3EFAA 1IGBA 1QSNA 2O28A 1YMEA 1IYKA 2QYVA 1XBUA 2ODFA 5K8PA 3F5BA 4QVTA 1ON0A 1ELLP 1PUAA 3WABA 4J3GA 1QSRA 2EVNA 3MN8A 5DWMA 2R8VA 4JJXA 4A38A 3KI9A 3IWWA 4NGTA 4PQAA 3R9GA 3GYAA 2PJ2A 1BO4A 3MGDA 1Z9UA 4B12A 4CS0B 2PJ5A 4KSFA 4R3LA 4MCSA 1YLOA 4KOUA 1JWQA 4G1PA 3P2HA 2OB0A 5G20A 1L0CA 4OC5A 5F49A 4QUSA 1Z8WA 3IC1A 2CY2A 3NH5A 4TWEA 4JXRA 1S7NA 4OIWA 1HDUA 1PU9A 1S7FA 2EK9A 4E2AA 4TNUA 4JZ0A 2Q0YA 4YWYA 2CNSA 3D3SA 3W91A 1CX8A 4FWUA 1XEBA 1CPXA 1YVOA 4FAIA 3PB8X 2HV2A 5K8NA 4YRHA 2YNEA 4GM5A 2BL1A 2J8NA 2ZW6A 4MY0A 2I79A 4P4BA 2VL1A 3FJUA 4XNHC 2BUEA 1CBXA 4M85A 1M44A 2J8MA 3B3CA 1XFOA 4OC2A 4H6ZA 4R87A 3W6SA 2PJ9A 3R9FA 3TO7A 2WUUA 3B8GA 1Y7EA 3ZZIA 3PB7X 2ZEFA 2ANPA 1KUVA 1Y9WA 2P6EA 4NXYA 4Y49B 2Z3KA 4BBHA 1I12A 3PB9X 2ZEGA 4KS9A 4UF4A 1S7KA 4A32A 3S9LA 1NSAA 2NYQA 2V77A 2FCKA 3CXSA 2PJ6A 2VBQA 5C88A 4FD6A 3LD2A 4AG9A 4YU9A 1ARLA 4CGOA 3I9SA 4R3KA 1VGYA 3HLPA 1Z8LA 2JEVA 1PYTB 1RXTA 4LQGA 3EO4A 1NMTA 2ZEEA 4UFXA 2Q51A 3PP9A 4OC3A 1UWYA 4MJ8A 3TFYA 4H6UA 1QSTA 1U6MA 5HMNA 3PRTA 4P44A 4P4JA 3FRMA 4GXHA 2VZYA 5D8NA 2OU2A 4DNCA 3GB0A 4KSAA 4IAVA 3D2PA 4HPSA 1SQHA 1PCAA 4KLVA 2BSWA 4M3SA 3CPAA 4MFJA 5KTAA 4F6AA 3N7ZA 3B35A 1TF8A 3PFOA 4MCPA 4GS4A 5ELYA 4CAEA 5J1QA 4XPLA 4L8AA 4ZX9A 2P0WA 5H86A 2B4BA 4CYQA 2PJ0A 4FD4A 5LYIA 1R43A 4UEFA 3FVLA 4KVOE 2GU2A 1Z8XA 5F46A 1XRYA 1M4GA 3QAHA 3T9YA 2BCOA 4WJBA 4KUAA 1MJAA 2PRBA 1Y0RA 2EO8A 4PK3A 4I49A 1ELMP 2B5GA 4OP4A 2R7HA 2PJAA 3KHXA 4MCQA 2YNCA 3WC6A 3R96A 4R9MA 5LRKA 5H84A 4UIAA 2PC1A 3QAYA 2IMOA 4PSWA 1MJBA 4W9YA 4LX9A 4F9UA 1MJ9A 1MK4A 2ZOGA 4KOWA 3EC4A 4PK2A 1FNOA 2B4DA 4P45A 4ZY1A 1FY7A 2CTCA 3IEHA 4OMEA 4P4FA 3TCVA 5JQ4A 1IOFA 3NH4A 2ATRA 2B3UA 1IICA 3F8KA 1AYEA 1LCPA 1F57A 3IWGA 1P0HA 4U9YA 4C2ZA 3GIUA 5C82A 6CPAA 3P2FA 5FVJA 4FBEA 5K8MA 2C6PA 2FE7A 4OC4A 3IFEA 3VATA 2ZW5A 4AVCA 1ZG7A 1S5KA 1VKCA 4PXCA 4RI1A 3R9EA 1S7LA 1DE4C 2VXKA 3RNZA 2IJZA 2PJ3A 3SJEA 3TC8A 1LAPA 1TKJA 2RC4A 3B3SA 2VQYA 3BLNA 4A2ZA 2JBJA 4EFDA 1XMTA 1Y9KA 3RBUA 2CTBA 4MI4A 2PQ8A 2PJ7A 1KUXA 4IK2A 4Q7AA 4X5KA 1VIXA 2PE3A 3B3WA 4NJRA 4UWJA 2REEA 3DR6A 5E96A 3TT2A 4B13A 5IB0A 1B6BA 1YX0A 2C1CA 3D4UA 1Z4EA 4F0YA 3TO6A 3H8GA 4KZTA 3IU2A 3IJ3A 2X7BA 3SI0A 5AG5A 4QC6A 3FF3A 3IWEA 4CGLA 5JGFA 2NMTA 2ZEOA 4B5OA 1HEEA 1VHEA 4MCRA 4OADA 3SXNA 3B2YA 2Q44A 1LFWA 1LRZA 1QSMA 2AFMA 2GIVA 3GY9A 3RYOA 4CAXA 2VEZA 3ISXA 2EWBA 5F47A 2BOAA 2PVWA 5G1ZA 4LUAA 4BMHA 3NA6A 1KWMA 4Z65A 4R76A 2PSWA 2V8GA 3LACA 1ZLIA 2NSMA 1HDQA 1YREA 4F8ZA 4KLWA 3TOBA 2Q4VA 2PDOA 1CG2A 1V0CA 2AFXA 4A30A 3BI0A 4MFZA 4C2XA 4IHMA 1AUGA 5IV0A 1CP7A 4M6IA 3GUXA 2JDDA 4BINA 4Q36A 5J8FA 2EK8A 4QBJA 3IO1A 1LOKA 4PSXA 3T8WA 1M4LA 2IQ6A 1YSJA 4CRZB 1Q2CA 3I3GA 5F09A 1IB1E 5LYLA 4FD5A 4NEXA 3B3VA 4A37A 4H89A 4MHYA 4WWVA 3UY5A 4H2KA 3D7GA 2Y0MA 1J4JA 5BWAB 2DF5A 4FUUA 4F9VA 4CGNA 3FEDA 4UBRA 1NE9A 1IU8A 3FB3A 2Q4YA 4CYOA 3FECA 3DLJA 4OLLA 3CPXA 1ZLHA 2Q43A 4MHZA 2GREA 1UFHA 2C6CA 3QB8A 2QECA 4JXQA 1JQGA 2XEGA 1YW6A 1XE4A 4MFLA 3JVNA 3V7ZA 4P4EA 2FS5A 3C26A 2ZELA 3EY5A 3CT9A 3KGQA 1XF8A 1P4NA 5CBMA 2YNCC 4A94A 2PCUA 5DWNA 3ZJ0A 3B7IA 1ZO0A 1WWZA 1IYLA 3CDXA 1GHEA 2CF4A 2Z3LA 2Q7BA 4EWTA 1M4IA 1S60A 1YVKA 2JDCA 4HNWB 4KOYA 3EXNA 4U5YA 2HB6A 4IF5A 5HXDA 4UCNA 3L2NA 5K8OA 1BLLE 3TE4A 3SI2A 4OC1A 4B5PB 2REFA 5G21A 4KOXA 4JWPA 5LRGA 4NSQA 2I00A 2WPWA 4R7MA 1XMBA 4NGSA 4UFWA 5IX3A 4UCMA 4XPDC 2J9AA 4UEZA 2EUIA 3PZJA 3S6GA 3FBUA 2GLFA 3OWCA 2WPXA 2DPTA 2PRQA 2FIWA 2R1IA 1K4JA 1Z8TA 2QMLA 4HNYB 2GLJA 2D4OA 2G0BA 4NGQA 4ZGYB 5EBVA 4XNHB 2WYRA 3PFEA 4ZX8A 5LYDA 2ZEDA 4MXUA 3PB4X 3G3SA 2ZEPA 3TO9A 1YLEA 4KOTA 4M6HA 4MFQA 3TX8A 3NE7A 3PBBA 3T90A 2CNTA 1S3ZA 2PIYA 5AGEA 4UCPA 5CPAA 2V8DA 4NGRA 2OOTA 5I4MA 4B10A 2ZW7A 2Q7SA 1KZFA 4P4IA 1YGHA 4MHPA 4MRIA 3S9NA 1I1DA 4EMEA 2B3VA 1LANA 2HQYA 3BHXA 3S6KA 2OZGA 3D7HA 3D67A 2ZEMA 2CNMA 1TF9A
chains in the Genus database with same CATH topology
4B11A 5G22A 2FL4A 3CXPA 3G8WA 1M1DA 3K9UA 4CRYB 3FXTA 4F0XA 1KUYA 5A27A 2YGWA 2ZPAA 1N71A 3FIXA 4CYNA 4IUSA 2GE3A 3H5ZA 3BJ8A 4HKFA 4RS2A 2FT0A 1Q2DA 1RO5A 2Z3OA 4JD6A 4XPDB 2BEIA 4KUBA 3TTHA 4MBUA 4L89A 3W6XA 4AG7A 2P6GA 4MY3A 4KVXA 4AVAA 4PV6A 2KCWA 2QIRA 2DPSA 2P6FA 4U9ZA 2OZHA 3VWEA 4KOSA 1BOBA 2Z10A 3D8PA 2HUZA 3VWDA 3DNSA 1M4DA 2R98A 3S6FA 5AG4A 5AG7A 4Q38A 4A33A 1B87A 2Z3NA 2G3TA 2A4NA 2DXQA 2D4PA 4ZBGA 3SXOA 5JPHA 2Z3PA 3DDDA 3JUWA 2OZUA 4UFVA 4C2YA 5ISVA 3DSBA 1TIQA 5A28A 3R1KA 5J8CA 4UWIA 4CAFA 1XIXA 5HH1A 4HNXB 4XPKA 4II9A 4CYPA 4MFPA 4E8OA 2G3AA 4MFKA 2ZW4A 4AVBA 4E0AA 5I0CA 4EVYA 2VZZA 3D2MA 2Z11A 2OH1A 4B14A 4NCZA 3IU1A 4B5PA 5CNPA 2AJ6A 4QB9A 1OZPA 2JLMA 3FNCA 2CXAA 3GKRA 2FIAA 5KTDA 3S6HA 1Y7RA 4CGMA 3H4QA 3F0AA 3R95A 3DR8A 3TOAA 2B58A 5KTCA 2ARHA 4R57A 4CAVA 3KKWA 4ORFA 4CAWA 4KOVA 2H5MA 4JLYA 1IIDA 3V8IA 4KORA 1CM0A 4A31A 4MHDA 3JTKA 2PR1A 4CGPA 4UA3A 3LODA 2K5TA 4ONUA 2YNDA 2Q04A 1WK4A 3CXQA 2FXFA 2AE6A 2B5GB 4YFJA 2IL4A 2Z3MA 4F0YA 3BJ7A 3FYNA 5F48A 3PGPA 2C27A 4OAEA 4A95A 4NF1A 1YK3A 2ZXVA 2Z0ZA 4YGOA 1QSOA 4AB7A 4K30A 1I21A 4CAXA 2B4DB 3WR7A 2VI7A 1Z4RA 3A9LA 1YR0A 3E0KA 1NSLA 2GANA 1VHSA 2J8RA 2WSAA 3SHPA 4Y49C 5AG6A 1CJWA 3IGRA 4FD7A 5EC4A 4C68A 4C7IA 4KVME 2F5IA 1Q2YA 2FSRA 5GCNA 4C7HA 1R57A 2PR8A 3EFAA 1QSNA 2O28A 1IYKA 3F5BA 4QVTA 1ON0A 1PUAA 4J3GA 1QSRA 2EVNA 5DWMA 2R8VA 4JJXA 3R9GA 3GYAA 1BO4A 3MGDA 1Z9UA 4B12A 4CS0B 4KSFA 4R3LA 4KOUA 3P2HA 2OB0A 5G20A 1L0CA 5F49A 4QUSA 2CY2A 4JXRA 1S7NA 1PU9A 1S7FA 4E2AA 2Q0YA 2CNSA 3D3SA 3W91A 1XEBA 1YVOA 2HV2A 4YRHA 2YNEA 4CYQA 2BL1A 2J8NA 2ZW6A 4MY0A 2I79A 4XNHC 2BUEA 4M85A 1M44A 2J8MA 3W6SA 4H6ZA 4R87A 3TO7A 3R9FA 2WUUA 3B8GA 3ZZIA 4Y49B 1KUVA 1Y9WA 2P6EA 4NXYA 4BBHA 2Z3KA 1I12A 4KS9A 1S7KA 4A32A 3CXSA 2FCKA 2VBQA 5C88A 4FD6A 3LD2A 4AG9A 4CGOA 3I9SA 4R3KA 2JEVA 1RXTA 3EO4A 1NMTA 4UFXA 3PP9A 4MJ8A 3TFYA 4H6UA 1QSTA 1U6MA 5HMNA 3FRMA 2VZYA 2OU2A 4DNCA 4KSAA 3D2PA 1SQHA 4KLVA 2BSWA 4M3SA 4MFJA 5KTAA 4F6AA 3N7ZA 4CAEA 4GS4A 4XPLA 4L8AA 2P0WA 5H86A 2B4BA 4FD4A 4KVOE 5F46A 3QAHA 1M4GA 3T9YA 4KUAA 1MJAA 2PRBA 4PK3A 4I49A 2B5GA 2R7HA 2YNCA 3R96A 4R9MA 5H84A 2PC1A 4PSWA 1MJBA 4LX9A 1MJ9A 1MK4A 4KOWA 3EC4A 4PK2A 2B4DA 1FY7A 3TCVA 5JQ4A 2ATRA 2B3UA 1IICA 3F8KA 3IWGA 1P0HA 4U9YA 4C2ZA 5C82A 3P2FA 5FVJA 2FE7A 2ZW5A 4AVCA 1S5KA 1VKCA 4RI1A 3R9EA 1S7LA 2VXKA 2RC4A 2VQYA 3BLNA 4A2ZA 1XMTA 1Y9KA 4MI4A 2PQ8A 1KUXA 4X5KA 4UWJA 5E96A 2REEA 3DR6A 3TT2A 4B13A 5IB0A 1B6BA 1YX0A 1Z4EA 3TO6A 4KZTA 3IU2A 2X7BA 5AG5A 4QC6A 3IWEA 4CGLA 2NMTA 4B5OA 4OADA 3SXNA 2Q44A 1LRZA 1QSMA 2GIVA 3GY9A 3RYOA 2VEZA 4BMHA 5F47A 5G1ZA 4LUAA 2PSWA 1YREA 4KLWA 3TOBA 2Q4VA 2PDOA 4C2XA 1V0CA 4A30A 4MFZA 5IV0A 2JDDA 4Q36A 5J8FA 4QBJA 4PSXA 4CRZB 1Q2CA 3I3GA 1IB1E 4FD5A 4NEXA 4H89A 3UY5A 2Y0MA 1J4JA 5BWAB 4CGNA 4UBRA 1NE9A 3FB3A 2Q4YA 4CYOA 4OLLA 1UFHA 3QB8A 2QECA 4JXQA 1XE4A 4MFLA 3JVNA 2FS5A 3C26A 3EY5A 1XF8A 1P4NA 2YNCC 5DWNA 3ZJ0A 1ZO0A 1WWZA 1IYLA 1GHEA 2Z3LA 2Q7BA 1M4IA 1S60A 1YVKA 2JDCA 4HNWB 4KOYA 3EXNA 4U5YA 4IF5A 4UCNA 3TE4A 4B5PB 2REFA 5G21A 4KOXA 4JWPA 4NSQA 2I00A 2WPWA 4UFWA 5IX3A 4UCMA 4XPDC 2EUIA 3PZJA 3S6GA 3FBUA 3OWCA 2WPXA 2DPTA 2FIWA 2R1IA 1K4JA 2QMLA 4HNYB 2D4OA 2G0BA 4ZGYB 5EBVA 4XNHB 3G3SA 3TO9A 1YLEA 4KOTA 4MFQA 3NE7A 3T90A 2CNTA 1S3ZA 5AGEA 4UCPA 4B10A 2ZW7A 1KZFA 1YGHA 1I1DA 2B3VA 3S6KA 2HQYA 2OZGA 2CNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FL4 A;  3CXP A;  3G8W A;  1M1D A;  3K9U A;  4CRY B;  3FXT A;  1KUY A;  2ZPA A;  1N71 A;  3FIX A;  4IUS A;  2GE3 A;  3BJ8 A;  4HKF A;  4RS2 A;  2FT0 A;  1Q2D A;  1RO5 A;  4XPD B;  4JD6 A;  4KUB A;  2BEI A;  3TTH A;  4MBU A;  4L89 A;  3W6X A;  4AG7 A;  2P6G A;  4MY3 A;  4KVX A;  4AVA A;  4PV6 A;  2KCW A;  2QIR A;  2P6F A;  4U9Z A;  2OZH A;  3VWE A;  4KOS A;  1BOB A;  2Z10 A;  3D8P A;  2HUZ A;  3VWD A;  3DNS A;  1M4D A;  2R98 A;  3S6F A;  1B87 A;  2G3T A;  2A4N A;  2DXQ A;  2D4P A;  4ZBG A;  3SXO A;  5JPH A;  3DDD A;  3JUW A;  2OZU A;  5ISV A;  3DSB A;  1TIQ A;  3R1K A;  5J8C A;  4UWI A;  1XIX A;  5HH1 A;  4HNX B;  4XPK A;  4II9 A;  4E8O A;  2G3A A;  4AVB A;  2ZW4 A;  4E0A A;  5I0C A;  4EVY A;  2VZZ A;  3D2M A;  2Z11 A;  2OH1 A;  4NCZ A;  4B5P A;  5CNP A;  2AJ6 A;  4QB9 A;  1OZP A;  2JLM A;  3FNC A;  3GKR A;  2FIA A;  5KTD A;  3S6H A;  1Y7R A;  3H4Q A;  3F0A A;  3R95 A;  3DR8 A;  3TOA A;  2B58 A;  5KTC A;  2ARH A;  4R57 A;  4CAV A;  3KKW A;  4ORF A;  4CAW A;  4KOV A;  2H5M A;  4JLY A;  1IID A;  3V8I A;  4KOR A;  1CM0 A;  4MHD A;  2PR1 A;  4UA3 A;  3LOD A;  2K5T A;  4ONU A;  2Q04 A;  1WK4 A;  3CXQ A;  2FXF A;  2AE6 A;  2B5G B;  4YFJ A;  2IL4 A;  4F0Y A;  3BJ7 A;  3FYN A;  5F48 A;  3PGP A;  2C27 A;  4OAE A;  4NF1 A;  1YK3 A;  2ZXV A;  2Z0Z A;  4YGO A;  1QSO A;  4AB7 A;  4K30 A;  1I21 A;  4CAX A;  2B4D B;  3WR7 A;  2VI7 A;  1Z4R A;  1YR0 A;  3E0K A;  1NSL A;  2GAN A;  1VHS A;  2J8R A;  3SHP A;  4Y49 C;  1CJW A;  3IGR A;  4FD7 A;  5EC4 A;  4KVM E;  2F5I A;  1Q2Y A;  2FSR A;  5GCN A;  1R57 A;  2PR8 A;  3EFA A;  1QSN A;  2O28 A;  1IYK A;  3F5B A;  4QVT A;  1ON0 A;  1PUA A;  4J3G A;  1QSR A;  2EVN A;  5DWM A;  2R8V A;  4JJX A;  3R9G A;  3GYA A;  1BO4 A;  3MGD A;  1Z9U A;  4CS0 B;  4R3L A;  4KOU A;  3P2H A;  2OB0 A;  1L0C A;  5F49 A;  4QUS A;  2CY2 A;  4JXR A;  1S7N A;  1PU9 A;  1S7F A;  4E2A A;  2Q0Y A;  2CNS A;  3D3S A;  3W91 A;  1XEB A;  1YVO A;  2HV2 A;  4YRH A;  2BL1 A;  2J8N A;  2ZW6 A;  4MY0 A;  2I79 A;  4XNH C;  2BUE A;  4M85 A;  1M44 A;  2J8M A;  3W6S A;  4H6Z A;  4R87 A;  3TO7 A;  3R9F A;  3B8G A;  3ZZI A;  4Y49 B;  1KUV A;  1Y9W A;  2P6E A;  4NXY A;  1I12 A;  1S7K A;  3CXS A;  2FCK A;  2VBQ A;  5C88 A;  4FD6 A;  3LD2 A;  4AG9 A;  3I9S A;  4R3K A;  2JEV A;  1RXT A;  3EO4 A;  1NMT A;  3PP9 A;  4MJ8 A;  3TFY A;  4H6U A;  1QST A;  1U6M A;  5HMN A;  3FRM A;  2VZY A;  2OU2 A;  4DNC A;  3D2P A;  1SQH A;  4KLV A;  2BSW A;  4M3S A;  5KTA A;  4F6A A;  3N7Z A;  4GS4 A;  4XPL A;  4L8A A;  2P0W A;  5H86 A;  2B4B A;  4FD4 A;  4KVO E;  5F46 A;  3QAH A;  1M4G A;  3T9Y A;  4KUA A;  1MJA A;  2PRB A;  4PK3 A;  4I49 A;  2B5G A;  2R7H A;  3R96 A;  4R9M A;  5H84 A;  2PC1 A;  4PSW A;  1MJB A;  4LX9 A;  4KOW A;  1MJ9 A;  1MK4 A;  3EC4 A;  4PK2 A;  2B4D A;  1FY7 A;  3TCV A;  5JQ4 A;  2ATR A;  2B3U A;  1IIC A;  3F8K A;  3IWG A;  1P0H A;  4U9Y A;  5C82 A;  3P2F A;  5FVJ A;  2FE7 A;  2ZW5 A;  4AVC A;  1S5K A;  1VKC A;  4RI1 A;  3R9E A;  1S7L A;  2VXK A;  2RC4 A;  2VQY A;  3BLN A;  1XMT A;  1Y9K A;  4MI4 A;  2PQ8 A;  1KUX A;  4X5K A;  4UWJ A;  5E96 A;  2REE A;  3DR6 A;  3TT2 A;  5IB0 A;  1B6B A;  1YX0 A;  1Z4E A;  3TO6 A;  4KZT A;  2X7B A;  4QC6 A;  2NMT A;  4B5O A;  4OAD A;  3SXN A;  2Q44 A;  1LRZ A;  1QSM A;  2GIV A;  3GY9 A;  3RYO A;  2VEZ A;  4BMH A;  5F47 A;  4LUA A;  2PSW A;  1YRE A;  4KLW A;  3TOB A;  2Q4V A;  2PDO A;  1V0C A;  5IV0 A;  2JDD A;  5J8F A;  4QBJ A;  4PSX A;  4CRZ B;  1Q2C A;  3I3G A;  1IB1 E;  4FD5 A;  4NEX A;  4H89 A;  3UY5 A;  2Y0M A;  1J4J A;  4UBR A;  1NE9 A;  3FB3 A;  2Q4Y A;  4OLL A;  1UFH A;  3QB8 A;  2QEC A;  4JXQ A;  1XE4 A;  3JVN A;  2FS5 A;  3C26 A;  3EY5 A;  1XF8 A;  1P4N A;  5DWN A;  3ZJ0 A;  1WWZ A;  1IYL A;  1GHE A;  2Q7B A;  1M4I A;  1S60 A;  4KOY A;  1YVK A;  2JDC A;  4HNW B;  3EXN A;  4U5Y A;  4IF5 A;  3TE4 A;  4B5P B;  2REF A;  4KOX A;  4JWP A;  4NSQ A;  2I00 A;  2WPW A;  5IX3 A;  4XPD C;  2EUI A;  3PZJ A;  3S6G A;  3FBU A;  3OWC A;  2WPX A;  2FIW A;  2R1I A;  1K4J A;  2QML A;  4HNY B;  2D4O A;  2G0B A;  5EBV A;  4XNH B;  3G3S A;  3TO9 A;  1YLE A;  4KOT A;  3NE7 A;  3T90 A;  2CNT A;  1S3Z A;  2ZW7 A;  1KZF A;  1YGH A;  1I1D A;  2B3V A;  3S6K A;  2HQY A;  2OZG A;  2CNM A; 
#chains in the Genus database with same CATH topology
 4O23 A;  4B11 A;  2V8H A;  5G22 A;  2F7V A;  2FL4 A;  3SJG A;  4K3N A;  3KQX A;  3CXP A;  3G8W A;  1Z5R A;  1LAM A;  1M1D A;  2RFH A;  3K9U A;  3D7D A;  3RZA A;  3FXT A;  4CRY B;  3S9M A;  4F0X A;  7CPA A;  1KUY A;  3JRU A;  3QNV A;  2O4H A;  5A27 A;  4UIB A;  2YGW A;  2ZPA A;  1N71 A;  3NH8 A;  2V8V A;  3WT4 A;  4P10 A;  2BO9 A;  3FIX A;  3LMS A;  3KR5 A;  1XOV A;  5LYF A;  3D7F A;  3BI1 A;  4NJQ A;  4IUS A;  2GE3 A;  3H5Z A;  1FT7 A;  4CYN A;  3BJ8 A;  4RN7 A;  4PXB A;  4HKF A;  4RS2 A;  4DUK A;  2FVG A;  2POK A;  3D66 A;  2FT0 A;  1TXR A;  1Q2D A;  1RO5 A;  1A2Z A;  2Z3O A;  4JD6 A;  4XPD B;  3WC5 A;  2BEI A;  4KUB A;  3TTH A;  4MBU A;  2AFO A;  4L89 A;  3W6X A;  4AG7 A;  4DJL A;  1YW4 A;  3HUV A;  2PVV A;  2P6G A;  2JBK A;  4MY3 A;  2ZOF A;  2XEJ A;  3NE8 A;  1F2O A;  2JEW A;  4KVX A;  4AVA A;  4PV6 A;  4PXD A;  3PBE A;  2KCW A;  4B6Z A;  2QIR A;  2DPS A;  2PJB A;  4NFR A;  1X10 A;  2P6F A;  4U9Z A;  3K2K A;  5LRJ A;  2OZH A;  3VWE A;  4KOS A;  4PPZ A;  4ZI6 A;  1H8L A;  5THW A;  1BOB A;  2Z10 A;  2EBJ A;  3D8P A;  2HUZ A;  3VWD A;  3DNS A;  1M4D A;  2R98 A;  1Z2L A;  4LQ6 A;  3S6F A;  4NGP A;  2AFW A;  3KZW A;  5HVG A;  5AG4 A;  2WZN A;  1QMU A;  4P4D A;  2AFS A;  2DEA A;  2XEF A;  2AFU A;  5AG7 A;  4Q38 A;  4A33 A;  1B87 A;  2Z3N A;  2G3T A;  2A4N A;  3RAM A;  2DXQ A;  2D4P A;  4ZBG A;  1R3N A;  3SXO A;  5JPH A;  2Z3P A;  3DDD A;  5HVF A;  3JUW A;  2OZU A;  1X12 A;  4ONW A;  4UFV A;  4C2Y A;  5ISV A;  5D29 A;  5JM6 A;  3DSB A;  1TIQ A;  3FH4 A;  3SJF A;  5A28 A;  3R1K A;  5J8C A;  1BPN A;  4UWI A;  2PJ4 A;  4CAF A;  2OR4 A;  4JYW A;  1XIX A;  5HH1 A;  4HNX B;  1YQE A;  4XPK A;  4II9 A;  4CYP A;  1TKH A;  3WC7 A;  4MFP A;  4E8O A;  4A39 A;  2G3A A;  4MFK A;  2ZW4 A;  4AVB A;  3NFZ A;  4E0A A;  2ZEN A;  3B3T A;  5I0C A;  3MRU A;  4EVY A;  5JH9 A;  2VZZ A;  3D2M A;  3KQZ A;  1ZG8 A;  2Z11 A;  2OH1 A;  1BAV A;  4ZY2 A;  4B14 A;  5DS0 A;  4NCZ A;  2PJC A;  3IU1 A;  4B5P A;  4MHN A;  3FMC A;  2AJ6 A;  5CNP A;  4QB9 A;  3RO0 A;  1OZP A;  4KSI A;  1AMP A;  2JLM A;  1QQ9 A;  1RTQ A;  3FNC A;  1F2P A;  3CZX A;  3H8E A;  1Q7L A;  2CXA A;  3GKR A;  2PIZ A;  2FIA A;  4PXE A;  4OC0 A;  5KTD A;  3S6H A;  4OID A;  1Y7R A;  4CGM A;  3H4Q A;  3F0A A;  1BPM A;  3LWU A;  3R95 A;  3V38 A;  3DR8 A;  3N5F A;  3TOA A;  2B58 A;  3FX6 A;  5KTC A;  1GYT A;  1CPS A;  2ARH A;  4R57 A;  3KL9 A;  2GFQ A;  3KKW A;  4ORF A;  4CAV A;  4KOV A;  4MMO A;  2H5M A;  4CAW A;  4RUH A;  4OKO A;  4JLY A;  1ZG9 A;  3VH9 A;  3IIB A;  1IID A;  3V8I A;  4KOR A;  2I3C A;  1CM0 A;  4X3R A;  4A31 A;  4MHD A;  1DTD A;  1OBR A;  3JTK A;  2AFZ A;  2PR1 A;  1VHO A;  4UA3 A;  4CGP A;  2ZEH A;  4NGN A;  8CPA A;  2QVP A;  3LOD A;  2HC9 A;  2O53 A;  1CP6 A;  2K5T A;  4ONU A;  2YND A;  2Q04 A;  5EMI A;  1WK4 A;  4DYO A;  5HVH A;  3KHZ A;  2G9D A;  3CXQ A;  2FXF A;  4UEE A;  1EE3 P;  2AE6 A;  1IY7 A;  2B5G B;  4YFJ A;  2IL4 A;  2Z3M A;  2F8H A;  3BJ7 A;  3KAS A;  4P6Y A;  3FYN A;  2XEI A;  4R6T A;  5F48 A;  2PJ8 A;  3PGP A;  2C27 A;  4OAE A;  3VAR A;  4A95 A;  4NF1 A;  2C6G A;  3FEE A;  4BD9 A;  4X8I A;  1YK3 A;  2ZXV A;  2Z0Z A;  4CPA A;  4ZYQ A;  1XJO A;  4YGO A;  1QSO A;  3SJX A;  4X2T A;  3H8F A;  4AB7 A;  3I1U A;  1I21 A;  3PB6 X;  2B4D B;  3BXM A;  4K30 A;  3PEI A;  3DGV A;  2VI7 A;  4R8F A;  1Z4R A;  3SI1 A;  3A9L A;  3WR7 A;  1YR0 A;  2RB7 A;  5IB9 A;  3E0K A;  2Q4Z A;  1IOI A;  2GAN A;  1NSL A;  1VHS A;  2J8R A;  4M6G A;  2WSA A;  3SHP A;  3K9T A;  4Y49 C;  5AG6 A;  2CIJ A;  2PJ1 A;  1CJW A;  4NGM A;  1Y0Y A;  3D68 A;  3KR4 A;  1TKF A;  3IGR A;  1ARM A;  3ISZ A;  4FD7 A;  5EC4 A;  4C68 A;  4KVM E;  4C7I A;  2QJ8 A;  2F5I A;  1Q2Y A;  4AXV A;  2FSR A;  3GLJ A;  5GCN A;  4C7H A;  2ABZ A;  1R57 A;  2PR8 A;  4ZY0 A;  3EFA A;  1IGB A;  1QSN A;  2O28 A;  1YME A;  1IYK A;  2QYV A;  1XBU A;  2ODF A;  5K8P A;  3F5B A;  4QVT A;  1ON0 A;  1ELL P;  1PUA A;  3WAB A;  4J3G A;  1QSR A;  2EVN A;  3MN8 A;  5DWM A;  2R8V A;  4JJX A;  4A38 A;  3KI9 A;  3IWW A;  4NGT A;  4PQA A;  3R9G A;  3GYA A;  2PJ2 A;  1BO4 A;  3MGD A;  1Z9U A;  4B12 A;  4CS0 B;  2PJ5 A;  4KSF A;  4R3L A;  4MCS A;  1YLO A;  4KOU A;  1JWQ A;  4G1P A;  3P2H A;  2OB0 A;  5G20 A;  1L0C A;  4OC5 A;  5F49 A;  4QUS A;  1Z8W A;  3IC1 A;  2CY2 A;  3NH5 A;  4TWE A;  4JXR A;  1S7N A;  4OIW A;  1HDU A;  1PU9 A;  1S7F A;  2EK9 A;  4E2A A;  4TNU A;  4JZ0 A;  2Q0Y A;  4YWY A;  2CNS A;  3D3S A;  3W91 A;  1CX8 A;  4FWU A;  1XEB A;  1CPX A;  1YVO A;  4FAI A;  3PB8 X;  2HV2 A;  5K8N A;  4YRH A;  2YNE A;  4GM5 A;  2BL1 A;  2J8N A;  2ZW6 A;  4MY0 A;  2I79 A;  4P4B A;  2VL1 A;  3FJU A;  4XNH C;  2BUE A;  1CBX A;  4M85 A;  1M44 A;  2J8M A;  3B3C A;  1XFO A;  4OC2 A;  4H6Z A;  4R87 A;  3W6S A;  2PJ9 A;  3R9F A;  3TO7 A;  2WUU A;  3B8G A;  1Y7E A;  3ZZI A;  3PB7 X;  2ZEF A;  2ANP A;  1KUV A;  1Y9W A;  2P6E A;  4NXY A;  4Y49 B;  2Z3K A;  4BBH A;  1I12 A;  3PB9 X;  2ZEG A;  4KS9 A;  4UF4 A;  1S7K A;  4A32 A;  3S9L A;  1NSA A;  2NYQ A;  2V77 A;  2FCK A;  3CXS A;  2PJ6 A;  2VBQ A;  5C88 A;  4FD6 A;  3LD2 A;  4AG9 A;  4YU9 A;  1ARL A;  4CGO A;  3I9S A;  4R3K A;  1VGY A;  3HLP A;  1Z8L A;  2JEV A;  1PYT B;  1RXT A;  4LQG A;  3EO4 A;  1NMT A;  2ZEE A;  4UFX A;  2Q51 A;  3PP9 A;  4OC3 A;  1UWY A;  4MJ8 A;  3TFY A;  4H6U A;  1QST A;  1U6M A;  5HMN A;  3PRT A;  4P44 A;  4P4J A;  3FRM A;  4GXH A;  2VZY A;  5D8N A;  2OU2 A;  4DNC A;  3GB0 A;  4KSA A;  4IAV A;  3D2P A;  4HPS A;  1SQH A;  1PCA A;  4KLV A;  2BSW A;  4M3S A;  3CPA A;  4MFJ A;  5KTA A;  4F6A A;  3N7Z A;  3B35 A;  1TF8 A;  3PFO A;  4MCP A;  4GS4 A;  5ELY A;  4CAE A;  5J1Q A;  4XPL A;  4L8A A;  4ZX9 A;  2P0W A;  5H86 A;  2B4B A;  4CYQ A;  2PJ0 A;  4FD4 A;  5LYI A;  1R43 A;  4UEF A;  3FVL A;  4KVO E;  2GU2 A;  1Z8X A;  5F46 A;  1XRY A;  1M4G A;  3QAH A;  3T9Y A;  2BCO A;  4WJB A;  4KUA A;  1MJA A;  2PRB A;  1Y0R A;  2EO8 A;  4PK3 A;  4I49 A;  1ELM P;  2B5G A;  4OP4 A;  2R7H A;  2PJA A;  3KHX A;  4MCQ A;  2YNC A;  3WC6 A;  3R96 A;  4R9M A;  5LRK A;  5H84 A;  4UIA A;  2PC1 A;  3QAY A;  2IMO A;  4PSW A;  1MJB A;  4W9Y A;  4LX9 A;  4F9U A;  1MJ9 A;  1MK4 A;  2ZOG A;  4KOW A;  3EC4 A;  4PK2 A;  1FNO A;  2B4D A;  4P45 A;  4ZY1 A;  1FY7 A;  2CTC A;  3IEH A;  4OME A;  4P4F A;  3TCV A;  5JQ4 A;  1IOF A;  3NH4 A;  2ATR A;  2B3U A;  1IIC A;  3F8K A;  1AYE A;  1LCP A;  1F57 A;  3IWG A;  1P0H A;  4U9Y A;  4C2Z A;  3GIU A;  5C82 A;  6CPA A;  3P2F A;  5FVJ A;  4FBE A;  5K8M A;  2C6P A;  2FE7 A;  4OC4 A;  3IFE A;  3VAT A;  2ZW5 A;  4AVC A;  1ZG7 A;  1S5K A;  1VKC A;  4PXC A;  4RI1 A;  3R9E A;  1S7L A;  1DE4 C;  2VXK A;  3RNZ A;  2IJZ A;  2PJ3 A;  3SJE A;  3TC8 A;  1LAP A;  1TKJ A;  2RC4 A;  3B3S A;  2VQY A;  3BLN A;  4A2Z A;  2JBJ A;  4EFD A;  1XMT A;  1Y9K A;  3RBU A;  2CTB A;  4MI4 A;  2PQ8 A;  2PJ7 A;  1KUX A;  4IK2 A;  4Q7A A;  4X5K A;  1VIX A;  2PE3 A;  3B3W A;  4NJR A;  4UWJ A;  2REE A;  3DR6 A;  5E96 A;  3TT2 A;  4B13 A;  5IB0 A;  1B6B A;  1YX0 A;  2C1C A;  3D4U A;  1Z4E A;  4F0Y A;  3TO6 A;  3H8G A;  4KZT A;  3IU2 A;  3IJ3 A;  2X7B A;  3SI0 A;  5AG5 A;  4QC6 A;  3FF3 A;  3IWE A;  4CGL A;  5JGF A;  2NMT A;  2ZEO A;  4B5O A;  1HEE A;  1VHE A;  4MCR A;  4OAD A;  3SXN A;  3B2Y A;  2Q44 A;  1LFW A;  1LRZ A;  1QSM A;  2AFM A;  2GIV A;  3GY9 A;  3RYO A;  4CAX A;  2VEZ A;  3ISX A;  2EWB A;  5F47 A;  2BOA A;  2PVW A;  5G1Z A;  4LUA A;  4BMH A;  3NA6 A;  1KWM A;  4Z65 A;  4R76 A;  2PSW A;  2V8G A;  3LAC A;  1ZLI A;  2NSM A;  1HDQ A;  1YRE A;  4F8Z A;  4KLW A;  3TOB A;  2Q4V A;  2PDO A;  1CG2 A;  1V0C A;  2AFX A;  4A30 A;  3BI0 A;  4MFZ A;  4C2X A;  4IHM A;  1AUG A;  5IV0 A;  1CP7 A;  4M6I A;  3GUX A;  2JDD A;  4BIN A;  4Q36 A;  5J8F A;  2EK8 A;  4QBJ A;  3IO1 A;  1LOK A;  4PSX A;  3T8W A;  1M4L A;  2IQ6 A;  1YSJ A;  4CRZ B;  1Q2C A;  3I3G A;  5F09 A;  1IB1 E;  5LYL A;  4FD5 A;  4NEX A;  3B3V A;  4A37 A;  4H89 A;  4MHY A;  4WWV A;  3UY5 A;  4H2K A;  3D7G A;  2Y0M A;  1J4J A;  5BWA B;  2DF5 A;  4FUU A;  4F9V A;  4CGN A;  3FED A;  4UBR A;  1NE9 A;  1IU8 A;  3FB3 A;  2Q4Y A;  4CYO A;  3FEC A;  3DLJ A;  4OLL A;  3CPX A;  1ZLH A;  2Q43 A;  4MHZ A;  2GRE A;  1UFH A;  2C6C A;  3QB8 A;  2QEC A;  4JXQ A;  1JQG A;  2XEG A;  1YW6 A;  1XE4 A;  4MFL A;  3JVN A;  3V7Z A;  4P4E A;  2FS5 A;  3C26 A;  2ZEL A;  3EY5 A;  3CT9 A;  3KGQ A;  1XF8 A;  1P4N A;  5CBM A;  2YNC C;  4A94 A;  2PCU A;  5DWN A;  3ZJ0 A;  3B7I A;  1ZO0 A;  1WWZ A;  1IYL A;  3CDX A;  1GHE A;  2CF4 A;  2Z3L A;  2Q7B A;  4EWT A;  1M4I A;  1S60 A;  1YVK A;  2JDC A;  4HNW B;  4KOY A;  3EXN A;  4U5Y A;  2HB6 A;  4IF5 A;  5HXD A;  4UCN A;  3L2N A;  5K8O A;  1BLL E;  3TE4 A;  3SI2 A;  4OC1 A;  4B5P B;  2REF A;  5G21 A;  4KOX A;  4JWP A;  5LRG A;  4NSQ A;  2I00 A;  2WPW A;  4R7M A;  1XMB A;  4NGS A;  4UFW A;  5IX3 A;  4UCM A;  4XPD C;  2J9A A;  4UEZ A;  2EUI A;  3PZJ A;  3S6G A;  3FBU A;  2GLF A;  3OWC A;  2WPX A;  2DPT A;  2PRQ A;  2FIW A;  2R1I A;  1K4J A;  1Z8T A;  2QML A;  4HNY B;  2GLJ A;  2D4O A;  2G0B A;  4NGQ A;  4ZGY B;  5EBV A;  4XNH B;  2WYR A;  3PFE A;  4ZX8 A;  5LYD A;  2ZED A;  4MXU A;  3PB4 X;  3G3S A;  2ZEP A;  3TO9 A;  1YLE A;  4KOT A;  4M6H A;  4MFQ A;  3TX8 A;  3NE7 A;  3PBB A;  3T90 A;  2CNT A;  1S3Z A;  2PIY A;  5AGE A;  4UCP A;  5CPA A;  2V8D A;  4NGR A;  2OOT A;  5I4M A;  4B10 A;  2ZW7 A;  2Q7S A;  1KZF A;  4P4I A;  1YGH A;  4MHP A;  4MRI A;  3S9N A;  1I1D A;  4EME A;  2B3V A;  1LAN A;  2HQY A;  3BHX A;  3S6K A;  2OZG A;  3D7H A;  3D67 A;  2ZEM A;  2CNM A;  1TF9 A; 
#chains in the Genus database with same CATH homology
 4B11 A;  5G22 A;  2FL4 A;  3CXP A;  3G8W A;  1M1D A;  3K9U A;  4CRY B;  3FXT A;  4F0X A;  1KUY A;  5A27 A;  2YGW A;  2ZPA A;  1N71 A;  3FIX A;  4CYN A;  4IUS A;  2GE3 A;  3H5Z A;  3BJ8 A;  4HKF A;  4RS2 A;  2FT0 A;  1Q2D A;  1RO5 A;  2Z3O A;  4JD6 A;  4XPD B;  2BEI A;  4KUB A;  3TTH A;  4MBU A;  4L89 A;  3W6X A;  4AG7 A;  2P6G A;  4MY3 A;  4KVX A;  4AVA A;  4PV6 A;  2KCW A;  2QIR A;  2DPS A;  2P6F A;  4U9Z A;  2OZH A;  3VWE A;  4KOS A;  1BOB A;  2Z10 A;  3D8P A;  2HUZ A;  3VWD A;  3DNS A;  1M4D A;  2R98 A;  3S6F A;  5AG4 A;  5AG7 A;  4Q38 A;  4A33 A;  1B87 A;  2Z3N A;  2G3T A;  2A4N A;  2DXQ A;  2D4P A;  4ZBG A;  3SXO A;  5JPH A;  2Z3P A;  3DDD A;  3JUW A;  2OZU A;  4UFV A;  4C2Y A;  5ISV A;  3DSB A;  1TIQ A;  5A28 A;  3R1K A;  5J8C A;  4UWI A;  4CAF A;  1XIX A;  5HH1 A;  4HNX B;  4XPK A;  4II9 A;  4CYP A;  4MFP A;  4E8O A;  2G3A A;  4MFK A;  2ZW4 A;  4AVB A;  4E0A A;  5I0C A;  4EVY A;  2VZZ A;  3D2M A;  2Z11 A;  2OH1 A;  4B14 A;  4NCZ A;  3IU1 A;  4B5P A;  5CNP A;  2AJ6 A;  4QB9 A;  1OZP A;  2JLM A;  3FNC A;  2CXA A;  3GKR A;  2FIA A;  5KTD A;  3S6H A;  1Y7R A;  4CGM A;  3H4Q A;  3F0A A;  3R95 A;  3DR8 A;  3TOA A;  2B58 A;  5KTC A;  2ARH A;  4R57 A;  4CAV A;  3KKW A;  4ORF A;  4CAW A;  4KOV A;  2H5M A;  4JLY A;  1IID A;  3V8I A;  4KOR A;  1CM0 A;  4A31 A;  4MHD A;  3JTK A;  2PR1 A;  4CGP A;  4UA3 A;  3LOD A;  2K5T A;  4ONU A;  2YND A;  2Q04 A;  1WK4 A;  3CXQ A;  2FXF A;  2AE6 A;  2B5G B;  4YFJ A;  2IL4 A;  2Z3M A;  4F0Y A;  3BJ7 A;  3FYN A;  5F48 A;  3PGP A;  2C27 A;  4OAE A;  4A95 A;  4NF1 A;  1YK3 A;  2ZXV A;  2Z0Z A;  4YGO A;  1QSO A;  4AB7 A;  4K30 A;  1I21 A;  4CAX A;  2B4D B;  3WR7 A;  2VI7 A;  1Z4R A;  3A9L A;  1YR0 A;  3E0K A;  1NSL A;  2GAN A;  1VHS A;  2J8R A;  2WSA A;  3SHP A;  4Y49 C;  5AG6 A;  1CJW A;  3IGR A;  4FD7 A;  5EC4 A;  4C68 A;  4C7I A;  4KVM E;  2F5I A;  1Q2Y A;  2FSR A;  5GCN A;  4C7H A;  1R57 A;  2PR8 A;  3EFA A;  1QSN A;  2O28 A;  1IYK A;  3F5B A;  4QVT A;  1ON0 A;  1PUA A;  4J3G A;  1QSR A;  2EVN A;  5DWM A;  2R8V A;  4JJX A;  3R9G A;  3GYA A;  1BO4 A;  3MGD A;  1Z9U A;  4B12 A;  4CS0 B;  4KSF A;  4R3L A;  4KOU A;  3P2H A;  2OB0 A;  5G20 A;  1L0C A;  5F49 A;  4QUS A;  2CY2 A;  4JXR A;  1S7N A;  1PU9 A;  1S7F A;  4E2A A;  2Q0Y A;  2CNS A;  3D3S A;  3W91 A;  1XEB A;  1YVO A;  2HV2 A;  4YRH A;  2YNE A;  4CYQ A;  2BL1 A;  2J8N A;  2ZW6 A;  4MY0 A;  2I79 A;  4XNH C;  2BUE A;  4M85 A;  1M44 A;  2J8M A;  3W6S A;  4H6Z A;  4R87 A;  3TO7 A;  3R9F A;  2WUU A;  3B8G A;  3ZZI A;  4Y49 B;  1KUV A;  1Y9W A;  2P6E A;  4NXY A;  4BBH A;  2Z3K A;  1I12 A;  4KS9 A;  1S7K A;  4A32 A;  3CXS A;  2FCK A;  2VBQ A;  5C88 A;  4FD6 A;  3LD2 A;  4AG9 A;  4CGO A;  3I9S A;  4R3K A;  2JEV A;  1RXT A;  3EO4 A;  1NMT A;  4UFX A;  3PP9 A;  4MJ8 A;  3TFY A;  4H6U A;  1QST A;  1U6M A;  5HMN A;  3FRM A;  2VZY A;  2OU2 A;  4DNC A;  4KSA A;  3D2P A;  1SQH A;  4KLV A;  2BSW A;  4M3S A;  4MFJ A;  5KTA A;  4F6A A;  3N7Z A;  4CAE A;  4GS4 A;  4XPL A;  4L8A A;  2P0W A;  5H86 A;  2B4B A;  4FD4 A;  4KVO E;  5F46 A;  3QAH A;  1M4G A;  3T9Y A;  4KUA A;  1MJA A;  2PRB A;  4PK3 A;  4I49 A;  2B5G A;  2R7H A;  2YNC A;  3R96 A;  4R9M A;  5H84 A;  2PC1 A;  4PSW A;  1MJB A;  4LX9 A;  1MJ9 A;  1MK4 A;  4KOW A;  3EC4 A;  4PK2 A;  2B4D A;  1FY7 A;  3TCV A;  5JQ4 A;  2ATR A;  2B3U A;  1IIC A;  3F8K A;  3IWG A;  1P0H A;  4U9Y A;  4C2Z A;  5C82 A;  3P2F A;  5FVJ A;  2FE7 A;  2ZW5 A;  4AVC A;  1S5K A;  1VKC A;  4RI1 A;  3R9E A;  1S7L A;  2VXK A;  2RC4 A;  2VQY A;  3BLN A;  4A2Z A;  1XMT A;  1Y9K A;  4MI4 A;  2PQ8 A;  1KUX A;  4X5K A;  4UWJ A;  5E96 A;  2REE A;  3DR6 A;  3TT2 A;  4B13 A;  5IB0 A;  1B6B A;  1YX0 A;  1Z4E A;  3TO6 A;  4KZT A;  3IU2 A;  2X7B A;  5AG5 A;  4QC6 A;  3IWE A;  4CGL A;  2NMT A;  4B5O A;  4OAD A;  3SXN A;  2Q44 A;  1LRZ A;  1QSM A;  2GIV A;  3GY9 A;  3RYO A;  2VEZ A;  4BMH A;  5F47 A;  5G1Z A;  4LUA A;  2PSW A;  1YRE A;  4KLW A;  3TOB A;  2Q4V A;  2PDO A;  4C2X A;  1V0C A;  4A30 A;  4MFZ A;  5IV0 A;  2JDD A;  4Q36 A;  5J8F A;  4QBJ A;  4PSX A;  4CRZ B;  1Q2C A;  3I3G A;  1IB1 E;  4FD5 A;  4NEX A;  4H89 A;  3UY5 A;  2Y0M A;  1J4J A;  5BWA B;  4CGN A;  4UBR A;  1NE9 A;  3FB3 A;  2Q4Y A;  4CYO A;  4OLL A;  1UFH A;  3QB8 A;  2QEC A;  4JXQ A;  1XE4 A;  4MFL A;  3JVN A;  2FS5 A;  3C26 A;  3EY5 A;  1XF8 A;  1P4N A;  2YNC C;  5DWN A;  3ZJ0 A;  1ZO0 A;  1WWZ A;  1IYL A;  1GHE A;  2Z3L A;  2Q7B A;  1M4I A;  1S60 A;  1YVK A;  2JDC A;  4HNW B;  4KOY A;  3EXN A;  4U5Y A;  4IF5 A;  4UCN A;  3TE4 A;  4B5P B;  2REF A;  5G21 A;  4KOX A;  4JWP A;  4NSQ A;  2I00 A;  2WPW A;  4UFW A;  5IX3 A;  4UCM A;  4XPD C;  2EUI A;  3PZJ A;  3S6G A;  3FBU A;  3OWC A;  2WPX A;  2DPT A;  2FIW A;  2R1I A;  1K4J A;  2QML A;  4HNY B;  2D4O A;  2G0B A;  4ZGY B;  5EBV A;  4XNH B;  3G3S A;  3TO9 A;  1YLE A;  4KOT A;  4MFQ A;  3NE7 A;  3T90 A;  2CNT A;  1S3Z A;  5AGE A;  4UCP A;  4B10 A;  2ZW7 A;  1KZF A;  1YGH A;  1I1D A;  2B3V A;  3S6K A;  2HQY A;  2OZG A;  2CNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...