1IB1E

Crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
178
Chain Sequence
SGIPGSPGRQRRHLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14-3-3 ZETA ISOFORM
publication title Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 45
structure length 178
sequence length 179
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2001-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ib1E00
3PGPA 3BJ7A 2R1IA 3IGRA 3TT2A 2J8RA 3S6HA 1IB1E 1S7LA 2DXQA 5J8FA 5JPHA 3P2HA 2I79A 3QB8A 1LRZA 2FIAA 1P0HA 2Z10A 1NE9A 2WPXA 1RXTA 2G3TA 3VWDA 2CNMA 3R9GA 4NSQA 2R98A 2OH1A 3BLNA 2VZYA 1Y7RA 3F8KA 4OAEA 2H5MA 3T90A 1ON0A 1YK3A 3TOAA 2B4DA 3ZZIA 2VI7A 1L0CA 3B8GA 3S6FA 2OB0A 3JUWA 1MJAA 3EXNA 4JXRA 4E2AA 3EFAA 4KOTA 4CAWA 3D2MA 5KTDA 2FT0A 4KVME 3T9YA 5F49A 4XNHC 3G3SA 3TOBA 1PU9A 4Y49C 1IICA 4IF5A 3K9UA 1Q2DA 4FD6A 2PRBA 4MHDA 1S3ZA 5FVJA 2AJ6A 3G8WA 4L8AA 4Y49B 4ZBGA 2Z11A 1CM0A 3NE7A 4F6AA 2RC4A 2ZXVA 1M44A 4KOUA 1KUVA 3C26A 4HKFA 1GHEA 2VBQA 2VQYA 2R8VA 4U5YA 3I9SA 5J8CA 4KOYA 1I21A 1S5KA 1FY7A 2B4DB 4U9YA 2VXKA 2CY2A 1XIXA 4RI1A 1VHSA 2B3VA 5F47A 4AB7A 2BEIA 1SQHA 2P6GA 4QVTA 2F5IA 2ZW4A 2R7HA 1BO4A 1XMTA 1IIDA 4KUAA 3W6XA 2Q04A 2JEVA 2PC1A 3CXSA 2JLMA 1YLEA 3VWEA 3GKRA 4OLLA 2Z0ZA 3FB3A 2OZGA 3I3GA 2Q4YA 3H4QA 2BSWA 2FXFA 1YVOA 1YX0A 2BUEA 3D8PA 1QSOA 3IWGA 4XPLA 2VZZA 5EBVA 3DNSA 4XPDC 4H6ZA 3TO9A 4QUSA 4PSWA 4R57A 3TE4A 2B4BA 3S6KA 2P6EA 3BJ8A 3FNCA 4MJ8A 4XPDB 5F46A 2EVNA 1VKCA 2AE6A 4CRYB 1Z4RA 5IV0A 4PK2A 5KTCA 2X7BA 4AG7A 2B3UA 1YR0A 3ZJ0A 1V0CA 5DWNA 4I49A 3SXNA 2REFA 3DR6A 4LUAA 4JWPA 2QECA 1Y9WA 4E0AA 1YGHA 2GANA 4RS2A 3V8IA 4NF1A 4GS4A 1OZPA 3JVNA 2HQYA 1M4IA 2ATRA 3EY5A 4JJXA 2G3AA 3F0AA 3LODA 4R9MA 2KCWA 5F48A 2A4NA 1I12A 3SHPA 1QSTA 1P4NA 3GYAA 2ARHA 4R3LA 1XF8A 3R1KA 4MY0A 4KOXA 3N7ZA 2PDOA 4H89A 2FSRA 2K5TA 4HNYB 4K30A 2G0BA 1BOBA 5I0CA 1B87A 2VEZA 5IB0A 4HNXB 1XEBA 2Q7BA 2FIWA 4PV6A 1M4DA 4FD7A 2FS5A 4AVBA 2PR8A 3W91A 4J3GA 1WWZA 2J8MA 3SXOA 1QSNA 1Y9KA 2CNTA 1U6MA 2ZW5A 4FD5A 1N71A 3EO4A 5H86A 4KOVA 4CRZB 3TO7A 1YVKA 4YFJA 5DWMA 1MK4A 3QAHA 1S7FA 4NCZA 3R96A 3TO6A 2OU2A 2P0WA 3DSBA 4M85A 3TFYA 4JD6A 4B5OA 4OADA 5C82A 1IYKA 2PR1A 2Y0MA 2OZUA 1Z9UA 2I00A 3WR7A 1B6BA 3FRMA 2CNSA 3EC4A 1UFHA 4R87A 1NMTA 4MY3A 4R3KA 5H84A 2PSWA 1R57A 4AG9A 1CJWA 2OZHA 2B5GA 5EC4A 4FD4A 4MBUA 1PUAA 4LX9A 4H6UA 3KKWA 1I1DA 1M1DA 2QMLA 3CXQA 2C27A 2HV2A 4CAXA 1M4GA 2GIVA 5GCNA 2J8NA 1Q2CA 1RO5A 4JXQA 4AVCA 4XPKA 5HMNA 2ZW6A 4KLWA 3E0KA 1NSLA 4KORA 3TTHA 3D2PA 2BL1A 4YGOA 4KOSA 4MI4A 3DDDA 2REEA 1KUXA 1K4JA 4E8OA 5ISVA 5CNPA 2B58A 2D4OA 3FXTA 3R9EA 5HH1A 2FL4A 1KZFA 4B5PA 4UWJA 2P6FA 3GY9A 4EVYA 2GE3A 2Q44A 3FIXA 2WPWA 4BMHA 4UBRA 3LD2A 4KUBA 4KVOE 2ZPAA 4KLVA 5KTAA 4DNCA 4KOWA 3FYNA 1YREA 1S7NA 2ZW7A 2JDDA 2D4PA 3F5BA 4NEXA 4PSXA 2JDCA 2O28A 3R9FA 4QBJA 1MJBA 2B5GB 3RYOA 4XNHB 3TCVA 1KUYA 3PP9A 4JLYA 4ONUA 1S60A 3MGDA 4YRHA 2Q4VA 2QIRA 4CS0B 2FE7A 3P2FA 2FCKA 4AVAA 4UWIA 4IUSA 2PQ8A 2HUZA 1QSMA 3OWCA 5C88A 4HNWB 3FBUA 3CXPA 4M3SA 1QSRA 4L89A 1MJ9A 4X5KA 5IX3A 3DR8A 1WK4A 2Q0YA 4F0YA 1IYLA 2IL4A 1Z4EA 4QC6A 3UY5A 3W6SA 3R95A 4KVXA 1Q2YA 4B5PB 1XE4A 1J4JA 2NMTA 4NXYA 1S7KA 1TIQA 4UA3A 4PK3A 4II9A 4KZTA 3PZJA 3D3SA 5E96A 3S6GA 4U9ZA 5JQ4A 2EUIA 4QB9A 4ORFA 4CAVA
chains in the Genus database with same CATH superfamily
2IQ6A 4K3NA 2CTBA 3NA6A 3KI9A 1LAPA 3PGPA 3BJ7A 4YWYA 2R1IA 3IGRA 3TT2A 2J8RA 3S6HA 1IB1E 1S7LA 2DXQA 4CGLA 3H8EA 5J8FA 5JPHA 4DJLA 3IC1A 2Z3OA 3P2HA 1ZLIA 2Z3LA 2YNDA 3QAYA 1VHEA 2I79A 3QB8A 1LRZA 4W9YA 4GXHA 2PJ9A 2FIAA 1P0HA 3NH8A 4FBEA 2Z10A 4O23A 1NE9A 2WPXA 1RXTA 2G3TA 1CX8A 3BI0A 4ZX9A 3VWDA 3PB6X 2OOTA 2CNMA 1BPMA 4NSQA 3R9GA 2R98A 2ZEFA 4P6YA 3V38A 2OH1A 3BLNA 3FH4A 2VZYA 1Y7RA 3F8KA 4NGMA 4IK2A 2PJBA 4MMOA 3WC7A 3B3VA 4OAEA 2H5MA 3T90A 2ZEHA 2AFSA 4B12A 7CPAA 1ON0A 1Q7LA 5LYFA 1YK3A 4MHNA 5A27A 4ZI6A 3FF3A 3TOAA 3GUXA 3RZAA 2B4DA 2PJ7A 3ZZIA 2VI7A 2RB7A 1L0CA 3K2KA 3H8FA 3B8GA 3DLJA 3FJUA 3S6FA 2HC9A 2BO9A 5LYDA 2OB0A 2ZEPA 2QVPA 5D8NA 4C7HA 4PQAA 3PBEA 3JUWA 4A2ZA 1MJAA 3EXNA 5CBMA 5G1ZA 4X2TA 1VIXA 1AMPA 4JXRA 2Q43A 3LACA 4E2AA 3EFAA 4KOTA 4CAWA 3D2MA 5KTDA 1ARMA 2ABZA 4A31A 4CYPA 2FT0A 4KVME 4Q38A 5LYIA 4UIBA 5F49A 4XNHC 1YMEA 3T9YA 4BINA 4LQGA 4DUKA 3G3SA 4NGTA 1PYTB 3TOBA 1PU9A 4Y49C 2PJ3A 4OKOA 2F8HA 1IICA 2O53A 4IF5A 4P45A 3K9UA 4OC4A 4UCMA 1Q2DA 1UWYA 4FD6A 2PRBA 3FEDA 1JQGA 1Y0RA 4MHDA 1S3ZA 5FVJA 2AJ6A 1BAVA 1CPSA 2WUUA 4CGMA 3G8WA 4L8AA 1CP7A 4RN7A 4Y49B 4M6IA 4R76A 2J9AA 4ZBGA 4B10A 2Z11A 4ZYQA 3VARA 1CM0A 1ELMP 3NE7A 2CIJA 2YGWA 5BWAB 4F6AA 3ISZA 2RC4A 2ZXVA 1M44A 2Z3PA 4R6TA 1DE4C 4IHMA 4KOUA 2V8GA 1KUVA 2ZEOA 3C26A 3KQZA 3IWWA 4C2XA 1H8LA 4F0XA 4HKFA 2YNEA 2PJAA 3TX8A 2PJ5A 4OC2A 3DGVA 3TC8A 1GHEA 2VBQA 4C2ZA 2VQYA 1LCPA 2R8VA 3H8GA 1OBRA 4U5YA 5AG7A 3SJFA 3I9SA 5LYLA 4P4DA 2VL1A 4CYQA 4KOYA 1I21A 4ZY1A 2FVGA 5J8CA 2Z3NA 1S5KA 4LQ6A 1FY7A 2HB6A 2B4DB 4U9YA 2AFWA 1TXRA 1YW4A 2VXKA 4A39A 2CY2A 1XIXA 3FEEA 4F9VA 4Z65A 4RI1A 1VHSA 2B3VA 1XRYA 3CPAA 5F47A 4AB7A 1YQEA 2BEIA 1ARLA 1SQHA 5AGEA 2Q4ZA 4YU9A 4MCPA 2YNCA 4Q36A 2P6GA 2ZENA 2F5IA 4QVTA 4OC1A 2ZW4A 3FX6A 2AFMA 3KASA 4CYOA 2R7HA 1BO4A 1XMTA 1IIDA 3IEHA 3IWEA 4KUAA 3W6XA 4NGQA 3GLJA 2Q04A 2JEVA 2PC1A 3CXSA 1ZLHA 3I1UA 1Z5RA 2JLMA 1YLEA 1PCAA 2C6GA 3KR4A 3VWEA 3GKRA 2Z3MA 4OLLA 2Z0ZA 3BXMA 3FB3A 2OZGA 2CXAA 4TNUA 3I3GA 2Q4YA 3H4QA 1IY7A 2BSWA 2FXFA 1YVOA 2PJ6A 1YX0A 2BUEA 1R43A 4A32A 3MN8A 3D8PA 2O4HA 1QSOA 3IWGA 4XPLA 5AG4A 2VZZA 5EBVA 2JBKA 3D68A 3DNSA 4XPDC 5AG5A 5HVFA 3B3WA 4H6ZA 5A28A 2XEJA 1TKJA 2ODFA 3TO9A 4QUSA 4PSWA 4R57A 1BLLE 2PJ4A 3TE4A 2B4BA 1Z2LA 1XOVA 4UFVA 3S6KA 3PFOA 3NH5A 2P6EA 3BJ8A 3FNCA 4MJ8A 2PVVA 4MCSA 4A95A 4NFRA 4OIWA 4C68A 4XPDB 4OP4A 5IB9A 3PEIA 4P4IA 3LMSA 4CAFA 5F46A 2EVNA 1VKCA 4UEEA 5AG6A 2AE6A 4CRYB 4ONWA 4P4EA 1Z4RA 5IV0A 2GFQA 4KS9A 3NE8A 4PK2A 2X7BA 4WJBA 4UEZA 3SJEA 4AG7A 4RUHA 2B3UA 4EMEA 4CYNA 2Q7SA 1TKFA 1YR0A 3KHXA 1XJOA 3ZJ0A 1ELLP 1V0CA 5DWNA 4B14A 4I49A 3VATA 3SXNA 2REFA 2YNCC 3B3CA 3DR6A 4G1PA 4LUAA 4JWPA 2QYVA 1Y7EA 2DEAA 2QECA 4X3RA 4C2YA 4MFZA 2V8DA 1Y9WA 4R8FA 4E0AA 1YGHA 2GANA 5JH9A 4M6GA 4RS2A 3FMCA 3V8IA 5HXDA 1M4LA 4NF1A 2G9DA 3JRUA 4GS4A 4UCPA 1OZPA 2HQYA 3JVNA 1M4IA 5G20A 4MCRA 2ATRA 3EY5A 4CGPA 5HVGA 4MFLA 4JJXA 2V8HA 2G3AA 3F0AA 3LODA 4R9MA 4UIAA 1F2PA 2EK8A 4MCQA 2KCWA 5F48A 2A4NA 3KHZA 1I12A 3SHPA 1QSTA 1P4NA 4CAEA 1CP6A 3GYAA 3IJ3A 3KR5A 3CDXA 4UEFA 2ARHA 1A2ZA 1R3NA 2AFXA 1XF8A 2POKA 1FNOA 1XFOA 1LFWA 2QJ8A 3D4UA 3R1KA 4R3LA 4MY0A 2CTCA 4KOXA 3S9LA 1NSAA 3N7ZA 2PDOA 1YSJA 4H89A 4F8ZA 2FSRA 4JZ0A 2ZELA 3ISXA 3WT4A 1HDQA 1LOKA 3NFZA 2K5TA 4HNYB 3BI1A 1RTQA 1X10A 2PCUA 4K30A 2ZEDA 2G0BA 1BOBA 1ZG9A 3D66A 3WC5A 5I0CA 1B87A 2VEZA 5IB0A 4HNXB 1YLOA 4OC5A 2JEWA 4NJQA 3IFEA 1XEBA 1VHOA 2Q7BA 2FIWA 4PV6A 1M4DA 4FD7A 2FS5A 4AVBA 2PJCA 2PR8A 4A37A 3W91A 4J3GA 1WWZA 2J8MA 2EK9A 2ZOGA 3B3TA 3SXOA 1QSNA 3KGQA 4Q7AA 1Y9KA 4HPSA 2CNTA 1U6MA 1Z8LA 2V8VA 3FVLA 4DYOA 2ZW5A 3SI2A 4FD5A 1JWQA 3D7HA 4X8IA 1N71A 3EO4A 4OMEA 5H86A 4KSFA 4ZX8A 2AFOA 4KOVA 2V77A 1ZO0A 3TO7A 4CRZB 1YVKA 3PRTA 4MFJA 4BBHA 4YFJA 1CBXA 4MRIA 3PB8X 1X12A 2IMOA 2PJ2A 5DWMA 2PJ8A 1MK4A 3PB7X 3QAHA 1IU8A 1S7FA 4NCZA 3R96A 5EMIA 3TO6A 3QNVA 5KTCA 5LRJA 2OU2A 1IOFA 3HUVA 2P0WA 3DSBA 3KQXA 4M85A 3TFYA 1Z8XA 4JD6A 5DS0A 5J1QA 4B5OA 3CPXA 4OADA 5K8MA 5C82A 2ZEMA 1IYKA 1EE3P 2I3CA 2PIYA 4GM5A 2PR1A 1QQ9A 2JBJA 2OZUA 2WZNA 2XEFA 2Y0MA 4M6HA 1Z9UA 4UFXA 2I00A 3FECA 3WR7A 1LAMA 1B6BA 4PXBA 2PJ0A 3FRMA 2CNSA 3EC4A 1UFHA 4R87A 1NMTA 2EBJA 4MHZA 3KZWA 4MY3A 4R3KA 5H84A 2PSWA 1R57A 4NGRA 4P4FA 4AG9A 1CJWA 4UCNA 5F09A 1YW6A 2DF5A 2WYRA 3SJXA 1IOIA 2OZHA 2GU2A 4OC3A 2B5GA 4OIDA 4FWUA 5EC4A 5JM6A 2ZOFA 3S9NA 2PJ1A 5LRKA 1FT7A 4FD4A 4MBUA 5LRGA 2XEGA 2PIZA 3RO0A 1PUAA 4KSIA 4LX9A 3K9TA 4H6UA 5THWA 3KKWA 1I1DA 2C6CA 5ELYA 4EFDA 1CPXA 1M1DA 2QMLA 5D29A 3CXQA 1CG2A 4PPZA 2C27A 2HV2A 1VGYA 3GIUA 1M4GA 4CAXA 2GIVA 1QMUA 5GCNA 2J8NA 2ANPA 4AXVA 4MHPA 1Q2CA 1RO5A 4JXQA 4AVCA 4ZY0A 4MFQA 4A33A 2AFUA 3PB4X 2Q51A 4XPKA 2NSMA 5HMNA 3D67A 2ZW6A 4R7MA 4KSAA 4KLWA 3B2YA 2CF4A 3E0KA 1NSLA 4KORA 3TTHA 3NH4A 4B11A 3PFEA 2BL1A 2RFHA 3D2PA 4UF4A 4YGOA 1LANA 3B35A 2ZEEA 3IU1A 3N5FA 4KOSA 4MI4A 3DDDA 2REEA 1ZG7A 4C7IA 1KUXA 1K4JA 2GREA 4P10A 4E8OA 1F57A 2C6PA 3IO1A 1ZG8A 3D7FA 5ISVA 4IAVA 5CNPA 5CPAA 2DPTA 2B58A 2D4OA 3FXTA 3GB0A 3R9EA 5HH1A 2FL4A 1KZFA 4B5PA 4UWJA 2P6FA 2OR4A 3GY9A 2NYQA 4OC0A 4EVYA 4TWEA 3B3SA 1TF8A 2GE3A 1TKHA 2Q44A 3FIXA 2WPWA 3RAMA 4UBRA 4BMHA 3HLPA 2BCOA 3LD2A 5K8PA 1BPNA 2EWBA 4KUBA 4KVOE 4P44A 2ZEGA 5I4MA 2ZPAA 4KLVA 5JGFA 3CT9A 2PE3A 5KTAA 2IJZA 4DNCA 4KOWA 5G21A 3FYNA 1YREA 1S7NA 2ZW7A 4JYWA 2JDDA 1Z8WA 3H5ZA 3WC6A 3D7DA 4CGNA 1TF9A 2D4PA 3F5BA 4NEXA 4PSXA 2PRQA 3WABA 2JDCA 2O28A 4FUUA 3R9FA 4QBJA 1IGBA 4FAIA 1MJBA 2B5GB 3RYOA 1Z8TA 4XNHB 3B7IA 3TCVA 1F2OA 1KUYA 3PP9A 4JLYA 4A30A 4ONUA 1XMBA 3IIBA 1XBUA 3A9LA 4PXDA 4EWTA 1S60A 3CZXA 1Y0YA 3MGDA 4YRHA 2F7VA 3RNZA 3PBBA 2Q4VA 1AUGA 2QIRA 2Z3KA 4MHYA 4A38A 4CS0B 2FE7A 3P2FA 4MXUA 3JTKA 2FCKA 4NGPA 2PVWA 4AVAA 4UWIA 4IUSA 2PQ8A 2AFZA 2HUZA 1QSMA 3OWCA 5C88A 4HNWB 2BOAA 3FBUA 1HDUA 5HVHA 4B13A 4UFWA 3KL9A 4WWVA 4MFKA 2WSAA 3T8WA 3CXPA 5G22A 4M3SA 1QSRA 3RBUA 4L89A 1MJ9A 4X5KA 5IX3A 4ZY2A 2EO8A 3DR8A 1WK4A 2Q0YA 3SJGA 4F0YA 1IYLA 2IL4A 1Z4EA 5K8NA 4P4JA 4QC6A 4CGOA 3UY5A 4F9UA 4A94A 4NGNA 4NGSA 3W6SA 3IU2A 4KVXA 1Q2YA 3R95A 4B5PB 1GYTA 2XEIA 3LWUA 2GLFA 3MRUA 3VH9A 1XE4A 4CPAA 1J4JA 2DPSA 6CPAA 2NMTA 3SI1A 3PB9X 1S7KA 1TIQA 3L2NA 4NXYA 4UA3A 4PK3A 3SI0A 4II9A 4NJRA 4KZTA 4ZGYB 4MFPA 2C1CA 1AYEA 3PZJA 4BD9A 3D3SA 5E96A 3S9MA 4PXCA 4H2KA 2GLJA 4U9ZA 3S6GA 5JQ4A 3D7GA 8CPAA 4PXEA 2EUIA 3V7ZA 1KWMA 4QB9A 5K8OA 1HEEA 3BHXA 4P4BA 4ORFA 4B6ZA 4CAVA 1DTDA
chains in the Genus database with same CATH topology
3PGPA 3BJ7A 2R1IA 3IGRA 3TT2A 2J8RA 3S6HA 1IB1E 1S7LA 2DXQA 4CGLA 5J8FA 5JPHA 2Z3OA 3P2HA 2Z3LA 2YNDA 2I79A 3QB8A 1LRZA 2FIAA 1P0HA 2Z10A 1NE9A 2WPXA 1RXTA 2G3TA 3VWDA 2CNMA 3R9GA 4NSQA 2R98A 2OH1A 3BLNA 2VZYA 1Y7RA 3F8KA 4OAEA 2H5MA 3T90A 4B12A 1ON0A 1YK3A 5A27A 3TOAA 2B4DA 3ZZIA 2VI7A 1L0CA 3B8GA 3S6FA 2OB0A 4C7HA 3JUWA 4A2ZA 1MJAA 3EXNA 5G1ZA 4JXRA 4E2AA 3EFAA 4KOTA 4CAWA 3D2MA 5KTDA 4A31A 4CYPA 2FT0A 4KVME 4Q38A 3T9YA 5F49A 4XNHC 3G3SA 3TOBA 1PU9A 4Y49C 1IICA 4IF5A 3K9UA 4UCMA 1Q2DA 4FD6A 2PRBA 4MHDA 1S3ZA 5FVJA 2AJ6A 2WUUA 4CGMA 3G8WA 4L8AA 4Y49B 4ZBGA 4B10A 2Z11A 1CM0A 3NE7A 5BWAB 2YGWA 4F6AA 2RC4A 2ZXVA 1M44A 2Z3PA 4KOUA 1KUVA 3C26A 4C2XA 4F0XA 4HKFA 2YNEA 1GHEA 2VBQA 4C2ZA 2VQYA 2R8VA 4U5YA 5AG7A 3I9SA 4CYQA 5J8CA 4KOYA 1I21A 2Z3NA 1S5KA 1FY7A 2B4DB 4U9YA 2VXKA 2CY2A 1XIXA 4RI1A 1VHSA 2B3VA 5F47A 4AB7A 2BEIA 1SQHA 5AGEA 2YNCA 4Q36A 2P6GA 4QVTA 2F5IA 2ZW4A 4CYOA 2R7HA 1BO4A 1XMTA 1IIDA 3IWEA 4KUAA 3W6XA 2Q04A 2JEVA 2PC1A 3CXSA 2JLMA 1YLEA 3VWEA 3GKRA 2Z3MA 4OLLA 2Z0ZA 3FB3A 2OZGA 2CXAA 3I3GA 2Q4YA 3H4QA 2BSWA 2FXFA 1YVOA 1YX0A 2BUEA 4A32A 3D8PA 1QSOA 3IWGA 4XPLA 5AG4A 2VZZA 5EBVA 3DNSA 4XPDC 5AG5A 5A28A 4H6ZA 3TO9A 4QUSA 4PSWA 4R57A 3TE4A 2B4BA 4UFVA 3S6KA 2P6EA 3BJ8A 3FNCA 4MJ8A 4A95A 4C68A 4XPDB 4CAFA 5F46A 2EVNA 1VKCA 5AG6A 2AE6A 4CRYB 1Z4RA 5IV0A 4PK2A 4KS9A 5KTCA 2X7BA 4AG7A 2B3UA 4CYNA 1YR0A 3ZJ0A 1V0CA 5DWNA 4B14A 4I49A 3SXNA 2REFA 2YNCC 3DR6A 4LUAA 4JWPA 2QECA 4C2YA 4MFZA 1Y9WA 4E0AA 1YGHA 2GANA 4RS2A 3V8IA 4NF1A 4GS4A 4UCPA 1OZPA 3JVNA 2HQYA 1M4IA 5G20A 2ATRA 3EY5A 4CGPA 4MFLA 4JJXA 2G3AA 3F0AA 3LODA 4R9MA 2KCWA 5F48A 2A4NA 1I12A 3SHPA 1QSTA 1P4NA 4CAEA 3GYAA 2ARHA 4R3LA 1XF8A 3R1KA 4MY0A 4KOXA 3N7ZA 2PDOA 4H89A 2FSRA 2K5TA 4HNYB 4K30A 2G0BA 1BOBA 5I0CA 1B87A 2VEZA 5IB0A 4HNXB 1XEBA 2Q7BA 2FIWA 4PV6A 1M4DA 4FD7A 2FS5A 4AVBA 2PR8A 3W91A 4J3GA 1WWZA 2J8MA 3SXOA 1QSNA 1Y9KA 2CNTA 1U6MA 2ZW5A 4FD5A 1N71A 3EO4A 5H86A 4KSFA 4KOVA 1ZO0A 3TO7A 4CRZB 1YVKA 4MFJA 4BBHA 4YFJA 5DWMA 1MK4A 3QAHA 1S7FA 4NCZA 3R96A 3TO6A 2OU2A 2P0WA 3DSBA 4M85A 3TFYA 4JD6A 4B5OA 4OADA 5C82A 1IYKA 2PR1A 2Y0MA 2OZUA 1Z9UA 4UFXA 2I00A 3WR7A 1B6BA 3FRMA 2CNSA 3EC4A 1UFHA 4R87A 1NMTA 4MY3A 4R3KA 5H84A 2PSWA 1R57A 4AG9A 1CJWA 4UCNA 2OZHA 2B5GA 5EC4A 4FD4A 4MBUA 1PUAA 4LX9A 4H6UA 3KKWA 1I1DA 1M1DA 2QMLA 3CXQA 2C27A 2HV2A 4CAXA 1M4GA 2GIVA 5GCNA 2J8NA 1Q2CA 1RO5A 4JXQA 4AVCA 4MFQA 4A33A 4XPKA 5HMNA 2ZW6A 4KSAA 4KLWA 3E0KA 1NSLA 4KORA 3TTHA 4B11A 3D2PA 2BL1A 4YGOA 4KOSA 3IU1A 4MI4A 3DDDA 2REEA 4C7IA 1KUXA 1K4JA 4E8OA 5ISVA 5CNPA 2DPTA 2B58A 2D4OA 3FXTA 3R9EA 5HH1A 2FL4A 1KZFA 4B5PA 4UWJA 2P6FA 3GY9A 4EVYA 2GE3A 2Q44A 3FIXA 2WPWA 4BMHA 4UBRA 3LD2A 4KUBA 4KVOE 2ZPAA 4KLVA 5KTAA 4DNCA 4KOWA 5G21A 3FYNA 1YREA 1S7NA 2ZW7A 2JDDA 3H5ZA 4CGNA 2D4PA 3F5BA 4NEXA 4PSXA 2JDCA 2O28A 3R9FA 4QBJA 1MJBA 2B5GB 3RYOA 4XNHB 3TCVA 1KUYA 3PP9A 4JLYA 4A30A 4ONUA 3A9LA 1S60A 3MGDA 4YRHA 2Q4VA 2QIRA 2Z3KA 4CS0B 2FE7A 3P2FA 3JTKA 2FCKA 4AVAA 4UWIA 4IUSA 2PQ8A 2HUZA 1QSMA 3OWCA 5C88A 4HNWB 3FBUA 4B13A 4UFWA 4MFKA 2WSAA 3CXPA 5G22A 4M3SA 1QSRA 4L89A 1MJ9A 4X5KA 5IX3A 3DR8A 1WK4A 2Q0YA 4F0YA 1IYLA 2IL4A 1Z4EA 4QC6A 4CGOA 3UY5A 3W6SA 3IU2A 4KVXA 1Q2YA 3R95A 4B5PB 1XE4A 1J4JA 2DPSA 2NMTA 4NXYA 1S7KA 1TIQA 4UA3A 4PK3A 4II9A 4KZTA 4ZGYB 4MFPA 3PZJA 3D3SA 5E96A 3S6GA 4U9ZA 5JQ4A 2EUIA 4QB9A 4ORFA 4CAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGP A;  3BJ7 A;  2R1I A;  3IGR A;  3TT2 A;  2J8R A;  3S6H A;  1IB1 E;  1S7L A;  2DXQ A;  5J8F A;  5JPH A;  3P2H A;  2I79 A;  3QB8 A;  1LRZ A;  2FIA A;  1P0H A;  2Z10 A;  1NE9 A;  2WPX A;  1RXT A;  2G3T A;  3VWD A;  2CNM A;  3R9G A;  4NSQ A;  2R98 A;  2OH1 A;  3BLN A;  2VZY A;  1Y7R A;  3F8K A;  4OAE A;  2H5M A;  3T90 A;  1ON0 A;  1YK3 A;  3TOA A;  2B4D A;  3ZZI A;  2VI7 A;  1L0C A;  3B8G A;  3S6F A;  2OB0 A;  3JUW A;  1MJA A;  3EXN A;  4JXR A;  4E2A A;  3EFA A;  4KOT A;  4CAW A;  3D2M A;  5KTD A;  2FT0 A;  4KVM E;  3T9Y A;  5F49 A;  4XNH C;  3G3S A;  3TOB A;  1PU9 A;  4Y49 C;  1IIC A;  4IF5 A;  3K9U A;  1Q2D A;  4FD6 A;  2PRB A;  4MHD A;  1S3Z A;  5FVJ A;  2AJ6 A;  3G8W A;  4L8A A;  4Y49 B;  4ZBG A;  2Z11 A;  1CM0 A;  3NE7 A;  4F6A A;  2RC4 A;  2ZXV A;  1M44 A;  4KOU A;  1KUV A;  3C26 A;  4HKF A;  1GHE A;  2VBQ A;  2VQY A;  2R8V A;  4U5Y A;  3I9S A;  5J8C A;  4KOY A;  1I21 A;  1S5K A;  1FY7 A;  2B4D B;  4U9Y A;  2VXK A;  2CY2 A;  1XIX A;  4RI1 A;  1VHS A;  2B3V A;  5F47 A;  4AB7 A;  2BEI A;  1SQH A;  2P6G A;  4QVT A;  2F5I A;  2ZW4 A;  2R7H A;  1BO4 A;  1XMT A;  1IID A;  4KUA A;  3W6X A;  2Q04 A;  2JEV A;  2PC1 A;  3CXS A;  2JLM A;  1YLE A;  3VWE A;  3GKR A;  4OLL A;  2Z0Z A;  3FB3 A;  2OZG A;  3I3G A;  2Q4Y A;  3H4Q A;  2BSW A;  2FXF A;  1YVO A;  1YX0 A;  2BUE A;  3D8P A;  1QSO A;  3IWG A;  4XPL A;  2VZZ A;  5EBV A;  3DNS A;  4XPD C;  4H6Z A;  3TO9 A;  4QUS A;  4PSW A;  4R57 A;  3TE4 A;  2B4B A;  3S6K A;  2P6E A;  3BJ8 A;  3FNC A;  4MJ8 A;  4XPD B;  5F46 A;  2EVN A;  1VKC A;  2AE6 A;  4CRY B;  1Z4R A;  5IV0 A;  4PK2 A;  5KTC A;  2X7B A;  4AG7 A;  2B3U A;  1YR0 A;  3ZJ0 A;  1V0C A;  5DWN A;  4I49 A;  3SXN A;  2REF A;  3DR6 A;  4LUA A;  4JWP A;  2QEC A;  1Y9W A;  4E0A A;  1YGH A;  2GAN A;  4RS2 A;  3V8I A;  4NF1 A;  4GS4 A;  1OZP A;  3JVN A;  2HQY A;  1M4I A;  2ATR A;  3EY5 A;  4JJX A;  2G3A A;  3F0A A;  3LOD A;  4R9M A;  2KCW A;  5F48 A;  2A4N A;  1I12 A;  3SHP A;  1QST A;  1P4N A;  3GYA A;  2ARH A;  4R3L A;  1XF8 A;  3R1K A;  4MY0 A;  4KOX A;  3N7Z A;  2PDO A;  4H89 A;  2FSR A;  2K5T A;  4HNY B;  4K30 A;  2G0B A;  1BOB A;  5I0C A;  1B87 A;  2VEZ A;  5IB0 A;  4HNX B;  1XEB A;  2Q7B A;  2FIW A;  4PV6 A;  1M4D A;  4FD7 A;  2FS5 A;  4AVB A;  2PR8 A;  3W91 A;  4J3G A;  1WWZ A;  2J8M A;  3SXO A;  1QSN A;  1Y9K A;  2CNT A;  1U6M A;  2ZW5 A;  4FD5 A;  1N71 A;  3EO4 A;  5H86 A;  4KOV A;  4CRZ B;  3TO7 A;  1YVK A;  4YFJ A;  5DWM A;  1MK4 A;  3QAH A;  1S7F A;  4NCZ A;  3R96 A;  3TO6 A;  2OU2 A;  2P0W A;  3DSB A;  4M85 A;  3TFY A;  4JD6 A;  4B5O A;  4OAD A;  5C82 A;  1IYK A;  2PR1 A;  2Y0M A;  2OZU A;  1Z9U A;  2I00 A;  3WR7 A;  1B6B A;  3FRM A;  2CNS A;  3EC4 A;  1UFH A;  4R87 A;  1NMT A;  4MY3 A;  4R3K A;  5H84 A;  2PSW A;  1R57 A;  4AG9 A;  1CJW A;  2OZH A;  2B5G A;  5EC4 A;  4FD4 A;  4MBU A;  1PUA A;  4LX9 A;  4H6U A;  3KKW A;  1I1D A;  1M1D A;  2QML A;  3CXQ A;  2C27 A;  2HV2 A;  4CAX A;  1M4G A;  2GIV A;  5GCN A;  2J8N A;  1Q2C A;  1RO5 A;  4JXQ A;  4AVC A;  4XPK A;  5HMN A;  2ZW6 A;  4KLW A;  3E0K A;  1NSL A;  4KOR A;  3TTH A;  3D2P A;  2BL1 A;  4YGO A;  4KOS A;  4MI4 A;  3DDD A;  2REE A;  1KUX A;  1K4J A;  4E8O A;  5ISV A;  5CNP A;  2B58 A;  2D4O A;  3FXT A;  3R9E A;  5HH1 A;  2FL4 A;  1KZF A;  4B5P A;  4UWJ A;  2P6F A;  3GY9 A;  4EVY A;  2GE3 A;  2Q44 A;  3FIX A;  2WPW A;  4BMH A;  4UBR A;  3LD2 A;  4KUB A;  4KVO E;  2ZPA A;  4KLV A;  5KTA A;  4DNC A;  4KOW A;  3FYN A;  1YRE A;  1S7N A;  2ZW7 A;  2JDD A;  2D4P A;  3F5B A;  4NEX A;  4PSX A;  2JDC A;  2O28 A;  3R9F A;  4QBJ A;  1MJB A;  2B5G B;  3RYO A;  4XNH B;  3TCV A;  1KUY A;  3PP9 A;  4JLY A;  4ONU A;  1S60 A;  3MGD A;  4YRH A;  2Q4V A;  2QIR A;  4CS0 B;  2FE7 A;  3P2F A;  2FCK A;  4AVA A;  4UWI A;  4IUS A;  2PQ8 A;  2HUZ A;  1QSM A;  3OWC A;  5C88 A;  4HNW B;  3FBU A;  3CXP A;  4M3S A;  1QSR A;  4L89 A;  1MJ9 A;  4X5K A;  5IX3 A;  3DR8 A;  1WK4 A;  2Q0Y A;  4F0Y A;  1IYL A;  2IL4 A;  1Z4E A;  4QC6 A;  3UY5 A;  3W6S A;  3R95 A;  4KVX A;  1Q2Y A;  4B5P B;  1XE4 A;  1J4J A;  2NMT A;  4NXY A;  1S7K A;  1TIQ A;  4UA3 A;  4PK3 A;  4II9 A;  4KZT A;  3PZJ A;  3D3S A;  5E96 A;  3S6G A;  4U9Z A;  5JQ4 A;  2EUI A;  4QB9 A;  4ORF A;  4CAV A; 
#chains in the Genus database with same CATH topology
 2IQ6 A;  4K3N A;  2CTB A;  3NA6 A;  3KI9 A;  1LAP A;  3PGP A;  3BJ7 A;  4YWY A;  2R1I A;  3IGR A;  3TT2 A;  2J8R A;  3S6H A;  1IB1 E;  1S7L A;  2DXQ A;  4CGL A;  3H8E A;  5J8F A;  5JPH A;  4DJL A;  3IC1 A;  2Z3O A;  3P2H A;  1ZLI A;  2Z3L A;  2YND A;  3QAY A;  1VHE A;  2I79 A;  3QB8 A;  1LRZ A;  4W9Y A;  4GXH A;  2PJ9 A;  2FIA A;  1P0H A;  3NH8 A;  4FBE A;  2Z10 A;  4O23 A;  1NE9 A;  2WPX A;  1RXT A;  2G3T A;  1CX8 A;  3BI0 A;  4ZX9 A;  3VWD A;  3PB6 X;  2OOT A;  2CNM A;  1BPM A;  4NSQ A;  3R9G A;  2R98 A;  2ZEF A;  4P6Y A;  3V38 A;  2OH1 A;  3BLN A;  3FH4 A;  2VZY A;  1Y7R A;  3F8K A;  4NGM A;  4IK2 A;  2PJB A;  4MMO A;  3WC7 A;  3B3V A;  4OAE A;  2H5M A;  3T90 A;  2ZEH A;  2AFS A;  4B12 A;  7CPA A;  1ON0 A;  1Q7L A;  5LYF A;  1YK3 A;  4MHN A;  5A27 A;  4ZI6 A;  3FF3 A;  3TOA A;  3GUX A;  3RZA A;  2B4D A;  2PJ7 A;  3ZZI A;  2VI7 A;  2RB7 A;  1L0C A;  3K2K A;  3H8F A;  3B8G A;  3DLJ A;  3FJU A;  3S6F A;  2HC9 A;  2BO9 A;  5LYD A;  2OB0 A;  2ZEP A;  2QVP A;  5D8N A;  4C7H A;  4PQA A;  3PBE A;  3JUW A;  4A2Z A;  1MJA A;  3EXN A;  5CBM A;  5G1Z A;  4X2T A;  1VIX A;  1AMP A;  4JXR A;  2Q43 A;  3LAC A;  4E2A A;  3EFA A;  4KOT A;  4CAW A;  3D2M A;  5KTD A;  1ARM A;  2ABZ A;  4A31 A;  4CYP A;  2FT0 A;  4KVM E;  4Q38 A;  5LYI A;  4UIB A;  5F49 A;  4XNH C;  1YME A;  3T9Y A;  4BIN A;  4LQG A;  4DUK A;  3G3S A;  4NGT A;  1PYT B;  3TOB A;  1PU9 A;  4Y49 C;  2PJ3 A;  4OKO A;  2F8H A;  1IIC A;  2O53 A;  4IF5 A;  4P45 A;  3K9U A;  4OC4 A;  4UCM A;  1Q2D A;  1UWY A;  4FD6 A;  2PRB A;  3FED A;  1JQG A;  1Y0R A;  4MHD A;  1S3Z A;  5FVJ A;  2AJ6 A;  1BAV A;  1CPS A;  2WUU A;  4CGM A;  3G8W A;  4L8A A;  1CP7 A;  4RN7 A;  4Y49 B;  4M6I A;  4R76 A;  2J9A A;  4ZBG A;  4B10 A;  2Z11 A;  4ZYQ A;  3VAR A;  1CM0 A;  1ELM P;  3NE7 A;  2CIJ A;  2YGW A;  5BWA B;  4F6A A;  3ISZ A;  2RC4 A;  2ZXV A;  1M44 A;  2Z3P A;  4R6T A;  1DE4 C;  4IHM A;  4KOU A;  2V8G A;  1KUV A;  2ZEO A;  3C26 A;  3KQZ A;  3IWW A;  4C2X A;  1H8L A;  4F0X A;  4HKF A;  2YNE A;  2PJA A;  3TX8 A;  2PJ5 A;  4OC2 A;  3DGV A;  3TC8 A;  1GHE A;  2VBQ A;  4C2Z A;  2VQY A;  1LCP A;  2R8V A;  3H8G A;  1OBR A;  4U5Y A;  5AG7 A;  3SJF A;  3I9S A;  5LYL A;  4P4D A;  2VL1 A;  4CYQ A;  4KOY A;  1I21 A;  4ZY1 A;  2FVG A;  5J8C A;  2Z3N A;  1S5K A;  4LQ6 A;  1FY7 A;  2HB6 A;  2B4D B;  4U9Y A;  2AFW A;  1TXR A;  1YW4 A;  2VXK A;  4A39 A;  2CY2 A;  1XIX A;  3FEE A;  4F9V A;  4Z65 A;  4RI1 A;  1VHS A;  2B3V A;  1XRY A;  3CPA A;  5F47 A;  4AB7 A;  1YQE A;  2BEI A;  1ARL A;  1SQH A;  5AGE A;  2Q4Z A;  4YU9 A;  4MCP A;  2YNC A;  4Q36 A;  2P6G A;  2ZEN A;  2F5I A;  4QVT A;  4OC1 A;  2ZW4 A;  3FX6 A;  2AFM A;  3KAS A;  4CYO A;  2R7H A;  1BO4 A;  1XMT A;  1IID A;  3IEH A;  3IWE A;  4KUA A;  3W6X A;  4NGQ A;  3GLJ A;  2Q04 A;  2JEV A;  2PC1 A;  3CXS A;  1ZLH A;  3I1U A;  1Z5R A;  2JLM A;  1YLE A;  1PCA A;  2C6G A;  3KR4 A;  3VWE A;  3GKR A;  2Z3M A;  4OLL A;  2Z0Z A;  3BXM A;  3FB3 A;  2OZG A;  2CXA A;  4TNU A;  3I3G A;  2Q4Y A;  3H4Q A;  1IY7 A;  2BSW A;  2FXF A;  1YVO A;  2PJ6 A;  1YX0 A;  2BUE A;  1R43 A;  4A32 A;  3MN8 A;  3D8P A;  2O4H A;  1QSO A;  3IWG A;  4XPL A;  5AG4 A;  2VZZ A;  5EBV A;  2JBK A;  3D68 A;  3DNS A;  4XPD C;  5AG5 A;  5HVF A;  3B3W A;  4H6Z A;  5A28 A;  2XEJ A;  1TKJ A;  2ODF A;  3TO9 A;  4QUS A;  4PSW A;  4R57 A;  1BLL E;  2PJ4 A;  3TE4 A;  2B4B A;  1Z2L A;  1XOV A;  4UFV A;  3S6K A;  3PFO A;  3NH5 A;  2P6E A;  3BJ8 A;  3FNC A;  4MJ8 A;  2PVV A;  4MCS A;  4A95 A;  4NFR A;  4OIW A;  4C68 A;  4XPD B;  4OP4 A;  5IB9 A;  3PEI A;  4P4I A;  3LMS A;  4CAF A;  5F46 A;  2EVN A;  1VKC A;  4UEE A;  5AG6 A;  2AE6 A;  4CRY B;  4ONW A;  4P4E A;  1Z4R A;  5IV0 A;  2GFQ A;  4KS9 A;  3NE8 A;  4PK2 A;  2X7B A;  4WJB A;  4UEZ A;  3SJE A;  4AG7 A;  4RUH A;  2B3U A;  4EME A;  4CYN A;  2Q7S A;  1TKF A;  1YR0 A;  3KHX A;  1XJO A;  3ZJ0 A;  1ELL P;  1V0C A;  5DWN A;  4B14 A;  4I49 A;  3VAT A;  3SXN A;  2REF A;  2YNC C;  3B3C A;  3DR6 A;  4G1P A;  4LUA A;  4JWP A;  2QYV A;  1Y7E A;  2DEA A;  2QEC A;  4X3R A;  4C2Y A;  4MFZ A;  2V8D A;  1Y9W A;  4R8F A;  4E0A A;  1YGH A;  2GAN A;  5JH9 A;  4M6G A;  4RS2 A;  3FMC A;  3V8I A;  5HXD A;  1M4L A;  4NF1 A;  2G9D A;  3JRU A;  4GS4 A;  4UCP A;  1OZP A;  2HQY A;  3JVN A;  1M4I A;  5G20 A;  4MCR A;  2ATR A;  3EY5 A;  4CGP A;  5HVG A;  4MFL A;  4JJX A;  2V8H A;  2G3A A;  3F0A A;  3LOD A;  4R9M A;  4UIA A;  1F2P A;  2EK8 A;  4MCQ A;  2KCW A;  5F48 A;  2A4N A;  3KHZ A;  1I12 A;  3SHP A;  1QST A;  1P4N A;  4CAE A;  1CP6 A;  3GYA A;  3IJ3 A;  3KR5 A;  3CDX A;  4UEF A;  2ARH A;  1A2Z A;  1R3N A;  2AFX A;  1XF8 A;  2POK A;  1FNO A;  1XFO A;  1LFW A;  2QJ8 A;  3D4U A;  3R1K A;  4R3L A;  4MY0 A;  2CTC A;  4KOX A;  3S9L A;  1NSA A;  3N7Z A;  2PDO A;  1YSJ A;  4H89 A;  4F8Z A;  2FSR A;  4JZ0 A;  2ZEL A;  3ISX A;  3WT4 A;  1HDQ A;  1LOK A;  3NFZ A;  2K5T A;  4HNY B;  3BI1 A;  1RTQ A;  1X10 A;  2PCU A;  4K30 A;  2ZED A;  2G0B A;  1BOB A;  1ZG9 A;  3D66 A;  3WC5 A;  5I0C A;  1B87 A;  2VEZ A;  5IB0 A;  4HNX B;  1YLO A;  4OC5 A;  2JEW A;  4NJQ A;  3IFE A;  1XEB A;  1VHO A;  2Q7B A;  2FIW A;  4PV6 A;  1M4D A;  4FD7 A;  2FS5 A;  4AVB A;  2PJC A;  2PR8 A;  4A37 A;  3W91 A;  4J3G A;  1WWZ A;  2J8M A;  2EK9 A;  2ZOG A;  3B3T A;  3SXO A;  1QSN A;  3KGQ A;  4Q7A A;  1Y9K A;  4HPS A;  2CNT A;  1U6M A;  1Z8L A;  2V8V A;  3FVL A;  4DYO A;  2ZW5 A;  3SI2 A;  4FD5 A;  1JWQ A;  3D7H A;  4X8I A;  1N71 A;  3EO4 A;  4OME A;  5H86 A;  4KSF A;  4ZX8 A;  2AFO A;  4KOV A;  2V77 A;  1ZO0 A;  3TO7 A;  4CRZ B;  1YVK A;  3PRT A;  4MFJ A;  4BBH A;  4YFJ A;  1CBX A;  4MRI A;  3PB8 X;  1X12 A;  2IMO A;  2PJ2 A;  5DWM A;  2PJ8 A;  1MK4 A;  3PB7 X;  3QAH A;  1IU8 A;  1S7F A;  4NCZ A;  3R96 A;  5EMI A;  3TO6 A;  3QNV A;  5KTC A;  5LRJ A;  2OU2 A;  1IOF A;  3HUV A;  2P0W A;  3DSB A;  3KQX A;  4M85 A;  3TFY A;  1Z8X A;  4JD6 A;  5DS0 A;  5J1Q A;  4B5O A;  3CPX A;  4OAD A;  5K8M A;  5C82 A;  2ZEM A;  1IYK A;  1EE3 P;  2I3C A;  2PIY A;  4GM5 A;  2PR1 A;  1QQ9 A;  2JBJ A;  2OZU A;  2WZN A;  2XEF A;  2Y0M A;  4M6H A;  1Z9U A;  4UFX A;  2I00 A;  3FEC A;  3WR7 A;  1LAM A;  1B6B A;  4PXB A;  2PJ0 A;  3FRM A;  2CNS A;  3EC4 A;  1UFH A;  4R87 A;  1NMT A;  2EBJ A;  4MHZ A;  3KZW A;  4MY3 A;  4R3K A;  5H84 A;  2PSW A;  1R57 A;  4NGR A;  4P4F A;  4AG9 A;  1CJW A;  4UCN A;  5F09 A;  1YW6 A;  2DF5 A;  2WYR A;  3SJX A;  1IOI A;  2OZH A;  2GU2 A;  4OC3 A;  2B5G A;  4OID A;  4FWU A;  5EC4 A;  5JM6 A;  2ZOF A;  3S9N A;  2PJ1 A;  5LRK A;  1FT7 A;  4FD4 A;  4MBU A;  5LRG A;  2XEG A;  2PIZ A;  3RO0 A;  1PUA A;  4KSI A;  4LX9 A;  3K9T A;  4H6U A;  5THW A;  3KKW A;  1I1D A;  2C6C A;  5ELY A;  4EFD A;  1CPX A;  1M1D A;  2QML A;  5D29 A;  3CXQ A;  1CG2 A;  4PPZ A;  2C27 A;  2HV2 A;  1VGY A;  3GIU A;  1M4G A;  4CAX A;  2GIV A;  1QMU A;  5GCN A;  2J8N A;  2ANP A;  4AXV A;  4MHP A;  1Q2C A;  1RO5 A;  4JXQ A;  4AVC A;  4ZY0 A;  4MFQ A;  4A33 A;  2AFU A;  3PB4 X;  2Q51 A;  4XPK A;  2NSM A;  5HMN A;  3D67 A;  2ZW6 A;  4R7M A;  4KSA A;  4KLW A;  3B2Y A;  2CF4 A;  3E0K A;  1NSL A;  4KOR A;  3TTH A;  3NH4 A;  4B11 A;  3PFE A;  2BL1 A;  2RFH A;  3D2P A;  4UF4 A;  4YGO A;  1LAN A;  3B35 A;  2ZEE A;  3IU1 A;  3N5F A;  4KOS A;  4MI4 A;  3DDD A;  2REE A;  1ZG7 A;  4C7I A;  1KUX A;  1K4J A;  2GRE A;  4P10 A;  4E8O A;  1F57 A;  2C6P A;  3IO1 A;  1ZG8 A;  3D7F A;  5ISV A;  4IAV A;  5CNP A;  5CPA A;  2DPT A;  2B58 A;  2D4O A;  3FXT A;  3GB0 A;  3R9E A;  5HH1 A;  2FL4 A;  1KZF A;  4B5P A;  4UWJ A;  2P6F A;  2OR4 A;  3GY9 A;  2NYQ A;  4OC0 A;  4EVY A;  4TWE A;  3B3S A;  1TF8 A;  2GE3 A;  1TKH A;  2Q44 A;  3FIX A;  2WPW A;  3RAM A;  4UBR A;  4BMH A;  3HLP A;  2BCO A;  3LD2 A;  5K8P A;  1BPN A;  2EWB A;  4KUB A;  4KVO E;  4P44 A;  2ZEG A;  5I4M A;  2ZPA A;  4KLV A;  5JGF A;  3CT9 A;  2PE3 A;  5KTA A;  2IJZ A;  4DNC A;  4KOW A;  5G21 A;  3FYN A;  1YRE A;  1S7N A;  2ZW7 A;  4JYW A;  2JDD A;  1Z8W A;  3H5Z A;  3WC6 A;  3D7D A;  4CGN A;  1TF9 A;  2D4P A;  3F5B A;  4NEX A;  4PSX A;  2PRQ A;  3WAB A;  2JDC A;  2O28 A;  4FUU A;  3R9F A;  4QBJ A;  1IGB A;  4FAI A;  1MJB A;  2B5G B;  3RYO A;  1Z8T A;  4XNH B;  3B7I A;  3TCV A;  1F2O A;  1KUY A;  3PP9 A;  4JLY A;  4A30 A;  4ONU A;  1XMB A;  3IIB A;  1XBU A;  3A9L A;  4PXD A;  4EWT A;  1S60 A;  3CZX A;  1Y0Y A;  3MGD A;  4YRH A;  2F7V A;  3RNZ A;  3PBB A;  2Q4V A;  1AUG A;  2QIR A;  2Z3K A;  4MHY A;  4A38 A;  4CS0 B;  2FE7 A;  3P2F A;  4MXU A;  3JTK A;  2FCK A;  4NGP A;  2PVW A;  4AVA A;  4UWI A;  4IUS A;  2PQ8 A;  2AFZ A;  2HUZ A;  1QSM A;  3OWC A;  5C88 A;  4HNW B;  2BOA A;  3FBU A;  1HDU A;  5HVH A;  4B13 A;  4UFW A;  3KL9 A;  4WWV A;  4MFK A;  2WSA A;  3T8W A;  3CXP A;  5G22 A;  4M3S A;  1QSR A;  3RBU A;  4L89 A;  1MJ9 A;  4X5K A;  5IX3 A;  4ZY2 A;  2EO8 A;  3DR8 A;  1WK4 A;  2Q0Y A;  3SJG A;  4F0Y A;  1IYL A;  2IL4 A;  1Z4E A;  5K8N A;  4P4J A;  4QC6 A;  4CGO A;  3UY5 A;  4F9U A;  4A94 A;  4NGN A;  4NGS A;  3W6S A;  3IU2 A;  4KVX A;  1Q2Y A;  3R95 A;  4B5P B;  1GYT A;  2XEI A;  3LWU A;  2GLF A;  3MRU A;  3VH9 A;  1XE4 A;  4CPA A;  1J4J A;  2DPS A;  6CPA A;  2NMT A;  3SI1 A;  3PB9 X;  1S7K A;  1TIQ A;  3L2N A;  4NXY A;  4UA3 A;  4PK3 A;  3SI0 A;  4II9 A;  4NJR A;  4KZT A;  4ZGY B;  4MFP A;  2C1C A;  1AYE A;  3PZJ A;  4BD9 A;  3D3S A;  5E96 A;  3S9M A;  4PXC A;  4H2K A;  2GLJ A;  4U9Z A;  3S6G A;  5JQ4 A;  3D7G A;  8CPA A;  4PXE A;  2EUI A;  3V7Z A;  1KWM A;  4QB9 A;  5K8O A;  1HEE A;  3BHX A;  4P4B A;  4ORF A;  4B6Z A;  4CAV A;  1DTD A; 
#chains in the Genus database with same CATH homology
 3PGP A;  3BJ7 A;  2R1I A;  3IGR A;  3TT2 A;  2J8R A;  3S6H A;  1IB1 E;  1S7L A;  2DXQ A;  4CGL A;  5J8F A;  5JPH A;  2Z3O A;  3P2H A;  2Z3L A;  2YND A;  2I79 A;  3QB8 A;  1LRZ A;  2FIA A;  1P0H A;  2Z10 A;  1NE9 A;  2WPX A;  1RXT A;  2G3T A;  3VWD A;  2CNM A;  3R9G A;  4NSQ A;  2R98 A;  2OH1 A;  3BLN A;  2VZY A;  1Y7R A;  3F8K A;  4OAE A;  2H5M A;  3T90 A;  4B12 A;  1ON0 A;  1YK3 A;  5A27 A;  3TOA A;  2B4D A;  3ZZI A;  2VI7 A;  1L0C A;  3B8G A;  3S6F A;  2OB0 A;  4C7H A;  3JUW A;  4A2Z A;  1MJA A;  3EXN A;  5G1Z A;  4JXR A;  4E2A A;  3EFA A;  4KOT A;  4CAW A;  3D2M A;  5KTD A;  4A31 A;  4CYP A;  2FT0 A;  4KVM E;  4Q38 A;  3T9Y A;  5F49 A;  4XNH C;  3G3S A;  3TOB A;  1PU9 A;  4Y49 C;  1IIC A;  4IF5 A;  3K9U A;  4UCM A;  1Q2D A;  4FD6 A;  2PRB A;  4MHD A;  1S3Z A;  5FVJ A;  2AJ6 A;  2WUU A;  4CGM A;  3G8W A;  4L8A A;  4Y49 B;  4ZBG A;  4B10 A;  2Z11 A;  1CM0 A;  3NE7 A;  5BWA B;  2YGW A;  4F6A A;  2RC4 A;  2ZXV A;  1M44 A;  2Z3P A;  4KOU A;  1KUV A;  3C26 A;  4C2X A;  4F0X A;  4HKF A;  2YNE A;  1GHE A;  2VBQ A;  4C2Z A;  2VQY A;  2R8V A;  4U5Y A;  5AG7 A;  3I9S A;  4CYQ A;  5J8C A;  4KOY A;  1I21 A;  2Z3N A;  1S5K A;  1FY7 A;  2B4D B;  4U9Y A;  2VXK A;  2CY2 A;  1XIX A;  4RI1 A;  1VHS A;  2B3V A;  5F47 A;  4AB7 A;  2BEI A;  1SQH A;  5AGE A;  2YNC A;  4Q36 A;  2P6G A;  4QVT A;  2F5I A;  2ZW4 A;  4CYO A;  2R7H A;  1BO4 A;  1XMT A;  1IID A;  3IWE A;  4KUA A;  3W6X A;  2Q04 A;  2JEV A;  2PC1 A;  3CXS A;  2JLM A;  1YLE A;  3VWE A;  3GKR A;  2Z3M A;  4OLL A;  2Z0Z A;  3FB3 A;  2OZG A;  2CXA A;  3I3G A;  2Q4Y A;  3H4Q A;  2BSW A;  2FXF A;  1YVO A;  1YX0 A;  2BUE A;  4A32 A;  3D8P A;  1QSO A;  3IWG A;  4XPL A;  5AG4 A;  2VZZ A;  5EBV A;  3DNS A;  4XPD C;  5AG5 A;  5A28 A;  4H6Z A;  3TO9 A;  4QUS A;  4PSW A;  4R57 A;  3TE4 A;  2B4B A;  4UFV A;  3S6K A;  2P6E A;  3BJ8 A;  3FNC A;  4MJ8 A;  4A95 A;  4C68 A;  4XPD B;  4CAF A;  5F46 A;  2EVN A;  1VKC A;  5AG6 A;  2AE6 A;  4CRY B;  1Z4R A;  5IV0 A;  4PK2 A;  4KS9 A;  5KTC A;  2X7B A;  4AG7 A;  2B3U A;  4CYN A;  1YR0 A;  3ZJ0 A;  1V0C A;  5DWN A;  4B14 A;  4I49 A;  3SXN A;  2REF A;  2YNC C;  3DR6 A;  4LUA A;  4JWP A;  2QEC A;  4C2Y A;  4MFZ A;  1Y9W A;  4E0A A;  1YGH A;  2GAN A;  4RS2 A;  3V8I A;  4NF1 A;  4GS4 A;  4UCP A;  1OZP A;  3JVN A;  2HQY A;  1M4I A;  5G20 A;  2ATR A;  3EY5 A;  4CGP A;  4MFL A;  4JJX A;  2G3A A;  3F0A A;  3LOD A;  4R9M A;  2KCW A;  5F48 A;  2A4N A;  1I12 A;  3SHP A;  1QST A;  1P4N A;  4CAE A;  3GYA A;  2ARH A;  4R3L A;  1XF8 A;  3R1K A;  4MY0 A;  4KOX A;  3N7Z A;  2PDO A;  4H89 A;  2FSR A;  2K5T A;  4HNY B;  4K30 A;  2G0B A;  1BOB A;  5I0C A;  1B87 A;  2VEZ A;  5IB0 A;  4HNX B;  1XEB A;  2Q7B A;  2FIW A;  4PV6 A;  1M4D A;  4FD7 A;  2FS5 A;  4AVB A;  2PR8 A;  3W91 A;  4J3G A;  1WWZ A;  2J8M A;  3SXO A;  1QSN A;  1Y9K A;  2CNT A;  1U6M A;  2ZW5 A;  4FD5 A;  1N71 A;  3EO4 A;  5H86 A;  4KSF A;  4KOV A;  1ZO0 A;  3TO7 A;  4CRZ B;  1YVK A;  4MFJ A;  4BBH A;  4YFJ A;  5DWM A;  1MK4 A;  3QAH A;  1S7F A;  4NCZ A;  3R96 A;  3TO6 A;  2OU2 A;  2P0W A;  3DSB A;  4M85 A;  3TFY A;  4JD6 A;  4B5O A;  4OAD A;  5C82 A;  1IYK A;  2PR1 A;  2Y0M A;  2OZU A;  1Z9U A;  4UFX A;  2I00 A;  3WR7 A;  1B6B A;  3FRM A;  2CNS A;  3EC4 A;  1UFH A;  4R87 A;  1NMT A;  4MY3 A;  4R3K A;  5H84 A;  2PSW A;  1R57 A;  4AG9 A;  1CJW A;  4UCN A;  2OZH A;  2B5G A;  5EC4 A;  4FD4 A;  4MBU A;  1PUA A;  4LX9 A;  4H6U A;  3KKW A;  1I1D A;  1M1D A;  2QML A;  3CXQ A;  2C27 A;  2HV2 A;  4CAX A;  1M4G A;  2GIV A;  5GCN A;  2J8N A;  1Q2C A;  1RO5 A;  4JXQ A;  4AVC A;  4MFQ A;  4A33 A;  4XPK A;  5HMN A;  2ZW6 A;  4KSA A;  4KLW A;  3E0K A;  1NSL A;  4KOR A;  3TTH A;  4B11 A;  3D2P A;  2BL1 A;  4YGO A;  4KOS A;  3IU1 A;  4MI4 A;  3DDD A;  2REE A;  4C7I A;  1KUX A;  1K4J A;  4E8O A;  5ISV A;  5CNP A;  2DPT A;  2B58 A;  2D4O A;  3FXT A;  3R9E A;  5HH1 A;  2FL4 A;  1KZF A;  4B5P A;  4UWJ A;  2P6F A;  3GY9 A;  4EVY A;  2GE3 A;  2Q44 A;  3FIX A;  2WPW A;  4BMH A;  4UBR A;  3LD2 A;  4KUB A;  4KVO E;  2ZPA A;  4KLV A;  5KTA A;  4DNC A;  4KOW A;  5G21 A;  3FYN A;  1YRE A;  1S7N A;  2ZW7 A;  2JDD A;  3H5Z A;  4CGN A;  2D4P A;  3F5B A;  4NEX A;  4PSX A;  2JDC A;  2O28 A;  3R9F A;  4QBJ A;  1MJB A;  2B5G B;  3RYO A;  4XNH B;  3TCV A;  1KUY A;  3PP9 A;  4JLY A;  4A30 A;  4ONU A;  3A9L A;  1S60 A;  3MGD A;  4YRH A;  2Q4V A;  2QIR A;  2Z3K A;  4CS0 B;  2FE7 A;  3P2F A;  3JTK A;  2FCK A;  4AVA A;  4UWI A;  4IUS A;  2PQ8 A;  2HUZ A;  1QSM A;  3OWC A;  5C88 A;  4HNW B;  3FBU A;  4B13 A;  4UFW A;  4MFK A;  2WSA A;  3CXP A;  5G22 A;  4M3S A;  1QSR A;  4L89 A;  1MJ9 A;  4X5K A;  5IX3 A;  3DR8 A;  1WK4 A;  2Q0Y A;  4F0Y A;  1IYL A;  2IL4 A;  1Z4E A;  4QC6 A;  4CGO A;  3UY5 A;  3W6S A;  3IU2 A;  4KVX A;  1Q2Y A;  3R95 A;  4B5P B;  1XE4 A;  1J4J A;  2DPS A;  2NMT A;  4NXY A;  1S7K A;  1TIQ A;  4UA3 A;  4PK3 A;  4II9 A;  4KZT A;  4ZGY B;  4MFP A;  3PZJ A;  3D3S A;  5E96 A;  3S6G A;  4U9Z A;  5JQ4 A;  2EUI A;  4QB9 A;  4ORF A;  4CAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...