1IB1E

Crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
178
Chain Sequence
b'SGIPGSPGRQRRHLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14-3-3 ZETA ISOFORM
publication title Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 45
structure length 178
sequence length 179
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2001-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ib1E00
3W6SA 1WK4A 4QB9A 5KTDA 3PP9A 4NF1A 2EUIA 1S7FA 2FS5A 3T90A 1U6MA 2R98A 4PV6A 4U9YA 3DR6A 3C26A 2PC1A 2VBQA 4XNHC 3FB3A 4FD5A 3DSBA 3TOAA 2JLMA 4F6AA 2K5TA 4JXRA 1QSNA 1M44A 3F8KA 4FD7A 1B6BA 4UBRA 2PSWA 3I3GA 5F47A 1BO4A 2KCWA 1S7LA 4PSWA 3I9SA 3V8IA 2ZW4A 5C88A 1IYKA 1M1DA 2GIVA 4U5YA 4KOYA 1IICA 1IYLA 2FSRA 3GY9A 5E96A 2FT0A 3R9FA 3UY5A 4UA3A 2O28A 2VQYA 4NCZA 4KOXA 2D4OA 4KOSA 1KZFA 3TTHA 3K9UA 4B5OA 3S6GA 5C82A 1PU9A 5KTAA 4I49A 5F46A 4CAVA 3TT2A 4AVAA 3DNSA 4NSQA 4R57A 3QAHA 2P6FA 2H5MA 5JQ4A 1Q2CA 5F49A 4IUSA 3IGRA 2VZZA 4XNHB 1Q2DA 4K30A 4YFJA 2OU2A 4X5KA 4LX9A 3FRMA 3VWEA 4AG9A 3R1KA 4U9ZA 2WPWA 2JEVA 4ZBGA 2CNMA 2R7HA 5IX3A 2VI7A 1M4IA 1S60A 2FCKA 4HNYB 4LUAA 4HKFA 1LRZA 2G3AA 4QUSA 2HQYA 3EO4A 4GS4A 2ZW7A 2VEZA 4E8OA 3D2PA 1YK3A 3VWDA 1N71A 1TIQA 3TO7A 2I79A 3B8GA 1YGHA 2BUEA 3P2HA 2WPXA 3EFAA 3P2FA 4R87A 2Q0YA 3TO6A 4OAEA 3RYOA 4DNCA 3E0KA 1VHSA 5HMNA 4CRYB 1KUVA 4XPDB 2R1IA 3WR7A 2HV2A 5J8FA 1XIXA 4H6UA 5FVJA 2R8VA 1IIDA 4M85A 1Y9WA 3KKWA 3LD2A 2DXQA 1XE4A 1RO5A 3ZZIA 3FNCA 2JDDA 2QECA 4E2AA 2IL4A 2BL1A 1Z4EA 2QMLA 4ORFA 4EVYA 2Q4VA 4F0YA 3NE7A 1XEBA 4QC6A 4II9A 2FIWA 1Q2YA 1M4DA 3PZJA 2GANA 3SXOA 2ARHA 1YX0A 1CM0A 1UFHA 1YR0A 1QSOA 4MBUA 2Q7BA 4XPLA 4Y49B 3CXPA 4HNXB 3S6HA 4RI1A 4JJXA 2A4NA 1MK4A 4UWIA 3EC4A 4ONUA 4HNWB 1MJAA 1SQHA 4KLWA 1Z4RA 4PSXA 3JVNA 1PUAA 1Z9UA 1XMTA 2Z0ZA 2G3TA 1Y7RA 4KVOE 2OH1A 3D3SA 2GE3A 2P6EA 1Y9KA 2CY2A 4OLLA 2B4DB 4RS2A 5EC4A 2VXKA 4JD6A 1S5KA 2NMTA 2J8NA 4B5PB 1YVKA 2ZPAA 4KOWA 3F0AA 2B3UA 1V0CA 1BOBA 2Q04A 1ON0A 4MJ8A 4CAXA 3F5BA 3W91A 1S7NA 2PR8A 1S7KA 2AE6A 2B58A 2FL4A 4R3KA 3TO9A 3DDDA 4KOTA 2FXFA 1XF8A 4KZTA 3T9YA 1VKCA 2J8MA 2OZUA 1I1DA 2J8RA 3JUWA 2AJ6A 3CXSA 3SHPA 3S6FA 4PK2A 1K4JA 4KVME 5F48A 4JWPA 4AG7A 4R9MA 2C27A 2OZHA 3IWGA 1FY7A 3FBUA 1IB1E 4XPKA 2EVNA 4YRHA 1L0CA 1B87A 2B5GB 1KUXA 3R95A 4PK3A 2Q44A 2RC4A 2REFA 3FXTA 3EY5A 3H4QA 4NXYA 2BSWA 5J8CA 4AB7A 2JDCA 4KLVA 3GYAA 2ZXVA 2PQ8A 3CXQA 1KUYA 4MHDA 1R57A 3TOBA 3TCVA 4L8AA 5H86A 1YLEA 5KTCA 4E0AA 2G0BA 4QBJA 5DWNA 4YGOA 4KORA 2FIAA 5GCNA 3LODA 3TFYA 4CAWA 1P4NA 3R9EA 3BJ8A 1MJBA 3MGDA 3OWCA 4MI4A 5I0CA 3BJ7A 2FE7A 3BLNA 2Z10A 4KUAA 4UWJA 1QSTA 3FYNA 3DR8A 1M4GA 3EXNA 3R96A 3ZJ0A 2CNSA 4KUBA 2B3VA 3D2MA 1S3ZA 1P0HA 2B4DA 2Q4YA 2Y0MA 3W6XA 1NMTA 4H89A 2F5IA 4BMHA 4B5PA 2OB0A 3PGPA 1YREA 1GHEA 2HUZA 2I00A 3D8PA 2ZW5A 5JPHA 1QSRA 1MJ9A 2ZW6A 3QB8A 3R9GA 4L89A 4MY0A 4R3LA 3N7ZA 4CRZB 5ISVA 4JLYA 5IV0A 4KVXA 2X7BA 2OZGA 2D4PA 5HH1A 2B4BA 3SXNA 4XPDC 1OZPA 1NSLA 3G3SA 4CS0B 4KOUA 4J3GA 4H6ZA 1QSMA 4NEXA 4KOVA 4IF5A 4AVBA 4MY3A 1RXTA 3GKRA 1I12A 5IB0A 2B5GA 4FD6A 1NE9A 3TE4A 2BEIA 2REEA 4FD4A 5H84A 4AVCA 2CNTA 4M3SA 2Z11A 5CNPA 1CJWA 4QVTA 2VZYA 4JXQA 2ATRA 1J4JA 2PRBA 2PDOA 3S6KA 1WWZA 3G8WA 5DWMA 2QIRA 2P0WA 4Y49C 3FIXA 1YVOA 4OADA 2P6GA 1I21A 5EBVA 2PR1A
chains in the Genus database with same CATH superfamily
4PQAA 1LCPA 3V38A 3W6SA 2WYRA 4B11A 1WK4A 4QB9A 5KTDA 5D29A 3PP9A 4NF1A 2EUIA 1S7FA 2FS5A 3T90A 2GU2A 1LAMA 2HC9A 3IWWA 1VIXA 1U6MA 4C68A 2R98A 2PJ9A 3H5ZA 4PV6A 3N5FA 4U9YA 3DR6A 2F8HA 1VHOA 3QAYA 5A28A 1IGBA 3C26A 3H8GA 2GLFA 3IJ3A 4W9YA 4MFKA 2PC1A 5LRGA 1TF9A 4B10A 2VBQA 1FNOA 2ZOGA 3FVLA 3FB3A 4FD5A 4XNHC 3DSBA 1TKHA 2JEWA 4CYPA 3TOAA 4ZGYB 5K8MA 2JLMA 4CGPA 4F6AA 3RBUA 3NE8A 3VARA 2K5TA 2AFXA 4JXRA 1QSNA 5AG6A 1M44A 2AFWA 4NGNA 3F8KA 4CGNA 2GFQA 4FD7A 4IAVA 3KQXA 4R8FA 2EK9A 3D68A 4M6HA 6CPAA 4MCRA 2Q51A 1DTDA 1ZLHA 1HDQA 4B13A 2GREA 1B6BA 4UBRA 4LQGA 2PSWA 3I3GA 5F47A 4FAIA 2CXAA 1BO4A 2KCWA 1S7LA 1HDUA 3SJEA 4DUKA 2JBJA 2V8VA 4PSWA 5LYFA 3I9SA 3V8IA 2ZW4A 3CPXA 3D7FA 3IFEA 5C88A 4WJBA 1IYKA 3CZXA 1AMPA 1M1DA 3FH4A 2GIVA 4U5YA 4KOYA 1IOFA 1IICA 1IYLA 4ZY2A 2FSRA 3GY9A 5E96A 4KSAA 5ELYA 2FT0A 2IQ6A 3R9FA 3UY5A 2CF4A 4A30A 5JH9A 4UA3A 2O28A 2RFHA 4EWTA 2VQYA 4NCZA 4KOXA 2D4OA 4KOSA 1KZFA 4UIBA 3TTHA 5D8NA 3K9UA 4B5OA 2ZEEA 3S6GA 3H8EA 2ZEDA 3D7DA 1TF8A 4CYQA 5C82A 3K2KA 1BPMA 3PB9X 3PB4X 1PU9A 2C6CA 5JGFA 1Z8LA 5KTAA 1DE4C 4I49A 2AFMA 5F46A 4CAVA 3TT2A 4AVAA 2XEFA 3DNSA 5AGEA 1QMUA 4NSQA 3CDXA 4R57A 3B3VA 3QAHA 2P6FA 4MFLA 3KQZA 4UFVA 2H5MA 4A37A 5JQ4A 1Q2CA 2BO9A 5F49A 4IUSA 3IGRA 2VZZA 3MN8A 5LRKA 5G20A 4XNHB 2PVVA 2JBKA 2C6PA 5LRJA 1Z8TA 1CPXA 1Q2DA 4K30A 1IOIA 4YFJA 4LQ6A 4MHNA 2OU2A 4X5KA 4LX9A 3VH9A 3FRMA 3VWEA 3KGQA 4AG9A 5CPAA 3R1KA 4U9ZA 2AFOA 2Q43A 4MCSA 3SJXA 4A94A 3TC8A 2J9AA 2ZEHA 3BHXA 2WPWA 2JEVA 4TWEA 1HEEA 3WT4A 4P4EA 2Z3NA 4ZBGA 2CNMA 2R7HA 5IX3A 4C2YA 2AFZA 1R43A 1CBXA 2VI7A 4M6IA 5K8PA 1M4IA 1S60A 2FCKA 3NH5A 4HNYB 4Q7AA 4LUAA 4HKFA 3WC6A 1LRZA 4P4BA 3MRUA 2G3AA 4QUSA 4EFDA 4GM5A 5LYIA 2WZNA 2HQYA 3EO4A 4GS4A 2PIZA 1ZG9A 4OMEA 1EE3P 1ZLIA 2ZW7A 2VEZA 4E8OA 3FX6A 3D2PA 1YK3A 3VWDA 4CYOA 2PJBA 2EK8A 1N71A 3D67A 1TIQA 3TO7A 5CBMA 2ZOFA 2I79A 3B8GA 2ZEFA 2EO8A 1YGHA 1TKFA 4OP4A 2BUEA 5AG4A 4AXVA 3JRUA 4F0XA 3P2HA 4FBEA 2WPXA 3EFAA 8CPAA 3P2FA 4R87A 2Q0YA 3TO6A 4Q38A 4OAEA 1FT7A 3RYOA 4BBHA 4DNCA 1LFWA 1H8LA 2V8GA 3E0KA 3PRTA 1TXRA 1VHSA 2ODFA 3D4UA 5HMNA 4CRYB 4MHPA 4MFQA 2Q4ZA 2YGWA 5AG5A 4R76A 4A33A 4MCQA 2PJ0A 1KUVA 2Z3OA 4XPDB 2AFUA 5DS0A 2BCOA 2R1IA 2F7VA 3WR7A 1QQ9A 2PJ6A 1XBUA 2HV2A 5J8FA 3GB0A 1XIXA 2XEIA 3IU2A 3FEEA 4H6UA 2R8VA 5FVJA 1IIDA 4ONWA 4M85A 2C1CA 1Y9WA 1YQEA 2EBJA 3KZWA 4P4DA 2IMOA 3RO0A 4A39A 3KKWA 1YSJA 3LD2A 2DXQA 4A31A 4WWVA 1ELLP 2YNEA 2IJZA 1XE4A 1RO5A 3ZZIA 3FNCA 4DJLA 1AYEA 2JDDA 2QECA 4NFRA 4E2AA 3S9MA 2IL4A 1NSAA 3FJUA 1CP7A 1Z2LA 2BL1A 1Z4EA 2QMLA 1PYTB 4ORFA 3B35A 5HVGA 4EVYA 4OKOA 4UEFA 5LYLA 2Q4VA 4F0YA 3IWEA 3NE7A 1XEBA 3L2NA 3JTKA 4QC6A 1XOVA 2O4HA 2FIWA 3LMSA 3NH8A 4II9A 1M4DA 1Q2YA 1IU8A 5J1QA 1Z5RA 1Y0RA 3PZJA 2GANA 3SXOA 2ARHA 3PFEA 1YX0A 4KS9A 1CM0A 1UFHA 1YR0A 4NGSA 1QSOA 2YNCA 5I4MA 2XEGA 4MBUA 4CPAA 3HUVA 4XPLA 2Q7BA 4Y49B 1YLOA 3CXPA 4HNXB 3S6HA 4RI1A 2C6GA 4JJXA 2A4NA 1MK4A 2GLJA 4UWIA 3SI1A 4MFPA 1IY7A 4ZX9A 2BOAA 3EC4A 1Z8XA 4ONUA 4HNWB 4P44A 1LANA 4B6ZA 1MJAA 1SQHA 4KLWA 3D66A 2ANPA 3FMCA 4X3RA 3S9LA 4C7IA 1Z4RA 3BI0A 1ELMP 4PSXA 3JVNA 1PUAA 1Z9UA 4JYWA 1XMTA 2Z0ZA 4NGMA 3DGVA 2G3TA 3KHXA 2PJAA 4KSFA 1Y7RA 3NA6A 4KVOE 2OH1A 2PIYA 3D3SA 4PXDA 2GE3A 4DYOA 2P6EA 1Y9KA 1OBRA 2CY2A 2B4DB 3KASA 3NFZA 4OLLA 4P6YA 4RS2A 4UCNA 5EC4A 2VXKA 4CGMA 4JD6A 1S5KA 4UF4A 4A38A 3IEHA 1VGYA 2NMTA 1R3NA 1JQGA 2J8NA 4MHYA 5F09A 5G22A 3B3WA 1RTQA 1Y0YA 1XJOA 4B5PB 1YVKA 1M4LA 2ZPAA 4KOWA 3F0AA 2B3UA 5HVFA 3B2YA 1CG2A 1V0CA 1BOBA 2Q04A 1ZG8A 1ON0A 3RZAA 2XEJA 4MJ8A 4CAXA 1JWQA 3F5BA 4JZ0A 4OC4A 3W91A 4F8ZA 4C2XA 1S7NA 2PR8A 3PB6X 3IO1A 4OC5A 1S7KA 5EMIA 3PB8X 2AE6A 2B58A 2FL4A 1LAPA 4R3KA 1ARMA 3PB7X 3SI0A 1TKJA 3DDDA 3TO9A 4KOTA 7CPAA 2V77A 1CX8A 2Z3LA 2FXFA 1XF8A 2NSMA 3ISZA 3PEIA 1PCAA 4KZTA 3T9YA 1VKCA 2J8MA 2OZUA 1I1DA 4ZI6A 2J8RA 5A27A 3GIUA 3JUWA 2AJ6A 3CXSA 4KSIA 3B3CA 4NJRA 3I1UA 3SHPA 3S6FA 2O53A 4PK2A 1K4JA 1BLLE 3D7HA 4PXEA 1VHEA 4KVME 5F48A 3D7GA 2FVGA 4JWPA 4UEZA 4PPZA 4OC3A 4R7MA 4A32A 2PRQA 4R9MA 2C27A 4AG7A 2OZHA 3IWGA 1FY7A 3FBUA 1IB1E 4XPKA 2EVNA 3NH4A 4YRHA 1L0CA 4RUHA 1Y7EA 3HLPA 1B87A 2B5GB 1KUXA 4OIDA 3BXMA 3R95A 3H8FA 4PK3A 2DPSA 2Q44A 2RC4A 2REFA 5BWAB 2RB7A 3FXTA 2ZEMA 2QYVA 3EY5A 3H4QA 4NXYA 2BSWA 4GXHA 5J8CA 4AB7A 2JDCA 1BPNA 4KLVA 4Q36A 2QVPA 2WUUA 3GYAA 4F9VA 2ZXVA 1Z8WA 1YMEA 2PQ8A 3CXQA 1KUYA 4NJQA 4P4FA 3S9NA 4MHDA 4P45A 4ZY0A 4NGQA 1R57A 4X8IA 5AG7A 3TOBA 3TCVA 4L8AA 5H86A 1YLEA 4P10A 5KTCA 3IU1A 4UFWA 4P4IA 3B3SA 4E0AA 1AUGA 2G0BA 2PJ7A 4QBJA 5DWNA 4NGPA 4YGOA 4KORA 2FIAA 3SI2A 4MCPA 4O23A 5GCNA 2PJ1A 2WSAA 3PFOA 3LODA 3TFYA 2YNCC 4UFXA 4CAWA 4H2KA 4MFZA 1P4NA 4M6GA 5G1ZA 4YWYA 5LYDA 3R9EA 4YU9A 1F2OA 3V7ZA 1XFOA 1X12A 3BJ8A 3FECA 3KL9A 1MJBA 3KR4A 3MGDA 3GUXA 4MXUA 3OWCA 4MI4A 5K8OA 5I0CA 1ARLA 3BJ7A 2FE7A 2CIJA 2CTBA 3BLNA 5THWA 2Z10A 4KUAA 4UWJA 4OC2A 5EBVA 4MRIA 2PJ3A 1QSTA 2PJCA 2ZELA 3GLJA 4G1PA 3FYNA 4HPSA 3RAMA 4UCMA 2PJ8A 4ZYQA 2Z3MA 2YNDA 2HB6A 3DR8A 1M4GA 3KR5A 3EXNA 3R96A 2Z3PA 3ZJ0A 4P4JA 2OR4A 3WC7A 2CNSA 2PJ5A 4FWUA 4KUBA 2V8DA 3CT9A 1BAVA 2B3VA 3DLJA 3D2MA 1S3ZA 1P0HA 3WABA 1CPSA 3KI9A 4CGOA 3FEDA 3K9TA 1ZG7A 2B4DA 2Q4YA 2Y0MA 1YW4A 4UEEA 2NYQA 3W6XA 4CYNA 3A9LA 4F9UA 4C2ZA 2ABZA 3SJFA 1NMTA 5HXDA 4NGTA 3CPAA 4RN7A 1CP6A 3T8WA 4H89A 2F5IA 4ZX8A 4BMHA 4B12A 5HVHA 4B5PA 2OB0A 3PGPA 1YREA 1GHEA 4IHMA 4UCPA 4CAFA 1XMBA 3ISXA 2Q7SA 3VATA 2QJ8A 2HUZA 2I00A 3D8PA 2ZW5A 4TNUA 5JPHA 4X2TA 1QSRA 1A2ZA 1MJ9A 2ZW6A 3QB8A 3R9GA 4L89A 1GYTA 4MY0A 4R3LA 4C7HA 2EWBA 5JM6A 3N7ZA 4CRZB 5ISVA 4A95A 4JLYA 3TX8A 3PBBA 5IV0A 4KVXA 2X7BA 1F2PA 2OZGA 3WC5A 2D4PA 1YW6A 4NGRA 3IIBA 5HH1A 4UIAA 2B4BA 3SXNA 4XPDC 1OZPA 4EMEA 4OIWA 1NSLA 3G3SA 4CS0B 4KOUA 4J3GA 4R6TA 4H6ZA 1QSMA 2PJ4A 3FF3A 4NEXA 1X10A 3LWUA 4KOVA 4IF5A 2CTCA 3SJGA 4AVBA 4OC0A 4BD9A 4MY3A 2ZEGA 1RXTA 3GKRA 1I12A 4CGLA 5IB0A 2B5GA 4FD6A 3IC1A 1NE9A 3TE4A 2BEIA 2DEAA 3PBEA 4ZY1A 4PXCA 1KWMA 5IB9A 2REEA 4FD4A 2VL1A 2ZEPA 5H84A 3LACA 4AVCA 4B14A 4PXBA 2CNTA 4M3SA 2Z11A 5CNPA 4CAEA 2ZEOA 1Q7LA 2POKA 5K8NA 1CJWA 4QVTA 4MFJA 2VZYA 4JXQA 2OOTA 2PJ2A 4FUUA 2ATRA 3KHZA 1J4JA 2G9DA 1F57A 2PRBA 2PDOA 2PVWA 4MMOA 3S6KA 1ZO0A 4BINA 1WWZA 3G8WA 2V8HA 5DWMA 1XRYA 3QNVA 2ZENA 2QIRA 1UWYA 1LOKA 2I3CA 4MHZA 2P0WA 2PE3A 4Y49C 2DPTA 3FIXA 2AFSA 2DF5A 2Z3KA 4IK2A 4OC1A 3B3TA 4A2ZA 1YVOA 4Z65A 3BI1A 2PCUA 4K3NA 3RNZA 4OADA 5G21A 2P6GA 1I21A 3B7IA 2PR1A
chains in the Genus database with same CATH topology
3W6SA 4B11A 1WK4A 4QB9A 5KTDA 3PP9A 4NF1A 2EUIA 1S7FA 2FS5A 3T90A 1U6MA 4C68A 2R98A 3H5ZA 4PV6A 4U9YA 3DR6A 5A28A 3C26A 4MFKA 2PC1A 4B10A 2VBQA 4XNHC 3FB3A 4FD5A 3DSBA 4CYPA 3TOAA 4ZGYB 2JLMA 4CGPA 4F6AA 2K5TA 4JXRA 1QSNA 5AG6A 1M44A 4CGNA 3F8KA 4FD7A 4B13A 1B6BA 4UBRA 2PSWA 3I3GA 5F47A 2CXAA 1BO4A 2KCWA 1S7LA 4PSWA 3I9SA 3V8IA 2ZW4A 5C88A 1IYKA 1M1DA 2GIVA 4U5YA 4KOYA 1IICA 1IYLA 2FSRA 3GY9A 5E96A 4KSAA 2FT0A 3R9FA 3UY5A 4A30A 4UA3A 2O28A 2VQYA 4NCZA 4KOXA 2D4OA 4KOSA 1KZFA 3TTHA 3K9UA 4B5OA 3S6GA 4CYQA 5C82A 1PU9A 5KTAA 4I49A 5F46A 4CAVA 3TT2A 4AVAA 3DNSA 5AGEA 4NSQA 4R57A 3QAHA 2P6FA 4MFLA 4UFVA 2H5MA 5JQ4A 1Q2CA 5F49A 4IUSA 3IGRA 2VZZA 5G20A 4XNHB 4CGOA 5AG4A 1Q2DA 4K30A 4YFJA 2OU2A 4X5KA 4LX9A 3FRMA 3VWEA 4AG9A 3R1KA 4U9ZA 2WPWA 2JEVA 2Z3NA 4ZBGA 2CNMA 2R7HA 5IX3A 4C2YA 2VI7A 1M4IA 1S60A 2FCKA 4HNYB 4LUAA 4HKFA 1LRZA 2G3AA 4QUSA 2HQYA 3EO4A 4GS4A 2ZW7A 2VEZA 4E8OA 3D2PA 1YK3A 3VWDA 4CYOA 1N71A 1TIQA 3TO7A 2I79A 3B8GA 1YGHA 2BUEA 4F0XA 3P2HA 2WPXA 3EFAA 3P2FA 4R87A 2Q0YA 3TO6A 4Q38A 4OAEA 3RYOA 4BBHA 4DNCA 3E0KA 1VHSA 5HMNA 4CRYB 4MFQA 2YGWA 5AG5A 4A33A 1KUVA 2Z3OA 4XPDB 2R1IA 3WR7A 2HV2A 5J8FA 1XIXA 4H6UA 3IU2A 5FVJA 2R8VA 1IIDA 4M85A 1Y9WA 3KKWA 3LD2A 2DXQA 4A31A 2YNEA 1XE4A 1RO5A 3ZZIA 3FNCA 2JDDA 2QECA 4E2AA 2IL4A 2BL1A 1Z4EA 2QMLA 4ORFA 4EVYA 2Q4VA 4F0YA 3IWEA 3NE7A 1XEBA 3JTKA 4QC6A 4II9A 2FIWA 1Q2YA 1M4DA 3PZJA 2GANA 3SXOA 2ARHA 4KS9A 1YX0A 1CM0A 1UFHA 1YR0A 1QSOA 2YNCA 4MBUA 2Q7BA 4XPLA 4Y49B 3CXPA 4HNXB 3S6HA 4RI1A 4JJXA 2A4NA 1MK4A 4UWIA 4MFPA 3EC4A 4ONUA 4HNWB 1MJAA 1SQHA 4KLWA 4C7IA 1Z4RA 4PSXA 3JVNA 1PUAA 1Z9UA 1XMTA 2Z0ZA 2G3TA 4KSFA 1Y7RA 4KVOE 2OH1A 3D3SA 2GE3A 2P6EA 1Y9KA 2CY2A 4OLLA 2B4DB 4RS2A 4UCNA 5EC4A 2VXKA 4CGMA 4JD6A 1S5KA 2NMTA 2J8NA 5G22A 4B5PB 1YVKA 2ZPAA 4KOWA 3F0AA 2B3UA 1V0CA 1BOBA 2Q04A 1ON0A 4MJ8A 4CAXA 3F5BA 3W91A 4C2XA 1S7NA 2PR8A 1S7KA 2AE6A 2B58A 2FL4A 4R3KA 3TO9A 3DDDA 4KOTA 2Z3LA 2FXFA 1XF8A 4KZTA 3T9YA 1VKCA 2J8MA 2OZUA 1I1DA 5A27A 2J8RA 3JUWA 2AJ6A 3CXSA 3SHPA 3S6FA 4PK2A 1K4JA 4KVME 5F48A 4JWPA 4A32A 4AG7A 4R9MA 2C27A 2OZHA 3IWGA 1FY7A 3FBUA 1IB1E 4XPKA 2EVNA 4YRHA 1L0CA 1B87A 2B5GB 1KUXA 3R95A 4PK3A 2DPSA 2Q44A 2RC4A 2REFA 5BWAB 3FXTA 3EY5A 3H4QA 4NXYA 2BSWA 5J8CA 4AB7A 2JDCA 4Q36A 4KLVA 2WUUA 3GYAA 2ZXVA 2PQ8A 3CXQA 1KUYA 4MHDA 1R57A 5AG7A 3TOBA 3TCVA 4L8AA 5H86A 1YLEA 5KTCA 3IU1A 4UFWA 4E0AA 2G0BA 4QBJA 5DWNA 4YGOA 4KORA 2FIAA 5GCNA 2WSAA 3LODA 3TFYA 2YNCC 4UFXA 4CAWA 4MFZA 1P4NA 5G1ZA 3R9EA 3BJ8A 1MJBA 3MGDA 3OWCA 4MI4A 5I0CA 3BJ7A 2FE7A 3BLNA 2Z10A 4KUAA 4UWJA 1QSTA 3FYNA 4UCMA 2Z3MA 2YNDA 3DR8A 1M4GA 3EXNA 3R96A 2Z3PA 3ZJ0A 2CNSA 4KUBA 2B3VA 3D2MA 1S3ZA 1P0HA 2B4DA 2Q4YA 2Y0MA 4CYNA 3W6XA 3A9LA 4C2ZA 1NMTA 4H89A 2F5IA 4BMHA 4B12A 4B5PA 2OB0A 3PGPA 1YREA 1GHEA 4UCPA 4CAFA 2HUZA 2I00A 3D8PA 2ZW5A 5JPHA 1QSRA 1MJ9A 2ZW6A 3QB8A 3R9GA 4L89A 4MY0A 4R3LA 4C7HA 3N7ZA 4CRZB 5ISVA 4A95A 4JLYA 5IV0A 4KVXA 2X7BA 2OZGA 2D4PA 5HH1A 2B4BA 3SXNA 4XPDC 1OZPA 1NSLA 3G3SA 4CS0B 4KOUA 4J3GA 4H6ZA 1QSMA 4NEXA 4KOVA 4IF5A 4AVBA 4MY3A 1RXTA 3GKRA 1I12A 4CGLA 5IB0A 2B5GA 4FD6A 1NE9A 3TE4A 2BEIA 2REEA 4FD4A 5H84A 4AVCA 4B14A 2CNTA 4M3SA 2Z11A 5CNPA 4CAEA 1CJWA 4QVTA 4MFJA 2VZYA 4JXQA 2ATRA 1J4JA 2PRBA 2PDOA 3S6KA 1ZO0A 1WWZA 3G8WA 5DWMA 2QIRA 2P0WA 4Y49C 2DPTA 3FIXA 2Z3KA 4A2ZA 1YVOA 4OADA 5G21A 2P6GA 1I21A 5EBVA 2PR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6S A;  1WK4 A;  4QB9 A;  5KTD A;  3PP9 A;  4NF1 A;  2EUI A;  1S7F A;  2FS5 A;  3T90 A;  1U6M A;  2R98 A;  4PV6 A;  4U9Y A;  3DR6 A;  3C26 A;  2PC1 A;  2VBQ A;  4XNH C;  3FB3 A;  4FD5 A;  3DSB A;  3TOA A;  2JLM A;  4F6A A;  2K5T A;  4JXR A;  1QSN A;  1M44 A;  3F8K A;  4FD7 A;  1B6B A;  4UBR A;  2PSW A;  3I3G A;  5F47 A;  1BO4 A;  2KCW A;  1S7L A;  4PSW A;  3I9S A;  3V8I A;  2ZW4 A;  5C88 A;  1IYK A;  1M1D A;  2GIV A;  4U5Y A;  4KOY A;  1IIC A;  1IYL A;  2FSR A;  3GY9 A;  5E96 A;  2FT0 A;  3R9F A;  3UY5 A;  4UA3 A;  2O28 A;  2VQY A;  4NCZ A;  4KOX A;  2D4O A;  4KOS A;  1KZF A;  3TTH A;  3K9U A;  4B5O A;  3S6G A;  5C82 A;  1PU9 A;  5KTA A;  4I49 A;  5F46 A;  4CAV A;  3TT2 A;  4AVA A;  3DNS A;  4NSQ A;  4R57 A;  3QAH A;  2P6F A;  2H5M A;  5JQ4 A;  1Q2C A;  5F49 A;  4IUS A;  3IGR A;  2VZZ A;  4XNH B;  1Q2D A;  4K30 A;  4YFJ A;  2OU2 A;  4X5K A;  4LX9 A;  3FRM A;  3VWE A;  4AG9 A;  3R1K A;  4U9Z A;  2WPW A;  2JEV A;  4ZBG A;  2CNM A;  2R7H A;  5IX3 A;  2VI7 A;  1M4I A;  1S60 A;  2FCK A;  4HNY B;  4LUA A;  4HKF A;  1LRZ A;  2G3A A;  4QUS A;  2HQY A;  3EO4 A;  4GS4 A;  2ZW7 A;  2VEZ A;  4E8O A;  3D2P A;  1YK3 A;  3VWD A;  1N71 A;  1TIQ A;  3TO7 A;  2I79 A;  3B8G A;  1YGH A;  2BUE A;  3P2H A;  2WPX A;  3EFA A;  3P2F A;  4R87 A;  2Q0Y A;  3TO6 A;  4OAE A;  3RYO A;  4DNC A;  3E0K A;  1VHS A;  5HMN A;  4CRY B;  1KUV A;  4XPD B;  2R1I A;  3WR7 A;  2HV2 A;  5J8F A;  1XIX A;  4H6U A;  5FVJ A;  2R8V A;  1IID A;  4M85 A;  1Y9W A;  3KKW A;  3LD2 A;  2DXQ A;  1XE4 A;  1RO5 A;  3ZZI A;  3FNC A;  2JDD A;  2QEC A;  4E2A A;  2IL4 A;  2BL1 A;  1Z4E A;  2QML A;  4ORF A;  4EVY A;  2Q4V A;  4F0Y A;  3NE7 A;  1XEB A;  4QC6 A;  4II9 A;  2FIW A;  1Q2Y A;  1M4D A;  3PZJ A;  2GAN A;  3SXO A;  2ARH A;  1YX0 A;  1CM0 A;  1UFH A;  1YR0 A;  1QSO A;  4MBU A;  2Q7B A;  4XPL A;  4Y49 B;  3CXP A;  4HNX B;  3S6H A;  4RI1 A;  4JJX A;  2A4N A;  1MK4 A;  4UWI A;  3EC4 A;  4ONU A;  4HNW B;  1MJA A;  1SQH A;  4KLW A;  1Z4R A;  4PSX A;  3JVN A;  1PUA A;  1Z9U A;  1XMT A;  2Z0Z A;  2G3T A;  1Y7R A;  4KVO E;  2OH1 A;  3D3S A;  2GE3 A;  2P6E A;  1Y9K A;  2CY2 A;  4OLL A;  2B4D B;  4RS2 A;  5EC4 A;  2VXK A;  4JD6 A;  1S5K A;  2NMT A;  2J8N A;  4B5P B;  1YVK A;  2ZPA A;  4KOW A;  3F0A A;  2B3U A;  1V0C A;  1BOB A;  2Q04 A;  1ON0 A;  4MJ8 A;  4CAX A;  3F5B A;  3W91 A;  1S7N A;  2PR8 A;  1S7K A;  2AE6 A;  2B58 A;  2FL4 A;  4R3K A;  3TO9 A;  3DDD A;  4KOT A;  2FXF A;  1XF8 A;  4KZT A;  3T9Y A;  1VKC A;  2J8M A;  2OZU A;  1I1D A;  2J8R A;  3JUW A;  2AJ6 A;  3CXS A;  3SHP A;  3S6F A;  4PK2 A;  1K4J A;  4KVM E;  5F48 A;  4JWP A;  4AG7 A;  4R9M A;  2C27 A;  2OZH A;  3IWG A;  1FY7 A;  3FBU A;  1IB1 E;  4XPK A;  2EVN A;  4YRH A;  1L0C A;  1B87 A;  2B5G B;  1KUX A;  3R95 A;  4PK3 A;  2Q44 A;  2RC4 A;  2REF A;  3FXT A;  3EY5 A;  3H4Q A;  4NXY A;  2BSW A;  5J8C A;  4AB7 A;  2JDC A;  4KLV A;  3GYA A;  2ZXV A;  2PQ8 A;  3CXQ A;  1KUY A;  4MHD A;  1R57 A;  3TOB A;  3TCV A;  4L8A A;  5H86 A;  1YLE A;  5KTC A;  4E0A A;  2G0B A;  4QBJ A;  5DWN A;  4YGO A;  4KOR A;  2FIA A;  5GCN A;  3LOD A;  3TFY A;  4CAW A;  1P4N A;  3R9E A;  3BJ8 A;  1MJB A;  3MGD A;  3OWC A;  4MI4 A;  5I0C A;  3BJ7 A;  2FE7 A;  3BLN A;  2Z10 A;  4KUA A;  4UWJ A;  1QST A;  3FYN A;  3DR8 A;  1M4G A;  3EXN A;  3R96 A;  3ZJ0 A;  2CNS A;  4KUB A;  2B3V A;  3D2M A;  1S3Z A;  1P0H A;  2B4D A;  2Q4Y A;  2Y0M A;  3W6X A;  1NMT A;  4H89 A;  2F5I A;  4BMH A;  4B5P A;  2OB0 A;  3PGP A;  1YRE A;  1GHE A;  2HUZ A;  2I00 A;  3D8P A;  2ZW5 A;  5JPH A;  1QSR A;  1MJ9 A;  2ZW6 A;  3QB8 A;  3R9G A;  4L89 A;  4MY0 A;  4R3L A;  3N7Z A;  4CRZ B;  5ISV A;  4JLY A;  5IV0 A;  4KVX A;  2X7B A;  2OZG A;  2D4P A;  5HH1 A;  2B4B A;  3SXN A;  4XPD C;  1OZP A;  1NSL A;  3G3S A;  4CS0 B;  4KOU A;  4J3G A;  4H6Z A;  1QSM A;  4NEX A;  4KOV A;  4IF5 A;  4AVB A;  4MY3 A;  1RXT A;  3GKR A;  1I12 A;  5IB0 A;  2B5G A;  4FD6 A;  1NE9 A;  3TE4 A;  2BEI A;  2REE A;  4FD4 A;  5H84 A;  4AVC A;  2CNT A;  4M3S A;  2Z11 A;  5CNP A;  1CJW A;  4QVT A;  2VZY A;  4JXQ A;  2ATR A;  1J4J A;  2PRB A;  2PDO A;  3S6K A;  1WWZ A;  3G8W A;  5DWM A;  2QIR A;  2P0W A;  4Y49 C;  3FIX A;  1YVO A;  4OAD A;  2P6G A;  1I21 A;  5EBV A;  2PR1 A; 
#chains in the Genus database with same CATH topology
 4PQA A;  1LCP A;  3V38 A;  3W6S A;  2WYR A;  4B11 A;  1WK4 A;  4QB9 A;  5KTD A;  5D29 A;  3PP9 A;  4NF1 A;  2EUI A;  1S7F A;  2FS5 A;  3T90 A;  2GU2 A;  1LAM A;  2HC9 A;  3IWW A;  1VIX A;  1U6M A;  4C68 A;  2R98 A;  2PJ9 A;  3H5Z A;  4PV6 A;  3N5F A;  4U9Y A;  3DR6 A;  2F8H A;  1VHO A;  3QAY A;  5A28 A;  1IGB A;  3C26 A;  3H8G A;  2GLF A;  3IJ3 A;  4W9Y A;  4MFK A;  2PC1 A;  5LRG A;  1TF9 A;  4B10 A;  2VBQ A;  1FNO A;  2ZOG A;  3FVL A;  3FB3 A;  4FD5 A;  4XNH C;  3DSB A;  1TKH A;  2JEW A;  4CYP A;  3TOA A;  4ZGY B;  5K8M A;  2JLM A;  4CGP A;  4F6A A;  3RBU A;  3NE8 A;  3VAR A;  2K5T A;  2AFX A;  4JXR A;  1QSN A;  5AG6 A;  1M44 A;  2AFW A;  4NGN A;  3F8K A;  4CGN A;  2GFQ A;  4FD7 A;  4IAV A;  3KQX A;  4R8F A;  2EK9 A;  3D68 A;  4M6H A;  6CPA A;  4MCR A;  2Q51 A;  1DTD A;  1ZLH A;  1HDQ A;  4B13 A;  2GRE A;  1B6B A;  4UBR A;  4LQG A;  2PSW A;  3I3G A;  5F47 A;  4FAI A;  2CXA A;  1BO4 A;  2KCW A;  1S7L A;  1HDU A;  3SJE A;  4DUK A;  2JBJ A;  2V8V A;  4PSW A;  5LYF A;  3I9S A;  3V8I A;  2ZW4 A;  3CPX A;  3D7F A;  3IFE A;  5C88 A;  4WJB A;  1IYK A;  3CZX A;  1AMP A;  1M1D A;  3FH4 A;  2GIV A;  4U5Y A;  4KOY A;  1IOF A;  1IIC A;  1IYL A;  4ZY2 A;  2FSR A;  3GY9 A;  5E96 A;  4KSA A;  5ELY A;  2FT0 A;  2IQ6 A;  3R9F A;  3UY5 A;  2CF4 A;  4A30 A;  5JH9 A;  4UA3 A;  2O28 A;  2RFH A;  4EWT A;  2VQY A;  4NCZ A;  4KOX A;  2D4O A;  4KOS A;  1KZF A;  4UIB A;  3TTH A;  5D8N A;  3K9U A;  4B5O A;  2ZEE A;  3S6G A;  3H8E A;  2ZED A;  3D7D A;  1TF8 A;  4CYQ A;  5C82 A;  3K2K A;  1BPM A;  3PB9 X;  3PB4 X;  1PU9 A;  2C6C A;  5JGF A;  1Z8L A;  5KTA A;  1DE4 C;  4I49 A;  2AFM A;  5F46 A;  4CAV A;  3TT2 A;  4AVA A;  2XEF A;  3DNS A;  5AGE A;  1QMU A;  4NSQ A;  3CDX A;  4R57 A;  3B3V A;  3QAH A;  2P6F A;  4MFL A;  3KQZ A;  4UFV A;  2H5M A;  4A37 A;  5JQ4 A;  1Q2C A;  2BO9 A;  5F49 A;  4IUS A;  3IGR A;  2VZZ A;  3MN8 A;  5LRK A;  5G20 A;  4XNH B;  2PVV A;  2JBK A;  2C6P A;  5LRJ A;  1Z8T A;  1CPX A;  1Q2D A;  4K30 A;  1IOI A;  4YFJ A;  4LQ6 A;  4MHN A;  2OU2 A;  4X5K A;  4LX9 A;  3VH9 A;  3FRM A;  3VWE A;  3KGQ A;  4AG9 A;  5CPA A;  3R1K A;  4U9Z A;  2AFO A;  2Q43 A;  4MCS A;  3SJX A;  4A94 A;  3TC8 A;  2J9A A;  2ZEH A;  3BHX A;  2WPW A;  2JEV A;  4TWE A;  1HEE A;  3WT4 A;  4P4E A;  2Z3N A;  4ZBG A;  2CNM A;  2R7H A;  5IX3 A;  4C2Y A;  2AFZ A;  1R43 A;  1CBX A;  2VI7 A;  4M6I A;  5K8P A;  1M4I A;  1S60 A;  2FCK A;  3NH5 A;  4HNY B;  4Q7A A;  4LUA A;  4HKF A;  3WC6 A;  1LRZ A;  4P4B A;  3MRU A;  2G3A A;  4QUS A;  4EFD A;  4GM5 A;  5LYI A;  2WZN A;  2HQY A;  3EO4 A;  4GS4 A;  2PIZ A;  1ZG9 A;  4OME A;  1EE3 P;  1ZLI A;  2ZW7 A;  2VEZ A;  4E8O A;  3FX6 A;  3D2P A;  1YK3 A;  3VWD A;  4CYO A;  2PJB A;  2EK8 A;  1N71 A;  3D67 A;  1TIQ A;  3TO7 A;  5CBM A;  2ZOF A;  2I79 A;  3B8G A;  2ZEF A;  2EO8 A;  1YGH A;  1TKF A;  4OP4 A;  2BUE A;  5AG4 A;  4AXV A;  3JRU A;  4F0X A;  3P2H A;  4FBE A;  2WPX A;  3EFA A;  8CPA A;  3P2F A;  4R87 A;  2Q0Y A;  3TO6 A;  4Q38 A;  4OAE A;  1FT7 A;  3RYO A;  4BBH A;  4DNC A;  1LFW A;  1H8L A;  2V8G A;  3E0K A;  3PRT A;  1TXR A;  1VHS A;  2ODF A;  3D4U A;  5HMN A;  4CRY B;  4MHP A;  4MFQ A;  2Q4Z A;  2YGW A;  5AG5 A;  4R76 A;  4A33 A;  4MCQ A;  2PJ0 A;  1KUV A;  2Z3O A;  4XPD B;  2AFU A;  5DS0 A;  2BCO A;  2R1I A;  2F7V A;  3WR7 A;  1QQ9 A;  2PJ6 A;  1XBU A;  2HV2 A;  5J8F A;  3GB0 A;  1XIX A;  2XEI A;  3IU2 A;  3FEE A;  4H6U A;  2R8V A;  5FVJ A;  1IID A;  4ONW A;  4M85 A;  2C1C A;  1Y9W A;  1YQE A;  2EBJ A;  3KZW A;  4P4D A;  2IMO A;  3RO0 A;  4A39 A;  3KKW A;  1YSJ A;  3LD2 A;  2DXQ A;  4A31 A;  4WWV A;  1ELL P;  2YNE A;  2IJZ A;  1XE4 A;  1RO5 A;  3ZZI A;  3FNC A;  4DJL A;  1AYE A;  2JDD A;  2QEC A;  4NFR A;  4E2A A;  3S9M A;  2IL4 A;  1NSA A;  3FJU A;  1CP7 A;  1Z2L A;  2BL1 A;  1Z4E A;  2QML A;  1PYT B;  4ORF A;  3B35 A;  5HVG A;  4EVY A;  4OKO A;  4UEF A;  5LYL A;  2Q4V A;  4F0Y A;  3IWE A;  3NE7 A;  1XEB A;  3L2N A;  3JTK A;  4QC6 A;  1XOV A;  2O4H A;  2FIW A;  3LMS A;  3NH8 A;  4II9 A;  1M4D A;  1Q2Y A;  1IU8 A;  5J1Q A;  1Z5R A;  1Y0R A;  3PZJ A;  2GAN A;  3SXO A;  2ARH A;  3PFE A;  1YX0 A;  4KS9 A;  1CM0 A;  1UFH A;  1YR0 A;  4NGS A;  1QSO A;  2YNC A;  5I4M A;  2XEG A;  4MBU A;  4CPA A;  3HUV A;  4XPL A;  2Q7B A;  4Y49 B;  1YLO A;  3CXP A;  4HNX B;  3S6H A;  4RI1 A;  2C6G A;  4JJX A;  2A4N A;  1MK4 A;  2GLJ A;  4UWI A;  3SI1 A;  4MFP A;  1IY7 A;  4ZX9 A;  2BOA A;  3EC4 A;  1Z8X A;  4ONU A;  4HNW B;  4P44 A;  1LAN A;  4B6Z A;  1MJA A;  1SQH A;  4KLW A;  3D66 A;  2ANP A;  3FMC A;  4X3R A;  3S9L A;  4C7I A;  1Z4R A;  3BI0 A;  1ELM P;  4PSX A;  3JVN A;  1PUA A;  1Z9U A;  4JYW A;  1XMT A;  2Z0Z A;  4NGM A;  3DGV A;  2G3T A;  3KHX A;  2PJA A;  4KSF A;  1Y7R A;  3NA6 A;  4KVO E;  2OH1 A;  2PIY A;  3D3S A;  4PXD A;  2GE3 A;  4DYO A;  2P6E A;  1Y9K A;  1OBR A;  2CY2 A;  2B4D B;  3KAS A;  3NFZ A;  4OLL A;  4P6Y A;  4RS2 A;  4UCN A;  5EC4 A;  2VXK A;  4CGM A;  4JD6 A;  1S5K A;  4UF4 A;  4A38 A;  3IEH A;  1VGY A;  2NMT A;  1R3N A;  1JQG A;  2J8N A;  4MHY A;  5F09 A;  5G22 A;  3B3W A;  1RTQ A;  1Y0Y A;  1XJO A;  4B5P B;  1YVK A;  1M4L A;  2ZPA A;  4KOW A;  3F0A A;  2B3U A;  5HVF A;  3B2Y A;  1CG2 A;  1V0C A;  1BOB A;  2Q04 A;  1ZG8 A;  1ON0 A;  3RZA A;  2XEJ A;  4MJ8 A;  4CAX A;  1JWQ A;  3F5B A;  4JZ0 A;  4OC4 A;  3W91 A;  4F8Z A;  4C2X A;  1S7N A;  2PR8 A;  3PB6 X;  3IO1 A;  4OC5 A;  1S7K A;  5EMI A;  3PB8 X;  2AE6 A;  2B58 A;  2FL4 A;  1LAP A;  4R3K A;  1ARM A;  3PB7 X;  3SI0 A;  1TKJ A;  3DDD A;  3TO9 A;  4KOT A;  7CPA A;  2V77 A;  1CX8 A;  2Z3L A;  2FXF A;  1XF8 A;  2NSM A;  3ISZ A;  3PEI A;  1PCA A;  4KZT A;  3T9Y A;  1VKC A;  2J8M A;  2OZU A;  1I1D A;  4ZI6 A;  2J8R A;  5A27 A;  3GIU A;  3JUW A;  2AJ6 A;  3CXS A;  4KSI A;  3B3C A;  4NJR A;  3I1U A;  3SHP A;  3S6F A;  2O53 A;  4PK2 A;  1K4J A;  1BLL E;  3D7H A;  4PXE A;  1VHE A;  4KVM E;  5F48 A;  3D7G A;  2FVG A;  4JWP A;  4UEZ A;  4PPZ A;  4OC3 A;  4R7M A;  4A32 A;  2PRQ A;  4R9M A;  2C27 A;  4AG7 A;  2OZH A;  3IWG A;  1FY7 A;  3FBU A;  1IB1 E;  4XPK A;  2EVN A;  3NH4 A;  4YRH A;  1L0C A;  4RUH A;  1Y7E A;  3HLP A;  1B87 A;  2B5G B;  1KUX A;  4OID A;  3BXM A;  3R95 A;  3H8F A;  4PK3 A;  2DPS A;  2Q44 A;  2RC4 A;  2REF A;  5BWA B;  2RB7 A;  3FXT A;  2ZEM A;  2QYV A;  3EY5 A;  3H4Q A;  4NXY A;  2BSW A;  4GXH A;  5J8C A;  4AB7 A;  2JDC A;  1BPN A;  4KLV A;  4Q36 A;  2QVP A;  2WUU A;  3GYA A;  4F9V A;  2ZXV A;  1Z8W A;  1YME A;  2PQ8 A;  3CXQ A;  1KUY A;  4NJQ A;  4P4F A;  3S9N A;  4MHD A;  4P45 A;  4ZY0 A;  4NGQ A;  1R57 A;  4X8I A;  5AG7 A;  3TOB A;  3TCV A;  4L8A A;  5H86 A;  1YLE A;  4P10 A;  5KTC A;  3IU1 A;  4UFW A;  4P4I A;  3B3S A;  4E0A A;  1AUG A;  2G0B A;  2PJ7 A;  4QBJ A;  5DWN A;  4NGP A;  4YGO A;  4KOR A;  2FIA A;  3SI2 A;  4MCP A;  4O23 A;  5GCN A;  2PJ1 A;  2WSA A;  3PFO A;  3LOD A;  3TFY A;  2YNC C;  4UFX A;  4CAW A;  4H2K A;  4MFZ A;  1P4N A;  4M6G A;  5G1Z A;  4YWY A;  5LYD A;  3R9E A;  4YU9 A;  1F2O A;  3V7Z A;  1XFO A;  1X12 A;  3BJ8 A;  3FEC A;  3KL9 A;  1MJB A;  3KR4 A;  3MGD A;  3GUX A;  4MXU A;  3OWC A;  4MI4 A;  5K8O A;  5I0C A;  1ARL A;  3BJ7 A;  2FE7 A;  2CIJ A;  2CTB A;  3BLN A;  5THW A;  2Z10 A;  4KUA A;  4UWJ A;  4OC2 A;  5EBV A;  4MRI A;  2PJ3 A;  1QST A;  2PJC A;  2ZEL A;  3GLJ A;  4G1P A;  3FYN A;  4HPS A;  3RAM A;  4UCM A;  2PJ8 A;  4ZYQ A;  2Z3M A;  2YND A;  2HB6 A;  3DR8 A;  1M4G A;  3KR5 A;  3EXN A;  3R96 A;  2Z3P A;  3ZJ0 A;  4P4J A;  2OR4 A;  3WC7 A;  2CNS A;  2PJ5 A;  4FWU A;  4KUB A;  2V8D A;  3CT9 A;  1BAV A;  2B3V A;  3DLJ A;  3D2M A;  1S3Z A;  1P0H A;  3WAB A;  1CPS A;  3KI9 A;  4CGO A;  3FED A;  3K9T A;  1ZG7 A;  2B4D A;  2Q4Y A;  2Y0M A;  1YW4 A;  4UEE A;  2NYQ A;  3W6X A;  4CYN A;  3A9L A;  4F9U A;  4C2Z A;  2ABZ A;  3SJF A;  1NMT A;  5HXD A;  4NGT A;  3CPA A;  4RN7 A;  1CP6 A;  3T8W A;  4H89 A;  2F5I A;  4ZX8 A;  4BMH A;  4B12 A;  5HVH A;  4B5P A;  2OB0 A;  3PGP A;  1YRE A;  1GHE A;  4IHM A;  4UCP A;  4CAF A;  1XMB A;  3ISX A;  2Q7S A;  3VAT A;  2QJ8 A;  2HUZ A;  2I00 A;  3D8P A;  2ZW5 A;  4TNU A;  5JPH A;  4X2T A;  1QSR A;  1A2Z A;  1MJ9 A;  2ZW6 A;  3QB8 A;  3R9G A;  4L89 A;  1GYT A;  4MY0 A;  4R3L A;  4C7H A;  2EWB A;  5JM6 A;  3N7Z A;  4CRZ B;  5ISV A;  4A95 A;  4JLY A;  3TX8 A;  3PBB A;  5IV0 A;  4KVX A;  2X7B A;  1F2P A;  2OZG A;  3WC5 A;  2D4P A;  1YW6 A;  4NGR A;  3IIB A;  5HH1 A;  4UIA A;  2B4B A;  3SXN A;  4XPD C;  1OZP A;  4EME A;  4OIW A;  1NSL A;  3G3S A;  4CS0 B;  4KOU A;  4J3G A;  4R6T A;  4H6Z A;  1QSM A;  2PJ4 A;  3FF3 A;  4NEX A;  1X10 A;  3LWU A;  4KOV A;  4IF5 A;  2CTC A;  3SJG A;  4AVB A;  4OC0 A;  4BD9 A;  4MY3 A;  2ZEG A;  1RXT A;  3GKR A;  1I12 A;  4CGL A;  5IB0 A;  2B5G A;  4FD6 A;  3IC1 A;  1NE9 A;  3TE4 A;  2BEI A;  2DEA A;  3PBE A;  4ZY1 A;  4PXC A;  1KWM A;  5IB9 A;  2REE A;  4FD4 A;  2VL1 A;  2ZEP A;  5H84 A;  3LAC A;  4AVC A;  4B14 A;  4PXB A;  2CNT A;  4M3S A;  2Z11 A;  5CNP A;  4CAE A;  2ZEO A;  1Q7L A;  2POK A;  5K8N A;  1CJW A;  4QVT A;  4MFJ A;  2VZY A;  4JXQ A;  2OOT A;  2PJ2 A;  4FUU A;  2ATR A;  3KHZ A;  1J4J A;  2G9D A;  1F57 A;  2PRB A;  2PDO A;  2PVW A;  4MMO A;  3S6K A;  1ZO0 A;  4BIN A;  1WWZ A;  3G8W A;  2V8H A;  5DWM A;  1XRY A;  3QNV A;  2ZEN A;  2QIR A;  1UWY A;  1LOK A;  2I3C A;  4MHZ A;  2P0W A;  2PE3 A;  4Y49 C;  2DPT A;  3FIX A;  2AFS A;  2DF5 A;  2Z3K A;  4IK2 A;  4OC1 A;  3B3T A;  4A2Z A;  1YVO A;  4Z65 A;  3BI1 A;  2PCU A;  4K3N A;  3RNZ A;  4OAD A;  5G21 A;  2P6G A;  1I21 A;  3B7I A;  2PR1 A; 
#chains in the Genus database with same CATH homology
 3W6S A;  4B11 A;  1WK4 A;  4QB9 A;  5KTD A;  3PP9 A;  4NF1 A;  2EUI A;  1S7F A;  2FS5 A;  3T90 A;  1U6M A;  4C68 A;  2R98 A;  3H5Z A;  4PV6 A;  4U9Y A;  3DR6 A;  5A28 A;  3C26 A;  4MFK A;  2PC1 A;  4B10 A;  2VBQ A;  4XNH C;  3FB3 A;  4FD5 A;  3DSB A;  4CYP A;  3TOA A;  4ZGY B;  2JLM A;  4CGP A;  4F6A A;  2K5T A;  4JXR A;  1QSN A;  5AG6 A;  1M44 A;  4CGN A;  3F8K A;  4FD7 A;  4B13 A;  1B6B A;  4UBR A;  2PSW A;  3I3G A;  5F47 A;  2CXA A;  1BO4 A;  2KCW A;  1S7L A;  4PSW A;  3I9S A;  3V8I A;  2ZW4 A;  5C88 A;  1IYK A;  1M1D A;  2GIV A;  4U5Y A;  4KOY A;  1IIC A;  1IYL A;  2FSR A;  3GY9 A;  5E96 A;  4KSA A;  2FT0 A;  3R9F A;  3UY5 A;  4A30 A;  4UA3 A;  2O28 A;  2VQY A;  4NCZ A;  4KOX A;  2D4O A;  4KOS A;  1KZF A;  3TTH A;  3K9U A;  4B5O A;  3S6G A;  4CYQ A;  5C82 A;  1PU9 A;  5KTA A;  4I49 A;  5F46 A;  4CAV A;  3TT2 A;  4AVA A;  3DNS A;  5AGE A;  4NSQ A;  4R57 A;  3QAH A;  2P6F A;  4MFL A;  4UFV A;  2H5M A;  5JQ4 A;  1Q2C A;  5F49 A;  4IUS A;  3IGR A;  2VZZ A;  5G20 A;  4XNH B;  4CGO A;  5AG4 A;  1Q2D A;  4K30 A;  4YFJ A;  2OU2 A;  4X5K A;  4LX9 A;  3FRM A;  3VWE A;  4AG9 A;  3R1K A;  4U9Z A;  2WPW A;  2JEV A;  2Z3N A;  4ZBG A;  2CNM A;  2R7H A;  5IX3 A;  4C2Y A;  2VI7 A;  1M4I A;  1S60 A;  2FCK A;  4HNY B;  4LUA A;  4HKF A;  1LRZ A;  2G3A A;  4QUS A;  2HQY A;  3EO4 A;  4GS4 A;  2ZW7 A;  2VEZ A;  4E8O A;  3D2P A;  1YK3 A;  3VWD A;  4CYO A;  1N71 A;  1TIQ A;  3TO7 A;  2I79 A;  3B8G A;  1YGH A;  2BUE A;  4F0X A;  3P2H A;  2WPX A;  3EFA A;  3P2F A;  4R87 A;  2Q0Y A;  3TO6 A;  4Q38 A;  4OAE A;  3RYO A;  4BBH A;  4DNC A;  3E0K A;  1VHS A;  5HMN A;  4CRY B;  4MFQ A;  2YGW A;  5AG5 A;  4A33 A;  1KUV A;  2Z3O A;  4XPD B;  2R1I A;  3WR7 A;  2HV2 A;  5J8F A;  1XIX A;  4H6U A;  3IU2 A;  5FVJ A;  2R8V A;  1IID A;  4M85 A;  1Y9W A;  3KKW A;  3LD2 A;  2DXQ A;  4A31 A;  2YNE A;  1XE4 A;  1RO5 A;  3ZZI A;  3FNC A;  2JDD A;  2QEC A;  4E2A A;  2IL4 A;  2BL1 A;  1Z4E A;  2QML A;  4ORF A;  4EVY A;  2Q4V A;  4F0Y A;  3IWE A;  3NE7 A;  1XEB A;  3JTK A;  4QC6 A;  4II9 A;  2FIW A;  1Q2Y A;  1M4D A;  3PZJ A;  2GAN A;  3SXO A;  2ARH A;  4KS9 A;  1YX0 A;  1CM0 A;  1UFH A;  1YR0 A;  1QSO A;  2YNC A;  4MBU A;  2Q7B A;  4XPL A;  4Y49 B;  3CXP A;  4HNX B;  3S6H A;  4RI1 A;  4JJX A;  2A4N A;  1MK4 A;  4UWI A;  4MFP A;  3EC4 A;  4ONU A;  4HNW B;  1MJA A;  1SQH A;  4KLW A;  4C7I A;  1Z4R A;  4PSX A;  3JVN A;  1PUA A;  1Z9U A;  1XMT A;  2Z0Z A;  2G3T A;  4KSF A;  1Y7R A;  4KVO E;  2OH1 A;  3D3S A;  2GE3 A;  2P6E A;  1Y9K A;  2CY2 A;  4OLL A;  2B4D B;  4RS2 A;  4UCN A;  5EC4 A;  2VXK A;  4CGM A;  4JD6 A;  1S5K A;  2NMT A;  2J8N A;  5G22 A;  4B5P B;  1YVK A;  2ZPA A;  4KOW A;  3F0A A;  2B3U A;  1V0C A;  1BOB A;  2Q04 A;  1ON0 A;  4MJ8 A;  4CAX A;  3F5B A;  3W91 A;  4C2X A;  1S7N A;  2PR8 A;  1S7K A;  2AE6 A;  2B58 A;  2FL4 A;  4R3K A;  3TO9 A;  3DDD A;  4KOT A;  2Z3L A;  2FXF A;  1XF8 A;  4KZT A;  3T9Y A;  1VKC A;  2J8M A;  2OZU A;  1I1D A;  5A27 A;  2J8R A;  3JUW A;  2AJ6 A;  3CXS A;  3SHP A;  3S6F A;  4PK2 A;  1K4J A;  4KVM E;  5F48 A;  4JWP A;  4A32 A;  4AG7 A;  4R9M A;  2C27 A;  2OZH A;  3IWG A;  1FY7 A;  3FBU A;  1IB1 E;  4XPK A;  2EVN A;  4YRH A;  1L0C A;  1B87 A;  2B5G B;  1KUX A;  3R95 A;  4PK3 A;  2DPS A;  2Q44 A;  2RC4 A;  2REF A;  5BWA B;  3FXT A;  3EY5 A;  3H4Q A;  4NXY A;  2BSW A;  5J8C A;  4AB7 A;  2JDC A;  4Q36 A;  4KLV A;  2WUU A;  3GYA A;  2ZXV A;  2PQ8 A;  3CXQ A;  1KUY A;  4MHD A;  1R57 A;  5AG7 A;  3TOB A;  3TCV A;  4L8A A;  5H86 A;  1YLE A;  5KTC A;  3IU1 A;  4UFW A;  4E0A A;  2G0B A;  4QBJ A;  5DWN A;  4YGO A;  4KOR A;  2FIA A;  5GCN A;  2WSA A;  3LOD A;  3TFY A;  2YNC C;  4UFX A;  4CAW A;  4MFZ A;  1P4N A;  5G1Z A;  3R9E A;  3BJ8 A;  1MJB A;  3MGD A;  3OWC A;  4MI4 A;  5I0C A;  3BJ7 A;  2FE7 A;  3BLN A;  2Z10 A;  4KUA A;  4UWJ A;  1QST A;  3FYN A;  4UCM A;  2Z3M A;  2YND A;  3DR8 A;  1M4G A;  3EXN A;  3R96 A;  2Z3P A;  3ZJ0 A;  2CNS A;  4KUB A;  2B3V A;  3D2M A;  1S3Z A;  1P0H A;  2B4D A;  2Q4Y A;  2Y0M A;  4CYN A;  3W6X A;  3A9L A;  4C2Z A;  1NMT A;  4H89 A;  2F5I A;  4BMH A;  4B12 A;  4B5P A;  2OB0 A;  3PGP A;  1YRE A;  1GHE A;  4UCP A;  4CAF A;  2HUZ A;  2I00 A;  3D8P A;  2ZW5 A;  5JPH A;  1QSR A;  1MJ9 A;  2ZW6 A;  3QB8 A;  3R9G A;  4L89 A;  4MY0 A;  4R3L A;  4C7H A;  3N7Z A;  4CRZ B;  5ISV A;  4A95 A;  4JLY A;  5IV0 A;  4KVX A;  2X7B A;  2OZG A;  2D4P A;  5HH1 A;  2B4B A;  3SXN A;  4XPD C;  1OZP A;  1NSL A;  3G3S A;  4CS0 B;  4KOU A;  4J3G A;  4H6Z A;  1QSM A;  4NEX A;  4KOV A;  4IF5 A;  4AVB A;  4MY3 A;  1RXT A;  3GKR A;  1I12 A;  4CGL A;  5IB0 A;  2B5G A;  4FD6 A;  1NE9 A;  3TE4 A;  2BEI A;  2REE A;  4FD4 A;  5H84 A;  4AVC A;  4B14 A;  2CNT A;  4M3S A;  2Z11 A;  5CNP A;  4CAE A;  1CJW A;  4QVT A;  4MFJ A;  2VZY A;  4JXQ A;  2ATR A;  1J4J A;  2PRB A;  2PDO A;  3S6K A;  1ZO0 A;  1WWZ A;  3G8W A;  5DWM A;  2QIR A;  2P0W A;  4Y49 C;  2DPT A;  3FIX A;  2Z3K A;  4A2Z A;  1YVO A;  4OAD A;  5G21 A;  2P6G A;  1I21 A;  5EBV A;  2PR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...