1IB1E

Crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
178
Chain Sequence
SGIPGSPGRQRRHLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
molecule keywords 14-3-3 ZETA ISOFORM
total genus 45
structure length 178
sequence length 179
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2001-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ib1E00
5JQ4A 2REFA 2OU2A 3I3GA 2ATRA 1OZPA 3T90A 3CXQA 1TIQA 2J8MA 1MJ9A 3PP9A 5GCNA 1FY7A 2BL1A 3DSBA 4B5OA 2B3UA 3S6HA 4QUSA 1KUXA 4K30A 2IL4A 3PZJA 2C27A 3D2PA 5HMNA 3TTHA 1WK4A 1V0CA 3H4QA 2JEVA 4NXYA 3CXPA 1KUVA 1S60A 4PSWA 4MJ8A 4HNXB 4KORA 2OB0A 2ZXVA 2Z0ZA 4CAXA 2OH1A 1YVOA 5DWMA 2P6FA 4MBUA 1IYLA 1IB1E 3W91A 3TFYA 1M4DA 3F5BA 1YGHA 4YRHA 2ZW7A 3NE7A 3R1KA 3W6XA 3QAHA 2VI7A 4Y49B 2VBQA 5CNPA 3JVNA 1SQHA 4AVCA 4CS0B 3R95A 3D3SA 4XNHB 2B4BA 2P0WA 3W6SA 2B3VA 4L8AA 2QIRA 2VZZA 4R57A 4PK3A 2HV2A 2B4DA 4UBRA 1MK4A 2R98A 1YVKA 1K4JA 3ZZIA 3IWGA 2K5TA 3E0KA 2Q7BA 2JDCA 4M3SA 3BLNA 4KZTA 4XPDB 3D2MA 3BJ7A 3TO9A 5F49A 2B5GB 4E0AA 1YREA 4U5YA 3EFAA 2FXFA 2ZPAA 4ZBGA 2J8RA 4Y49C 1VKCA 4PSXA 2Q4VA 4LX9A 5C82A 2JDDA 4HKFA 2FIWA 2REEA 4KVXA 1Z4RA 2Q44A 1MJBA 1J4JA 4KLWA 1YLEA 1XEBA 3MGDA 2CY2A 3VWDA 4GS4A 4KUAA 2BEIA 4MHDA 3FXTA 1XE4A 5IX3A 3TT2A 1QSMA 3P2HA 3R9GA 2R8VA 4XPDC 3I9SA 1Q2CA 1Z9UA 4JLYA 4R9MA 1NMTA 4FD7A 4JD6A 2EVNA 4MI4A 1LRZA 4UWJA 1KUYA 4AVAA 4HNYB 2GIVA 4X5KA 5FVJA 4LUAA 3DDDA 4AB7A 3S6GA 2ZW5A 2GANA 4KOSA 2BSWA 3R9FA 1WWZA 2X7BA 1PU9A 4ONUA 4F0YA 4J3GA 2FT0A 2FIAA 3TO7A 4HNWB 1Q2YA 2B4DB 4H6ZA 4KLVA 5ISVA 2CNTA 4OADA 3S6KA 1U6MA 1M4GA 1QSNA 4AG9A 2ZW6A 1S3ZA 2CNSA 3F8KA 5DWNA 5H86A 3KKWA 4KOXA 3EO4A 3TOAA 1S7LA 3F0AA 3TE4A 4B5PA 3FIXA 2PQ8A 4OLLA 2GE3A 1YX0A 5KTAA 2KCWA 4YFJA 1NE9A 1GHEA 2G3AA 2PC1A 2WPXA 4FD6A 3B8GA 5F47A 1Y7RA 1RXTA 3DR8A 4AVBA 2B5GA 2Q0YA 2G0BA 3FNCA 3SHPA 1IIDA 4NF1A 4B5PB 3D8PA 2FE7A 1UFHA 3BJ8A 1Q2DA 1I1DA 1YR0A 4IF5A 4I49A 3EXNA 5E96A 1VHSA 1XIXA 4YGOA 3GYAA 4CRYB 2P6GA 3P2FA 1QSOA 4NCZA 1P4NA 4PK2A 1NSLA 2FS5A 4EVYA 3TCVA 4QBJA 5EC4A 4CAVA 1Y9KA 5I0CA 2J8NA 1XMTA 3JUWA 1QSRA 2Q04A 5H84A 3GKRA 2A4NA 3CXSA 1IYKA 4R87A 2H5MA 1S7KA 3PGPA 2BUEA 2Q4YA 2OZUA 4R3KA 2F5IA 1PUAA 4NEXA 2VEZA 2PSWA 2PR1A 4JJXA 4KOTA 1I21A 4XPLA 4KUBA 1CM0A 2ARHA 2HQYA 2P6EA 2VQYA 3VWEA 3SXOA 1B6BA 4E2AA 2AJ6A 4NSQA 5HH1A 5C88A 2EUIA 2AE6A 4XPKA 4ORFA 2DXQA 4CAWA 1I12A 1BO4A 1Z4EA 2OZHA 5F46A 5KTDA 4JWPA 2O28A 4PV6A 3R96A 2QECA 4KOWA 2I79A 4JXRA 1YK3A 2QMLA 4KOUA 3T9YA 5IV0A 3LODA 4KOVA 1ON0A 3DR6A 1S7NA 5F48A 1CJWA 1N71A 1BOBA 5IB0A 1KZFA 3RYOA 2R1IA 3G3SA 1MJAA 2Y0MA 3QB8A 1L0CA 4MY0A 3R9EA 4XNHC 4FD5A 4CRZB 4E8OA 4UWIA 3UY5A 2RC4A 4RS2A 3WR7A 3IGRA 2FCKA 4KVOE 4FD4A 1S7FA 3FRMA 2CNMA 4QC6A 3GY9A 5JPHA 3OWCA 2Z11A 1B87A 1QSTA 2R7HA 3S6FA 2PR8A 4AG7A 2PDOA 3EC4A 4KOYA 4RI1A 2G3TA 4H89A 2D4PA 1M1DA 3FB3A 4QVTA 4OAEA 5KTCA 4UA3A 2JLMA 3SXNA 4II9A 4M85A 1M44A 4BMHA 4IUSA 1RO5A 5J8CA 1M4IA 4H6UA 2ZW4A 1XF8A 1R57A 3K9UA 2PRBA 4L89A 2VZYA 3DNSA 4DNCA 2WPWA 3TOBA 3ZJ0A 4KVME 4F6AA 2OZGA 2FL4A 2Z10A 5EBVA 3G8WA 3FBUA 1Y9WA 2D4OA 4R3LA 3V8IA 2NMTA 4JXQA 2VXKA 2HUZA 4U9YA 4U9ZA 3N7ZA 3TO6A 5J8FA 3C26A 3EY5A 1S5KA 1IICA 1P0HA 3LD2A 4MY3A 4QB9A 2FSRA 2I00A 2B58A 3FYNA
chains in the Genus database with same CATH superfamily
5JQ4A 3SJGA 2REFA 2Z3OA 4TNUA 2OU2A 3I3GA 4WJBA 2ATRA 1IOFA 1OZPA 4ZY2A 3KL9A 3T90A 4B11A 3PB6X 3CXQA 2PJ8A 1IOIA 2BOAA 1TIQA 2J8MA 1MJ9A 2ZELA 3FX6A 3PP9A 4KSAA 1FY7A 2XEJA 4NGRA 5AGEA 5GCNA 4A95A 2BL1A 2Q4ZA 3DSBA 2QYVA 3WT4A 4B5OA 4C68A 2YNDA 2Z3KA 2B3UA 3S6HA 4QUSA 4CYOA 1KUXA 2V8GA 3D66A 4K30A 1TXRA 5ELYA 2V8HA 2IL4A 1ZG8A 3GUXA 3PZJA 4MHPA 2PJ2A 2C27A 3D2PA 5HMNA 3TTHA 1WK4A 2POKA 3KR4A 3DLJA 1V0CA 5HVFA 1AMPA 3H4QA 2JEVA 4PXBA 4ZYQA 4NXYA 3CPAA 2Q7SA 4R76A 3CXPA 1KUVA 1TKHA 2IQ6A 1S60A 4PSWA 3LACA 3JTKA 1TF8A 2PJ3A 1ARMA 3D67A 3H8EA 4MJ8A 4HNXB 3RAMA 4LQ6A 3PB9X 4KORA 2OB0A 2ZXVA 2Z0ZA 4CAXA 1BPNA 2OH1A 2RFHA 4HPSA 1YVOA 5LYFA 5DWMA 3MRUA 2P6FA 5LRGA 4MBUA 3CZXA 3B3SA 4MFPA 5K8MA 1IYLA 1IB1E 3W91A 2AFSA 4UFXA 1M4DA 3F5BA 3HLPA 3TFYA 4YU9A 1YGHA 5J1QA 4YRHA 3D4UA 2Z3NA 2ZW7A 2AFWA 5LRJA 3NE7A 3R1KA 3W6XA 3PB4X 2DEAA 4UEFA 1YW6A 3QAHA 2VI7A 4Y49B 2VBQA 3PB8X 5CNPA 3JVNA 1SQHA 4AVCA 3PFOA 4PPZA 3RO0A 4CS0B 4KSIA 3R95A 3D3SA 2PJAA 2B4BA 4OIWA 4XNHB 5AG4A 2P0WA 3W6SA 4B10A 4C7HA 2B3VA 3PBEA 4EMEA 1Q7LA 4A32A 3B3WA 4A30A 4MFZA 1AYEA 4L8AA 4CPAA 1GYTA 4Z65A 2QIRA 2VZZA 4R57A 4PK3A 2HV2A 2B4DA 3FJUA 3TC8A 4UBRA 4BD9A 1MK4A 2R98A 3N5FA 1YVKA 1K4JA 3KHZA 3ZZIA 3PBBA 2JBKA 5IB9A 4P4IA 3IWGA 1XMBA 4OIDA 3BI1A 2K5TA 4UEEA 1Z8XA 3V38A 1LAMA 3TX8A 1M4LA 2O4HA 2ZOFA 2NSMA 1PCAA 3E0KA 3FECA 2Q7BA 4OC2A 2JDCA 3GB0A 3D68A 3BLNA 4M3SA 3BI0A 4KZTA 4XPDB 3D2MA 3BJ7A 3I1UA 1Y7EA 3TO9A 5F49A 2AFMA 2CTCA 2V8VA 2B5GB 2XEGA 2V77A 4E0AA 2OOTA 2PIZA 3SI0A 1YREA 4M6IA 3B35A 4FAIA 4U5YA 3EFAA 2FXFA 2ZPAA 4ZBGA 2J8RA 4UIBA 4X3RA 4Q7AA 4CYNA 4ZY1A 3RNZA 2EWBA 4Y49C 4CGMA 1VKCA 4PSXA 4CGPA 1ZG9A 2Q4VA 3IU1A 3NFZA 1F2PA 3IO1A 4LX9A 5C82A 1DTDA 2JDDA 4HKFA 2FIWA 2ODFA 2REEA 4KVXA 1Z4RA 2WZNA 1VHOA 3H8GA 2Q44A 1MJBA 1LANA 1J4JA 4KLWA 4MHYA 2ZEPA 5CPAA 4ZX9A 1YLEA 4NJQA 1XEBA 5G21A 2Z3MA 5I4MA 5K8OA 3MGDA 3B3TA 2CY2A 1CPSA 4GS4A 3VWDA 3B3VA 4F8ZA 4KUAA 2BEIA 1Y0RA 4MHDA 3FXTA 1XE4A 5G20A 3TT2A 5IX3A 1QSMA 3P2HA 2JEWA 3R9GA 2YNCC 4P4EA 4UFVA 2R8VA 4XPDC 3SI1A 1YLOA 3I9SA 1XRYA 4Q36A 1VGYA 1Q2CA 1Z9UA 1X12A 4JLYA 2PRQA 3K2KA 4R9MA 1HDUA 3DGVA 1NMTA 2C6GA 4FD7A 4JD6A 4NGMA 3QAYA 2EVNA 4JZ0A 1XFOA 1LRZA 4M6HA 4MI4A 4UWJA 1VIXA 1KUYA 2PJ0A 2YNEA 3BHXA 4AVAA 1IGBA 5K8NA 1FNOA 4HNYB 2GIVA 4X5KA 3KZWA 5LYLA 5G1ZA 2C1CA 2F8HA 2ZEHA 3DDDA 4LUAA 5FVJA 3WC7A 4LQGA 4AB7A 3S6GA 2ZW5A 1Z2LA 2GANA 2Q43A 4KOSA 1H8LA 3PEIA 5A28A 2BSWA 1PYTB 3R9FA 1WWZA 3IEHA 2X7BA 4ZY0A 4C2YA 1PU9A 4ONUA 2AFUA 2ZEMA 3IIBA 1ZLIA 1Y0YA 3LWUA 4F0YA 1ELLP 5JM6A 2PVVA 1Z8LA 4RN7A 3IC1A 4J3GA 1LCPA 1ZG7A 2FT0A 2PJBA 2J9AA 4UCPA 3RZAA 1CP7A 2C6PA 3FVLA 2F7VA 2FIAA 1IU8A 3S9LA 4C2ZA 3TO7A 4HNWB 3B2YA 1Q2YA 2B4DB 4H6ZA 4KLVA 5ISVA 2CNTA 4X8IA 3CPXA 4OADA 3NH5A 4C2XA 3B3CA 3IWEA 3S6KA 1M4GA 1U6MA 3GIUA 3WC5A 4OC1A 1QSNA 4AG9A 2ZW6A 4OC4A 2GREA 2PJ6A 1S3ZA 2CNSA 3F8KA 5DWNA 5H86A 4MHNA 3VARA 2GLJA 3PB7X 1CPXA 4EWTA 4F9VA 3KKWA 3S9MA 4KOXA 3EO4A 3TOAA 1S7LA 3F0AA 4A38A 2PJ5A 2DPTA 4CYPA 2GFQA 4B5PA 2Z3LA 3FIXA 4F0XA 2PQ8A 3KQZA 2PJ1A 4CGNA 4OLLA 2GE3A 1YX0A 1ZO0A 5KTAA 1YMEA 2KCWA 2PJ9A 5LYIA 3KI9A 4YFJA 1CX8A 1NE9A 1GHEA 2G3AA 4O23A 2PC1A 3ISXA 6CPAA 2WPXA 1ZLHA 4FD6A 3B8GA 4WWVA 1Y7RA 2GU2A 2AFXA 1RXTA 4OC5A 5F47A 1XBUA 3DR8A 4AVBA 2B5GA 2BCOA 2FVGA 4OP4A 2Q0YA 2G0BA 1X10A 3RBUA 2DF5A 3FNCA 4DJLA 4EFDA 3D7HA 5HVHA 4OMEA 4P4JA 1ARLA 3SHPA 2XEFA 1JWQA 4P4FA 5D8NA 1IIDA 1BLLE 1OBRA 4NF1A 4ZGYB 4B5PB 2ZEOA 3D8PA 4MFQA 2FE7A 1UFHA 4A31A 4B12A 2BO9A 2JBJA 3BJ8A 1Q2DA 3H5ZA 1I1DA 1YR0A 4CYQA 2WSAA 3QNVA 4I49A 2EBJA 3EXNA 4IF5A 4B6ZA 5E96A 4P45A 2Z3PA 4NJRA 1VHSA 1XIXA 3PRTA 4A39A 4R7MA 4YGOA 4F9UA 4IK2A 3GYAA 4CRYB 2P6GA 3P2FA 1QSOA 4NCZA 2PCUA 4KSFA 1P4NA 3D7GA 3SJXA 4CGLA 3FMCA 2V8DA 4PK2A 1NSLA 2FS5A 4EVYA 4UF4A 2PIYA 3TCVA 4NGSA 4QBJA 5CBMA 5G22A 5EC4A 4CAVA 3FEDA 3CDXA 3IWWA 4P6YA 1Y9KA 5THWA 3SI2A 5I0CA 2J8NA 1XMTA 2DPSA 3JUWA 1QSRA 1YW4A 4MRIA 2ZEGA 2Q04A 4P10A 5H84A 3T8WA 3MN8A 8CPAA 3BXMA 3GKRA 2A4NA 3CXSA 3B7IA 2Q51A 1IYKA 4PQAA 1A2ZA 1DE4C 4R87A 2H5MA 1S7KA 4MMOA 3PGPA 2BUEA 4C7IA 4PXCA 2Q4YA 2C6CA 2OZUA 4R3KA 2F5IA 2ZOGA 1PUAA 2ANPA 4NEXA 2QJ8A 3IJ3A 2VEZA 1YSJA 2PSWA 5AG7A 2PR1A 4JJXA 4X2TA 1YQEA 4KOTA 4UFWA 1I21A 4XPLA 5BWAB 3H8FA 4KUBA 1CM0A 2ARHA 2CF4A 2I3CA 1Z5RA 5JGFA 2G9DA 2RB7A 4UCNA 2HQYA 2P6EA 4P44A 4AXVA 1NSAA 4PXEA 2YGWA 4P4DA 3FF3A 4NGNA 2VQYA 4OC3A 3VWEA 3SXOA 1B6BA 2PJCA 2HB6A 4TWEA 2ZEFA 4E2AA 2HC9A 2AJ6A 4NSQA 5HH1A 2IMOA 5C88A 1R43A 3GLJA 4ZI6A 2EUIA 2AFZA 4GXHA 4P4BA 2PE3A 2AE6A 4XPKA 4DYOA 4ORFA 4CAEA 3NA6A 4DUKA 2XEIA 1F2OA 4G1PA 5D29A 4W9YA 4NFRA 2DXQA 4CAWA 1I12A 1BO4A 3IFEA 1VHEA 4ZX8A 1Z4EA 2OZHA 4A94A 5F46A 4BINA 5KTDA 3HUVA 4MHZA 1KWMA 4JWPA 2O28A 4UEZA 4PXDA 4PV6A 5JH9A 3V7ZA 4MFJA 2QECA 2PJ4A 3R96A 4KOWA 4NGPA 2I79A 3FEEA 4GM5A 4JXRA 5A27A 1YK3A 2QMLA 2CIJA 5F09A 1RTQA 3KQXA 3SJFA 3KGQA 4KOUA 3T9YA 5IV0A 3LODA 4KOVA 1ON0A 2OR4A 4K3NA 3DR6A 1S7NA 4KS9A 5F48A 2QVPA 1CJWA 3S9NA 1AUGA 1N71A 1BOBA 5IB0A 1TKJA 1TF9A 1KZFA 3RYOA 4IHMA 1BPMA 2ABZA 4MCQA 2ZEDA 4MXUA 1LOKA 4ONWA 2R1IA 4R8FA 2EK8A 3G3SA 1MJAA 2Y0MA 3ISZA 3D7FA 3QB8A 1L0CA 4MY0A 1HEEA 3R9EA 4XNHC 4FD5A 4CRZB 3WABA 4E8OA 3FH4A 4UWIA 3TE4A 2WUUA 4R6TA 3UY5A 5HXDA 2RC4A 1ELMP 4RS2A 3WR7A 1Z8WA 3IGRA 2FCKA 5LRKA 4KVOE 2WYRA 2YNCA 1F57A 3K9TA 1S7FA 2ZENA 4FD4A 4MCRA 1UWYA 3FRMA 3JRUA 7CPAA 2CNMA 4QC6A 1R3NA 3GY9A 5JPHA 3OWCA 2Z11A 1FT7A 2O53A 4MCSA 1QQ9A 4UCMA 4FBEA 3NE8A 1B87A 1QSTA 4CAFA 4Q38A 2AFOA 2R7HA 3S6FA 3A9LA 4A37A 4H2KA 2PR8A 4FWUA 4AG7A 2PDOA 3EC4A 3WC6A 3PFEA 4KOYA 4RI1A 2GLFA 2G3TA 3D7DA 2D4PA 2PVWA 4H89A 4IAVA 1M1DA 4B14A 2PJ7A 4UIAA 3FB3A 1CBXA 2IJZA 2CXAA 1EE3P 4OAEA 4QVTA 5KTCA 1BAVA 4UA3A 2JLMA 4M6GA 2ZEEA 4NGTA 4CGOA 1JQGA 3SXNA 5AG5A 3NH8A 5AG6A 4II9A 2CTBA 4M85A 4B13A 1M44A 3NH4A 4BMHA 4IUSA 1RO5A 4FUUA 4MFKA 1IY7A 2VL1A 5J8CA 4RUHA 1M4IA 4A33A 1XOVA 4H6UA 3VH9A 4A2ZA 2ZW4A 3CT9A 1CG2A 1XF8A 2EO8A 3KHXA 5HVGA 1R57A 3K9UA 2PRBA 4L89A 2VZYA 3DNSA 4DNCA 4OKOA 4MCPA 1HDQA 5DS0A 4YWYA 1XJOA 2WPWA 2EK9A 3LMSA 3TOBA 3ZJ0A 4KVME 4BBHA 1LFWA 3KASA 2NYQA 4F6AA 2OZGA 3SJEA 2FL4A 4MFLA 2Z10A 5EBVA 3G8WA 3FBUA 1Y9WA 1Z8TA 2D4OA 4R3LA 3V8IA 1QMUA 2NMTA 4JYWA 4JXQA 4NGQA 2VXKA 1TKFA 2HUZA 4U9YA 4U9ZA 3N7ZA 3TO6A 5J8FA 3C26A 5EMIA 4OC0A 3IU2A 3EY5A 1LAPA 5K8PA 1S5KA 5LYDA 1IICA 1P0HA 3KR5A 3LD2A 4MY3A 4QB9A 2FSRA 3VATA 2I00A 1CP6A 3L2NA 2B58A 3FYNA
chains in the Genus database with same CATH topology
5JQ4A 2REFA 2Z3OA 2OU2A 3I3GA 2ATRA 1OZPA 3T90A 4B11A 3CXQA 1TIQA 2J8MA 1MJ9A 3PP9A 4KSAA 5AGEA 5GCNA 1FY7A 4A95A 4C68A 2BL1A 3DSBA 4B5OA 2YNDA 2Z3KA 2B3UA 3S6HA 4QUSA 4CYOA 1KUXA 4K30A 2IL4A 3PZJA 2C27A 3D2PA 5HMNA 3TTHA 1WK4A 1V0CA 3H4QA 2JEVA 4NXYA 3CXPA 1KUVA 1S60A 4PSWA 3JTKA 4MJ8A 4HNXB 4KORA 2OB0A 2ZXVA 2Z0ZA 4CAXA 2OH1A 1YVOA 5DWMA 2P6FA 4MBUA 4MFPA 1IYLA 1IB1E 3W91A 4UFXA 3TFYA 1M4DA 3F5BA 1YGHA 4YRHA 2Z3NA 2ZW7A 3NE7A 3R1KA 3W6XA 3QAHA 2VI7A 4Y49B 2VBQA 5CNPA 3JVNA 1SQHA 4AVCA 4CS0B 3R95A 3D3SA 4XNHB 2B4BA 5AG4A 2P0WA 3W6SA 4B10A 4C7HA 2B3VA 4A32A 4A30A 4MFZA 4L8AA 2QIRA 2VZZA 4R57A 4PK3A 2HV2A 2B4DA 4UBRA 1MK4A 2R98A 1YVKA 1K4JA 3ZZIA 3IWGA 2K5TA 3E0KA 2Q7BA 2JDCA 4M3SA 3BLNA 4KZTA 4XPDB 3D2MA 3BJ7A 3TO9A 5F49A 2B5GB 4E0AA 1YREA 4U5YA 3EFAA 2FXFA 2ZPAA 4ZBGA 2J8RA 4CYNA 4Y49C 4CGMA 1VKCA 4PSXA 4CGPA 2Q4VA 3IU1A 4LX9A 5C82A 2JDDA 4HKFA 2FIWA 2REEA 4KVXA 1Z4RA 2Q44A 1MJBA 1J4JA 4KLWA 1YLEA 1XEBA 5G21A 2Z3MA 3MGDA 2CY2A 3VWDA 4GS4A 4KUAA 2BEIA 5G20A 4MHDA 3FXTA 1XE4A 5IX3A 3TT2A 1QSMA 3P2HA 3R9GA 2YNCC 4UFVA 2R8VA 4XPDC 3I9SA 4Q36A 1Q2CA 1Z9UA 4JLYA 4R9MA 1NMTA 4FD7A 4JD6A 2EVNA 4MI4A 1LRZA 4UWJA 1KUYA 2YNEA 4AVAA 4HNYB 2GIVA 4X5KA 5G1ZA 5FVJA 4LUAA 3DDDA 4AB7A 3S6GA 2ZW5A 2GANA 4KOSA 5A28A 2BSWA 3R9FA 1WWZA 2X7BA 4C2YA 1PU9A 4ONUA 4F0YA 4J3GA 2FT0A 4UCPA 2FIAA 4C2ZA 3TO7A 4HNWB 1Q2YA 2B4DB 4H6ZA 4KLVA 5ISVA 2CNTA 4OADA 4C2XA 3IWEA 3S6KA 1U6MA 1M4GA 1QSNA 4AG9A 2ZW6A 1S3ZA 2CNSA 3F8KA 5DWNA 5H86A 3KKWA 4KOXA 3EO4A 3TOAA 1S7LA 3F0AA 4CYPA 3TE4A 2DPTA 4F0XA 4B5PA 2Z3LA 3FIXA 2PQ8A 4CGNA 4OLLA 2GE3A 1YX0A 1ZO0A 5KTAA 2KCWA 4YFJA 1NE9A 1GHEA 2G3AA 2PC1A 2WPXA 4FD6A 3B8GA 5F47A 1Y7RA 1RXTA 3DR8A 4AVBA 2B5GA 2Q0YA 2G0BA 3FNCA 3SHPA 1IIDA 4ZGYB 4NF1A 4B5PB 3D8PA 4MFQA 2FE7A 1UFHA 4A31A 4B12A 3H5ZA 3BJ8A 1Q2DA 1I1DA 1YR0A 2WSAA 4IF5A 4I49A 3EXNA 5E96A 2Z3PA 1VHSA 1XIXA 4YGOA 3GYAA 4CRYB 2P6GA 3P2FA 1QSOA 4NCZA 4KSFA 1P4NA 4CGLA 4PK2A 1NSLA 2FS5A 4EVYA 3TCVA 4QBJA 5G22A 5EC4A 4CAVA 1Y9KA 5I0CA 2J8NA 1XMTA 2DPSA 3JUWA 1QSRA 2Q04A 5H84A 3GKRA 2A4NA 3CXSA 1IYKA 4R87A 4C7IA 2H5MA 1S7KA 3PGPA 2BUEA 2Q4YA 2OZUA 4R3KA 2F5IA 1PUAA 4NEXA 2VEZA 2PSWA 5AG7A 2PR1A 4JJXA 4KOTA 4UFWA 1I21A 4XPLA 5BWAB 4KUBA 1CM0A 2ARHA 4UCNA 2HQYA 2P6EA 2YGWA 2VQYA 3VWEA 3SXOA 1B6BA 4E2AA 2AJ6A 4NSQA 5HH1A 5C88A 2EUIA 2AE6A 4XPKA 4ORFA 4CAEA 2DXQA 4CAWA 1I12A 1BO4A 1Z4EA 2OZHA 5F46A 5KTDA 4JWPA 2O28A 4PV6A 4MFJA 2QECA 3R96A 4KOWA 2I79A 4JXRA 5A27A 1YK3A 2QMLA 4KOUA 3T9YA 5IV0A 3LODA 4KOVA 1ON0A 3DR6A 1S7NA 4KS9A 5F48A 1CJWA 1N71A 1BOBA 5IB0A 1KZFA 3RYOA 4CYQA 2R1IA 3G3SA 1MJAA 2Y0MA 3QB8A 1L0CA 4MY0A 3R9EA 4XNHC 4FD5A 4CRZB 4E8OA 4UWIA 2WUUA 3UY5A 2RC4A 4RS2A 3WR7A 3IGRA 2FCKA 4KVOE 2YNCA 4FD4A 1S7FA 3FRMA 2CNMA 4QC6A 3GY9A 5JPHA 3OWCA 2Z11A 4UCMA 1B87A 1QSTA 4CAFA 4Q38A 2R7HA 3S6FA 3A9LA 2PR8A 4AG7A 2PDOA 3EC4A 4KOYA 4RI1A 2G3TA 4H89A 2D4PA 1M1DA 4B14A 3FB3A 2CXAA 4OAEA 4QVTA 5KTCA 4UA3A 2JLMA 4CGOA 3SXNA 5AG5A 5AG6A 4II9A 4M85A 4B13A 1M44A 4BMHA 4IUSA 1RO5A 4MFKA 5J8CA 1M4IA 4A33A 4H6UA 4A2ZA 2ZW4A 1XF8A 1R57A 3K9UA 2PRBA 4L89A 2VZYA 3DNSA 4DNCA 2WPWA 3TOBA 3ZJ0A 4KVME 4BBHA 4F6AA 2OZGA 2FL4A 4MFLA 2Z10A 5EBVA 3G8WA 3FBUA 1Y9WA 2D4OA 4R3LA 3V8IA 2NMTA 4JXQA 2VXKA 2HUZA 4U9YA 4U9ZA 3N7ZA 3TO6A 5J8FA 3C26A 3IU2A 3EY5A 1S5KA 1IICA 1P0HA 3LD2A 4MY3A 4QB9A 2FSRA 2I00A 2B58A 3FYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JQ4 A;  2REF A;  2OU2 A;  3I3G A;  2ATR A;  1OZP A;  3T90 A;  3CXQ A;  1TIQ A;  2J8M A;  1MJ9 A;  3PP9 A;  5GCN A;  1FY7 A;  2BL1 A;  3DSB A;  4B5O A;  2B3U A;  3S6H A;  4QUS A;  1KUX A;  4K30 A;  2IL4 A;  3PZJ A;  2C27 A;  3D2P A;  5HMN A;  3TTH A;  1WK4 A;  1V0C A;  3H4Q A;  2JEV A;  4NXY A;  3CXP A;  1KUV A;  1S60 A;  4PSW A;  4MJ8 A;  4HNX B;  4KOR A;  2OB0 A;  2ZXV A;  2Z0Z A;  4CAX A;  2OH1 A;  1YVO A;  5DWM A;  2P6F A;  4MBU A;  1IYL A;  1IB1 E;  3W91 A;  3TFY A;  1M4D A;  3F5B A;  1YGH A;  4YRH A;  2ZW7 A;  3NE7 A;  3R1K A;  3W6X A;  3QAH A;  2VI7 A;  4Y49 B;  2VBQ A;  5CNP A;  3JVN A;  1SQH A;  4AVC A;  4CS0 B;  3R95 A;  3D3S A;  4XNH B;  2B4B A;  2P0W A;  3W6S A;  2B3V A;  4L8A A;  2QIR A;  2VZZ A;  4R57 A;  4PK3 A;  2HV2 A;  2B4D A;  4UBR A;  1MK4 A;  2R98 A;  1YVK A;  1K4J A;  3ZZI A;  3IWG A;  2K5T A;  3E0K A;  2Q7B A;  2JDC A;  4M3S A;  3BLN A;  4KZT A;  4XPD B;  3D2M A;  3BJ7 A;  3TO9 A;  5F49 A;  2B5G B;  4E0A A;  1YRE A;  4U5Y A;  3EFA A;  2FXF A;  2ZPA A;  4ZBG A;  2J8R A;  4Y49 C;  1VKC A;  4PSX A;  2Q4V A;  4LX9 A;  5C82 A;  2JDD A;  4HKF A;  2FIW A;  2REE A;  4KVX A;  1Z4R A;  2Q44 A;  1MJB A;  1J4J A;  4KLW A;  1YLE A;  1XEB A;  3MGD A;  2CY2 A;  3VWD A;  4GS4 A;  4KUA A;  2BEI A;  4MHD A;  3FXT A;  1XE4 A;  5IX3 A;  3TT2 A;  1QSM A;  3P2H A;  3R9G A;  2R8V A;  4XPD C;  3I9S A;  1Q2C A;  1Z9U A;  4JLY A;  4R9M A;  1NMT A;  4FD7 A;  4JD6 A;  2EVN A;  4MI4 A;  1LRZ A;  4UWJ A;  1KUY A;  4AVA A;  4HNY B;  2GIV A;  4X5K A;  5FVJ A;  4LUA A;  3DDD A;  4AB7 A;  3S6G A;  2ZW5 A;  2GAN A;  4KOS A;  2BSW A;  3R9F A;  1WWZ A;  2X7B A;  1PU9 A;  4ONU A;  4F0Y A;  4J3G A;  2FT0 A;  2FIA A;  3TO7 A;  4HNW B;  1Q2Y A;  2B4D B;  4H6Z A;  4KLV A;  5ISV A;  2CNT A;  4OAD A;  3S6K A;  1U6M A;  1M4G A;  1QSN A;  4AG9 A;  2ZW6 A;  1S3Z A;  2CNS A;  3F8K A;  5DWN A;  5H86 A;  3KKW A;  4KOX A;  3EO4 A;  3TOA A;  1S7L A;  3F0A A;  3TE4 A;  4B5P A;  3FIX A;  2PQ8 A;  4OLL A;  2GE3 A;  1YX0 A;  5KTA A;  2KCW A;  4YFJ A;  1NE9 A;  1GHE A;  2G3A A;  2PC1 A;  2WPX A;  4FD6 A;  3B8G A;  5F47 A;  1Y7R A;  1RXT A;  3DR8 A;  4AVB A;  2B5G A;  2Q0Y A;  2G0B A;  3FNC A;  3SHP A;  1IID A;  4NF1 A;  4B5P B;  3D8P A;  2FE7 A;  1UFH A;  3BJ8 A;  1Q2D A;  1I1D A;  1YR0 A;  4IF5 A;  4I49 A;  3EXN A;  5E96 A;  1VHS A;  1XIX A;  4YGO A;  3GYA A;  4CRY B;  2P6G A;  3P2F A;  1QSO A;  4NCZ A;  1P4N A;  4PK2 A;  1NSL A;  2FS5 A;  4EVY A;  3TCV A;  4QBJ A;  5EC4 A;  4CAV A;  1Y9K A;  5I0C A;  2J8N A;  1XMT A;  3JUW A;  1QSR A;  2Q04 A;  5H84 A;  3GKR A;  2A4N A;  3CXS A;  1IYK A;  4R87 A;  2H5M A;  1S7K A;  3PGP A;  2BUE A;  2Q4Y A;  2OZU A;  4R3K A;  2F5I A;  1PUA A;  4NEX A;  2VEZ A;  2PSW A;  2PR1 A;  4JJX A;  4KOT A;  1I21 A;  4XPL A;  4KUB A;  1CM0 A;  2ARH A;  2HQY A;  2P6E A;  2VQY A;  3VWE A;  3SXO A;  1B6B A;  4E2A A;  2AJ6 A;  4NSQ A;  5HH1 A;  5C88 A;  2EUI A;  2AE6 A;  4XPK A;  4ORF A;  2DXQ A;  4CAW A;  1I12 A;  1BO4 A;  1Z4E A;  2OZH A;  5F46 A;  5KTD A;  4JWP A;  2O28 A;  4PV6 A;  3R96 A;  2QEC A;  4KOW A;  2I79 A;  4JXR A;  1YK3 A;  2QML A;  4KOU A;  3T9Y A;  5IV0 A;  3LOD A;  4KOV A;  1ON0 A;  3DR6 A;  1S7N A;  5F48 A;  1CJW A;  1N71 A;  1BOB A;  5IB0 A;  1KZF A;  3RYO A;  2R1I A;  3G3S A;  1MJA A;  2Y0M A;  3QB8 A;  1L0C A;  4MY0 A;  3R9E A;  4XNH C;  4FD5 A;  4CRZ B;  4E8O A;  4UWI A;  3UY5 A;  2RC4 A;  4RS2 A;  3WR7 A;  3IGR A;  2FCK A;  4KVO E;  4FD4 A;  1S7F A;  3FRM A;  2CNM A;  4QC6 A;  3GY9 A;  5JPH A;  3OWC A;  2Z11 A;  1B87 A;  1QST A;  2R7H A;  3S6F A;  2PR8 A;  4AG7 A;  2PDO A;  3EC4 A;  4KOY A;  4RI1 A;  2G3T A;  4H89 A;  2D4P A;  1M1D A;  3FB3 A;  4QVT A;  4OAE A;  5KTC A;  4UA3 A;  2JLM A;  3SXN A;  4II9 A;  4M85 A;  1M44 A;  4BMH A;  4IUS A;  1RO5 A;  5J8C A;  1M4I A;  4H6U A;  2ZW4 A;  1XF8 A;  1R57 A;  3K9U A;  2PRB A;  4L89 A;  2VZY A;  3DNS A;  4DNC A;  2WPW A;  3TOB A;  3ZJ0 A;  4KVM E;  4F6A A;  2OZG A;  2FL4 A;  2Z10 A;  5EBV A;  3G8W A;  3FBU A;  1Y9W A;  2D4O A;  4R3L A;  3V8I A;  2NMT A;  4JXQ A;  2VXK A;  2HUZ A;  4U9Y A;  4U9Z A;  3N7Z A;  3TO6 A;  5J8F A;  3C26 A;  3EY5 A;  1S5K A;  1IIC A;  1P0H A;  3LD2 A;  4MY3 A;  4QB9 A;  2FSR A;  2I00 A;  2B58 A;  3FYN A; 
#chains in the Genus database with same CATH topology
 5JQ4 A;  3SJG A;  2REF A;  2Z3O A;  4TNU A;  2OU2 A;  3I3G A;  4WJB A;  2ATR A;  1IOF A;  1OZP A;  4ZY2 A;  3KL9 A;  3T90 A;  4B11 A;  3PB6 X;  3CXQ A;  2PJ8 A;  1IOI A;  2BOA A;  1TIQ A;  2J8M A;  1MJ9 A;  2ZEL A;  3FX6 A;  3PP9 A;  4KSA A;  1FY7 A;  2XEJ A;  4NGR A;  5AGE A;  5GCN A;  4A95 A;  2BL1 A;  2Q4Z A;  3DSB A;  2QYV A;  3WT4 A;  4B5O A;  4C68 A;  2YND A;  2Z3K A;  2B3U A;  3S6H A;  4QUS A;  4CYO A;  1KUX A;  2V8G A;  3D66 A;  4K30 A;  1TXR A;  5ELY A;  2V8H A;  2IL4 A;  1ZG8 A;  3GUX A;  3PZJ A;  4MHP A;  2PJ2 A;  2C27 A;  3D2P A;  5HMN A;  3TTH A;  1WK4 A;  2POK A;  3KR4 A;  3DLJ A;  1V0C A;  5HVF A;  1AMP A;  3H4Q A;  2JEV A;  4PXB A;  4ZYQ A;  4NXY A;  3CPA A;  2Q7S A;  4R76 A;  3CXP A;  1KUV A;  1TKH A;  2IQ6 A;  1S60 A;  4PSW A;  3LAC A;  3JTK A;  1TF8 A;  2PJ3 A;  1ARM A;  3D67 A;  3H8E A;  4MJ8 A;  4HNX B;  3RAM A;  4LQ6 A;  3PB9 X;  4KOR A;  2OB0 A;  2ZXV A;  2Z0Z A;  4CAX A;  1BPN A;  2OH1 A;  2RFH A;  4HPS A;  1YVO A;  5LYF A;  5DWM A;  3MRU A;  2P6F A;  5LRG A;  4MBU A;  3CZX A;  3B3S A;  4MFP A;  5K8M A;  1IYL A;  1IB1 E;  3W91 A;  2AFS A;  4UFX A;  1M4D A;  3F5B A;  3HLP A;  3TFY A;  4YU9 A;  1YGH A;  5J1Q A;  4YRH A;  3D4U A;  2Z3N A;  2ZW7 A;  2AFW A;  5LRJ A;  3NE7 A;  3R1K A;  3W6X A;  3PB4 X;  2DEA A;  4UEF A;  1YW6 A;  3QAH A;  2VI7 A;  4Y49 B;  2VBQ A;  3PB8 X;  5CNP A;  3JVN A;  1SQH A;  4AVC A;  3PFO A;  4PPZ A;  3RO0 A;  4CS0 B;  4KSI A;  3R95 A;  3D3S A;  2PJA A;  2B4B A;  4OIW A;  4XNH B;  5AG4 A;  2P0W A;  3W6S A;  4B10 A;  4C7H A;  2B3V A;  3PBE A;  4EME A;  1Q7L A;  4A32 A;  3B3W A;  4A30 A;  4MFZ A;  1AYE A;  4L8A A;  4CPA A;  1GYT A;  4Z65 A;  2QIR A;  2VZZ A;  4R57 A;  4PK3 A;  2HV2 A;  2B4D A;  3FJU A;  3TC8 A;  4UBR A;  4BD9 A;  1MK4 A;  2R98 A;  3N5F A;  1YVK A;  1K4J A;  3KHZ A;  3ZZI A;  3PBB A;  2JBK A;  5IB9 A;  4P4I A;  3IWG A;  1XMB A;  4OID A;  3BI1 A;  2K5T A;  4UEE A;  1Z8X A;  3V38 A;  1LAM A;  3TX8 A;  1M4L A;  2O4H A;  2ZOF A;  2NSM A;  1PCA A;  3E0K A;  3FEC A;  2Q7B A;  4OC2 A;  2JDC A;  3GB0 A;  3D68 A;  3BLN A;  4M3S A;  3BI0 A;  4KZT A;  4XPD B;  3D2M A;  3BJ7 A;  3I1U A;  1Y7E A;  3TO9 A;  5F49 A;  2AFM A;  2CTC A;  2V8V A;  2B5G B;  2XEG A;  2V77 A;  4E0A A;  2OOT A;  2PIZ A;  3SI0 A;  1YRE A;  4M6I A;  3B35 A;  4FAI A;  4U5Y A;  3EFA A;  2FXF A;  2ZPA A;  4ZBG A;  2J8R A;  4UIB A;  4X3R A;  4Q7A A;  4CYN A;  4ZY1 A;  3RNZ A;  2EWB A;  4Y49 C;  4CGM A;  1VKC A;  4PSX A;  4CGP A;  1ZG9 A;  2Q4V A;  3IU1 A;  3NFZ A;  1F2P A;  3IO1 A;  4LX9 A;  5C82 A;  1DTD A;  2JDD A;  4HKF A;  2FIW A;  2ODF A;  2REE A;  4KVX A;  1Z4R A;  2WZN A;  1VHO A;  3H8G A;  2Q44 A;  1MJB A;  1LAN A;  1J4J A;  4KLW A;  4MHY A;  2ZEP A;  5CPA A;  4ZX9 A;  1YLE A;  4NJQ A;  1XEB A;  5G21 A;  2Z3M A;  5I4M A;  5K8O A;  3MGD A;  3B3T A;  2CY2 A;  1CPS A;  4GS4 A;  3VWD A;  3B3V A;  4F8Z A;  4KUA A;  2BEI A;  1Y0R A;  4MHD A;  3FXT A;  1XE4 A;  5G20 A;  3TT2 A;  5IX3 A;  1QSM A;  3P2H A;  2JEW A;  3R9G A;  2YNC C;  4P4E A;  4UFV A;  2R8V A;  4XPD C;  3SI1 A;  1YLO A;  3I9S A;  1XRY A;  4Q36 A;  1VGY A;  1Q2C A;  1Z9U A;  1X12 A;  4JLY A;  2PRQ A;  3K2K A;  4R9M A;  1HDU A;  3DGV A;  1NMT A;  2C6G A;  4FD7 A;  4JD6 A;  4NGM A;  3QAY A;  2EVN A;  4JZ0 A;  1XFO A;  1LRZ A;  4M6H A;  4MI4 A;  4UWJ A;  1VIX A;  1KUY A;  2PJ0 A;  2YNE A;  3BHX A;  4AVA A;  1IGB A;  5K8N A;  1FNO A;  4HNY B;  2GIV A;  4X5K A;  3KZW A;  5LYL A;  5G1Z A;  2C1C A;  2F8H A;  2ZEH A;  3DDD A;  4LUA A;  5FVJ A;  3WC7 A;  4LQG A;  4AB7 A;  3S6G A;  2ZW5 A;  1Z2L A;  2GAN A;  2Q43 A;  4KOS A;  1H8L A;  3PEI A;  5A28 A;  2BSW A;  1PYT B;  3R9F A;  1WWZ A;  3IEH A;  2X7B A;  4ZY0 A;  4C2Y A;  1PU9 A;  4ONU A;  2AFU A;  2ZEM A;  3IIB A;  1ZLI A;  1Y0Y A;  3LWU A;  4F0Y A;  1ELL P;  5JM6 A;  2PVV A;  1Z8L A;  4RN7 A;  3IC1 A;  4J3G A;  1LCP A;  1ZG7 A;  2FT0 A;  2PJB A;  2J9A A;  4UCP A;  3RZA A;  1CP7 A;  2C6P A;  3FVL A;  2F7V A;  2FIA A;  1IU8 A;  3S9L A;  4C2Z A;  3TO7 A;  4HNW B;  3B2Y A;  1Q2Y A;  2B4D B;  4H6Z A;  4KLV A;  5ISV A;  2CNT A;  4X8I A;  3CPX A;  4OAD A;  3NH5 A;  4C2X A;  3B3C A;  3IWE A;  3S6K A;  1M4G A;  1U6M A;  3GIU A;  3WC5 A;  4OC1 A;  1QSN A;  4AG9 A;  2ZW6 A;  4OC4 A;  2GRE A;  2PJ6 A;  1S3Z A;  2CNS A;  3F8K A;  5DWN A;  5H86 A;  4MHN A;  3VAR A;  2GLJ A;  3PB7 X;  1CPX A;  4EWT A;  4F9V A;  3KKW A;  3S9M A;  4KOX A;  3EO4 A;  3TOA A;  1S7L A;  3F0A A;  4A38 A;  2PJ5 A;  2DPT A;  4CYP A;  2GFQ A;  4B5P A;  2Z3L A;  3FIX A;  4F0X A;  2PQ8 A;  3KQZ A;  2PJ1 A;  4CGN A;  4OLL A;  2GE3 A;  1YX0 A;  1ZO0 A;  5KTA A;  1YME A;  2KCW A;  2PJ9 A;  5LYI A;  3KI9 A;  4YFJ A;  1CX8 A;  1NE9 A;  1GHE A;  2G3A A;  4O23 A;  2PC1 A;  3ISX A;  6CPA A;  2WPX A;  1ZLH A;  4FD6 A;  3B8G A;  4WWV A;  1Y7R A;  2GU2 A;  2AFX A;  1RXT A;  4OC5 A;  5F47 A;  1XBU A;  3DR8 A;  4AVB A;  2B5G A;  2BCO A;  2FVG A;  4OP4 A;  2Q0Y A;  2G0B A;  1X10 A;  3RBU A;  2DF5 A;  3FNC A;  4DJL A;  4EFD A;  3D7H A;  5HVH A;  4OME A;  4P4J A;  1ARL A;  3SHP A;  2XEF A;  1JWQ A;  4P4F A;  5D8N A;  1IID A;  1BLL E;  1OBR A;  4NF1 A;  4ZGY B;  4B5P B;  2ZEO A;  3D8P A;  4MFQ A;  2FE7 A;  1UFH A;  4A31 A;  4B12 A;  2BO9 A;  2JBJ A;  3BJ8 A;  1Q2D A;  3H5Z A;  1I1D A;  1YR0 A;  4CYQ A;  2WSA A;  3QNV A;  4I49 A;  2EBJ A;  3EXN A;  4IF5 A;  4B6Z A;  5E96 A;  4P45 A;  2Z3P A;  4NJR A;  1VHS A;  1XIX A;  3PRT A;  4A39 A;  4R7M A;  4YGO A;  4F9U A;  4IK2 A;  3GYA A;  4CRY B;  2P6G A;  3P2F A;  1QSO A;  4NCZ A;  2PCU A;  4KSF A;  1P4N A;  3D7G A;  3SJX A;  4CGL A;  3FMC A;  2V8D A;  4PK2 A;  1NSL A;  2FS5 A;  4EVY A;  4UF4 A;  2PIY A;  3TCV A;  4NGS A;  4QBJ A;  5CBM A;  5G22 A;  5EC4 A;  4CAV A;  3FED A;  3CDX A;  3IWW A;  4P6Y A;  1Y9K A;  5THW A;  3SI2 A;  5I0C A;  2J8N A;  1XMT A;  2DPS A;  3JUW A;  1QSR A;  1YW4 A;  4MRI A;  2ZEG A;  2Q04 A;  4P10 A;  5H84 A;  3T8W A;  3MN8 A;  8CPA A;  3BXM A;  3GKR A;  2A4N A;  3CXS A;  3B7I A;  2Q51 A;  1IYK A;  4PQA A;  1A2Z A;  1DE4 C;  4R87 A;  2H5M A;  1S7K A;  4MMO A;  3PGP A;  2BUE A;  4C7I A;  4PXC A;  2Q4Y A;  2C6C A;  2OZU A;  4R3K A;  2F5I A;  2ZOG A;  1PUA A;  2ANP A;  4NEX A;  2QJ8 A;  3IJ3 A;  2VEZ A;  1YSJ A;  2PSW A;  5AG7 A;  2PR1 A;  4JJX A;  4X2T A;  1YQE A;  4KOT A;  4UFW A;  1I21 A;  4XPL A;  5BWA B;  3H8F A;  4KUB A;  1CM0 A;  2ARH A;  2CF4 A;  2I3C A;  1Z5R A;  5JGF A;  2G9D A;  2RB7 A;  4UCN A;  2HQY A;  2P6E A;  4P44 A;  4AXV A;  1NSA A;  4PXE A;  2YGW A;  4P4D A;  3FF3 A;  4NGN A;  2VQY A;  4OC3 A;  3VWE A;  3SXO A;  1B6B A;  2PJC A;  2HB6 A;  4TWE A;  2ZEF A;  4E2A A;  2HC9 A;  2AJ6 A;  4NSQ A;  5HH1 A;  2IMO A;  5C88 A;  1R43 A;  3GLJ A;  4ZI6 A;  2EUI A;  2AFZ A;  4GXH A;  4P4B A;  2PE3 A;  2AE6 A;  4XPK A;  4DYO A;  4ORF A;  4CAE A;  3NA6 A;  4DUK A;  2XEI A;  1F2O A;  4G1P A;  5D29 A;  4W9Y A;  4NFR A;  2DXQ A;  4CAW A;  1I12 A;  1BO4 A;  3IFE A;  1VHE A;  4ZX8 A;  1Z4E A;  2OZH A;  4A94 A;  5F46 A;  4BIN A;  5KTD A;  3HUV A;  4MHZ A;  1KWM A;  4JWP A;  2O28 A;  4UEZ A;  4PXD A;  4PV6 A;  5JH9 A;  3V7Z A;  4MFJ A;  2QEC A;  2PJ4 A;  3R96 A;  4KOW A;  4NGP A;  2I79 A;  3FEE A;  4GM5 A;  4JXR A;  5A27 A;  1YK3 A;  2QML A;  2CIJ A;  5F09 A;  1RTQ A;  3KQX A;  3SJF A;  3KGQ A;  4KOU A;  3T9Y A;  5IV0 A;  3LOD A;  4KOV A;  1ON0 A;  2OR4 A;  4K3N A;  3DR6 A;  1S7N A;  4KS9 A;  5F48 A;  2QVP A;  1CJW A;  3S9N A;  1AUG A;  1N71 A;  1BOB A;  5IB0 A;  1TKJ A;  1TF9 A;  1KZF A;  3RYO A;  4IHM A;  1BPM A;  2ABZ A;  4MCQ A;  2ZED A;  4MXU A;  1LOK A;  4ONW A;  2R1I A;  4R8F A;  2EK8 A;  3G3S A;  1MJA A;  2Y0M A;  3ISZ A;  3D7F A;  3QB8 A;  1L0C A;  4MY0 A;  1HEE A;  3R9E A;  4XNH C;  4FD5 A;  4CRZ B;  3WAB A;  4E8O A;  3FH4 A;  4UWI A;  3TE4 A;  2WUU A;  4R6T A;  3UY5 A;  5HXD A;  2RC4 A;  1ELM P;  4RS2 A;  3WR7 A;  1Z8W A;  3IGR A;  2FCK A;  5LRK A;  4KVO E;  2WYR A;  2YNC A;  1F57 A;  3K9T A;  1S7F A;  2ZEN A;  4FD4 A;  4MCR A;  1UWY A;  3FRM A;  3JRU A;  7CPA A;  2CNM A;  4QC6 A;  1R3N A;  3GY9 A;  5JPH A;  3OWC A;  2Z11 A;  1FT7 A;  2O53 A;  4MCS A;  1QQ9 A;  4UCM A;  4FBE A;  3NE8 A;  1B87 A;  1QST A;  4CAF A;  4Q38 A;  2AFO A;  2R7H A;  3S6F A;  3A9L A;  4A37 A;  4H2K A;  2PR8 A;  4FWU A;  4AG7 A;  2PDO A;  3EC4 A;  3WC6 A;  3PFE A;  4KOY A;  4RI1 A;  2GLF A;  2G3T A;  3D7D A;  2D4P A;  2PVW A;  4H89 A;  4IAV A;  1M1D A;  4B14 A;  2PJ7 A;  4UIA A;  3FB3 A;  1CBX A;  2IJZ A;  2CXA A;  1EE3 P;  4OAE A;  4QVT A;  5KTC A;  1BAV A;  4UA3 A;  2JLM A;  4M6G A;  2ZEE A;  4NGT A;  4CGO A;  1JQG A;  3SXN A;  5AG5 A;  3NH8 A;  5AG6 A;  4II9 A;  2CTB A;  4M85 A;  4B13 A;  1M44 A;  3NH4 A;  4BMH A;  4IUS A;  1RO5 A;  4FUU A;  4MFK A;  1IY7 A;  2VL1 A;  5J8C A;  4RUH A;  1M4I A;  4A33 A;  1XOV A;  4H6U A;  3VH9 A;  4A2Z A;  2ZW4 A;  3CT9 A;  1CG2 A;  1XF8 A;  2EO8 A;  3KHX A;  5HVG A;  1R57 A;  3K9U A;  2PRB A;  4L89 A;  2VZY A;  3DNS A;  4DNC A;  4OKO A;  4MCP A;  1HDQ A;  5DS0 A;  4YWY A;  1XJO A;  2WPW A;  2EK9 A;  3LMS A;  3TOB A;  3ZJ0 A;  4KVM E;  4BBH A;  1LFW A;  3KAS A;  2NYQ A;  4F6A A;  2OZG A;  3SJE A;  2FL4 A;  4MFL A;  2Z10 A;  5EBV A;  3G8W A;  3FBU A;  1Y9W A;  1Z8T A;  2D4O A;  4R3L A;  3V8I A;  1QMU A;  2NMT A;  4JYW A;  4JXQ A;  4NGQ A;  2VXK A;  1TKF A;  2HUZ A;  4U9Y A;  4U9Z A;  3N7Z A;  3TO6 A;  5J8F A;  3C26 A;  5EMI A;  4OC0 A;  3IU2 A;  3EY5 A;  1LAP A;  5K8P A;  1S5K A;  5LYD A;  1IIC A;  1P0H A;  3KR5 A;  3LD2 A;  4MY3 A;  4QB9 A;  2FSR A;  3VAT A;  2I00 A;  1CP6 A;  3L2N A;  2B58 A;  3FYN A; 
#chains in the Genus database with same CATH homology
 5JQ4 A;  2REF A;  2Z3O A;  2OU2 A;  3I3G A;  2ATR A;  1OZP A;  3T90 A;  4B11 A;  3CXQ A;  1TIQ A;  2J8M A;  1MJ9 A;  3PP9 A;  4KSA A;  5AGE A;  5GCN A;  1FY7 A;  4A95 A;  4C68 A;  2BL1 A;  3DSB A;  4B5O A;  2YND A;  2Z3K A;  2B3U A;  3S6H A;  4QUS A;  4CYO A;  1KUX A;  4K30 A;  2IL4 A;  3PZJ A;  2C27 A;  3D2P A;  5HMN A;  3TTH A;  1WK4 A;  1V0C A;  3H4Q A;  2JEV A;  4NXY A;  3CXP A;  1KUV A;  1S60 A;  4PSW A;  3JTK A;  4MJ8 A;  4HNX B;  4KOR A;  2OB0 A;  2ZXV A;  2Z0Z A;  4CAX A;  2OH1 A;  1YVO A;  5DWM A;  2P6F A;  4MBU A;  4MFP A;  1IYL A;  1IB1 E;  3W91 A;  4UFX A;  3TFY A;  1M4D A;  3F5B A;  1YGH A;  4YRH A;  2Z3N A;  2ZW7 A;  3NE7 A;  3R1K A;  3W6X A;  3QAH A;  2VI7 A;  4Y49 B;  2VBQ A;  5CNP A;  3JVN A;  1SQH A;  4AVC A;  4CS0 B;  3R95 A;  3D3S A;  4XNH B;  2B4B A;  5AG4 A;  2P0W A;  3W6S A;  4B10 A;  4C7H A;  2B3V A;  4A32 A;  4A30 A;  4MFZ A;  4L8A A;  2QIR A;  2VZZ A;  4R57 A;  4PK3 A;  2HV2 A;  2B4D A;  4UBR A;  1MK4 A;  2R98 A;  1YVK A;  1K4J A;  3ZZI A;  3IWG A;  2K5T A;  3E0K A;  2Q7B A;  2JDC A;  4M3S A;  3BLN A;  4KZT A;  4XPD B;  3D2M A;  3BJ7 A;  3TO9 A;  5F49 A;  2B5G B;  4E0A A;  1YRE A;  4U5Y A;  3EFA A;  2FXF A;  2ZPA A;  4ZBG A;  2J8R A;  4CYN A;  4Y49 C;  4CGM A;  1VKC A;  4PSX A;  4CGP A;  2Q4V A;  3IU1 A;  4LX9 A;  5C82 A;  2JDD A;  4HKF A;  2FIW A;  2REE A;  4KVX A;  1Z4R A;  2Q44 A;  1MJB A;  1J4J A;  4KLW A;  1YLE A;  1XEB A;  5G21 A;  2Z3M A;  3MGD A;  2CY2 A;  3VWD A;  4GS4 A;  4KUA A;  2BEI A;  5G20 A;  4MHD A;  3FXT A;  1XE4 A;  5IX3 A;  3TT2 A;  1QSM A;  3P2H A;  3R9G A;  2YNC C;  4UFV A;  2R8V A;  4XPD C;  3I9S A;  4Q36 A;  1Q2C A;  1Z9U A;  4JLY A;  4R9M A;  1NMT A;  4FD7 A;  4JD6 A;  2EVN A;  4MI4 A;  1LRZ A;  4UWJ A;  1KUY A;  2YNE A;  4AVA A;  4HNY B;  2GIV A;  4X5K A;  5G1Z A;  5FVJ A;  4LUA A;  3DDD A;  4AB7 A;  3S6G A;  2ZW5 A;  2GAN A;  4KOS A;  5A28 A;  2BSW A;  3R9F A;  1WWZ A;  2X7B A;  4C2Y A;  1PU9 A;  4ONU A;  4F0Y A;  4J3G A;  2FT0 A;  4UCP A;  2FIA A;  4C2Z A;  3TO7 A;  4HNW B;  1Q2Y A;  2B4D B;  4H6Z A;  4KLV A;  5ISV A;  2CNT A;  4OAD A;  4C2X A;  3IWE A;  3S6K A;  1U6M A;  1M4G A;  1QSN A;  4AG9 A;  2ZW6 A;  1S3Z A;  2CNS A;  3F8K A;  5DWN A;  5H86 A;  3KKW A;  4KOX A;  3EO4 A;  3TOA A;  1S7L A;  3F0A A;  4CYP A;  3TE4 A;  2DPT A;  4F0X A;  4B5P A;  2Z3L A;  3FIX A;  2PQ8 A;  4CGN A;  4OLL A;  2GE3 A;  1YX0 A;  1ZO0 A;  5KTA A;  2KCW A;  4YFJ A;  1NE9 A;  1GHE A;  2G3A A;  2PC1 A;  2WPX A;  4FD6 A;  3B8G A;  5F47 A;  1Y7R A;  1RXT A;  3DR8 A;  4AVB A;  2B5G A;  2Q0Y A;  2G0B A;  3FNC A;  3SHP A;  1IID A;  4ZGY B;  4NF1 A;  4B5P B;  3D8P A;  4MFQ A;  2FE7 A;  1UFH A;  4A31 A;  4B12 A;  3H5Z A;  3BJ8 A;  1Q2D A;  1I1D A;  1YR0 A;  2WSA A;  4IF5 A;  4I49 A;  3EXN A;  5E96 A;  2Z3P A;  1VHS A;  1XIX A;  4YGO A;  3GYA A;  4CRY B;  2P6G A;  3P2F A;  1QSO A;  4NCZ A;  4KSF A;  1P4N A;  4CGL A;  4PK2 A;  1NSL A;  2FS5 A;  4EVY A;  3TCV A;  4QBJ A;  5G22 A;  5EC4 A;  4CAV A;  1Y9K A;  5I0C A;  2J8N A;  1XMT A;  2DPS A;  3JUW A;  1QSR A;  2Q04 A;  5H84 A;  3GKR A;  2A4N A;  3CXS A;  1IYK A;  4R87 A;  4C7I A;  2H5M A;  1S7K A;  3PGP A;  2BUE A;  2Q4Y A;  2OZU A;  4R3K A;  2F5I A;  1PUA A;  4NEX A;  2VEZ A;  2PSW A;  5AG7 A;  2PR1 A;  4JJX A;  4KOT A;  4UFW A;  1I21 A;  4XPL A;  5BWA B;  4KUB A;  1CM0 A;  2ARH A;  4UCN A;  2HQY A;  2P6E A;  2YGW A;  2VQY A;  3VWE A;  3SXO A;  1B6B A;  4E2A A;  2AJ6 A;  4NSQ A;  5HH1 A;  5C88 A;  2EUI A;  2AE6 A;  4XPK A;  4ORF A;  4CAE A;  2DXQ A;  4CAW A;  1I12 A;  1BO4 A;  1Z4E A;  2OZH A;  5F46 A;  5KTD A;  4JWP A;  2O28 A;  4PV6 A;  4MFJ A;  2QEC A;  3R96 A;  4KOW A;  2I79 A;  4JXR A;  5A27 A;  1YK3 A;  2QML A;  4KOU A;  3T9Y A;  5IV0 A;  3LOD A;  4KOV A;  1ON0 A;  3DR6 A;  1S7N A;  4KS9 A;  5F48 A;  1CJW A;  1N71 A;  1BOB A;  5IB0 A;  1KZF A;  3RYO A;  4CYQ A;  2R1I A;  3G3S A;  1MJA A;  2Y0M A;  3QB8 A;  1L0C A;  4MY0 A;  3R9E A;  4XNH C;  4FD5 A;  4CRZ B;  4E8O A;  4UWI A;  2WUU A;  3UY5 A;  2RC4 A;  4RS2 A;  3WR7 A;  3IGR A;  2FCK A;  4KVO E;  2YNC A;  4FD4 A;  1S7F A;  3FRM A;  2CNM A;  4QC6 A;  3GY9 A;  5JPH A;  3OWC A;  2Z11 A;  4UCM A;  1B87 A;  1QST A;  4CAF A;  4Q38 A;  2R7H A;  3S6F A;  3A9L A;  2PR8 A;  4AG7 A;  2PDO A;  3EC4 A;  4KOY A;  4RI1 A;  2G3T A;  4H89 A;  2D4P A;  1M1D A;  4B14 A;  3FB3 A;  2CXA A;  4OAE A;  4QVT A;  5KTC A;  4UA3 A;  2JLM A;  4CGO A;  3SXN A;  5AG5 A;  5AG6 A;  4II9 A;  4M85 A;  4B13 A;  1M44 A;  4BMH A;  4IUS A;  1RO5 A;  4MFK A;  5J8C A;  1M4I A;  4A33 A;  4H6U A;  4A2Z A;  2ZW4 A;  1XF8 A;  1R57 A;  3K9U A;  2PRB A;  4L89 A;  2VZY A;  3DNS A;  4DNC A;  2WPW A;  3TOB A;  3ZJ0 A;  4KVM E;  4BBH A;  4F6A A;  2OZG A;  2FL4 A;  4MFL A;  2Z10 A;  5EBV A;  3G8W A;  3FBU A;  1Y9W A;  2D4O A;  4R3L A;  3V8I A;  2NMT A;  4JXQ A;  2VXK A;  2HUZ A;  4U9Y A;  4U9Z A;  3N7Z A;  3TO6 A;  5J8F A;  3C26 A;  3IU2 A;  3EY5 A;  1S5K A;  1IIC A;  1P0H A;  3LD2 A;  4MY3 A;  4QB9 A;  2FSR A;  2I00 A;  2B58 A;  3FYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...