2J8NA

Structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
SIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title l-Methionine sulfoximine, but not phosphinothricin, is a substrate for an acetyltransferase (gene PA4866) from Pseudomonas aeruginosa: structural and functional studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 49
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8nA00
4QC6A 3R95A 1QSOA 2J8RA 2JDDA 1BOBA 1YX0A 3LD2A 4U5YA 2FE7A 2ZPAA 1U6MA 1WK4A 2IL4A 1XEBA 4HNWB 2VQYA 1QSNA 1XE4A 1I12A 1R57A 4IF5A 2FXFA 4AVBA 3S6KA 5IX3A 2ATRA 4JJXA 3FBUA 2Z10A 2ZW5A 4U9YA 4AVCA 3D2MA 4KVOE 2WPWA 4KOXA 4CAWA 4ORFA 4KVME 4MBUA 2HV2A 2RC4A 4M85A 3V8IA 1Q2DA 2A4NA 2I79A 2OU2A 2B5GB 4MHDA 5KTDA 1IICA 1K4JA 3CXPA 2G3TA 1B87A 2VBQA 4Y49B 3UY5A 4YGOA 2B4BA 5JPHA 1M4GA 2AJ6A 1WWZA 2OB0A 2OZHA 4I49A 3TE4A 2AE6A 3K9UA 1TIQA 2Q44A 2Y0MA 3I3GA 1B6BA 1Q2YA 3ZJ0A 2R8VA 1KUYA 2ZW7A 4UWJA 4PSXA 3EY5A 3OWCA 4KUBA 4AB7A 2FIAA 5KTCA 4OADA 2OH1A 4KORA 4KOWA 1YK3A 4FD6A 3SXNA 1Q2CA 3TFYA 3FXTA 3QB8A 2FCKA 4KLVA 1RXTA 2Q04A 3GY9A 2KCWA 2JDCA 1M1DA 2B3VA 2HUZA 3CXSA 1IYLA 2P6GA 3GYAA 4H6ZA 4NSQA 5H84A 4CAXA 4LX9A 1FY7A 2FT0A 2QMLA 3I9SA 2Q4VA 2J8MA 4DNCA 4K30A 2PQ8A 3F0AA 2J8NA 4ONUA 4XNHB 4CAVA 2P6EA 2K5TA 5IV0A 1QSTA 1XF8A 4NXYA 4AVAA 3EXNA 4L8AA 4MI4A 1XIXA 2REFA 1S7NA 3PP9A 1Z9UA 4KUAA 3JVNA 3SHPA 4Y49C 1QSRA 1IYKA 3D8PA 3B8GA 1S7FA 1S7KA 3LODA 3IGRA 4UBRA 4NEXA 4XPDC 2CNTA 2JLMA 3W6XA 4AG9A 3P2HA 3SXOA 3EO4A 3TOBA 4XPLA 1L0CA 1XMTA 3QAHA 4KOUA 1N71A 4PK3A 4MY0A 1ON0A 1P0HA 4L89A 5FVJA 5F46A 5I0CA 1KUVA 4R87A 4FD5A 3FRMA 2G0BA 3RYOA 4PSWA 4R57A 1UFHA 1S60A 4MY3A 3T9YA 4LUAA 5HH1A 3TO6A 2B58A 3W91A 2VEZA 5EC4A 3VWDA 3R96A 3ZZIA 1CJWA 3BLNA 2F5IA 3F5BA 1YVKA 3FNCA 4KZTA 1KZFA 2D4OA 2GE3A 4NCZA 1SQHA 3FB3A 2DXQA 2EVNA 5IB0A 2ZW6A 1NSLA 1P4NA 2Q0YA 4KVXA 2Q7BA 2R1IA 3S6FA 2R98A 1M4IA 4CRYB 4E0AA 5F47A 4R3LA 2GIVA 4F0YA 4XNHC 1PU9A 1Z4EA 4M3SA 3TCVA 1MJAA 2B4DA 2Q4YA 3DNSA 3P2FA 5JQ4A 5J8FA 1S7LA 2PR1A 3NE7A 3FIXA 1QSMA 2Z11A 2R7HA 3T90A 2P6FA 2O28A 2HQYA 3EC4A 4QUSA 4OAEA 1PUAA 1IB1E 3H4QA 2BUEA 3WR7A 4FD4A 1RO5A 5ISVA 2X7BA 4H89A 5DWNA 5DWMA 4HNYB 5F49A 4FD7A 5H86A 4R9MA 1GHEA 5CNPA 1V0CA 3R9GA 4UA3A 4MJ8A 4EVYA 2CY2A 1YGHA 1MJ9A 2D4PA 3TTHA 4E2AA 3S6GA 3DDDA 3EFAA 1J4JA 3JUWA 4XPKA 4KOTA 3VWEA 4JWPA 4PK2A 4U9ZA 3MGDA 4OLLA 5E96A 1OZPA 1Z4RA 3IWGA 4KOSA 4BMHA 2PDOA 3TO7A 3TO9A 1S5KA 4UWIA 1YREA 1Y9WA 3F8KA 2I00A 1IIDA 3R9FA 4JXQA 2FIWA 4GS4A 1VKCA 4JD6A 3S6HA 3DSBA 1M44A 4II9A 2QECA 3PZJA 4B5PB 4QBJA 4F6AA 1NE9A 4KLWA 3CXQA 2H5MA 2REEA 4QB9A 4ZBGA 2NMTA 2BSWA 3PGPA 2BL1A 2VZYA 1I21A 2VZZA 2ZW4A 3KKWA 1MJBA 2G3AA 2B4DB 3G8WA 2OZGA 4PV6A 2PC1A 4H6UA 4XPDB 4J3GA 3G3SA 3DR8A 4YRHA 1NMTA 5J8CA 4RS2A 1I1DA 2BEIA 4KOVA 4YFJA 3BJ8A 1BO4A 1KUXA 3D2PA 2Z0ZA 1M4DA 4JLYA 4AG7A 2JEVA 2QIRA 5GCNA 4B5PA 4IUSA 2B5GA 2PSWA 3DR6A 3R9EA 5C82A 3TT2A 4JXRA 3FYNA 2FSRA 2WPXA 4CS0B 1YVOA 2C27A 4HKFA 3W6SA 4QVTA 2EUIA 2P0WA 5KTAA 2ZXVA 1MK4A 1CM0A 4KOYA 1Y7RA 4R3KA 3GKRA 1YR0A 3R1KA 3TOAA 2FS5A 1Y9KA 2B3UA 2CNMA 4B5OA 2PRBA 2CNSA 1S3ZA 3BJ7A 2FL4A 2GANA 5C88A 2VI7A 5HMNA 2ARHA 2PR8A 4CRZB 4X5KA 2OZUA 3E0KA 5EBVA 4HNXB 1VHSA 3D3SA 4NF1A 3C26A 3N7ZA 4RI1A 2VXKA 1YLEA 1LRZA 4E8OA 5F48A
chains in the Genus database with same CATH superfamily
4MHZA 4NGTA 3PB7X 3D7GA 4QC6A 3R95A 4CYQA 1QSOA 4A31A 4CYNA 3BXMA 3NA6A 2J8RA 2JDDA 2PRQA 2F7VA 1BOBA 1YX0A 3KHZA 3LD2A 4U5YA 3S9NA 1CPSA 2DF5A 2FE7A 2ZPAA 1U6MA 4UFXA 3KZWA 5G22A 1WK4A 2IL4A 4MRIA 3ISZA 1XEBA 4HNWB 1ARLA 2VQYA 1QSNA 1XE4A 1I12A 1R57A 4IF5A 2FXFA 4AVBA 1Y0YA 3LWUA 3S6KA 5IX3A 2ZOGA 1ZLIA 3B3VA 4P4EA 1BLLE 5F09A 2CTBA 2ATRA 4JJXA 3FBUA 2Z10A 1F2PA 2ZW5A 1HDQA 4U9YA 4AVCA 1IGBA 3D2MA 3PBEA 1VHOA 4KVOE 4F0XA 4MCPA 1VHEA 1M4LA 2WPWA 4KOXA 4CAWA 4BINA 4ZY1A 4ORFA 2JEWA 3SI2A 3FECA 4KVME 2GREA 4OC3A 4MBUA 5A28A 1FNOA 6CPAA 3RO0A 3QNVA 5D29A 4K3NA 2HV2A 2RC4A 4M85A 2EWBA 3V8IA 1Q2DA 3B3TA 4YU9A 2AFUA 2A4NA 2NYQA 2I79A 2OU2A 2B5GB 4MHDA 4C2YA 4IK2A 5KTDA 1IICA 2CTCA 1K4JA 3CXPA 2G3TA 1B87A 2VBQA 2G9DA 2RFHA 1IU8A 4Y49B 3UY5A 2BO9A 3D67A 3D7DA 4CGOA 2QJ8A 3B7IA 1XMBA 1Y0RA 3VARA 5HXDA 4B12A 1JQGA 4ZYQA 4YGOA 2B4BA 5JPHA 1M4GA 5LYIA 5AG7A 3S9LA 2AJ6A 3H8EA 1WWZA 2EBJA 4NJQA 3VATA 2OB0A 2OZHA 4I49A 3TE4A 1XRYA 2AE6A 4W9YA 1XOVA 3K9UA 4A38A 1TKFA 2EK8A 1TIQA 2Q44A 2PJCA 2PIZA 3DGVA 5K8OA 2Y0MA 1YMEA 3I3GA 4FWUA 1B6BA 1Q2YA 3ZJ0A 1TKJA 1YLOA 5J1QA 4B6ZA 2R8VA 2PIYA 4ZI6A 1ELLP 3D7FA 3KGQA 1DE4C 1KUYA 2F8HA 2ZW7A 4UWJA 1X10A 4PSXA 3EY5A 4JZ0A 4CGLA 4CPAA 4EMEA 1QMUA 1R3NA 3OWCA 4A32A 2ANPA 3JTKA 1OBRA 4KUBA 4AB7A 2FIAA 4MHYA 5KTCA 4OADA 1LFWA 4NGMA 4TNUA 4PPZA 5HVGA 5EBVA 1LAMA 2OR4A 2C6CA 2OH1A 3H5ZA 5I4MA 4CGMA 4F8ZA 5THWA 4KORA 4KOWA 4OKOA 3FX6A 4ZGYB 1YK3A 4FD6A 8CPAA 3SXNA 1LCPA 1Q2CA 4PQAA 3TFYA 3FXTA 3QB8A 4PXDA 4CAEA 2FCKA 4P6YA 2AFXA 3FEDA 4KLVA 1RXTA 2PJ4A 1AYEA 3SI0A 2Q04A 3VH9A 3GY9A 2KCWA 2JDCA 2Z3KA 1M1DA 4Q7AA 2V77A 2B3VA 2HUZA 2PJ5A 2QYVA 1IYLA 3CPAA 3CXSA 4C7IA 2ZEGA 4P45A 2JBJA 2P6GA 3KASA 1ZG8A 2JBKA 3GYAA 3HUVA 3B3CA 4H6ZA 4BD9A 4NSQA 5H84A 2VL1A 4CAXA 4LX9A 4WJBA 1FY7A 1ARMA 2FT0A 2QMLA 1LAPA 3D66A 2PJ2A 3I9SA 2Q4VA 4UCPA 4ZY0A 2J8MA 4DNCA 3IU1A 4K30A 3V7ZA 2PQ8A 3F0AA 1EE3P 3QAYA 4MXUA 2J8NA 3V38A 1Q7LA 4ONUA 4XNHB 4CAVA 5LYLA 4B13A 2P6EA 2C6GA 4MMOA 4G1PA 2K5TA 3H8GA 3JRUA 4NFRA 5IV0A 4KS9A 3FVLA 4RN7A 1QSTA 1XF8A 4ZY2A 3B3SA 4NXYA 4AVAA 3EXNA 4L8AA 4MI4A 2YNCA 1XIXA 4RI1A 2Z3OA 2PE3A 1S7NA 2REFA 3PP9A 5A27A 4LQ6A 1Z9UA 4KUAA 3JVNA 5AG6A 3SHPA 4CAFA 3NH5A 4Y49C 1QSRA 1IYKA 2PJAA 3D8PA 4CGNA 3B8GA 1S7FA 4PXCA 1S7KA 3TC8A 5K8MA 4FAIA 3NH4A 5IB9A 3LODA 4OP4A 3IGRA 4MFJA 4UBRA 4NEXA 4XPDC 5JH9A 1HDUA 1CX8A 2CNTA 2JLMA 4IAVA 4KSAA 1ELMP 5HVHA 3W6XA 1ZLHA 4C2XA 4C68A 4AG9A 3SJXA 3P2HA 1AMPA 3SXOA 5LRKA 3EO4A 3TOBA 2RB7A 4XPLA 4JYWA 1RTQA 1L0CA 1XMTA 3QAHA 4KOUA 4P10A 1N71A 4NGNA 3RAMA 1ZO0A 1H8LA 3N5FA 3PFOA 4PK3A 3RZAA 1Z8WA 1Z2LA 2HB6A 3CT9A 4M6IA 4OMEA 2QVPA 4MY0A 2Q7SA 3IEHA 1ON0A 1P0HA 3PB4X 4EWTA 1CP6A 3BI0A 4L89A 4C2ZA 1TKHA 3KR4A 1YW4A 5FVJA 5F46A 5CBMA 4MFZA 5I0CA 5K8NA 3SJEA 2NSMA 1KUVA 4R87A 4KSIA 2DPTA 2V8HA 2YNEA 3FRMA 4FD5A 1ZG7A 2G0BA 1VGYA 3RYOA 4PSWA 1ZG9A 1UFHA 1A2ZA 4R57A 1S60A 4MY3A 2YGWA 4UCMA 3T9YA 5K8PA 1YSJA 2PJ7A 2WZNA 3L2NA 4LUAA 5HH1A 3TO6A 1Z5RA 2B58A 3W91A 4B14A 2VEZA 4UEEA 5EC4A 1KWMA 3VWDA 4A39A 3FMCA 3R96A 3PB6X 4B10A 4Q36A 3ZZIA 2POKA 4UFVA 3KHXA 2AFOA 3GB0A 3K2KA 1CJWA 3BLNA 3MN8A 2F5IA 3F5BA 4R76A 4PXBA 1YVKA 2ZEMA 1BAVA 3BI1A 2CIJA 2ABZA 3GUXA 1R43A 2DEAA 2GLFA 3FNCA 4KZTA 4A94A 3NE8A 1KZFA 1XJOA 3MRUA 4P4IA 4FBEA 2D4OA 2AFWA 1CG2A 3IIBA 4KSFA 1Z8TA 4OC4A 2GE3A 4NCZA 1SQHA 2Z3NA 4YWYA 2GU2A 3FB3A 5JM6A 4UCNA 2DXQA 2EVNA 1CPXA 5IB0A 2ZW6A 3D4UA 4UFWA 2CF4A 1HEEA 1NSLA 5D8NA 2EK9A 2PJ1A 4P4FA 1P4NA 1Z8XA 2Q0YA 2WUUA 4KVXA 4MCRA 2Q7BA 5JGFA 2PJ9A 2AFSA 2R1IA 2R98A 3S6FA 5AG4A 1IOIA 4ZX8A 1QQ9A 4R7MA 5LRGA 1M4IA 3NH8A 2DPSA 4CRYB 4E0AA 5F47A 4R3LA 4X2TA 2GIVA 4F0YA 5ELYA 4XNHC 4AXVA 2Q51A 1PU9A 1Z4EA 4X8IA 4M3SA 3WC5A 4X3RA 2ODFA 2HC9A 4Q38A 3IJ3A 3TCVA 1MJAA 2ZEPA 2B4DA 3WC7A 2Q4YA 4DJLA 3DNSA 4MFQA 2CXAA 4NGSA 3P2FA 5JQ4A 5J8FA 1S7LA 2Q43A 2PR1A 4FUUA 3NE7A 3IO1A 2ZEHA 5LYDA 3FIXA 2Z3LA 4DYOA 4TWEA 1QSMA 2Z11A 2C6PA 4UEFA 4Z65A 2FVGA 2R7HA 2V8GA 2IJZA 3T90A 2P6FA 2O28A 2HQYA 2EO8A 3EC4A 4GXHA 4QUSA 3KI9A 5HVFA 4OAEA 1PUAA 1IB1E 4MHPA 3H4QA 4A33A 2BUEA 5EMIA 2AFMA 3B3WA 4FD4A 4M6GA 3WR7A 4CYOA 1BPMA 1RO5A 4P4JA 5ISVA 2X7BA 4MFKA 2WSAA 1CP7A 4H89A 2PCUA 4CGPA 5DWNA 2ZENA 5DWMA 4HNYB 5F49A 4NGRA 3PBBA 4FD7A 5H86A 2YNDA 2ZELA 1GHEA 4R9MA 5G21A 3FJUA 5CNPA 1V0CA 3R9GA 4UA3A 2BOAA 4MJ8A 1F2OA 3KQZA 4EVYA 4H2KA 4LQGA 2XEFA 2CY2A 5G20A 1NSAA 2ZEFA 1PYTB 1YGHA 3IC1A 1MJ9A 2D4PA 3TTHA 4F9VA 4E2AA 4BBHA 3S6GA 3DDDA 3EFAA 1J4JA 3JUWA 4XPKA 3PB8X 4KOTA 3VWEA 4JWPA 4PK2A 4U9ZA 3DLJA 4OC5A 2PJBA 3MGDA 2XEIA 3WT4A 4OLLA 5E96A 3ISXA 1OZPA 1Z4RA 2J9AA 4M6HA 4ZX9A 7CPAA 2XEJA 2V8VA 3IWGA 2PJ0A 3SI1A 3A9LA 4OC2A 4DUKA 1YQEA 4KOSA 1BPNA 4HPSA 4BMHA 4A37A 2GLJA 2PDOA 3TO7A 3TO9A 1S5KA 4UWIA 5DS0A 1YREA 1Y9WA 3I1UA 5G1ZA 5CPAA 3F8KA 4A30A 2I00A 1IIDA 3R9FA 4JXQA 3LACA 4MHNA 3GLJA 4RUHA 2FIWA 1LANA 3FH4A 3PRTA 4GS4A 1VKCA 2AFZA 4A95A 1Y7EA 4JD6A 3S6HA 3DSBA 4UIBA 2ZEEA 4A2ZA 3PEIA 3K9TA 3SJGA 2O53A 3RNZA 1M44A 4O23A 3KR5A 5BWAB 5LYFA 4II9A 3BHXA 4UEZA 2GFQA 2QECA 3PZJA 4GM5A 4B5PB 2PJ3A 3IWEA 4F6AA 4QBJA 1NE9A 4KLWA 3CXQA 1TF8A 2H5MA 2REEA 4QB9A 4ZBGA 2NMTA 2BSWA 3NFZA 1FT7A 4MCQA 3PGPA 2Q4ZA 3B2YA 3S9MA 2BL1A 2VZYA 1I21A 2VZZA 2ZW4A 3KKWA 1MJBA 1Z8LA 2G3AA 2B4DB 3G8WA 2OZGA 4PV6A 2C1CA 2PVVA 2PC1A 2XEGA 4H6UA 4B11A 4XPDB 2IMOA 3WABA 2YNCC 4J3GA 5LRJA 3G3SA 1TF9A 1XFOA 3DR8A 3SJFA 4YRHA 1NMTA 4CYPA 2OOTA 3PFEA 3TX8A 5J8CA 4RS2A 1I1DA 3WC6A 4IHMA 2BEIA 4KOVA 5AGEA 1UWYA 3BJ8A 1BO4A 4OIWA 4YFJA 1KUXA 3D2PA 2PJ8A 3IFEA 3GIUA 4OIDA 1CBXA 1LOKA 2Z0ZA 3D68A 1PCAA 3CPXA 3H8FA 4NJRA 1M4DA 4F9UA 4JLYA 4AG7A 2JEVA 1IY7A 2QIRA 5GCNA 4B5PA 2ZEOA 4IUSA 2B5GA 2PSWA 2ZOFA 3DR6A 3R9EA 5C82A 3TT2A 4JXRA 1F57A 3FYNA 2FSRA 3IU2A 4ONWA 2WPXA 1GYTA 4CS0B 4NGPA 2WYRA 2V8DA 1YVOA 1YW6A 3LMSA 2Z3PA 1TXRA 1IOFA 1AUGA 3IWWA 4P4DA 3CDXA 2C27A 4HKFA 4P44A 3W6SA 4MCSA 4QVTA 1JWQA 2I3CA 2ZEDA 1X12A 2EUIA 2P0WA 5KTAA 2Z3MA 4WWVA 2ZXVA 1MK4A 1CM0A 2BCOA 3HLPA 4KOYA 1Y7RA 4R3KA 3GKRA 1YR0A 4MFLA 3R1KA 3TOAA 4R8FA 3B35A 2FS5A 4NGQA 2O4HA 1Y9KA 3CZXA 4OC1A 4R6TA 3D7HA 4EFDA 2B3UA 2CNMA 4B5OA 2IQ6A 2PRBA 2CNSA 4P4BA 1S3ZA 3KL9A 1XBUA 3T8WA 3KQXA 3BJ7A 2FL4A 2GANA 5C88A 2VI7A 4OC0A 2ARHA 4UF4A 5HMNA 2PR8A 3PB9X 3RBUA 4CRZB 4MFPA 4X5KA 2OZUA 3E0KA 4PXEA 3FEEA 4HNXB 1VHSA 3D3SA 4NF1A 4UIAA 5AG5A 3C26A 3N7ZA 3FF3A 4C7HA 1VIXA 2PVWA 2PJ6A 2VXKA 1YLEA 1LRZA 4E8OA 5F48A 1DTDA
chains in the Genus database with same CATH topology
4QC6A 3R95A 4CYQA 1QSOA 4A31A 4CYNA 2J8RA 2JDDA 1BOBA 1YX0A 3LD2A 4U5YA 2FE7A 4UFXA 2ZPAA 1U6MA 5G22A 1WK4A 2IL4A 1XEBA 4HNWB 2VQYA 1QSNA 1XE4A 1I12A 1R57A 4IF5A 2FXFA 4AVBA 3S6KA 5IX3A 2ATRA 4JJXA 3FBUA 2Z10A 2ZW5A 4U9YA 4AVCA 3D2MA 4KVOE 4F0XA 2WPWA 4KOXA 4CAWA 4ORFA 4KVME 4MBUA 5A28A 2HV2A 2RC4A 4M85A 3V8IA 1Q2DA 2A4NA 2I79A 2OU2A 2B5GB 4MHDA 4C2YA 5KTDA 1IICA 1K4JA 3CXPA 2G3TA 1B87A 2VBQA 4Y49B 3UY5A 4CGOA 4B12A 4YGOA 2B4BA 5JPHA 1M4GA 5AG7A 2AJ6A 1WWZA 2OB0A 2OZHA 4I49A 3TE4A 2AE6A 3K9UA 1TIQA 2Q44A 2Y0MA 3I3GA 1B6BA 1Q2YA 3ZJ0A 2R8VA 1KUYA 2ZW7A 4UWJA 4PSXA 3EY5A 4CGLA 3OWCA 4A32A 4KUBA 3JTKA 4AB7A 2FIAA 5KTCA 4OADA 2OH1A 3H5ZA 4CGMA 4KORA 4KOWA 4ZGYB 1YK3A 4FD6A 3SXNA 1Q2CA 3TFYA 3FXTA 3QB8A 4CAEA 2FCKA 4KLVA 1RXTA 2Q04A 3GY9A 2KCWA 2JDCA 2Z3KA 1M1DA 2B3VA 2HUZA 3CXSA 1IYLA 4C7IA 2P6GA 3GYAA 4H6ZA 4NSQA 5H84A 4CAXA 4LX9A 1FY7A 2FT0A 2QMLA 4UCPA 3I9SA 2Q4VA 2J8MA 4DNCA 3IU1A 4K30A 2PQ8A 3F0AA 2J8NA 4ONUA 4XNHB 4CAVA 4B13A 2P6EA 2K5TA 5IV0A 4KS9A 1QSTA 1XF8A 4NXYA 4AVAA 3EXNA 4L8AA 4MI4A 2YNCA 1XIXA 2Z3OA 2REFA 1S7NA 3PP9A 5A27A 1Z9UA 4KUAA 3JVNA 5AG6A 3SHPA 4CAFA 4Y49C 1QSRA 1IYKA 3D8PA 4CGNA 3B8GA 1S7FA 1S7KA 3LODA 3IGRA 4MFJA 4UBRA 4NEXA 4XPDC 2CNTA 2JLMA 4KSAA 3W6XA 4C2XA 4C68A 4AG9A 3P2HA 3SXOA 3EO4A 3TOBA 4XPLA 1L0CA 1XMTA 3QAHA 4KOUA 1N71A 1ZO0A 4PK3A 4MY0A 1ON0A 1P0HA 4L89A 4C2ZA 5FVJA 5F46A 4MFZA 5I0CA 1KUVA 4R87A 2DPTA 2YNEA 4FD5A 3FRMA 2G0BA 3RYOA 4PSWA 4R57A 1UFHA 4UCMA 1S60A 4MY3A 2YGWA 3T9YA 4LUAA 5HH1A 3TO6A 4B14A 2B58A 3W91A 2VEZA 5EC4A 3VWDA 3R96A 4B10A 4Q36A 3ZZIA 4UFVA 1CJWA 3BLNA 2F5IA 3F5BA 1YVKA 3FNCA 4KZTA 1KZFA 2D4OA 4KSFA 2GE3A 4NCZA 1SQHA 2Z3NA 3FB3A 4UCNA 2DXQA 2EVNA 5IB0A 2ZW6A 4UFWA 1NSLA 1P4NA 2WUUA 2Q0YA 4KVXA 2Q7BA 2R1IA 3S6FA 2R98A 5AG4A 1M4IA 2DPSA 4CRYB 4E0AA 5F47A 4R3LA 2GIVA 4F0YA 4XNHC 1PU9A 1Z4EA 4M3SA 4Q38A 3TCVA 1MJAA 2B4DA 2Q4YA 3DNSA 4MFQA 2CXAA 3P2FA 5JQ4A 5J8FA 1S7LA 2PR1A 3NE7A 3FIXA 2Z3LA 1QSMA 2Z11A 2R7HA 3T90A 2P6FA 2O28A 2HQYA 3EC4A 4QUSA 4OAEA 1PUAA 1IB1E 3H4QA 4A33A 2BUEA 3WR7A 4FD4A 4CYOA 1RO5A 5ISVA 2X7BA 4MFKA 2WSAA 4H89A 4CGPA 5DWNA 5DWMA 4HNYB 5F49A 4FD7A 5H86A 2YNDA 4R9MA 1GHEA 5G21A 5CNPA 1V0CA 3R9GA 4UA3A 4MJ8A 4EVYA 2CY2A 5G20A 1YGHA 1MJ9A 2D4PA 3TTHA 4E2AA 4BBHA 3S6GA 3DDDA 3EFAA 1J4JA 3JUWA 4XPKA 4KOTA 3VWEA 4JWPA 4PK2A 4U9ZA 3MGDA 4OLLA 5E96A 1OZPA 1Z4RA 3IWGA 3A9LA 4KOSA 4BMHA 2PDOA 3TO7A 3TO9A 1S5KA 4UWIA 1YREA 1Y9WA 5G1ZA 3F8KA 4A30A 2I00A 1IIDA 3R9FA 4JXQA 2FIWA 4GS4A 1VKCA 4A95A 4JD6A 3S6HA 3DSBA 4A2ZA 1M44A 5BWAB 4II9A 2QECA 3PZJA 4B5PB 3IWEA 4F6AA 4QBJA 1NE9A 4KLWA 3CXQA 2H5MA 2REEA 4QB9A 4ZBGA 2NMTA 2BSWA 3PGPA 2BL1A 2VZYA 1I21A 2VZZA 2ZW4A 3KKWA 1MJBA 2G3AA 2B4DB 3G8WA 2OZGA 4PV6A 4B11A 2PC1A 4H6UA 4XPDB 2YNCC 4J3GA 3G3SA 3DR8A 4YRHA 1NMTA 4CYPA 5J8CA 4RS2A 1I1DA 2BEIA 4KOVA 5AGEA 4YFJA 3BJ8A 1BO4A 1KUXA 3D2PA 2Z0ZA 1M4DA 4JLYA 4AG7A 2JEVA 2QIRA 5GCNA 4B5PA 4IUSA 2B5GA 2PSWA 3DR6A 3R9EA 5C82A 3TT2A 4JXRA 3FYNA 2FSRA 3IU2A 2WPXA 4CS0B 1YVOA 2Z3PA 2C27A 4HKFA 3W6SA 4QVTA 2EUIA 2P0WA 5KTAA 2Z3MA 2ZXVA 1MK4A 1CM0A 4KOYA 1Y7RA 4R3KA 3GKRA 1YR0A 4MFLA 3R1KA 3TOAA 2FS5A 1Y9KA 2B3UA 2CNMA 4B5OA 2PRBA 2CNSA 1S3ZA 3BJ7A 2FL4A 2GANA 5C88A 2VI7A 5HMNA 2ARHA 2PR8A 4CRZB 4MFPA 4X5KA 2OZUA 3E0KA 5AG5A 4HNXB 5EBVA 1VHSA 3D3SA 4NF1A 4C7HA 3C26A 3N7ZA 4RI1A 2VXKA 1YLEA 1LRZA 4E8OA 5F48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QC6 A;  3R95 A;  1QSO A;  2J8R A;  2JDD A;  1BOB A;  1YX0 A;  3LD2 A;  4U5Y A;  2FE7 A;  2ZPA A;  1U6M A;  1WK4 A;  2IL4 A;  1XEB A;  4HNW B;  2VQY A;  1QSN A;  1XE4 A;  1I12 A;  1R57 A;  4IF5 A;  2FXF A;  4AVB A;  3S6K A;  5IX3 A;  2ATR A;  4JJX A;  3FBU A;  2Z10 A;  2ZW5 A;  4U9Y A;  4AVC A;  3D2M A;  4KVO E;  2WPW A;  4KOX A;  4CAW A;  4ORF A;  4KVM E;  4MBU A;  2HV2 A;  2RC4 A;  4M85 A;  3V8I A;  1Q2D A;  2A4N A;  2I79 A;  2OU2 A;  2B5G B;  4MHD A;  5KTD A;  1IIC A;  1K4J A;  3CXP A;  2G3T A;  1B87 A;  2VBQ A;  4Y49 B;  3UY5 A;  4YGO A;  2B4B A;  5JPH A;  1M4G A;  2AJ6 A;  1WWZ A;  2OB0 A;  2OZH A;  4I49 A;  3TE4 A;  2AE6 A;  3K9U A;  1TIQ A;  2Q44 A;  2Y0M A;  3I3G A;  1B6B A;  1Q2Y A;  3ZJ0 A;  2R8V A;  1KUY A;  2ZW7 A;  4UWJ A;  4PSX A;  3EY5 A;  3OWC A;  4KUB A;  4AB7 A;  2FIA A;  5KTC A;  4OAD A;  2OH1 A;  4KOR A;  4KOW A;  1YK3 A;  4FD6 A;  3SXN A;  1Q2C A;  3TFY A;  3FXT A;  3QB8 A;  2FCK A;  4KLV A;  1RXT A;  2Q04 A;  3GY9 A;  2KCW A;  2JDC A;  1M1D A;  2B3V A;  2HUZ A;  3CXS A;  1IYL A;  2P6G A;  3GYA A;  4H6Z A;  4NSQ A;  5H84 A;  4CAX A;  4LX9 A;  1FY7 A;  2FT0 A;  2QML A;  3I9S A;  2Q4V A;  2J8M A;  4DNC A;  4K30 A;  2PQ8 A;  3F0A A;  2J8N A;  4ONU A;  4XNH B;  4CAV A;  2P6E A;  2K5T A;  5IV0 A;  1QST A;  1XF8 A;  4NXY A;  4AVA A;  3EXN A;  4L8A A;  4MI4 A;  1XIX A;  2REF A;  1S7N A;  3PP9 A;  1Z9U A;  4KUA A;  3JVN A;  3SHP A;  4Y49 C;  1QSR A;  1IYK A;  3D8P A;  3B8G A;  1S7F A;  1S7K A;  3LOD A;  3IGR A;  4UBR A;  4NEX A;  4XPD C;  2CNT A;  2JLM A;  3W6X A;  4AG9 A;  3P2H A;  3SXO A;  3EO4 A;  3TOB A;  4XPL A;  1L0C A;  1XMT A;  3QAH A;  4KOU A;  1N71 A;  4PK3 A;  4MY0 A;  1ON0 A;  1P0H A;  4L89 A;  5FVJ A;  5F46 A;  5I0C A;  1KUV A;  4R87 A;  4FD5 A;  3FRM A;  2G0B A;  3RYO A;  4PSW A;  4R57 A;  1UFH A;  1S60 A;  4MY3 A;  3T9Y A;  4LUA A;  5HH1 A;  3TO6 A;  2B58 A;  3W91 A;  2VEZ A;  5EC4 A;  3VWD A;  3R96 A;  3ZZI A;  1CJW A;  3BLN A;  2F5I A;  3F5B A;  1YVK A;  3FNC A;  4KZT A;  1KZF A;  2D4O A;  2GE3 A;  4NCZ A;  1SQH A;  3FB3 A;  2DXQ A;  2EVN A;  5IB0 A;  2ZW6 A;  1NSL A;  1P4N A;  2Q0Y A;  4KVX A;  2Q7B A;  2R1I A;  3S6F A;  2R98 A;  1M4I A;  4CRY B;  4E0A A;  5F47 A;  4R3L A;  2GIV A;  4F0Y A;  4XNH C;  1PU9 A;  1Z4E A;  4M3S A;  3TCV A;  1MJA A;  2B4D A;  2Q4Y A;  3DNS A;  3P2F A;  5JQ4 A;  5J8F A;  1S7L A;  2PR1 A;  3NE7 A;  3FIX A;  1QSM A;  2Z11 A;  2R7H A;  3T90 A;  2P6F A;  2O28 A;  2HQY A;  3EC4 A;  4QUS A;  4OAE A;  1PUA A;  1IB1 E;  3H4Q A;  2BUE A;  3WR7 A;  4FD4 A;  1RO5 A;  5ISV A;  2X7B A;  4H89 A;  5DWN A;  5DWM A;  4HNY B;  5F49 A;  4FD7 A;  5H86 A;  4R9M A;  1GHE A;  5CNP A;  1V0C A;  3R9G A;  4UA3 A;  4MJ8 A;  4EVY A;  2CY2 A;  1YGH A;  1MJ9 A;  2D4P A;  3TTH A;  4E2A A;  3S6G A;  3DDD A;  3EFA A;  1J4J A;  3JUW A;  4XPK A;  4KOT A;  3VWE A;  4JWP A;  4PK2 A;  4U9Z A;  3MGD A;  4OLL A;  5E96 A;  1OZP A;  1Z4R A;  3IWG A;  4KOS A;  4BMH A;  2PDO A;  3TO7 A;  3TO9 A;  1S5K A;  4UWI A;  1YRE A;  1Y9W A;  3F8K A;  2I00 A;  1IID A;  3R9F A;  4JXQ A;  2FIW A;  4GS4 A;  1VKC A;  4JD6 A;  3S6H A;  3DSB A;  1M44 A;  4II9 A;  2QEC A;  3PZJ A;  4B5P B;  4QBJ A;  4F6A A;  1NE9 A;  4KLW A;  3CXQ A;  2H5M A;  2REE A;  4QB9 A;  4ZBG A;  2NMT A;  2BSW A;  3PGP A;  2BL1 A;  2VZY A;  1I21 A;  2VZZ A;  2ZW4 A;  3KKW A;  1MJB A;  2G3A A;  2B4D B;  3G8W A;  2OZG A;  4PV6 A;  2PC1 A;  4H6U A;  4XPD B;  4J3G A;  3G3S A;  3DR8 A;  4YRH A;  1NMT A;  5J8C A;  4RS2 A;  1I1D A;  2BEI A;  4KOV A;  4YFJ A;  3BJ8 A;  1BO4 A;  1KUX A;  3D2P A;  2Z0Z A;  1M4D A;  4JLY A;  4AG7 A;  2JEV A;  2QIR A;  5GCN A;  4B5P A;  4IUS A;  2B5G A;  2PSW A;  3DR6 A;  3R9E A;  5C82 A;  3TT2 A;  4JXR A;  3FYN A;  2FSR A;  2WPX A;  4CS0 B;  1YVO A;  2C27 A;  4HKF A;  3W6S A;  4QVT A;  2EUI A;  2P0W A;  5KTA A;  2ZXV A;  1MK4 A;  1CM0 A;  4KOY A;  1Y7R A;  4R3K A;  3GKR A;  1YR0 A;  3R1K A;  3TOA A;  2FS5 A;  1Y9K A;  2B3U A;  2CNM A;  4B5O A;  2PRB A;  2CNS A;  1S3Z A;  3BJ7 A;  2FL4 A;  2GAN A;  5C88 A;  2VI7 A;  5HMN A;  2ARH A;  2PR8 A;  4CRZ B;  4X5K A;  2OZU A;  3E0K A;  5EBV A;  4HNX B;  1VHS A;  3D3S A;  4NF1 A;  3C26 A;  3N7Z A;  4RI1 A;  2VXK A;  1YLE A;  1LRZ A;  4E8O A;  5F48 A; 
#chains in the Genus database with same CATH topology
 4MHZ A;  4NGT A;  3PB7 X;  3D7G A;  4QC6 A;  3R95 A;  4CYQ A;  1QSO A;  4A31 A;  4CYN A;  3BXM A;  3NA6 A;  2J8R A;  2JDD A;  2PRQ A;  2F7V A;  1BOB A;  1YX0 A;  3KHZ A;  3LD2 A;  4U5Y A;  3S9N A;  1CPS A;  2DF5 A;  2FE7 A;  2ZPA A;  1U6M A;  4UFX A;  3KZW A;  5G22 A;  1WK4 A;  2IL4 A;  4MRI A;  3ISZ A;  1XEB A;  4HNW B;  1ARL A;  2VQY A;  1QSN A;  1XE4 A;  1I12 A;  1R57 A;  4IF5 A;  2FXF A;  4AVB A;  1Y0Y A;  3LWU A;  3S6K A;  5IX3 A;  2ZOG A;  1ZLI A;  3B3V A;  4P4E A;  1BLL E;  5F09 A;  2CTB A;  2ATR A;  4JJX A;  3FBU A;  2Z10 A;  1F2P A;  2ZW5 A;  1HDQ A;  4U9Y A;  4AVC A;  1IGB A;  3D2M A;  3PBE A;  1VHO A;  4KVO E;  4F0X A;  4MCP A;  1VHE A;  1M4L A;  2WPW A;  4KOX A;  4CAW A;  4BIN A;  4ZY1 A;  4ORF A;  2JEW A;  3SI2 A;  3FEC A;  4KVM E;  2GRE A;  4OC3 A;  4MBU A;  5A28 A;  1FNO A;  6CPA A;  3RO0 A;  3QNV A;  5D29 A;  4K3N A;  2HV2 A;  2RC4 A;  4M85 A;  2EWB A;  3V8I A;  1Q2D A;  3B3T A;  4YU9 A;  2AFU A;  2A4N A;  2NYQ A;  2I79 A;  2OU2 A;  2B5G B;  4MHD A;  4C2Y A;  4IK2 A;  5KTD A;  1IIC A;  2CTC A;  1K4J A;  3CXP A;  2G3T A;  1B87 A;  2VBQ A;  2G9D A;  2RFH A;  1IU8 A;  4Y49 B;  3UY5 A;  2BO9 A;  3D67 A;  3D7D A;  4CGO A;  2QJ8 A;  3B7I A;  1XMB A;  1Y0R A;  3VAR A;  5HXD A;  4B12 A;  1JQG A;  4ZYQ A;  4YGO A;  2B4B A;  5JPH A;  1M4G A;  5LYI A;  5AG7 A;  3S9L A;  2AJ6 A;  3H8E A;  1WWZ A;  2EBJ A;  4NJQ A;  3VAT A;  2OB0 A;  2OZH A;  4I49 A;  3TE4 A;  1XRY A;  2AE6 A;  4W9Y A;  1XOV A;  3K9U A;  4A38 A;  1TKF A;  2EK8 A;  1TIQ A;  2Q44 A;  2PJC A;  2PIZ A;  3DGV A;  5K8O A;  2Y0M A;  1YME A;  3I3G A;  4FWU A;  1B6B A;  1Q2Y A;  3ZJ0 A;  1TKJ A;  1YLO A;  5J1Q A;  4B6Z A;  2R8V A;  2PIY A;  4ZI6 A;  1ELL P;  3D7F A;  3KGQ A;  1DE4 C;  1KUY A;  2F8H A;  2ZW7 A;  4UWJ A;  1X10 A;  4PSX A;  3EY5 A;  4JZ0 A;  4CGL A;  4CPA A;  4EME A;  1QMU A;  1R3N A;  3OWC A;  4A32 A;  2ANP A;  3JTK A;  1OBR A;  4KUB A;  4AB7 A;  2FIA A;  4MHY A;  5KTC A;  4OAD A;  1LFW A;  4NGM A;  4TNU A;  4PPZ A;  5HVG A;  5EBV A;  1LAM A;  2OR4 A;  2C6C A;  2OH1 A;  3H5Z A;  5I4M A;  4CGM A;  4F8Z A;  5THW A;  4KOR A;  4KOW A;  4OKO A;  3FX6 A;  4ZGY B;  1YK3 A;  4FD6 A;  8CPA A;  3SXN A;  1LCP A;  1Q2C A;  4PQA A;  3TFY A;  3FXT A;  3QB8 A;  4PXD A;  4CAE A;  2FCK A;  4P6Y A;  2AFX A;  3FED A;  4KLV A;  1RXT A;  2PJ4 A;  1AYE A;  3SI0 A;  2Q04 A;  3VH9 A;  3GY9 A;  2KCW A;  2JDC A;  2Z3K A;  1M1D A;  4Q7A A;  2V77 A;  2B3V A;  2HUZ A;  2PJ5 A;  2QYV A;  1IYL A;  3CPA A;  3CXS A;  4C7I A;  2ZEG A;  4P45 A;  2JBJ A;  2P6G A;  3KAS A;  1ZG8 A;  2JBK A;  3GYA A;  3HUV A;  3B3C A;  4H6Z A;  4BD9 A;  4NSQ A;  5H84 A;  2VL1 A;  4CAX A;  4LX9 A;  4WJB A;  1FY7 A;  1ARM A;  2FT0 A;  2QML A;  1LAP A;  3D66 A;  2PJ2 A;  3I9S A;  2Q4V A;  4UCP A;  4ZY0 A;  2J8M A;  4DNC A;  3IU1 A;  4K30 A;  3V7Z A;  2PQ8 A;  3F0A A;  1EE3 P;  3QAY A;  4MXU A;  2J8N A;  3V38 A;  1Q7L A;  4ONU A;  4XNH B;  4CAV A;  5LYL A;  4B13 A;  2P6E A;  2C6G A;  4MMO A;  4G1P A;  2K5T A;  3H8G A;  3JRU A;  4NFR A;  5IV0 A;  4KS9 A;  3FVL A;  4RN7 A;  1QST A;  1XF8 A;  4ZY2 A;  3B3S A;  4NXY A;  4AVA A;  3EXN A;  4L8A A;  4MI4 A;  2YNC A;  1XIX A;  4RI1 A;  2Z3O A;  2PE3 A;  1S7N A;  2REF A;  3PP9 A;  5A27 A;  4LQ6 A;  1Z9U A;  4KUA A;  3JVN A;  5AG6 A;  3SHP A;  4CAF A;  3NH5 A;  4Y49 C;  1QSR A;  1IYK A;  2PJA A;  3D8P A;  4CGN A;  3B8G A;  1S7F A;  4PXC A;  1S7K A;  3TC8 A;  5K8M A;  4FAI A;  3NH4 A;  5IB9 A;  3LOD A;  4OP4 A;  3IGR A;  4MFJ A;  4UBR A;  4NEX A;  4XPD C;  5JH9 A;  1HDU A;  1CX8 A;  2CNT A;  2JLM A;  4IAV A;  4KSA A;  1ELM P;  5HVH A;  3W6X A;  1ZLH A;  4C2X A;  4C68 A;  4AG9 A;  3SJX A;  3P2H A;  1AMP A;  3SXO A;  5LRK A;  3EO4 A;  3TOB A;  2RB7 A;  4XPL A;  4JYW A;  1RTQ A;  1L0C A;  1XMT A;  3QAH A;  4KOU A;  4P10 A;  1N71 A;  4NGN A;  3RAM A;  1ZO0 A;  1H8L A;  3N5F A;  3PFO A;  4PK3 A;  3RZA A;  1Z8W A;  1Z2L A;  2HB6 A;  3CT9 A;  4M6I A;  4OME A;  2QVP A;  4MY0 A;  2Q7S A;  3IEH A;  1ON0 A;  1P0H A;  3PB4 X;  4EWT A;  1CP6 A;  3BI0 A;  4L89 A;  4C2Z A;  1TKH A;  3KR4 A;  1YW4 A;  5FVJ A;  5F46 A;  5CBM A;  4MFZ A;  5I0C A;  5K8N A;  3SJE A;  2NSM A;  1KUV A;  4R87 A;  4KSI A;  2DPT A;  2V8H A;  2YNE A;  3FRM A;  4FD5 A;  1ZG7 A;  2G0B A;  1VGY A;  3RYO A;  4PSW A;  1ZG9 A;  1UFH A;  1A2Z A;  4R57 A;  1S60 A;  4MY3 A;  2YGW A;  4UCM A;  3T9Y A;  5K8P A;  1YSJ A;  2PJ7 A;  2WZN A;  3L2N A;  4LUA A;  5HH1 A;  3TO6 A;  1Z5R A;  2B58 A;  3W91 A;  4B14 A;  2VEZ A;  4UEE A;  5EC4 A;  1KWM A;  3VWD A;  4A39 A;  3FMC A;  3R96 A;  3PB6 X;  4B10 A;  4Q36 A;  3ZZI A;  2POK A;  4UFV A;  3KHX A;  2AFO A;  3GB0 A;  3K2K A;  1CJW A;  3BLN A;  3MN8 A;  2F5I A;  3F5B A;  4R76 A;  4PXB A;  1YVK A;  2ZEM A;  1BAV A;  3BI1 A;  2CIJ A;  2ABZ A;  3GUX A;  1R43 A;  2DEA A;  2GLF A;  3FNC A;  4KZT A;  4A94 A;  3NE8 A;  1KZF A;  1XJO A;  3MRU A;  4P4I A;  4FBE A;  2D4O A;  2AFW A;  1CG2 A;  3IIB A;  4KSF A;  1Z8T A;  4OC4 A;  2GE3 A;  4NCZ A;  1SQH A;  2Z3N A;  4YWY A;  2GU2 A;  3FB3 A;  5JM6 A;  4UCN A;  2DXQ A;  2EVN A;  1CPX A;  5IB0 A;  2ZW6 A;  3D4U A;  4UFW A;  2CF4 A;  1HEE A;  1NSL A;  5D8N A;  2EK9 A;  2PJ1 A;  4P4F A;  1P4N A;  1Z8X A;  2Q0Y A;  2WUU A;  4KVX A;  4MCR A;  2Q7B A;  5JGF A;  2PJ9 A;  2AFS A;  2R1I A;  2R98 A;  3S6F A;  5AG4 A;  1IOI A;  4ZX8 A;  1QQ9 A;  4R7M A;  5LRG A;  1M4I A;  3NH8 A;  2DPS A;  4CRY B;  4E0A A;  5F47 A;  4R3L A;  4X2T A;  2GIV A;  4F0Y A;  5ELY A;  4XNH C;  4AXV A;  2Q51 A;  1PU9 A;  1Z4E A;  4X8I A;  4M3S A;  3WC5 A;  4X3R A;  2ODF A;  2HC9 A;  4Q38 A;  3IJ3 A;  3TCV A;  1MJA A;  2ZEP A;  2B4D A;  3WC7 A;  2Q4Y A;  4DJL A;  3DNS A;  4MFQ A;  2CXA A;  4NGS A;  3P2F A;  5JQ4 A;  5J8F A;  1S7L A;  2Q43 A;  2PR1 A;  4FUU A;  3NE7 A;  3IO1 A;  2ZEH A;  5LYD A;  3FIX A;  2Z3L A;  4DYO A;  4TWE A;  1QSM A;  2Z11 A;  2C6P A;  4UEF A;  4Z65 A;  2FVG A;  2R7H A;  2V8G A;  2IJZ A;  3T90 A;  2P6F A;  2O28 A;  2HQY A;  2EO8 A;  3EC4 A;  4GXH A;  4QUS A;  3KI9 A;  5HVF A;  4OAE A;  1PUA A;  1IB1 E;  4MHP A;  3H4Q A;  4A33 A;  2BUE A;  5EMI A;  2AFM A;  3B3W A;  4FD4 A;  4M6G A;  3WR7 A;  4CYO A;  1BPM A;  1RO5 A;  4P4J A;  5ISV A;  2X7B A;  4MFK A;  2WSA A;  1CP7 A;  4H89 A;  2PCU A;  4CGP A;  5DWN A;  2ZEN A;  5DWM A;  4HNY B;  5F49 A;  4NGR A;  3PBB A;  4FD7 A;  5H86 A;  2YND A;  2ZEL A;  1GHE A;  4R9M A;  5G21 A;  3FJU A;  5CNP A;  1V0C A;  3R9G A;  4UA3 A;  2BOA A;  4MJ8 A;  1F2O A;  3KQZ A;  4EVY A;  4H2K A;  4LQG A;  2XEF A;  2CY2 A;  5G20 A;  1NSA A;  2ZEF A;  1PYT B;  1YGH A;  3IC1 A;  1MJ9 A;  2D4P A;  3TTH A;  4F9V A;  4E2A A;  4BBH A;  3S6G A;  3DDD A;  3EFA A;  1J4J A;  3JUW A;  4XPK A;  3PB8 X;  4KOT A;  3VWE A;  4JWP A;  4PK2 A;  4U9Z A;  3DLJ A;  4OC5 A;  2PJB A;  3MGD A;  2XEI A;  3WT4 A;  4OLL A;  5E96 A;  3ISX A;  1OZP A;  1Z4R A;  2J9A A;  4M6H A;  4ZX9 A;  7CPA A;  2XEJ A;  2V8V A;  3IWG A;  2PJ0 A;  3SI1 A;  3A9L A;  4OC2 A;  4DUK A;  1YQE A;  4KOS A;  1BPN A;  4HPS A;  4BMH A;  4A37 A;  2GLJ A;  2PDO A;  3TO7 A;  3TO9 A;  1S5K A;  4UWI A;  5DS0 A;  1YRE A;  1Y9W A;  3I1U A;  5G1Z A;  5CPA A;  3F8K A;  4A30 A;  2I00 A;  1IID A;  3R9F A;  4JXQ A;  3LAC A;  4MHN A;  3GLJ A;  4RUH A;  2FIW A;  1LAN A;  3FH4 A;  3PRT A;  4GS4 A;  1VKC A;  2AFZ A;  4A95 A;  1Y7E A;  4JD6 A;  3S6H A;  3DSB A;  4UIB A;  2ZEE A;  4A2Z A;  3PEI A;  3K9T A;  3SJG A;  2O53 A;  3RNZ A;  1M44 A;  4O23 A;  3KR5 A;  5BWA B;  5LYF A;  4II9 A;  3BHX A;  4UEZ A;  2GFQ A;  2QEC A;  3PZJ A;  4GM5 A;  4B5P B;  2PJ3 A;  3IWE A;  4F6A A;  4QBJ A;  1NE9 A;  4KLW A;  3CXQ A;  1TF8 A;  2H5M A;  2REE A;  4QB9 A;  4ZBG A;  2NMT A;  2BSW A;  3NFZ A;  1FT7 A;  4MCQ A;  3PGP A;  2Q4Z A;  3B2Y A;  3S9M A;  2BL1 A;  2VZY A;  1I21 A;  2VZZ A;  2ZW4 A;  3KKW A;  1MJB A;  1Z8L A;  2G3A A;  2B4D B;  3G8W A;  2OZG A;  4PV6 A;  2C1C A;  2PVV A;  2PC1 A;  2XEG A;  4H6U A;  4B11 A;  4XPD B;  2IMO A;  3WAB A;  2YNC C;  4J3G A;  5LRJ A;  3G3S A;  1TF9 A;  1XFO A;  3DR8 A;  3SJF A;  4YRH A;  1NMT A;  4CYP A;  2OOT A;  3PFE A;  3TX8 A;  5J8C A;  4RS2 A;  1I1D A;  3WC6 A;  4IHM A;  2BEI A;  4KOV A;  5AGE A;  1UWY A;  3BJ8 A;  1BO4 A;  4OIW A;  4YFJ A;  1KUX A;  3D2P A;  2PJ8 A;  3IFE A;  3GIU A;  4OID A;  1CBX A;  1LOK A;  2Z0Z A;  3D68 A;  1PCA A;  3CPX A;  3H8F A;  4NJR A;  1M4D A;  4F9U A;  4JLY A;  4AG7 A;  2JEV A;  1IY7 A;  2QIR A;  5GCN A;  4B5P A;  2ZEO A;  4IUS A;  2B5G A;  2PSW A;  2ZOF A;  3DR6 A;  3R9E A;  5C82 A;  3TT2 A;  4JXR A;  1F57 A;  3FYN A;  2FSR A;  3IU2 A;  4ONW A;  2WPX A;  1GYT A;  4CS0 B;  4NGP A;  2WYR A;  2V8D A;  1YVO A;  1YW6 A;  3LMS A;  2Z3P A;  1TXR A;  1IOF A;  1AUG A;  3IWW A;  4P4D A;  3CDX A;  2C27 A;  4HKF A;  4P44 A;  3W6S A;  4MCS A;  4QVT A;  1JWQ A;  2I3C A;  2ZED A;  1X12 A;  2EUI A;  2P0W A;  5KTA A;  2Z3M A;  4WWV A;  2ZXV A;  1MK4 A;  1CM0 A;  2BCO A;  3HLP A;  4KOY A;  1Y7R A;  4R3K A;  3GKR A;  1YR0 A;  4MFL A;  3R1K A;  3TOA A;  4R8F A;  3B35 A;  2FS5 A;  4NGQ A;  2O4H A;  1Y9K A;  3CZX A;  4OC1 A;  4R6T A;  3D7H A;  4EFD A;  2B3U A;  2CNM A;  4B5O A;  2IQ6 A;  2PRB A;  2CNS A;  4P4B A;  1S3Z A;  3KL9 A;  1XBU A;  3T8W A;  3KQX A;  3BJ7 A;  2FL4 A;  2GAN A;  5C88 A;  2VI7 A;  4OC0 A;  2ARH A;  4UF4 A;  5HMN A;  2PR8 A;  3PB9 X;  3RBU A;  4CRZ B;  4MFP A;  4X5K A;  2OZU A;  3E0K A;  4PXE A;  3FEE A;  4HNX B;  1VHS A;  3D3S A;  4NF1 A;  4UIA A;  5AG5 A;  3C26 A;  3N7Z A;  3FF3 A;  4C7H A;  1VIX A;  2PVW A;  2PJ6 A;  2VXK A;  1YLE A;  1LRZ A;  4E8O A;  5F48 A;  1DTD A; 
#chains in the Genus database with same CATH homology
 4QC6 A;  3R95 A;  4CYQ A;  1QSO A;  4A31 A;  4CYN A;  2J8R A;  2JDD A;  1BOB A;  1YX0 A;  3LD2 A;  4U5Y A;  2FE7 A;  4UFX A;  2ZPA A;  1U6M A;  5G22 A;  1WK4 A;  2IL4 A;  1XEB A;  4HNW B;  2VQY A;  1QSN A;  1XE4 A;  1I12 A;  1R57 A;  4IF5 A;  2FXF A;  4AVB A;  3S6K A;  5IX3 A;  2ATR A;  4JJX A;  3FBU A;  2Z10 A;  2ZW5 A;  4U9Y A;  4AVC A;  3D2M A;  4KVO E;  4F0X A;  2WPW A;  4KOX A;  4CAW A;  4ORF A;  4KVM E;  4MBU A;  5A28 A;  2HV2 A;  2RC4 A;  4M85 A;  3V8I A;  1Q2D A;  2A4N A;  2I79 A;  2OU2 A;  2B5G B;  4MHD A;  4C2Y A;  5KTD A;  1IIC A;  1K4J A;  3CXP A;  2G3T A;  1B87 A;  2VBQ A;  4Y49 B;  3UY5 A;  4CGO A;  4B12 A;  4YGO A;  2B4B A;  5JPH A;  1M4G A;  5AG7 A;  2AJ6 A;  1WWZ A;  2OB0 A;  2OZH A;  4I49 A;  3TE4 A;  2AE6 A;  3K9U A;  1TIQ A;  2Q44 A;  2Y0M A;  3I3G A;  1B6B A;  1Q2Y A;  3ZJ0 A;  2R8V A;  1KUY A;  2ZW7 A;  4UWJ A;  4PSX A;  3EY5 A;  4CGL A;  3OWC A;  4A32 A;  4KUB A;  3JTK A;  4AB7 A;  2FIA A;  5KTC A;  4OAD A;  2OH1 A;  3H5Z A;  4CGM A;  4KOR A;  4KOW A;  4ZGY B;  1YK3 A;  4FD6 A;  3SXN A;  1Q2C A;  3TFY A;  3FXT A;  3QB8 A;  4CAE A;  2FCK A;  4KLV A;  1RXT A;  2Q04 A;  3GY9 A;  2KCW A;  2JDC A;  2Z3K A;  1M1D A;  2B3V A;  2HUZ A;  3CXS A;  1IYL A;  4C7I A;  2P6G A;  3GYA A;  4H6Z A;  4NSQ A;  5H84 A;  4CAX A;  4LX9 A;  1FY7 A;  2FT0 A;  2QML A;  4UCP A;  3I9S A;  2Q4V A;  2J8M A;  4DNC A;  3IU1 A;  4K30 A;  2PQ8 A;  3F0A A;  2J8N A;  4ONU A;  4XNH B;  4CAV A;  4B13 A;  2P6E A;  2K5T A;  5IV0 A;  4KS9 A;  1QST A;  1XF8 A;  4NXY A;  4AVA A;  3EXN A;  4L8A A;  4MI4 A;  2YNC A;  1XIX A;  2Z3O A;  2REF A;  1S7N A;  3PP9 A;  5A27 A;  1Z9U A;  4KUA A;  3JVN A;  5AG6 A;  3SHP A;  4CAF A;  4Y49 C;  1QSR A;  1IYK A;  3D8P A;  4CGN A;  3B8G A;  1S7F A;  1S7K A;  3LOD A;  3IGR A;  4MFJ A;  4UBR A;  4NEX A;  4XPD C;  2CNT A;  2JLM A;  4KSA A;  3W6X A;  4C2X A;  4C68 A;  4AG9 A;  3P2H A;  3SXO A;  3EO4 A;  3TOB A;  4XPL A;  1L0C A;  1XMT A;  3QAH A;  4KOU A;  1N71 A;  1ZO0 A;  4PK3 A;  4MY0 A;  1ON0 A;  1P0H A;  4L89 A;  4C2Z A;  5FVJ A;  5F46 A;  4MFZ A;  5I0C A;  1KUV A;  4R87 A;  2DPT A;  2YNE A;  4FD5 A;  3FRM A;  2G0B A;  3RYO A;  4PSW A;  4R57 A;  1UFH A;  4UCM A;  1S60 A;  4MY3 A;  2YGW A;  3T9Y A;  4LUA A;  5HH1 A;  3TO6 A;  4B14 A;  2B58 A;  3W91 A;  2VEZ A;  5EC4 A;  3VWD A;  3R96 A;  4B10 A;  4Q36 A;  3ZZI A;  4UFV A;  1CJW A;  3BLN A;  2F5I A;  3F5B A;  1YVK A;  3FNC A;  4KZT A;  1KZF A;  2D4O A;  4KSF A;  2GE3 A;  4NCZ A;  1SQH A;  2Z3N A;  3FB3 A;  4UCN A;  2DXQ A;  2EVN A;  5IB0 A;  2ZW6 A;  4UFW A;  1NSL A;  1P4N A;  2WUU A;  2Q0Y A;  4KVX A;  2Q7B A;  2R1I A;  3S6F A;  2R98 A;  5AG4 A;  1M4I A;  2DPS A;  4CRY B;  4E0A A;  5F47 A;  4R3L A;  2GIV A;  4F0Y A;  4XNH C;  1PU9 A;  1Z4E A;  4M3S A;  4Q38 A;  3TCV A;  1MJA A;  2B4D A;  2Q4Y A;  3DNS A;  4MFQ A;  2CXA A;  3P2F A;  5JQ4 A;  5J8F A;  1S7L A;  2PR1 A;  3NE7 A;  3FIX A;  2Z3L A;  1QSM A;  2Z11 A;  2R7H A;  3T90 A;  2P6F A;  2O28 A;  2HQY A;  3EC4 A;  4QUS A;  4OAE A;  1PUA A;  1IB1 E;  3H4Q A;  4A33 A;  2BUE A;  3WR7 A;  4FD4 A;  4CYO A;  1RO5 A;  5ISV A;  2X7B A;  4MFK A;  2WSA A;  4H89 A;  4CGP A;  5DWN A;  5DWM A;  4HNY B;  5F49 A;  4FD7 A;  5H86 A;  2YND A;  4R9M A;  1GHE A;  5G21 A;  5CNP A;  1V0C A;  3R9G A;  4UA3 A;  4MJ8 A;  4EVY A;  2CY2 A;  5G20 A;  1YGH A;  1MJ9 A;  2D4P A;  3TTH A;  4E2A A;  4BBH A;  3S6G A;  3DDD A;  3EFA A;  1J4J A;  3JUW A;  4XPK A;  4KOT A;  3VWE A;  4JWP A;  4PK2 A;  4U9Z A;  3MGD A;  4OLL A;  5E96 A;  1OZP A;  1Z4R A;  3IWG A;  3A9L A;  4KOS A;  4BMH A;  2PDO A;  3TO7 A;  3TO9 A;  1S5K A;  4UWI A;  1YRE A;  1Y9W A;  5G1Z A;  3F8K A;  4A30 A;  2I00 A;  1IID A;  3R9F A;  4JXQ A;  2FIW A;  4GS4 A;  1VKC A;  4A95 A;  4JD6 A;  3S6H A;  3DSB A;  4A2Z A;  1M44 A;  5BWA B;  4II9 A;  2QEC A;  3PZJ A;  4B5P B;  3IWE A;  4F6A A;  4QBJ A;  1NE9 A;  4KLW A;  3CXQ A;  2H5M A;  2REE A;  4QB9 A;  4ZBG A;  2NMT A;  2BSW A;  3PGP A;  2BL1 A;  2VZY A;  1I21 A;  2VZZ A;  2ZW4 A;  3KKW A;  1MJB A;  2G3A A;  2B4D B;  3G8W A;  2OZG A;  4PV6 A;  4B11 A;  2PC1 A;  4H6U A;  4XPD B;  2YNC C;  4J3G A;  3G3S A;  3DR8 A;  4YRH A;  1NMT A;  4CYP A;  5J8C A;  4RS2 A;  1I1D A;  2BEI A;  4KOV A;  5AGE A;  4YFJ A;  3BJ8 A;  1BO4 A;  1KUX A;  3D2P A;  2Z0Z A;  1M4D A;  4JLY A;  4AG7 A;  2JEV A;  2QIR A;  5GCN A;  4B5P A;  4IUS A;  2B5G A;  2PSW A;  3DR6 A;  3R9E A;  5C82 A;  3TT2 A;  4JXR A;  3FYN A;  2FSR A;  3IU2 A;  2WPX A;  4CS0 B;  1YVO A;  2Z3P A;  2C27 A;  4HKF A;  3W6S A;  4QVT A;  2EUI A;  2P0W A;  5KTA A;  2Z3M A;  2ZXV A;  1MK4 A;  1CM0 A;  4KOY A;  1Y7R A;  4R3K A;  3GKR A;  1YR0 A;  4MFL A;  3R1K A;  3TOA A;  2FS5 A;  1Y9K A;  2B3U A;  2CNM A;  4B5O A;  2PRB A;  2CNS A;  1S3Z A;  3BJ7 A;  2FL4 A;  2GAN A;  5C88 A;  2VI7 A;  5HMN A;  2ARH A;  2PR8 A;  4CRZ B;  4MFP A;  4X5K A;  2OZU A;  3E0K A;  5AG5 A;  4HNX B;  5EBV A;  1VHS A;  3D3S A;  4NF1 A;  4C7H A;  3C26 A;  3N7Z A;  4RI1 A;  2VXK A;  1YLE A;  1LRZ A;  4E8O A;  5F48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...