2J8NA

Structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
SIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title l-Methionine sulfoximine, but not phosphinothricin, is a substrate for an acetyltransferase (gene PA4866) from Pseudomonas aeruginosa: structural and functional studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
total genus 49
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8nA00
3DDDA 4UBRA 1PUAA 2J8RA 1Q2DA 3H4QA 5JQ4A 4B5OA 1NSLA 2PR1A 5F47A 4HNYB 3FRMA 4AB7A 2CNSA 4AG7A 1Z9UA 3DR6A 3DSBA 5IV0A 4XPDB 2PDOA 4R87A 4H6UA 2VQYA 3TOBA 1QSMA 3R9FA 4OAEA 2REFA 1S7KA 3SXOA 5IB0A 2K5TA 4CRYB 3I3GA 1OZPA 3G8WA 2FSRA 3GKRA 4U9ZA 2B5GA 5F49A 2HQYA 2R98A 2G3TA 2FL4A 3UY5A 4RI1A 1MJBA 1L0CA 2PC1A 4KVOE 4R57A 4XPLA 4H89A 2FIAA 4ZBGA 1YVOA 4KOVA 4FD7A 1R57A 3OWCA 3RYOA 2KCWA 3I9SA 3F8KA 4R3KA 2OB0A 1XF8A 3GYAA 4KUAA 1KUXA 1KUVA 1CJWA 2OU2A 4KOUA 4QVTA 1N71A 3TCVA 3T9YA 4KORA 3K9UA 4NCZA 2Q44A 1K4JA 2PSWA 4AVCA 4NEXA 1LRZA 2Z10A 4CAXA 2R8VA 2VXKA 4OLLA 3BLNA 2ARHA 1MJ9A 2JDCA 5DWNA 4U5YA 4KLWA 5E96A 2PQ8A 2B4BA 3N7ZA 1MK4A 2J8MA 3EC4A 1M4IA 1VKCA 4UWJA 4HKFA 4NF1A 3MGDA 1ON0A 2P0WA 4L89A 2R1IA 3S6FA 4U9YA 2ZPAA 1J4JA 2B3UA 1SQHA 2NMTA 2Q0YA 2B4DA 2QECA 3G3SA 2PRBA 4RS2A 2C27A 4B5PB 2OH1A 1KZFA 4KOTA 1XEBA 2D4OA 3P2FA 4J3GA 1M44A 4AVBA 5JPHA 1M1DA 1Z4EA 2CNTA 1CM0A 4JD6A 1UFHA 3R95A 3ZZIA 1QSOA 3VWDA 4QUSA 3R96A 3VWEA 2Z11A 1NMTA 4AVAA 2ATRA 2JDDA 2JLMA 4KOXA 4ORFA 3TO9A 4Y49B 2REEA 4PK3A 4YRHA 3S6GA 3DNSA 4KVXA 5CNPA 4KVME 2ZW5A 1XE4A 4HNWB 3EFAA 4JWPA 2Y0MA 1IICA 2WPWA 4EVYA 3TOAA 5KTCA 4MHDA 4LUAA 1MJAA 1IYLA 1S5KA 4MI4A 1Y9WA 3IGRA 1YVKA 4JLYA 1S3ZA 5KTDA 3B8GA 4PSXA 4R9MA 2HUZA 3FB3A 1YK3A 4NXYA 2Z0ZA 2P6GA 4B5PA 2FS5A 1U6MA 1P0HA 3D8PA 4PV6A 4DNCA 2OZUA 2VBQA 2O28A 4CRZB 1KUYA 4KOSA 5H84A 1V0CA 3D2PA 2G3AA 3W6XA 2JEVA 5KTAA 1I21A 1WK4A 4AG9A 1M4DA 1TIQA 1WWZA 2RC4A 4KZTA 3SHPA 2AJ6A 3R9EA 4QBJA 4YGOA 2PR8A 3BJ8A 3TO7A 2AE6A 4IF5A 3D3SA 1B6BA 4CS0B 2FCKA 1YLEA 3TE4A 1I12A 4OADA 3EY5A 4R3LA 2IL4A 4IUSA 2Q7BA 2QMLA 4QB9A 4XPKA 4II9A 1YR0A 3EXNA 5HMNA 4HNXB 4F0YA 4MBUA 2Q04A 1BOBA 5J8CA 3E0KA 2P6EA 3LODA 1B87A 2B4DB 1M4GA 2FT0A 3S6HA 2VI7A 3NE7A 3F5BA 3V8IA 4BMHA 3FXTA 1NE9A 5ISVA 2DXQA 2CNMA 2HV2A 5I0CA 1XIXA 2GANA 1YREA 4CAWA 1YGHA 2FE7A 3BJ7A 4K30A 3P2HA 2WPXA 1S60A 5EC4A 3R1KA 3W6SA 3SXNA 1Y7RA 2ZXVA 4PK2A 1S7LA 4FD5A 4LX9A 5C82A 3TTHA 3QB8A 3CXSA 2P6FA 4KOWA 1RO5A 4XPDC 5H86A 4Y49C 2BSWA 4KUBA 2VEZA 2B58A 3C26A 2OZGA 2D4PA 5F46A 3LD2A 3FBUA 4UA3A 1IB1E 1FY7A 2GE3A 2H5MA 4MY3A 3QAHA 2QIRA 3FYNA 4NSQA 4JXQA 2BL1A 3FIXA 1I1DA 4UWIA 3R9GA 2J8NA 3TFYA 1GHEA 5DWMA 4YFJA 3D2MA 1QSRA 4MY0A 2ZW6A 4E0AA 2R7HA 3FNCA 3EO4A 1RXTA 1BO4A 1Y9KA 4ONUA 2X7BA 5GCNA 1Q2CA 4PSWA 2GIVA 2BEIA 5EBVA 3KKWA 1XMTA 1IYKA 1YX0A 2CY2A 4X5KA 1S7FA 2F5IA 4FD6A 4L8AA 4XNHB 4GS4A 3GY9A 3PGPA 3F0AA 2A4NA 2FIWA 2Q4YA 3TO6A 2OZHA 3TT2A 1Q2YA 2EUIA 3JVNA 2Q4VA 4QC6A 3WR7A 3ZJ0A 2B3VA 4JXRA 4JJXA 3PZJA 3T90A 4KOYA 5C88A 4M85A 1QSNA 3DR8A 5J8FA 4F6AA 1P4NA 4E8OA 3S6KA 1VHSA 1Z4RA 2I79A 4H6ZA 2G0BA 4FD4A 2VZYA 5HH1A 5IX3A 3PP9A 1IIDA 2FXFA 1QSTA 4MJ8A 2ZW7A 5FVJA 4E2AA 2BUEA 3IWGA 2I00A 1PU9A 5F48A 4XNHC 3W91A 2VZZA 1S7NA 3CXPA 2EVNA 4I49A 4CAVA 2B5GB 4M3SA 3JUWA 4KLVA 2ZW4A 3CXQA
chains in the Genus database with same CATH superfamily
3DDDA 1YQEA 4UBRA 1LOKA 3QNVA 1YLOA 1PUAA 1PCAA 3D4UA 3FJUA 2J8RA 1Q2DA 3H4QA 5JQ4A 4B5OA 1NSLA 2PR1A 3FEEA 3SJEA 5F47A 1TXRA 2JEWA 3RO0A 4HNYB 2AFSA 5CPAA 3FRMA 4AB7A 2CNSA 1FT7A 4AG7A 1Z9UA 2O4HA 4OC4A 1YW4A 3DR6A 1HEEA 3DSBA 4K3NA 5IV0A 4XPDB 2NYQA 2PDOA 2ZEOA 3GUXA 4NGQA 4H6UA 4NGPA 3B3WA 4R87A 2VQYA 1XOVA 3TOBA 4FWUA 2AFMA 3CT9A 5JM6A 1QSMA 3R9FA 5K8OA 4CYQA 3IU2A 4OAEA 5LYFA 2FVGA 2REFA 1S7KA 3SXOA 5IB0A 2K5TA 4CRYB 2PJ4A 3I3GA 1OZPA 4NGSA 3G8WA 2FSRA 3GKRA 5K8NA 4R8FA 1IOIA 4KSAA 4U9ZA 5G22A 3NE8A 5LRJA 2Z3MA 4Q36A 2B5GA 5F49A 2HQYA 2R98A 4ZY2A 4CGOA 2G3TA 2FL4A 4Q7AA 3UY5A 4MFZA 4RI1A 4CPAA 1MJBA 1L0CA 1VGYA 2PC1A 3B3SA 4KVOE 4R57A 4XPLA 4H89A 4ONWA 3N5FA 1OBRA 3LACA 2XEIA 2FIAA 4UIBA 2WUUA 2YNCC 3SJFA 4ZBGA 1LAMA 1YVOA 4R76A 4P4EA 3FEDA 3SJXA 4KOVA 4FD7A 3CDXA 3SI0A 2PJ7A 3SI1A 1R57A 2PJ0A 2ZEGA 4W9YA 1R3NA 3OWCA 4ZYQA 4EFDA 4B10A 5IB9A 3GIUA 1IU8A 3RYOA 2KCWA 2ZOGA 3I9SA 3F8KA 4R3KA 2OB0A 1XF8A 3V7ZA 3GYAA 4KUAA 1CJWA 1KUXA 1KUVA 4M6HA 2ABZA 3GB0A 1ELMP 5EMIA 3IEHA 2OU2A 4KOUA 4QVTA 1N71A 4OC1A 3TCVA 3T9YA 4KORA 4B14A 4ZX9A 1CG2A 3K9UA 4NCZA 1ZG7A 1Z2LA 2Q44A 1K4JA 1F57A 3D7HA 2VL1A 2PSWA 4AVCA 4NEXA 1CPXA 1LRZA 4RN7A 4M6GA 2ZEDA 1YW6A 2Z10A 1TF9A 4CAXA 4P10A 1TKJA 2QVPA 5D8NA 1JWQA 2R8VA 2PJCA 2VXKA 1QQ9A 1AYEA 3BLNA 2ARHA 4OLLA 4C2YA 1MJ9A 3WC7A 2C6GA 5LYLA 1LANA 4OKOA 3DGVA 2JDCA 4KSIA 5DWNA 4U5YA 2PJ9A 4KLWA 5E96A 2PQ8A 3K2KA 3VH9A 2B4BA 4P4IA 3N7ZA 3NA6A 4B13A 1MK4A 2J8MA 3EC4A 2GREA 2C6CA 1M4IA 3DLJA 5THWA 1VKCA 3S9MA 1Z8XA 3KR4A 4UWJA 1AMPA 3PEIA 4HKFA 4NF1A 3MGDA 3PB6X 1ON0A 2P0WA 1ARMA 4MHNA 4BD9A 4L89A 2R1IA 3S6FA 1VHOA 4U9YA 3BI1A 3H5ZA 3KHZA 2Q43A 4KSFA 2ZPAA 2PCUA 4OIDA 1J4JA 2DPTA 2B3UA 2HC9A 1SQHA 4A30A 2PJAA 2NMTA 2Q0YA 3K9TA 2B4DA 2QECA 3G3SA 2PRBA 5JH9A 4RS2A 2C27A 4HPSA 4OC3A 1CPSA 4B5PB 2OH1A 2Q7SA 1KZFA 4C2ZA 4KOTA 1XEBA 2D4OA 1QMUA 3P2FA 3I1UA 4NGNA 2XEJA 4X8IA 4J3GA 3CZXA 1M44A 4CYPA 2GU2A 3IO1A 3B3CA 4B11A 4AVBA 4B6ZA 5JPHA 1M1DA 2AFZA 4F9UA 1TKFA 1Z4EA 3JRUA 5ELYA 4FUUA 2CNTA 4YU9A 3TC8A 1CM0A 4JD6A 1UFHA 2ZEPA 3R95A 3ZZIA 5BWAB 4IAVA 2CXAA 1CBXA 1QSOA 2Z3OA 4WWVA 2HB6A 1XRYA 3IWEA 3VWDA 4MHPA 4QUSA 3HUVA 3R96A 2CTBA 3VWEA 2Z11A 3MN8A 1NMTA 4Z65A 1UWYA 1YSJA 2PVVA 2ZELA 3PBBA 2V8GA 4AVAA 4O23A 4DYOA 4OMEA 2ATRA 2JDDA 2JLMA 2J9AA 4KOXA 3NH5A 4MFLA 2RB7A 3PFOA 4ORFA 3TO9A 3PB9X 4PPZA 3S9NA 4Y49B 1XBUA 4F0XA 2REEA 3GLJA 4PK3A 4KS9A 4YRHA 5AG7A 5K8MA 3S6GA 1NSAA 4CGPA 3DNSA 4KVXA 5CNPA 4UEEA 4KVME 2XEFA 2ZW5A 1XE4A 1IY7A 2V8HA 4HNWB 3EFAA 4UFWA 5HVHA 2EBJA 4JWPA 3B35A 2Y0MA 4P4DA 1CP6A 1IICA 3SJGA 3PB4X 3BXMA 2WPWA 4EVYA 4EWTA 4MRIA 3TOAA 4A37A 3WC6A 1PYTB 4MCPA 5KTCA 4MHDA 4LUAA 1ZG8A 5HXDA 3FX6A 4CGNA 4UCMA 1RTQA 2OOTA 1MJAA 2OR4A 4P4JA 1IYLA 1S5KA 3FVLA 4MI4A 1Y9WA 1DTDA 4H2KA 3IGRA 4PXCA 4M6IA 2RFHA 4G1PA 3B3TA 1YVKA 3T8WA 3B2YA 3WC5A 4TNUA 4JLYA 1S3ZA 2AFUA 2PRQA 5KTDA 3B8GA 4PSXA 4R9MA 5LRKA 2HUZA 4BBHA 2PJ6A 3FB3A 3IC1A 4NJRA 3NH8A 1F2PA 4CYOA 1YK3A 4MHYA 5AG6A 3B7IA 3HLPA 4NXYA 2Z0ZA 4NJQA 4UIAA 3PBEA 1X12A 1ARLA 1Y7EA 1FNOA 3RNZA 2P6GA 1VIXA 4P6YA 4B5PA 2FS5A 1U6MA 2YNEA 2AFWA 4UEFA 4MMOA 3D66A 1P0HA 4NFRA 2ZEHA 4NGRA 3D8PA 1F2OA 2ZEMA 3PRTA 4MFQA 4CAEA 2QYVA 2EK8A 4PV6A 4DNCA 2G9DA 2OZUA 1CP7A 1HDQA 4OP4A 3H8FA 2VBQA 2O28A 3KZWA 4P45A 5A27A 4CRZB 1KUYA 4KOSA 2I3CA 4ZX8A 8CPAA 1TKHA 2ZEEA 4MFJA 4C68A 5H84A 4JYWA 1V0CA 3B3VA 2O53A 2G3AA 3D2PA 3W6XA 4FBEA 2PVWA 4F9VA 2JEVA 6CPAA 5KTAA 1I21A 3NH4A 3KQZA 1WK4A 3PFEA 4MCQA 5LYDA 4AG9A 1M4DA 1TIQA 1WWZA 2RC4A 4KZTA 3SHPA 4P4BA 3VARA 4OC2A 2Z3PA 2AJ6A 3R9EA 4QBJA 2CIJA 4GM5A 4C7IA 2PJ5A 4CAFA 4ZGYB 5AGEA 4YGOA 2PR8A 3BJ8A 4PXEA 3TO7A 3KI9A 4MCRA 2YNCA 4TWEA 4PXBA 2AE6A 2DPSA 3RZAA 4IF5A 3D3SA 1B6BA 1X10A 4CS0B 2PJ8A 2PJ1A 2FCKA 1YLEA 3TE4A 1I12A 4DUKA 4OADA 1TF8A 3EY5A 4R3LA 2IL4A 3RAMA 2BO9A 1BLLE 4IUSA 2Q7BA 2NSMA 4P44A 3PB8X 5AG4A 2QMLA 1LAPA 3QAYA 4QB9A 4XPKA 4A33A 1KWMA 1YR0A 7CPAA 4II9A 2XEGA 4MFPA 2V8DA 3EXNA 1YMEA 5HMNA 4HNXB 4F0YA 3A9LA 3ISZA 2Q04A 4MBUA 1BOBA 5J8CA 2EWBA 2ZOFA 3E0KA 2P6EA 2JBJA 1JQGA 2Q4ZA 3KGQA 2PJBA 3LODA 4GXHA 1LCPA 1B87A 3D7FA 2B4DB 4P4FA 4CGLA 4RUHA 1M4GA 2AFXA 3CPAA 2AFOA 2FT0A 3S6HA 4C7HA 2VI7A 3FECA 3H8GA 4AXVA 5CBMA 1ELLP 1HDUA 3D7DA 3NE7A 3NFZA 3F5BA 2BCOA 3V8IA 2DEAA 2POKA 3WABA 4BMHA 3FXTA 1NE9A 3PB7X 5ISVA 3D67A 2EK9A 2DXQA 1XFOA 5I4MA 1A2ZA 2CNMA 3FMCA 2HV2A 5I0CA 1XIXA 2GANA 3S9LA 1Z5RA 1YREA 2PIZA 1YGHA 2FE7A 4X2TA 4BINA 4CAWA 1IOFA 4UF4A 3BJ7A 4K30A 1Z8WA 3P2HA 2WPXA 1S60A 5EC4A 4F8ZA 3R1KA 3W6SA 3SXNA 1GYTA 1ZLHA 1Y7RA 2ZXVA 4PK2A 3BHXA 1S7LA 4C2XA 4FD5A 4LX9A 3FF3A 5C82A 3TTHA 3QB8A 2WSAA 3CXSA 5G1ZA 2P6FA 4KOWA 2QJ8A 4B12A 3LMSA 3IU1A 1RO5A 3RBUA 4IK2A 4DJLA 1Y0YA 4XPDC 5H86A 4Y49C 2GFQA 2YNDA 2BSWA 2PJ3A 3H8EA 1DE4C 4KUBA 4PQAA 4ZY0A 2V8VA 4UCNA 4YWYA 2VEZA 2PE3A 2B58A 2JBKA 2OZGA 3C26A 2D4PA 2ZEFA 5F46A 3LD2A 3FBUA 2IMOA 5G21A 1Y0RA 4UA3A 1IB1E 1FY7A 3D68A 2GE3A 5LYIA 2H5MA 2GLFA 4A95A 2WZNA 1AUGA 1BPMA 4R6TA 3JTKA 4MY3A 5A28A 3QAHA 3BI0A 2QIRA 3FYNA 4NSQA 4JXQA 1IGBA 2BL1A 5AG5A 2ANPA 3FIXA 1VHEA 4OC5A 1I1DA 4UWIA 3R9GA 2J8NA 1R43A 3TFYA 1GHEA 2IQ6A 3KR5A 5DWMA 2F8HA 3SI2A 4YFJA 3D2MA 1QSRA 3WT4A 4MY0A 3CPXA 3MRUA 2ZW6A 1ZO0A 4E0AA 2R7HA 3IWWA 3FNCA 3V38A 1H8LA 1LFWA 4MFKA 3EO4A 1RXTA 4UFVA 4WJBA 5G20A 1BO4A 3LWUA 1Y9KA 4ONUA 4Q38A 4IHMA 1CX8A 1BAVA 2X7BA 2CF4A 4UEZA 4NGTA 5GCNA 1Q2CA 4MXUA 3IIBA 4CYNA 5JGFA 4PSWA 2GIVA 4OC0A 2BEIA 5EBVA 3KKWA 4CGMA 1XMBA 1XMTA 1IYKA 2CTCA 3IFEA 1YX0A 2CY2A 4OIWA 4X5KA 1EE3P 1S7FA 2F5IA 4FD6A 4L8AA 1Z8TA 4XNHB 4FAIA 2YGWA 4ZY1A 4GS4A 2C1CA 3GY9A 2PIYA 4UFXA 2Z3KA 3F0AA 3FH4A 3PGPA 2GLJA 2A4NA 1XJOA 2C6PA 2FIWA 2F7VA 2Q4YA 5D29A 3TO6A 2EO8A 1M4LA 2OZHA 3TT2A 5HVFA 3KL9A 1Q2YA 2EUIA 2ODFA 3JVNA 2ZENA 1Z8LA 2Q4VA 4LQGA 4QC6A 3WR7A 3ZJ0A 4A38A 2B3VA 4JXRA 4JJXA 3IJ3A 4X3RA 2DF5A 3PZJA 3T90A 4KOYA 1ZLIA 5C88A 4M85A 1QSNA 1Q7LA 3KASA 1BPNA 4NGMA 4ZI6A 3DR8A 4UCPA 4PXDA 5J8FA 2BOAA 2Z3NA 2Q51A 4F6AA 1P4NA 2Z3LA 4E8OA 3S6KA 1VHSA 1Z4RA 2I79A 2V77A 2G0BA 4FD4A 4H6ZA 5LRGA 3KHXA 2VZYA 5HH1A 5IX3A 3PP9A 4MCSA 3KQXA 1IIDA 4A39A 2FXFA 2PJ2A 1QSTA 4MJ8A 2ZW7A 5J1QA 5FVJA 4E2AA 4LQ6A 2BUEA 3IWGA 2I00A 1ZG9A 3D7GA 1PU9A 5F48A 4XNHC 3W91A 4A31A 3VATA 4JZ0A 4A2ZA 2VZZA 4A94A 5K8PA 1S7NA 3CXPA 2EVNA 4I49A 4CAVA 4EMEA 5F09A 2B5GB 4M3SA 4MHZA 3JUWA 5DS0A 4A32A 4KLVA 2ZW4A 2IJZA 5HVGA 3ISXA 2WYRA 4R7MA 3CXQA 3L2NA 3TX8A
chains in the Genus database with same CATH topology
3DDDA 4UBRA 1PUAA 2J8RA 1Q2DA 3H4QA 5JQ4A 4B5OA 1NSLA 2PR1A 5F47A 4HNYB 3FRMA 4AB7A 2CNSA 4AG7A 1Z9UA 3DR6A 3DSBA 5IV0A 4XPDB 2PDOA 4R87A 4H6UA 2VQYA 3TOBA 1QSMA 3R9FA 4CYQA 3IU2A 4OAEA 2REFA 1S7KA 3SXOA 5IB0A 2K5TA 4CRYB 3I3GA 1OZPA 3G8WA 2FSRA 3GKRA 5G22A 4KSAA 4U9ZA 2Z3MA 4Q36A 2B5GA 5F49A 2HQYA 2R98A 4CGOA 2G3TA 2FL4A 3UY5A 4MFZA 4RI1A 1MJBA 1L0CA 2PC1A 4KVOE 4R57A 4XPLA 4H89A 2FIAA 2WUUA 2YNCC 4ZBGA 1YVOA 4KOVA 4FD7A 1R57A 3OWCA 4B10A 3RYOA 2KCWA 3I9SA 3F8KA 4R3KA 2OB0A 1XF8A 3GYAA 4KUAA 1KUXA 1KUVA 1CJWA 2OU2A 4KOUA 4QVTA 1N71A 3TCVA 3T9YA 4KORA 4B14A 3K9UA 4NCZA 2Q44A 1K4JA 2PSWA 4AVCA 4NEXA 1LRZA 2Z10A 4CAXA 2R8VA 2VXKA 4OLLA 3BLNA 2ARHA 4C2YA 1MJ9A 2JDCA 5DWNA 4U5YA 4KLWA 5E96A 2PQ8A 2B4BA 3N7ZA 4B13A 1MK4A 2J8MA 3EC4A 1M4IA 1VKCA 4UWJA 4HKFA 4NF1A 3MGDA 1ON0A 2P0WA 4L89A 2R1IA 3S6FA 4U9YA 3H5ZA 4KSFA 2ZPAA 1J4JA 2DPTA 2B3UA 1SQHA 4A30A 2NMTA 2Q0YA 2B4DA 2QECA 3G3SA 2PRBA 4RS2A 2C27A 4B5PB 2OH1A 1KZFA 4C2ZA 4KOTA 1XEBA 2D4OA 3P2FA 4J3GA 1M44A 4CYPA 4B11A 4AVBA 5JPHA 1M1DA 1Z4EA 2CNTA 1CM0A 4JD6A 1UFHA 3R95A 3ZZIA 5BWAB 2CXAA 1QSOA 2Z3OA 3IWEA 3VWDA 4QUSA 3R96A 3VWEA 2Z11A 1NMTA 4AVAA 2ATRA 2JDDA 2JLMA 4KOXA 4MFLA 4ORFA 3TO9A 4Y49B 4F0XA 2REEA 4PK3A 4KS9A 4YRHA 5AG7A 3S6GA 4CGPA 3DNSA 4KVXA 5CNPA 4KVME 2ZW5A 1XE4A 4HNWB 4UFWA 3EFAA 4JWPA 2Y0MA 1IICA 2WPWA 4EVYA 3TOAA 5KTCA 4MHDA 4LUAA 4CGNA 4UCMA 1MJAA 1IYLA 1S5KA 4MI4A 1Y9WA 3IGRA 1YVKA 4JLYA 1S3ZA 5KTDA 3B8GA 4PSXA 4R9MA 2HUZA 4BBHA 4CYOA 3FB3A 1YK3A 5AG6A 4NXYA 2Z0ZA 2P6GA 4B5PA 2FS5A 1U6MA 2YNEA 1P0HA 3D8PA 4MFQA 4CAEA 4PV6A 4DNCA 5A27A 2OZUA 2VBQA 2O28A 4CRZB 1KUYA 4KOSA 4MFJA 4C68A 5H84A 1V0CA 3D2PA 2G3AA 3W6XA 2JEVA 5KTAA 1I21A 1WK4A 4AG9A 1M4DA 1TIQA 1WWZA 2RC4A 4KZTA 3SHPA 2Z3PA 2AJ6A 3R9EA 4QBJA 4ZGYB 4CAFA 4C7IA 5AGEA 4YGOA 2PR8A 3BJ8A 3TO7A 2YNCA 2AE6A 2DPSA 4IF5A 3D3SA 1B6BA 4CS0B 2FCKA 1YLEA 3TE4A 1I12A 4OADA 3EY5A 4R3LA 2IL4A 4IUSA 2Q7BA 5AG4A 2QMLA 4QB9A 4XPKA 4A33A 4II9A 1YR0A 4MFPA 3EXNA 5HMNA 4HNXB 4F0YA 3A9LA 4MBUA 2Q04A 1BOBA 5J8CA 3E0KA 2P6EA 3LODA 4CGLA 1B87A 2B4DB 1M4GA 2FT0A 3S6HA 4C7HA 2VI7A 3NE7A 3F5BA 3V8IA 4BMHA 3FXTA 1NE9A 5ISVA 2DXQA 2CNMA 2HV2A 5I0CA 1XIXA 2GANA 1YREA 4CAWA 1YGHA 2FE7A 3BJ7A 4K30A 3P2HA 2WPXA 1S60A 5EC4A 3R1KA 3W6SA 3SXNA 1Y7RA 2ZXVA 4PK2A 1S7LA 4C2XA 4FD5A 4LX9A 5C82A 3TTHA 3QB8A 2WSAA 3CXSA 5G1ZA 2P6FA 4KOWA 4B12A 3IU1A 1RO5A 4XPDC 5H86A 4Y49C 2YNDA 2BSWA 4KUBA 4UCNA 2VEZA 2B58A 3C26A 2OZGA 2D4PA 5F46A 3LD2A 3FBUA 5G21A 4UA3A 1IB1E 1FY7A 2GE3A 2H5MA 4A95A 3JTKA 4MY3A 5A28A 3QAHA 2QIRA 3FYNA 4NSQA 4JXQA 2BL1A 5AG5A 3FIXA 1I1DA 4UWIA 3R9GA 2J8NA 3TFYA 1GHEA 5DWMA 4YFJA 3D2MA 1QSRA 4MY0A 2ZW6A 1ZO0A 4E0AA 2R7HA 3FNCA 4MFKA 3EO4A 1RXTA 4UFVA 5G20A 1BO4A 1Y9KA 4ONUA 4Q38A 2X7BA 5GCNA 1Q2CA 4CYNA 4PSWA 2GIVA 2BEIA 5EBVA 3KKWA 4CGMA 1XMTA 1IYKA 1YX0A 2CY2A 4X5KA 1S7FA 2F5IA 4FD6A 4L8AA 4XNHB 2YGWA 4GS4A 3GY9A 2Z3KA 3F0AA 3PGPA 2A4NA 2FIWA 2Q4YA 3TO6A 2OZHA 3TT2A 1Q2YA 2EUIA 3JVNA 2Q4VA 4QC6A 3WR7A 3ZJ0A 2B3VA 4JXRA 4JJXA 3PZJA 3T90A 4KOYA 5C88A 4M85A 1QSNA 3DR8A 4UCPA 5J8FA 2Z3NA 4F6AA 1P4NA 2Z3LA 4E8OA 3S6KA 1VHSA 1Z4RA 2I79A 4H6ZA 2G0BA 4FD4A 2VZYA 5HH1A 5IX3A 3PP9A 1IIDA 2FXFA 1QSTA 4MJ8A 2ZW7A 5FVJA 4E2AA 2BUEA 3IWGA 2I00A 1PU9A 5F48A 4XNHC 3W91A 4A31A 4A2ZA 2VZZA 1S7NA 3CXPA 2EVNA 4I49A 4CAVA 2B5GB 4M3SA 3JUWA 4A32A 4KLVA 2ZW4A 4UFXA 3CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDD A;  4UBR A;  1PUA A;  2J8R A;  1Q2D A;  3H4Q A;  5JQ4 A;  4B5O A;  1NSL A;  2PR1 A;  5F47 A;  4HNY B;  3FRM A;  4AB7 A;  2CNS A;  4AG7 A;  1Z9U A;  3DR6 A;  3DSB A;  5IV0 A;  4XPD B;  2PDO A;  4R87 A;  4H6U A;  2VQY A;  3TOB A;  1QSM A;  3R9F A;  4OAE A;  2REF A;  1S7K A;  3SXO A;  5IB0 A;  2K5T A;  4CRY B;  3I3G A;  1OZP A;  3G8W A;  2FSR A;  3GKR A;  4U9Z A;  2B5G A;  5F49 A;  2HQY A;  2R98 A;  2G3T A;  2FL4 A;  3UY5 A;  4RI1 A;  1MJB A;  1L0C A;  2PC1 A;  4KVO E;  4R57 A;  4XPL A;  4H89 A;  2FIA A;  4ZBG A;  1YVO A;  4KOV A;  4FD7 A;  1R57 A;  3OWC A;  3RYO A;  2KCW A;  3I9S A;  3F8K A;  4R3K A;  2OB0 A;  1XF8 A;  3GYA A;  4KUA A;  1KUX A;  1KUV A;  1CJW A;  2OU2 A;  4KOU A;  4QVT A;  1N71 A;  3TCV A;  3T9Y A;  4KOR A;  3K9U A;  4NCZ A;  2Q44 A;  1K4J A;  2PSW A;  4AVC A;  4NEX A;  1LRZ A;  2Z10 A;  4CAX A;  2R8V A;  2VXK A;  4OLL A;  3BLN A;  2ARH A;  1MJ9 A;  2JDC A;  5DWN A;  4U5Y A;  4KLW A;  5E96 A;  2PQ8 A;  2B4B A;  3N7Z A;  1MK4 A;  2J8M A;  3EC4 A;  1M4I A;  1VKC A;  4UWJ A;  4HKF A;  4NF1 A;  3MGD A;  1ON0 A;  2P0W A;  4L89 A;  2R1I A;  3S6F A;  4U9Y A;  2ZPA A;  1J4J A;  2B3U A;  1SQH A;  2NMT A;  2Q0Y A;  2B4D A;  2QEC A;  3G3S A;  2PRB A;  4RS2 A;  2C27 A;  4B5P B;  2OH1 A;  1KZF A;  4KOT A;  1XEB A;  2D4O A;  3P2F A;  4J3G A;  1M44 A;  4AVB A;  5JPH A;  1M1D A;  1Z4E A;  2CNT A;  1CM0 A;  4JD6 A;  1UFH A;  3R95 A;  3ZZI A;  1QSO A;  3VWD A;  4QUS A;  3R96 A;  3VWE A;  2Z11 A;  1NMT A;  4AVA A;  2ATR A;  2JDD A;  2JLM A;  4KOX A;  4ORF A;  3TO9 A;  4Y49 B;  2REE A;  4PK3 A;  4YRH A;  3S6G A;  3DNS A;  4KVX A;  5CNP A;  4KVM E;  2ZW5 A;  1XE4 A;  4HNW B;  3EFA A;  4JWP A;  2Y0M A;  1IIC A;  2WPW A;  4EVY A;  3TOA A;  5KTC A;  4MHD A;  4LUA A;  1MJA A;  1IYL A;  1S5K A;  4MI4 A;  1Y9W A;  3IGR A;  1YVK A;  4JLY A;  1S3Z A;  5KTD A;  3B8G A;  4PSX A;  4R9M A;  2HUZ A;  3FB3 A;  1YK3 A;  4NXY A;  2Z0Z A;  2P6G A;  4B5P A;  2FS5 A;  1U6M A;  1P0H A;  3D8P A;  4PV6 A;  4DNC A;  2OZU A;  2VBQ A;  2O28 A;  4CRZ B;  1KUY A;  4KOS A;  5H84 A;  1V0C A;  3D2P A;  2G3A A;  3W6X A;  2JEV A;  5KTA A;  1I21 A;  1WK4 A;  4AG9 A;  1M4D A;  1TIQ A;  1WWZ A;  2RC4 A;  4KZT A;  3SHP A;  2AJ6 A;  3R9E A;  4QBJ A;  4YGO A;  2PR8 A;  3BJ8 A;  3TO7 A;  2AE6 A;  4IF5 A;  3D3S A;  1B6B A;  4CS0 B;  2FCK A;  1YLE A;  3TE4 A;  1I12 A;  4OAD A;  3EY5 A;  4R3L A;  2IL4 A;  4IUS A;  2Q7B A;  2QML A;  4QB9 A;  4XPK A;  4II9 A;  1YR0 A;  3EXN A;  5HMN A;  4HNX B;  4F0Y A;  4MBU A;  2Q04 A;  1BOB A;  5J8C A;  3E0K A;  2P6E A;  3LOD A;  1B87 A;  2B4D B;  1M4G A;  2FT0 A;  3S6H A;  2VI7 A;  3NE7 A;  3F5B A;  3V8I A;  4BMH A;  3FXT A;  1NE9 A;  5ISV A;  2DXQ A;  2CNM A;  2HV2 A;  5I0C A;  1XIX A;  2GAN A;  1YRE A;  4CAW A;  1YGH A;  2FE7 A;  3BJ7 A;  4K30 A;  3P2H A;  2WPX A;  1S60 A;  5EC4 A;  3R1K A;  3W6S A;  3SXN A;  1Y7R A;  2ZXV A;  4PK2 A;  1S7L A;  4FD5 A;  4LX9 A;  5C82 A;  3TTH A;  3QB8 A;  3CXS A;  2P6F A;  4KOW A;  1RO5 A;  4XPD C;  5H86 A;  4Y49 C;  2BSW A;  4KUB A;  2VEZ A;  2B58 A;  3C26 A;  2OZG A;  2D4P A;  5F46 A;  3LD2 A;  3FBU A;  4UA3 A;  1IB1 E;  1FY7 A;  2GE3 A;  2H5M A;  4MY3 A;  3QAH A;  2QIR A;  3FYN A;  4NSQ A;  4JXQ A;  2BL1 A;  3FIX A;  1I1D A;  4UWI A;  3R9G A;  2J8N A;  3TFY A;  1GHE A;  5DWM A;  4YFJ A;  3D2M A;  1QSR A;  4MY0 A;  2ZW6 A;  4E0A A;  2R7H A;  3FNC A;  3EO4 A;  1RXT A;  1BO4 A;  1Y9K A;  4ONU A;  2X7B A;  5GCN A;  1Q2C A;  4PSW A;  2GIV A;  2BEI A;  5EBV A;  3KKW A;  1XMT A;  1IYK A;  1YX0 A;  2CY2 A;  4X5K A;  1S7F A;  2F5I A;  4FD6 A;  4L8A A;  4XNH B;  4GS4 A;  3GY9 A;  3PGP A;  3F0A A;  2A4N A;  2FIW A;  2Q4Y A;  3TO6 A;  2OZH A;  3TT2 A;  1Q2Y A;  2EUI A;  3JVN A;  2Q4V A;  4QC6 A;  3WR7 A;  3ZJ0 A;  2B3V A;  4JXR A;  4JJX A;  3PZJ A;  3T90 A;  4KOY A;  5C88 A;  4M85 A;  1QSN A;  3DR8 A;  5J8F A;  4F6A A;  1P4N A;  4E8O A;  3S6K A;  1VHS A;  1Z4R A;  2I79 A;  4H6Z A;  2G0B A;  4FD4 A;  2VZY A;  5HH1 A;  5IX3 A;  3PP9 A;  1IID A;  2FXF A;  1QST A;  4MJ8 A;  2ZW7 A;  5FVJ A;  4E2A A;  2BUE A;  3IWG A;  2I00 A;  1PU9 A;  5F48 A;  4XNH C;  3W91 A;  2VZZ A;  1S7N A;  3CXP A;  2EVN A;  4I49 A;  4CAV A;  2B5G B;  4M3S A;  3JUW A;  4KLV A;  2ZW4 A;  3CXQ A; 
#chains in the Genus database with same CATH topology
 3DDD A;  1YQE A;  4UBR A;  1LOK A;  3QNV A;  1YLO A;  1PUA A;  1PCA A;  3D4U A;  3FJU A;  2J8R A;  1Q2D A;  3H4Q A;  5JQ4 A;  4B5O A;  1NSL A;  2PR1 A;  3FEE A;  3SJE A;  5F47 A;  1TXR A;  2JEW A;  3RO0 A;  4HNY B;  2AFS A;  5CPA A;  3FRM A;  4AB7 A;  2CNS A;  1FT7 A;  4AG7 A;  1Z9U A;  2O4H A;  4OC4 A;  1YW4 A;  3DR6 A;  1HEE A;  3DSB A;  4K3N A;  5IV0 A;  4XPD B;  2NYQ A;  2PDO A;  2ZEO A;  3GUX A;  4NGQ A;  4H6U A;  4NGP A;  3B3W A;  4R87 A;  2VQY A;  1XOV A;  3TOB A;  4FWU A;  2AFM A;  3CT9 A;  5JM6 A;  1QSM A;  3R9F A;  5K8O A;  4CYQ A;  3IU2 A;  4OAE A;  5LYF A;  2FVG A;  2REF A;  1S7K A;  3SXO A;  5IB0 A;  2K5T A;  4CRY B;  2PJ4 A;  3I3G A;  1OZP A;  4NGS A;  3G8W A;  2FSR A;  3GKR A;  5K8N A;  4R8F A;  1IOI A;  4KSA A;  4U9Z A;  5G22 A;  3NE8 A;  5LRJ A;  2Z3M A;  4Q36 A;  2B5G A;  5F49 A;  2HQY A;  2R98 A;  4ZY2 A;  4CGO A;  2G3T A;  2FL4 A;  4Q7A A;  3UY5 A;  4MFZ A;  4RI1 A;  4CPA A;  1MJB A;  1L0C A;  1VGY A;  2PC1 A;  3B3S A;  4KVO E;  4R57 A;  4XPL A;  4H89 A;  4ONW A;  3N5F A;  1OBR A;  3LAC A;  2XEI A;  2FIA A;  4UIB A;  2WUU A;  2YNC C;  3SJF A;  4ZBG A;  1LAM A;  1YVO A;  4R76 A;  4P4E A;  3FED A;  3SJX A;  4KOV A;  4FD7 A;  3CDX A;  3SI0 A;  2PJ7 A;  3SI1 A;  1R57 A;  2PJ0 A;  2ZEG A;  4W9Y A;  1R3N A;  3OWC A;  4ZYQ A;  4EFD A;  4B10 A;  5IB9 A;  3GIU A;  1IU8 A;  3RYO A;  2KCW A;  2ZOG A;  3I9S A;  3F8K A;  4R3K A;  2OB0 A;  1XF8 A;  3V7Z A;  3GYA A;  4KUA A;  1CJW A;  1KUX A;  1KUV A;  4M6H A;  2ABZ A;  3GB0 A;  1ELM P;  5EMI A;  3IEH A;  2OU2 A;  4KOU A;  4QVT A;  1N71 A;  4OC1 A;  3TCV A;  3T9Y A;  4KOR A;  4B14 A;  4ZX9 A;  1CG2 A;  3K9U A;  4NCZ A;  1ZG7 A;  1Z2L A;  2Q44 A;  1K4J A;  1F57 A;  3D7H A;  2VL1 A;  2PSW A;  4AVC A;  4NEX A;  1CPX A;  1LRZ A;  4RN7 A;  4M6G A;  2ZED A;  1YW6 A;  2Z10 A;  1TF9 A;  4CAX A;  4P10 A;  1TKJ A;  2QVP A;  5D8N A;  1JWQ A;  2R8V A;  2PJC A;  2VXK A;  1QQ9 A;  1AYE A;  3BLN A;  2ARH A;  4OLL A;  4C2Y A;  1MJ9 A;  3WC7 A;  2C6G A;  5LYL A;  1LAN A;  4OKO A;  3DGV A;  2JDC A;  4KSI A;  5DWN A;  4U5Y A;  2PJ9 A;  4KLW A;  5E96 A;  2PQ8 A;  3K2K A;  3VH9 A;  2B4B A;  4P4I A;  3N7Z A;  3NA6 A;  4B13 A;  1MK4 A;  2J8M A;  3EC4 A;  2GRE A;  2C6C A;  1M4I A;  3DLJ A;  5THW A;  1VKC A;  3S9M A;  1Z8X A;  3KR4 A;  4UWJ A;  1AMP A;  3PEI A;  4HKF A;  4NF1 A;  3MGD A;  3PB6 X;  1ON0 A;  2P0W A;  1ARM A;  4MHN A;  4BD9 A;  4L89 A;  2R1I A;  3S6F A;  1VHO A;  4U9Y A;  3BI1 A;  3H5Z A;  3KHZ A;  2Q43 A;  4KSF A;  2ZPA A;  2PCU A;  4OID A;  1J4J A;  2DPT A;  2B3U A;  2HC9 A;  1SQH A;  4A30 A;  2PJA A;  2NMT A;  2Q0Y A;  3K9T A;  2B4D A;  2QEC A;  3G3S A;  2PRB A;  5JH9 A;  4RS2 A;  2C27 A;  4HPS A;  4OC3 A;  1CPS A;  4B5P B;  2OH1 A;  2Q7S A;  1KZF A;  4C2Z A;  4KOT A;  1XEB A;  2D4O A;  1QMU A;  3P2F A;  3I1U A;  4NGN A;  2XEJ A;  4X8I A;  4J3G A;  3CZX A;  1M44 A;  4CYP A;  2GU2 A;  3IO1 A;  3B3C A;  4B11 A;  4AVB A;  4B6Z A;  5JPH A;  1M1D A;  2AFZ A;  4F9U A;  1TKF A;  1Z4E A;  3JRU A;  5ELY A;  4FUU A;  2CNT A;  4YU9 A;  3TC8 A;  1CM0 A;  4JD6 A;  1UFH A;  2ZEP A;  3R95 A;  3ZZI A;  5BWA B;  4IAV A;  2CXA A;  1CBX A;  1QSO A;  2Z3O A;  4WWV A;  2HB6 A;  1XRY A;  3IWE A;  3VWD A;  4MHP A;  4QUS A;  3HUV A;  3R96 A;  2CTB A;  3VWE A;  2Z11 A;  3MN8 A;  1NMT A;  4Z65 A;  1UWY A;  1YSJ A;  2PVV A;  2ZEL A;  3PBB A;  2V8G A;  4AVA A;  4O23 A;  4DYO A;  4OME A;  2ATR A;  2JDD A;  2JLM A;  2J9A A;  4KOX A;  3NH5 A;  4MFL A;  2RB7 A;  3PFO A;  4ORF A;  3TO9 A;  3PB9 X;  4PPZ A;  3S9N A;  4Y49 B;  1XBU A;  4F0X A;  2REE A;  3GLJ A;  4PK3 A;  4KS9 A;  4YRH A;  5AG7 A;  5K8M A;  3S6G A;  1NSA A;  4CGP A;  3DNS A;  4KVX A;  5CNP A;  4UEE A;  4KVM E;  2XEF A;  2ZW5 A;  1XE4 A;  1IY7 A;  2V8H A;  4HNW B;  3EFA A;  4UFW A;  5HVH A;  2EBJ A;  4JWP A;  3B35 A;  2Y0M A;  4P4D A;  1CP6 A;  1IIC A;  3SJG A;  3PB4 X;  3BXM A;  2WPW A;  4EVY A;  4EWT A;  4MRI A;  3TOA A;  4A37 A;  3WC6 A;  1PYT B;  4MCP A;  5KTC A;  4MHD A;  4LUA A;  1ZG8 A;  5HXD A;  3FX6 A;  4CGN A;  4UCM A;  1RTQ A;  2OOT A;  1MJA A;  2OR4 A;  4P4J A;  1IYL A;  1S5K A;  3FVL A;  4MI4 A;  1Y9W A;  1DTD A;  4H2K A;  3IGR A;  4PXC A;  4M6I A;  2RFH A;  4G1P A;  3B3T A;  1YVK A;  3T8W A;  3B2Y A;  3WC5 A;  4TNU A;  4JLY A;  1S3Z A;  2AFU A;  2PRQ A;  5KTD A;  3B8G A;  4PSX A;  4R9M A;  5LRK A;  2HUZ A;  4BBH A;  2PJ6 A;  3FB3 A;  3IC1 A;  4NJR A;  3NH8 A;  1F2P A;  4CYO A;  1YK3 A;  4MHY A;  5AG6 A;  3B7I A;  3HLP A;  4NXY A;  2Z0Z A;  4NJQ A;  4UIA A;  3PBE A;  1X12 A;  1ARL A;  1Y7E A;  1FNO A;  3RNZ A;  2P6G A;  1VIX A;  4P6Y A;  4B5P A;  2FS5 A;  1U6M A;  2YNE A;  2AFW A;  4UEF A;  4MMO A;  3D66 A;  1P0H A;  4NFR A;  2ZEH A;  4NGR A;  3D8P A;  1F2O A;  2ZEM A;  3PRT A;  4MFQ A;  4CAE A;  2QYV A;  2EK8 A;  4PV6 A;  4DNC A;  2G9D A;  2OZU A;  1CP7 A;  1HDQ A;  4OP4 A;  3H8F A;  2VBQ A;  2O28 A;  3KZW A;  4P45 A;  5A27 A;  4CRZ B;  1KUY A;  4KOS A;  2I3C A;  4ZX8 A;  8CPA A;  1TKH A;  2ZEE A;  4MFJ A;  4C68 A;  5H84 A;  4JYW A;  1V0C A;  3B3V A;  2O53 A;  2G3A A;  3D2P A;  3W6X A;  4FBE A;  2PVW A;  4F9V A;  2JEV A;  6CPA A;  5KTA A;  1I21 A;  3NH4 A;  3KQZ A;  1WK4 A;  3PFE A;  4MCQ A;  5LYD A;  4AG9 A;  1M4D A;  1TIQ A;  1WWZ A;  2RC4 A;  4KZT A;  3SHP A;  4P4B A;  3VAR A;  4OC2 A;  2Z3P A;  2AJ6 A;  3R9E A;  4QBJ A;  2CIJ A;  4GM5 A;  4C7I A;  2PJ5 A;  4CAF A;  4ZGY B;  5AGE A;  4YGO A;  2PR8 A;  3BJ8 A;  4PXE A;  3TO7 A;  3KI9 A;  4MCR A;  2YNC A;  4TWE A;  4PXB A;  2AE6 A;  2DPS A;  3RZA A;  4IF5 A;  3D3S A;  1B6B A;  1X10 A;  4CS0 B;  2PJ8 A;  2PJ1 A;  2FCK A;  1YLE A;  3TE4 A;  1I12 A;  4DUK A;  4OAD A;  1TF8 A;  3EY5 A;  4R3L A;  2IL4 A;  3RAM A;  2BO9 A;  1BLL E;  4IUS A;  2Q7B A;  2NSM A;  4P44 A;  3PB8 X;  5AG4 A;  2QML A;  1LAP A;  3QAY A;  4QB9 A;  4XPK A;  4A33 A;  1KWM A;  1YR0 A;  7CPA A;  4II9 A;  2XEG A;  4MFP A;  2V8D A;  3EXN A;  1YME A;  5HMN A;  4HNX B;  4F0Y A;  3A9L A;  3ISZ A;  2Q04 A;  4MBU A;  1BOB A;  5J8C A;  2EWB A;  2ZOF A;  3E0K A;  2P6E A;  2JBJ A;  1JQG A;  2Q4Z A;  3KGQ A;  2PJB A;  3LOD A;  4GXH A;  1LCP A;  1B87 A;  3D7F A;  2B4D B;  4P4F A;  4CGL A;  4RUH A;  1M4G A;  2AFX A;  3CPA A;  2AFO A;  2FT0 A;  3S6H A;  4C7H A;  2VI7 A;  3FEC A;  3H8G A;  4AXV A;  5CBM A;  1ELL P;  1HDU A;  3D7D A;  3NE7 A;  3NFZ A;  3F5B A;  2BCO A;  3V8I A;  2DEA A;  2POK A;  3WAB A;  4BMH A;  3FXT A;  1NE9 A;  3PB7 X;  5ISV A;  3D67 A;  2EK9 A;  2DXQ A;  1XFO A;  5I4M A;  1A2Z A;  2CNM A;  3FMC A;  2HV2 A;  5I0C A;  1XIX A;  2GAN A;  3S9L A;  1Z5R A;  1YRE A;  2PIZ A;  1YGH A;  2FE7 A;  4X2T A;  4BIN A;  4CAW A;  1IOF A;  4UF4 A;  3BJ7 A;  4K30 A;  1Z8W A;  3P2H A;  2WPX A;  1S60 A;  5EC4 A;  4F8Z A;  3R1K A;  3W6S A;  3SXN A;  1GYT A;  1ZLH A;  1Y7R A;  2ZXV A;  4PK2 A;  3BHX A;  1S7L A;  4C2X A;  4FD5 A;  4LX9 A;  3FF3 A;  5C82 A;  3TTH A;  3QB8 A;  2WSA A;  3CXS A;  5G1Z A;  2P6F A;  4KOW A;  2QJ8 A;  4B12 A;  3LMS A;  3IU1 A;  1RO5 A;  3RBU A;  4IK2 A;  4DJL A;  1Y0Y A;  4XPD C;  5H86 A;  4Y49 C;  2GFQ A;  2YND A;  2BSW A;  2PJ3 A;  3H8E A;  1DE4 C;  4KUB A;  4PQA A;  4ZY0 A;  2V8V A;  4UCN A;  4YWY A;  2VEZ A;  2PE3 A;  2B58 A;  2JBK A;  2OZG A;  3C26 A;  2D4P A;  2ZEF A;  5F46 A;  3LD2 A;  3FBU A;  2IMO A;  5G21 A;  1Y0R A;  4UA3 A;  1IB1 E;  1FY7 A;  3D68 A;  2GE3 A;  5LYI A;  2H5M A;  2GLF A;  4A95 A;  2WZN A;  1AUG A;  1BPM A;  4R6T A;  3JTK A;  4MY3 A;  5A28 A;  3QAH A;  3BI0 A;  2QIR A;  3FYN A;  4NSQ A;  4JXQ A;  1IGB A;  2BL1 A;  5AG5 A;  2ANP A;  3FIX A;  1VHE A;  4OC5 A;  1I1D A;  4UWI A;  3R9G A;  2J8N A;  1R43 A;  3TFY A;  1GHE A;  2IQ6 A;  3KR5 A;  5DWM A;  2F8H A;  3SI2 A;  4YFJ A;  3D2M A;  1QSR A;  3WT4 A;  4MY0 A;  3CPX A;  3MRU A;  2ZW6 A;  1ZO0 A;  4E0A A;  2R7H A;  3IWW A;  3FNC A;  3V38 A;  1H8L A;  1LFW A;  4MFK A;  3EO4 A;  1RXT A;  4UFV A;  4WJB A;  5G20 A;  1BO4 A;  3LWU A;  1Y9K A;  4ONU A;  4Q38 A;  4IHM A;  1CX8 A;  1BAV A;  2X7B A;  2CF4 A;  4UEZ A;  4NGT A;  5GCN A;  1Q2C A;  4MXU A;  3IIB A;  4CYN A;  5JGF A;  4PSW A;  2GIV A;  4OC0 A;  2BEI A;  5EBV A;  3KKW A;  4CGM A;  1XMB A;  1XMT A;  1IYK A;  2CTC A;  3IFE A;  1YX0 A;  2CY2 A;  4OIW A;  4X5K A;  1EE3 P;  1S7F A;  2F5I A;  4FD6 A;  4L8A A;  1Z8T A;  4XNH B;  4FAI A;  2YGW A;  4ZY1 A;  4GS4 A;  2C1C A;  3GY9 A;  2PIY A;  4UFX A;  2Z3K A;  3F0A A;  3FH4 A;  3PGP A;  2GLJ A;  2A4N A;  1XJO A;  2C6P A;  2FIW A;  2F7V A;  2Q4Y A;  5D29 A;  3TO6 A;  2EO8 A;  1M4L A;  2OZH A;  3TT2 A;  5HVF A;  3KL9 A;  1Q2Y A;  2EUI A;  2ODF A;  3JVN A;  2ZEN A;  1Z8L A;  2Q4V A;  4LQG A;  4QC6 A;  3WR7 A;  3ZJ0 A;  4A38 A;  2B3V A;  4JXR A;  4JJX A;  3IJ3 A;  4X3R A;  2DF5 A;  3PZJ A;  3T90 A;  4KOY A;  1ZLI A;  5C88 A;  4M85 A;  1QSN A;  1Q7L A;  3KAS A;  1BPN A;  4NGM A;  4ZI6 A;  3DR8 A;  4UCP A;  4PXD A;  5J8F A;  2BOA A;  2Z3N A;  2Q51 A;  4F6A A;  1P4N A;  2Z3L A;  4E8O A;  3S6K A;  1VHS A;  1Z4R A;  2I79 A;  2V77 A;  2G0B A;  4FD4 A;  4H6Z A;  5LRG A;  3KHX A;  2VZY A;  5HH1 A;  5IX3 A;  3PP9 A;  4MCS A;  3KQX A;  1IID A;  4A39 A;  2FXF A;  2PJ2 A;  1QST A;  4MJ8 A;  2ZW7 A;  5J1Q A;  5FVJ A;  4E2A A;  4LQ6 A;  2BUE A;  3IWG A;  2I00 A;  1ZG9 A;  3D7G A;  1PU9 A;  5F48 A;  4XNH C;  3W91 A;  4A31 A;  3VAT A;  4JZ0 A;  4A2Z A;  2VZZ A;  4A94 A;  5K8P A;  1S7N A;  3CXP A;  2EVN A;  4I49 A;  4CAV A;  4EME A;  5F09 A;  2B5G B;  4M3S A;  4MHZ A;  3JUW A;  5DS0 A;  4A32 A;  4KLV A;  2ZW4 A;  2IJZ A;  5HVG A;  3ISX A;  2WYR A;  4R7M A;  3CXQ A;  3L2N A;  3TX8 A; 
#chains in the Genus database with same CATH homology
 3DDD A;  4UBR A;  1PUA A;  2J8R A;  1Q2D A;  3H4Q A;  5JQ4 A;  4B5O A;  1NSL A;  2PR1 A;  5F47 A;  4HNY B;  3FRM A;  4AB7 A;  2CNS A;  4AG7 A;  1Z9U A;  3DR6 A;  3DSB A;  5IV0 A;  4XPD B;  2PDO A;  4R87 A;  4H6U A;  2VQY A;  3TOB A;  1QSM A;  3R9F A;  4CYQ A;  3IU2 A;  4OAE A;  2REF A;  1S7K A;  3SXO A;  5IB0 A;  2K5T A;  4CRY B;  3I3G A;  1OZP A;  3G8W A;  2FSR A;  3GKR A;  5G22 A;  4KSA A;  4U9Z A;  2Z3M A;  4Q36 A;  2B5G A;  5F49 A;  2HQY A;  2R98 A;  4CGO A;  2G3T A;  2FL4 A;  3UY5 A;  4MFZ A;  4RI1 A;  1MJB A;  1L0C A;  2PC1 A;  4KVO E;  4R57 A;  4XPL A;  4H89 A;  2FIA A;  2WUU A;  2YNC C;  4ZBG A;  1YVO A;  4KOV A;  4FD7 A;  1R57 A;  3OWC A;  4B10 A;  3RYO A;  2KCW A;  3I9S A;  3F8K A;  4R3K A;  2OB0 A;  1XF8 A;  3GYA A;  4KUA A;  1KUX A;  1KUV A;  1CJW A;  2OU2 A;  4KOU A;  4QVT A;  1N71 A;  3TCV A;  3T9Y A;  4KOR A;  4B14 A;  3K9U A;  4NCZ A;  2Q44 A;  1K4J A;  2PSW A;  4AVC A;  4NEX A;  1LRZ A;  2Z10 A;  4CAX A;  2R8V A;  2VXK A;  4OLL A;  3BLN A;  2ARH A;  4C2Y A;  1MJ9 A;  2JDC A;  5DWN A;  4U5Y A;  4KLW A;  5E96 A;  2PQ8 A;  2B4B A;  3N7Z A;  4B13 A;  1MK4 A;  2J8M A;  3EC4 A;  1M4I A;  1VKC A;  4UWJ A;  4HKF A;  4NF1 A;  3MGD A;  1ON0 A;  2P0W A;  4L89 A;  2R1I A;  3S6F A;  4U9Y A;  3H5Z A;  4KSF A;  2ZPA A;  1J4J A;  2DPT A;  2B3U A;  1SQH A;  4A30 A;  2NMT A;  2Q0Y A;  2B4D A;  2QEC A;  3G3S A;  2PRB A;  4RS2 A;  2C27 A;  4B5P B;  2OH1 A;  1KZF A;  4C2Z A;  4KOT A;  1XEB A;  2D4O A;  3P2F A;  4J3G A;  1M44 A;  4CYP A;  4B11 A;  4AVB A;  5JPH A;  1M1D A;  1Z4E A;  2CNT A;  1CM0 A;  4JD6 A;  1UFH A;  3R95 A;  3ZZI A;  5BWA B;  2CXA A;  1QSO A;  2Z3O A;  3IWE A;  3VWD A;  4QUS A;  3R96 A;  3VWE A;  2Z11 A;  1NMT A;  4AVA A;  2ATR A;  2JDD A;  2JLM A;  4KOX A;  4MFL A;  4ORF A;  3TO9 A;  4Y49 B;  4F0X A;  2REE A;  4PK3 A;  4KS9 A;  4YRH A;  5AG7 A;  3S6G A;  4CGP A;  3DNS A;  4KVX A;  5CNP A;  4KVM E;  2ZW5 A;  1XE4 A;  4HNW B;  4UFW A;  3EFA A;  4JWP A;  2Y0M A;  1IIC A;  2WPW A;  4EVY A;  3TOA A;  5KTC A;  4MHD A;  4LUA A;  4CGN A;  4UCM A;  1MJA A;  1IYL A;  1S5K A;  4MI4 A;  1Y9W A;  3IGR A;  1YVK A;  4JLY A;  1S3Z A;  5KTD A;  3B8G A;  4PSX A;  4R9M A;  2HUZ A;  4BBH A;  4CYO A;  3FB3 A;  1YK3 A;  5AG6 A;  4NXY A;  2Z0Z A;  2P6G A;  4B5P A;  2FS5 A;  1U6M A;  2YNE A;  1P0H A;  3D8P A;  4MFQ A;  4CAE A;  4PV6 A;  4DNC A;  5A27 A;  2OZU A;  2VBQ A;  2O28 A;  4CRZ B;  1KUY A;  4KOS A;  4MFJ A;  4C68 A;  5H84 A;  1V0C A;  3D2P A;  2G3A A;  3W6X A;  2JEV A;  5KTA A;  1I21 A;  1WK4 A;  4AG9 A;  1M4D A;  1TIQ A;  1WWZ A;  2RC4 A;  4KZT A;  3SHP A;  2Z3P A;  2AJ6 A;  3R9E A;  4QBJ A;  4ZGY B;  4CAF A;  4C7I A;  5AGE A;  4YGO A;  2PR8 A;  3BJ8 A;  3TO7 A;  2YNC A;  2AE6 A;  2DPS A;  4IF5 A;  3D3S A;  1B6B A;  4CS0 B;  2FCK A;  1YLE A;  3TE4 A;  1I12 A;  4OAD A;  3EY5 A;  4R3L A;  2IL4 A;  4IUS A;  2Q7B A;  5AG4 A;  2QML A;  4QB9 A;  4XPK A;  4A33 A;  4II9 A;  1YR0 A;  4MFP A;  3EXN A;  5HMN A;  4HNX B;  4F0Y A;  3A9L A;  4MBU A;  2Q04 A;  1BOB A;  5J8C A;  3E0K A;  2P6E A;  3LOD A;  4CGL A;  1B87 A;  2B4D B;  1M4G A;  2FT0 A;  3S6H A;  4C7H A;  2VI7 A;  3NE7 A;  3F5B A;  3V8I A;  4BMH A;  3FXT A;  1NE9 A;  5ISV A;  2DXQ A;  2CNM A;  2HV2 A;  5I0C A;  1XIX A;  2GAN A;  1YRE A;  4CAW A;  1YGH A;  2FE7 A;  3BJ7 A;  4K30 A;  3P2H A;  2WPX A;  1S60 A;  5EC4 A;  3R1K A;  3W6S A;  3SXN A;  1Y7R A;  2ZXV A;  4PK2 A;  1S7L A;  4C2X A;  4FD5 A;  4LX9 A;  5C82 A;  3TTH A;  3QB8 A;  2WSA A;  3CXS A;  5G1Z A;  2P6F A;  4KOW A;  4B12 A;  3IU1 A;  1RO5 A;  4XPD C;  5H86 A;  4Y49 C;  2YND A;  2BSW A;  4KUB A;  4UCN A;  2VEZ A;  2B58 A;  3C26 A;  2OZG A;  2D4P A;  5F46 A;  3LD2 A;  3FBU A;  5G21 A;  4UA3 A;  1IB1 E;  1FY7 A;  2GE3 A;  2H5M A;  4A95 A;  3JTK A;  4MY3 A;  5A28 A;  3QAH A;  2QIR A;  3FYN A;  4NSQ A;  4JXQ A;  2BL1 A;  5AG5 A;  3FIX A;  1I1D A;  4UWI A;  3R9G A;  2J8N A;  3TFY A;  1GHE A;  5DWM A;  4YFJ A;  3D2M A;  1QSR A;  4MY0 A;  2ZW6 A;  1ZO0 A;  4E0A A;  2R7H A;  3FNC A;  4MFK A;  3EO4 A;  1RXT A;  4UFV A;  5G20 A;  1BO4 A;  1Y9K A;  4ONU A;  4Q38 A;  2X7B A;  5GCN A;  1Q2C A;  4CYN A;  4PSW A;  2GIV A;  2BEI A;  5EBV A;  3KKW A;  4CGM A;  1XMT A;  1IYK A;  1YX0 A;  2CY2 A;  4X5K A;  1S7F A;  2F5I A;  4FD6 A;  4L8A A;  4XNH B;  2YGW A;  4GS4 A;  3GY9 A;  2Z3K A;  3F0A A;  3PGP A;  2A4N A;  2FIW A;  2Q4Y A;  3TO6 A;  2OZH A;  3TT2 A;  1Q2Y A;  2EUI A;  3JVN A;  2Q4V A;  4QC6 A;  3WR7 A;  3ZJ0 A;  2B3V A;  4JXR A;  4JJX A;  3PZJ A;  3T90 A;  4KOY A;  5C88 A;  4M85 A;  1QSN A;  3DR8 A;  4UCP A;  5J8F A;  2Z3N A;  4F6A A;  1P4N A;  2Z3L A;  4E8O A;  3S6K A;  1VHS A;  1Z4R A;  2I79 A;  4H6Z A;  2G0B A;  4FD4 A;  2VZY A;  5HH1 A;  5IX3 A;  3PP9 A;  1IID A;  2FXF A;  1QST A;  4MJ8 A;  2ZW7 A;  5FVJ A;  4E2A A;  2BUE A;  3IWG A;  2I00 A;  1PU9 A;  5F48 A;  4XNH C;  3W91 A;  4A31 A;  4A2Z A;  2VZZ A;  1S7N A;  3CXP A;  2EVN A;  4I49 A;  4CAV A;  2B5G B;  4M3S A;  3JUW A;  4A32 A;  4KLV A;  2ZW4 A;  4UFX A;  3CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...