2J8NA

Structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
b'SIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title l-Methionine sulfoximine, but not phosphinothricin, is a substrate for an acetyltransferase (gene PA4866) from Pseudomonas aeruginosa: structural and functional studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8nA00
2B4BA 2HQYA 4KZTA 3D2MA 3FB3A 3ZJ0A 1S5KA 1B6BA 2Z11A 5EC4A 3FYNA 4R9MA 4M3SA 4KOVA 3TTHA 4CS0B 5KTDA 3SHPA 2BUEA 3VWEA 5EBVA 4ZBGA 2OZHA 3W6XA 2VZYA 1IYLA 2D4PA 1Q2YA 2I00A 4UWJA 2RC4A 3DR8A 3SXNA 2R1IA 4ONUA 4R3KA 3DNSA 3R96A 2PR1A 4QC6A 2Z0ZA 2HV2A 2B5GA 4KOSA 4CRZB 3R9FA 1QSTA 1Y9WA 3MGDA 1SQHA 4UWIA 4L8AA 4MY0A 3BLNA 4R87A 4KUBA 3FIXA 4FD7A 1YX0A 3DR6A 1P0HA 1IB1E 1CM0A 1R57A 5GCNA 4YGOA 1YR0A 5E96A 1I1DA 2B5GB 1S7LA 4H89A 4JXQA 4MBUA 2QECA 1S3ZA 2PC1A 5C82A 4PK2A 3GKRA 4UBRA 5F49A 4I49A 1V0CA 3QAHA 4B5OA 2Q7BA 2R7HA 2P6EA 4KOTA 1UFHA 4HNYB 5HH1A 3IGRA 5KTCA 2BEIA 4U5YA 3IWGA 3FNCA 4QUSA 1XIXA 2B3UA 4GS4A 4OADA 3EC4A 4F0YA 3TOBA 2VBQA 2ZPAA 3N7ZA 2ZW6A 5CNPA 3GYAA 1TIQA 4PSWA 2Z10A 3JUWA 4KUAA 1IIDA 3RYOA 3NE7A 4KVOE 2ZXVA 2F5IA 4HNWB 3F5BA 4AVAA 5DWNA 1MJBA 4KLWA 2Q44A 1MJ9A 2ATRA 1KUXA 2ARHA 3K9UA 3EY5A 2PDOA 2AJ6A 4XPKA 3OWCA 1QSMA 3CXQA 2OU2A 4YRHA 2CNSA 4FD4A 3GY9A 4UA3A 3LODA 1VHSA 4MY3A 2KCWA 3VWDA 4LX9A 1LRZA 3EFAA 4L89A 4EVYA 1S7FA 3P2FA 5JPHA 1Y7RA 2Q0YA 3S6FA 3I9SA 3JVNA 2GANA 2VQYA 3FRMA 2P0WA 2G3TA 2CNMA 2B4DB 4J3GA 2C27A 4U9ZA 4AG9A 3EXNA 3S6KA 5ISVA 4HNXB 2CY2A 3TT2A 2BSWA 1XE4A 1NMTA 4NF1A 1L0CA 4IUSA 2JDCA 2P6FA 2FIWA 1I12A 4QB9A 4NEXA 4AB7A 5KTAA 3WR7A 1PUAA 1Z4RA 3CXPA 2J8NA 1S7KA 4KOUA 4KVXA 5F48A 1ON0A 1YREA 4U9YA 4CRYB 5JQ4A 2H5MA 3TE4A 1KUYA 1YLEA 4RS2A 3TOAA 4KOYA 1N71A 3G8WA 2WPWA 3D3SA 3I3GA 1S60A 3T9YA 2Q4YA 4Y49C 2WPXA 5J8CA 1NSLA 3UY5A 2FSRA 2QMLA 2CNTA 3DDDA 3F8KA 2K5TA 3P2HA 4JXRA 5C88A 2B3VA 4AVBA 4PV6A 1P4NA 2QIRA 2B58A 2D4OA 3F0AA 4XPDC 4BMHA 1M4GA 3CXSA 2PQ8A 4E8OA 1YVOA 1Z4EA 1FY7A 3R9GA 3D8PA 4NSQA 4JJXA 3TCVA 3S6HA 2I79A 4II9A 4IF5A 3KKWA 2VZZA 4NCZA 1XEBA 2FIAA 2FS5A 3PGPA 2VI7A 3LD2A 1KZFA 2P6GA 2B4DA 1YK3A 4CAXA 4Y49B 4CAVA 3QB8A 3R1KA 5H86A 2PSWA 1XF8A 4OLLA 2FXFA 2JDDA 3W91A 2X7BA 4KOXA 3V8IA 1M4IA 2G3AA 3ZZIA 2FT0A 2REEA 2OB0A 2AE6A 4JLYA 2Q04A 4HKFA 3R9EA 1Q2CA 1RO5A 4MHDA 4KVME 1Y9KA 4XPDB 4B5PA 3FXTA 3DSBA 2VXKA 1M44A 5IV0A 3B8GA 4JD6A 5FVJA 3C26A 5DWMA 4K30A 2VEZA 2OZUA 4X5KA 4KOWA 1B87A 4MI4A 2GE3A 3H4QA 1K4JA 2NMTA 4H6UA 4KORA 1KUVA 4M85A 2R98A 2ZW7A 2EVNA 3TO7A 4B5PB 1GHEA 1NE9A 3G3SA 4F6AA 1QSNA 4FD5A 4CAWA 2GIVA 1PU9A 4R3LA 1U6MA 5IX3A 1OZPA 4ORFA 1J4JA 3TO9A 1WK4A 3TO6A 1YGHA 1S7NA 1VKCA 4PSXA 2A4NA 1WWZA 2FCKA 2IL4A 4XNHC 3BJ8A 2PR8A 2OZGA 5J8FA 4H6ZA 4AVCA 4YFJA 4FD6A 4PK3A 1M1DA 2JLMA 1IICA 2EUIA 4OAEA 4R57A 2ZW5A 5F46A 1MJAA 4MJ8A 2Q4VA 5H84A 1XMTA 1Q2DA 2G0BA 2O28A 1CJWA 4AG7A 4RI1A 1Z9UA 3PZJA 3T90A 5IB0A 2J8MA 2BL1A 2JEVA 4LUAA 1QSRA 3R95A 2J8RA 4E2AA 3TFYA 1BO4A 3BJ7A 2Y0MA 1YVKA 3W6SA 1BOBA 2OH1A 3E0KA 1MK4A 1M4DA 1QSOA 4KLVA 4NXYA 5HMNA 5I0CA 1I21A 2ZW4A 4XPLA 3PP9A 5F47A 4XNHB 4E0AA 3SXOA 3D2PA 1IYKA 2FE7A 2FL4A 4QBJA 2REFA 4DNCA 3S6GA 3EO4A 4JWPA 1RXTA 2PRBA 3FBUA 4QVTA 2DXQA 2HUZA 2R8VA
chains in the Genus database with same CATH superfamily
4OC5A 1QQ9A 1VIXA 4ZI6A 2WUUA 2B4BA 2HQYA 4KZTA 2IJZA 3D2MA 4H2KA 3IWWA 3FB3A 1BPNA 2CTBA 3ZJ0A 1S5KA 1B6BA 2Z11A 3B2YA 4F9VA 5EC4A 4KSFA 3KGQA 3FYNA 3KR5A 3LACA 4R9MA 1Y0RA 4NGRA 2V8DA 3KI9A 1ARLA 4M3SA 4KOVA 3TTHA 4CS0B 2JEWA 5KTDA 3SHPA 2BUEA 2WZNA 3VARA 4PPZA 4A30A 1F57A 3VWEA 5LRGA 5EBVA 4YWYA 3IU1A 4ZBGA 2OZHA 3W6XA 1IOIA 3BI0A 2VZYA 1IYLA 2YNEA 2GREA 3PB4X 3QAYA 2D4PA 2I00A 1Q2YA 1XRYA 2EK9A 3H8GA 4UWJA 3RO0A 3VATA 2RC4A 3DR8A 3SXNA 2R1IA 3S9LA 3SJEA 1UWYA 4ONUA 4B11A 4R3KA 4ONWA 4WJBA 3DNSA 3R96A 1EE3P 2PR1A 1Z8WA 4QC6A 2EWBA 2Z0ZA 4W9YA 4RN7A 4DJLA 2HV2A 2PJ0A 1XOVA 2B5GA 4KOSA 4CRZB 1JWQA 2Q7SA 4P4EA 3R9FA 1QSTA 1Y9WA 3WC5A 5K8MA 1GYTA 3SJGA 3MGDA 1SQHA 4UWIA 1Z8LA 2AFMA 1ZG9A 4L8AA 2G9DA 4UEZA 4MXUA 4MY0A 4CYPA 3BLNA 4R87A 5HVGA 3L2NA 4KUBA 3FIXA 3KHXA 4ZY1A 2PJ7A 3D67A 4FD7A 1YX0A 4OC1A 2PJBA 2PJ3A 1LOKA 2NYQA 1P0HA 3DR6A 4C68A 4MFQA 4UF4A 1A2ZA 1IB1E 1CM0A 1LAPA 5AGEA 4FAIA 1R57A 1YSJA 3MRUA 2NSMA 3B3SA 4YGOA 5D8NA 5EMIA 1ZLIA 5GCNA 3SJXA 1YR0A 4OC2A 5E96A 3KQXA 4CGLA 4MFZA 3IJ3A 1I1DA 2B5GB 1S7LA 4UFWA 4CGMA 4CYOA 2HC9A 3PB8X 4H89A 4JXQA 4MBUA 2QECA 1S3ZA 2PC1A 5C82A 1Z8XA 3SI2A 4PK2A 3GKRA 3WC7A 4UBRA 4A94A 4MHZA 5F49A 4I49A 5JM6A 1V0CA 3D7HA 3QAHA 5LRKA 4B5OA 3SI0A 1YQEA 2Q7BA 3D4UA 2R7HA 2P6EA 4KOTA 5THWA 1CX8A 1UFHA 2ZEPA 4HNYB 3KZWA 2PJAA 5HH1A 4PXCA 3H5ZA 2YNDA 4UIBA 3IGRA 5KTCA 4HPSA 4EFDA 1TKFA 4B12A 1DTDA 2BEIA 4U5YA 1NSAA 3IWGA 3FNCA 4JYWA 4R76A 4F0XA 4QUSA 3PBEA 1XIXA 4NJRA 3S9MA 2IQ6A 1LANA 2Q43A 3KHZA 4MCSA 2B3UA 4GS4A 4OIWA 3IIBA 3S9NA 3H8FA 4O23A 4OADA 1ZG8A 2PRQA 4OKOA 3EC4A 3NE8A 4EWTA 2PIZA 2VBQA 2C6CA 2ZPAA 3N7ZA 3FVLA 4P4JA 3TOBA 2ZW6A 4IAVA 2Q51A 1XFOA 5CNPA 3GYAA 3KL9A 5DS0A 2WYRA 4DUKA 3TC8A 4BINA 1TIQA 1DE4C 2BO9A 2Z10A 1BAVA 1Q7LA 1HDQA 3JUWA 3KASA 3LWUA 4PSWA 3D66A 5G20A 3WC6A 2XEIA 4KUAA 1IIDA 5LYIA 1HEEA 3B3CA 3RYOA 2GLJA 3NE7A 4KVOE 1ARMA 5CPAA 5G1ZA 2EO8A 2ZXVA 2F5IA 4HNWB 4ZX8A 1Z8TA 3F5BA 4AVAA 4P6YA 5DWNA 1MJBA 3FECA 2DPSA 4KLWA 4B13A 2Q44A 1MJ9A 4OC3A 2ATRA 2HB6A 1LFWA 1KUXA 2ARHA 3K9UA 2Z3PA 4Q7AA 3EY5A 2PDOA 2AJ6A 4XPKA 3OWCA 4Q36A 1QSMA 1FT7A 2AFUA 2PIYA 3KQZA 1R43A 4A32A 3CXQA 2VL1A 2ODFA 2OU2A 5G22A 3FX6A 2F8HA 2ZEMA 3BXMA 4YRHA 2CNSA 4UCPA 4FD4A 3GY9A 3IO1A 4UA3A 1JQGA 2C1CA 4B6ZA 4Q38A 3LODA 2V8VA 1VHSA 2DF5A 2Q4ZA 4P44A 4MY3A 2KCWA 4OC4A 3IEHA 3I1UA 3VWDA 4LX9A 3FEDA 4UCMA 1LRZA 3EFAA 3GIUA 4F8ZA 3PBBA 4L89A 4MFPA 4EVYA 1S7FA 3P2FA 4FBEA 1F2OA 2ZEOA 3GLJA 4UEFA 5JPHA 4GM5A 3T8WA 1Y7RA 2Q0YA 3S6FA 3I9SA 3JVNA 2GANA 3B3VA 2VQYA 3FRMA 4OMEA 4P4BA 1ELMP 2P0WA 2G3TA 2CNMA 2B4DB 4J3GA 2C27A 1ELLP 4R8FA 2PJCA 4U9ZA 4AG9A 2C6PA 3EXNA 2EBJA 4NGMA 3FH4A 3S6KA 5ISVA 4HNXB 2CY2A 3TT2A 2BSWA 1XE4A 1NMTA 2ZEGA 4NF1A 1L0CA 3TX8A 3JRUA 4UEEA 2JDCA 4IUSA 2P6FA 2FIWA 4A39A 1I12A 4QB9A 2ZOGA 4NEXA 4CYNA 1AUGA 3GB0A 4AB7A 3B3TA 1Y0YA 4EMEA 5KTAA 3WR7A 1PUAA 4Z65A 1Z4RA 3CXPA 2J8NA 3V7ZA 1PYTB 1S7KA 4KOUA 4MRIA 4NGSA 4KVXA 5F48A 5BWAB 5I4MA 1ON0A 3HUVA 1YREA 4KSIA 2CF4A 4U9YA 2PJ8A 4CRYB 2RB7A 4CGNA 5JQ4A 2H5MA 3TE4A 3NFZA 3PEIA 8CPAA 1FNOA 1KUYA 4A95A 1YLEA 4RS2A 3TOAA 3RNZA 4KOYA 1N71A 3G8WA 3IFEA 3PB7X 2ZELA 2WPWA 3BHXA 3D3SA 3I3GA 1S60A 3T9YA 4ZY2A 2Q4YA 4Y49C 3DGVA 3CDXA 1CPSA 4WWVA 7CPAA 2WPXA 2OOTA 5J8CA 1NSLA 4X2TA 1YMEA 3UY5A 2FSRA 2QMLA 3SI1A 2CNTA 4UFXA 2PCUA 1CBXA 1OBRA 2F7VA 3DDDA 2ZEHA 2YGWA 3F8KA 4OIDA 2K5TA 3P2HA 4JXRA 2IMOA 3B35A 4M6IA 2B3VA 5C88A 3KR4A 4GXHA 2AFSA 4AVBA 1TXRA 4MMOA 1AYEA 4CAFA 4PV6A 3GUXA 1P4NA 5G21A 2QIRA 3CPAA 4CYQA 2B58A 2CTCA 2D4OA 2V8HA 5LYLA 3H8EA 1ZO0A 3FMCA 3F0AA 4F0YA 2PJ5A 4XPDC 4BMHA 3V38A 5F09A 4MCRA 5AG6A 1M4GA 3B7IA 2AFOA 3CXSA 2PQ8A 3NH4A 3RZAA 3BI1A 1YVOA 3PFEA 3RBUA 2XEGA 4E8OA 1Z4EA 5IB9A 1FY7A 1IOFA 3PB6X 1H8LA 3R9GA 2I3CA 4MHPA 1QMUA 3PRTA 3D8PA 4NSQA 5HVFA 1IY7A 4JJXA 4X3RA 3TCVA 2C6GA 4KSAA 1CP7A 4MCPA 4NGPA 1F2PA 3FF3A 5D29A 3S6HA 2I79A 3D7FA 4II9A 2PJ4A 3KKWA 1TKJA 2VZZA 3NH8A 4IF5A 4A38A 4NCZA 1XEBA 2ZEFA 4JZ0A 2PVVA 2FIAA 2FS5A 3PGPA 4LQ6A 4B14A 3JTKA 4UCNA 2VI7A 1CG2A 1LAMA 4C2YA 4F9UA 3LD2A 4BBHA 1KZFA 5HVHA 2P6GA 4NGTA 4DYOA 2B4DA 2ZENA 1YK3A 1XMBA 4CAXA 4P10A 4Y49B 1TKHA 4CAVA 4ZGYB 2EK8A 3QB8A 4A31A 5AG7A 5HXDA 3R1KA 5H86A 2PSWA 2GU2A 1XF8A 2J9AA 2OR4A 4OLLA 2FXFA 2WSAA 3LMSA 4A37A 3QNVA 2JDDA 3W91A 2X7BA 4KOXA 3SJFA 3V8IA 3WT4A 1M4IA 2QJ8A 2AFZA 3HLPA 2G3AA 2PJ1A 2XEJA 4UIAA 3FJUA 3ZZIA 1Z2LA 3CT9A 5A28A 2FT0A 1ZLHA 3IC1A 4R7MA 1YW4A 2REEA 2OB0A 2AE6A 5ELYA 5K8OA 3NH5A 4X8IA 2Z3LA 4P45A 2Q04A 4JLYA 4HKFA 3D7GA 4LQGA 1Q2CA 1RO5A 4OC0A 4R6TA 3R9EA 4TWEA 4MHDA 4KVME 4MFKA 1Y9KA 4XPDB 2POKA 2QVPA 4B5PA 2ZEEA 3FXTA 2Z3NA 1VHEA 3DSBA 2VXKA 1M44A 3PB9X 4M6HA 5IV0A 3IU2A 3B8GA 5LYDA 2V8GA 4JD6A 3B3WA 4NFRA 4OP4A 5FVJA 3VH9A 4NGQA 1R3NA 3C26A 4TNUA 5DWMA 1M4LA 4IK2A 4K30A 4C2XA 4C7HA 2VEZA 1IU8A 4P4DA 2OZUA 4X5KA 4KOWA 2PJ6A 1B87A 4ZYQA 4MI4A 3FEEA 2JBJA 2GE3A 1HDUA 3H4QA 1K4JA 2NMTA 5J1QA 4H6UA 4K3NA 1Z5RA 1KUVA 2PE3A 4G1PA 4KORA 2ANPA 4M85A 1XJOA 2R98A 2YNCC 1CP6A 2ZW7A 2EVNA 1CPXA 4IHMA 3TO7A 4B5PB 1VGYA 1GHEA 1NE9A 2XEFA 2GLFA 3G3SA 4F6AA 1QSNA 4MFJA 4FD5A 1VHOA 4CAWA 2GIVA 4PXDA 1PU9A 4MFLA 1U6MA 4R3LA 1OZPA 4A2ZA 4ZY0A 5IX3A 4ORFA 3A9LA 1J4JA 3TO9A 4BD9A 1WK4A 4CPAA 3TO6A 4KS9A 1YGHA 3ISZA 1TF9A 1IGBA 2CXAA 1S7NA 1VKCA 4PSXA 2A4NA 2BCOA 2O4HA 1WWZA 1BPMA 2FCKA 1YW6A 2IL4A 4XNHC 3BJ8A 2ABZA 2YNCA 2PR8A 1AMPA 4CGOA 4MHNA 2OZGA 5LRJA 5J8FA 4AXVA 3NA6A 4H6ZA 3D68A 4AVCA 4YFJA 6CPAA 4FD6A 4M6GA 2BOAA 4PK3A 1M1DA 2JLMA 1IICA 2EUIA 4OAEA 4R57A 1X10A 2ZW5A 4ZX9A 5F46A 3DLJA 1LCPA 3CPXA 5JH9A 1MJAA 3D7DA 3K2KA 1ZG7A 3CZXA 1YLOA 2Q4VA 4MJ8A 4UFVA 5H84A 4RUHA 1XMTA 4PXBA 1Q2DA 2G0BA 2O28A 1CJWA 4YU9A 2V77A 4AG7A 4RI1A 5CBMA 1Z9UA 5K8NA 4FWUA 3PZJA 4B10A 3T90A 2Z3OA 1KWMA 2PJ2A 2JBKA 2ZEDA 5IB0A 2PVWA 2GFQA 2J8MA 4FUUA 2BL1A 2JEVA 4LUAA 4MCQA 1QSRA 1BLLE 3R95A 4C7IA 4C2ZA 4CAEA 5JGFA 2J8RA 4E2AA 2FVGA 3TFYA 1BO4A 4MHYA 3BJ7A 2RFHA 2Y0MA 1YVKA 5K8PA 3W6SA 3RAMA 3WABA 4P4IA 2ZOFA 1BOBA 2OH1A 3E0KA 3K9TA 5A27A 1MK4A 1M4DA 1QSOA 1RTQA 2Z3KA 4KLVA 4NXYA 1I21A 4NGNA 3IWEA 5HMNA 2ZW4A 3PFOA 4XPLA 3PP9A 5AG4A 3ISXA 4PXEA 5AG5A 5F47A 5I0CA 1TF8A 2AFXA 4XNHB 4E0AA 4CGPA 3SXOA 3D2PA 1IYKA 2DPTA 2FE7A 2AFWA 1XBUA 2FL4A 2REFA 2Z3MA 4QBJA 4DNCA 3MN8A 3S6GA 2CIJA 4NJQA 5LYFA 1Y7EA 3EO4A 3N5FA 4JWPA 1RXTA 4A33A 2PRBA 1X12A 3FBUA 2QYVA 4QVTA 4PQAA 2DXQA 2PJ9A 2HUZA 2R8VA 2DEAA 2O53A 4P4FA 1PCAA
chains in the Genus database with same CATH topology
2WUUA 2B4BA 2HQYA 4KZTA 3D2MA 3FB3A 3ZJ0A 1S5KA 1B6BA 2Z11A 5EC4A 4KSFA 3FYNA 4R9MA 4M3SA 4KOVA 3TTHA 4CS0B 5KTDA 3SHPA 2BUEA 4A30A 3VWEA 5EBVA 3IU1A 4ZBGA 2OZHA 3W6XA 2VZYA 1IYLA 2YNEA 2D4PA 1Q2YA 2I00A 4UWJA 2RC4A 3DR8A 3SXNA 2R1IA 4B11A 4ONUA 4R3KA 3DNSA 3R96A 2PR1A 4QC6A 2Z0ZA 2HV2A 2B5GA 4KOSA 4CRZB 3R9FA 1QSTA 1Y9WA 3MGDA 1SQHA 4UWIA 4L8AA 4MY0A 4CYPA 3BLNA 4R87A 4KUBA 3FIXA 4FD7A 1YX0A 3DR6A 1P0HA 4C68A 4MFQA 1IB1E 1CM0A 5AGEA 1R57A 5GCNA 4YGOA 1YR0A 5E96A 4CGLA 4MFZA 1I1DA 2B5GB 1S7LA 4UFWA 4CGMA 4CYOA 4H89A 4JXQA 4MBUA 2QECA 1S3ZA 2PC1A 5C82A 4PK2A 3GKRA 4UBRA 5F49A 4I49A 1V0CA 3QAHA 4B5OA 2Q7BA 2R7HA 2P6EA 4KOTA 1UFHA 4HNYB 5HH1A 3H5ZA 2YNDA 3IGRA 5KTCA 4B12A 2BEIA 4U5YA 3IWGA 3FNCA 4F0XA 4QUSA 1XIXA 2B3UA 4GS4A 4OADA 3EC4A 4F0YA 3TOBA 2VBQA 2ZPAA 3N7ZA 2ZW6A 5CNPA 3GYAA 1TIQA 4PSWA 2Z10A 5G20A 3JUWA 4KUAA 1IIDA 3RYOA 3NE7A 4KVOE 5G1ZA 2ZXVA 2F5IA 4HNWB 3F5BA 4AVAA 5DWNA 1MJBA 4KLWA 2DPSA 4B13A 2Q44A 1MJ9A 2ATRA 1KUXA 2ARHA 3K9UA 2Z3PA 3EY5A 2PDOA 2AJ6A 4XPKA 3OWCA 4Q36A 1QSMA 4A32A 3CXQA 2OU2A 5G22A 4YRHA 2CNSA 4UCPA 4FD4A 3GY9A 4UA3A 4Q38A 3LODA 1VHSA 4MY3A 2KCWA 3VWDA 4LX9A 4UCMA 1LRZA 3EFAA 4L89A 4MFPA 4EVYA 1S7FA 3P2FA 5JPHA 1Y7RA 2Q0YA 3S6FA 3I9SA 3JVNA 2GANA 2VQYA 3FRMA 2P0WA 2G3TA 2CNMA 2B4DB 4J3GA 2C27A 4U9ZA 4AG9A 3EXNA 3S6KA 5ISVA 4HNXB 2CY2A 3TT2A 2BSWA 1XE4A 1NMTA 4NF1A 1L0CA 4IUSA 2JDCA 2P6FA 2FIWA 1I12A 4QB9A 4NEXA 4CYNA 4AB7A 5KTAA 3WR7A 1PUAA 1Z4RA 3CXPA 2J8NA 1S7KA 4KOUA 4KVXA 5F48A 5BWAB 1ON0A 1YREA 4U9YA 4CRYB 4CGNA 5JQ4A 2H5MA 3TE4A 1KUYA 4A95A 1YLEA 4RS2A 3TOAA 4KOYA 1N71A 3G8WA 2WPWA 3D3SA 3I3GA 1S60A 3T9YA 2Q4YA 4Y49C 2WPXA 5J8CA 1NSLA 3UY5A 2FSRA 2QMLA 2CNTA 4UFXA 3DDDA 2YGWA 3F8KA 2K5TA 3P2HA 4JXRA 5C88A 2B3VA 4AVBA 4CAFA 4PV6A 1P4NA 5G21A 2QIRA 4CYQA 2B58A 2D4OA 1ZO0A 3F0AA 4XPDC 4BMHA 5AG6A 1M4GA 3CXSA 2PQ8A 4E8OA 1YVOA 1Z4EA 1FY7A 3R9GA 3D8PA 4NSQA 4JJXA 3TCVA 4KSAA 3S6HA 2I79A 4II9A 4IF5A 3KKWA 2VZZA 4NCZA 1XEBA 2FIAA 2FS5A 3PGPA 4B14A 3JTKA 4UCNA 2VI7A 4C2YA 3LD2A 4BBHA 1KZFA 2P6GA 2B4DA 1YK3A 4CAXA 4Y49B 4CAVA 4ZGYB 3QB8A 4A31A 5AG7A 3R1KA 5H86A 2PSWA 1XF8A 4OLLA 2FXFA 2WSAA 2JDDA 3W91A 2X7BA 4KOXA 3V8IA 1M4IA 2G3AA 3ZZIA 5A28A 2FT0A 2REEA 2OB0A 2AE6A 2Z3LA 4JLYA 2Q04A 4HKFA 3R9EA 1Q2CA 1RO5A 4MHDA 4KVME 4MFKA 1Y9KA 4XPDB 4B5PA 3FXTA 2Z3NA 3DSBA 2VXKA 1M44A 5IV0A 3IU2A 3B8GA 4JD6A 5FVJA 3C26A 5DWMA 4K30A 4C2XA 4C7HA 2VEZA 2OZUA 4X5KA 4KOWA 1B87A 4MI4A 2GE3A 3H4QA 1K4JA 2NMTA 4H6UA 4KORA 1KUVA 4M85A 2R98A 2YNCC 2ZW7A 2EVNA 3TO7A 4B5PB 1GHEA 1NE9A 3G3SA 4F6AA 1QSNA 4MFJA 4FD5A 4CAWA 2GIVA 1PU9A 4MFLA 1U6MA 4R3LA 1OZPA 4A2ZA 5IX3A 4ORFA 3A9LA 1J4JA 3TO9A 1WK4A 3TO6A 4KS9A 1YGHA 2CXAA 1S7NA 1VKCA 4PSXA 2A4NA 1WWZA 2FCKA 2IL4A 4XNHC 3BJ8A 2YNCA 2PR8A 4CGOA 2OZGA 5J8FA 4H6ZA 4AVCA 4YFJA 4FD6A 4PK3A 1M1DA 2JLMA 1IICA 2EUIA 4OAEA 4R57A 2ZW5A 5F46A 1MJAA 4UFVA 4MJ8A 2Q4VA 5H84A 1XMTA 1Q2DA 2G0BA 2O28A 1CJWA 4AG7A 4RI1A 1Z9UA 3PZJA 4B10A 3T90A 2Z3OA 5IB0A 2J8MA 2BL1A 2JEVA 4LUAA 1QSRA 3R95A 4C7IA 4C2ZA 4CAEA 2J8RA 4E2AA 3TFYA 1BO4A 3BJ7A 2Y0MA 1YVKA 3W6SA 1BOBA 2OH1A 3E0KA 5A27A 1MK4A 1M4DA 1QSOA 2Z3KA 4KLVA 4NXYA 5HMNA 1I21A 5I0CA 3IWEA 2ZW4A 4XPLA 3PP9A 5AG4A 5AG5A 5F47A 4XNHB 4E0AA 4CGPA 3SXOA 3D2PA 1IYKA 2DPTA 2FE7A 2FL4A 2Z3MA 4QBJA 2REFA 4DNCA 3S6GA 3EO4A 4JWPA 1RXTA 4A33A 2PRBA 3FBUA 4QVTA 2DXQA 2HUZA 2R8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4B A;  2HQY A;  4KZT A;  3D2M A;  3FB3 A;  3ZJ0 A;  1S5K A;  1B6B A;  2Z11 A;  5EC4 A;  3FYN A;  4R9M A;  4M3S A;  4KOV A;  3TTH A;  4CS0 B;  5KTD A;  3SHP A;  2BUE A;  3VWE A;  5EBV A;  4ZBG A;  2OZH A;  3W6X A;  2VZY A;  1IYL A;  2D4P A;  1Q2Y A;  2I00 A;  4UWJ A;  2RC4 A;  3DR8 A;  3SXN A;  2R1I A;  4ONU A;  4R3K A;  3DNS A;  3R96 A;  2PR1 A;  4QC6 A;  2Z0Z A;  2HV2 A;  2B5G A;  4KOS A;  4CRZ B;  3R9F A;  1QST A;  1Y9W A;  3MGD A;  1SQH A;  4UWI A;  4L8A A;  4MY0 A;  3BLN A;  4R87 A;  4KUB A;  3FIX A;  4FD7 A;  1YX0 A;  3DR6 A;  1P0H A;  1IB1 E;  1CM0 A;  1R57 A;  5GCN A;  4YGO A;  1YR0 A;  5E96 A;  1I1D A;  2B5G B;  1S7L A;  4H89 A;  4JXQ A;  4MBU A;  2QEC A;  1S3Z A;  2PC1 A;  5C82 A;  4PK2 A;  3GKR A;  4UBR A;  5F49 A;  4I49 A;  1V0C A;  3QAH A;  4B5O A;  2Q7B A;  2R7H A;  2P6E A;  4KOT A;  1UFH A;  4HNY B;  5HH1 A;  3IGR A;  5KTC A;  2BEI A;  4U5Y A;  3IWG A;  3FNC A;  4QUS A;  1XIX A;  2B3U A;  4GS4 A;  4OAD A;  3EC4 A;  4F0Y A;  3TOB A;  2VBQ A;  2ZPA A;  3N7Z A;  2ZW6 A;  5CNP A;  3GYA A;  1TIQ A;  4PSW A;  2Z10 A;  3JUW A;  4KUA A;  1IID A;  3RYO A;  3NE7 A;  4KVO E;  2ZXV A;  2F5I A;  4HNW B;  3F5B A;  4AVA A;  5DWN A;  1MJB A;  4KLW A;  2Q44 A;  1MJ9 A;  2ATR A;  1KUX A;  2ARH A;  3K9U A;  3EY5 A;  2PDO A;  2AJ6 A;  4XPK A;  3OWC A;  1QSM A;  3CXQ A;  2OU2 A;  4YRH A;  2CNS A;  4FD4 A;  3GY9 A;  4UA3 A;  3LOD A;  1VHS A;  4MY3 A;  2KCW A;  3VWD A;  4LX9 A;  1LRZ A;  3EFA A;  4L89 A;  4EVY A;  1S7F A;  3P2F A;  5JPH A;  1Y7R A;  2Q0Y A;  3S6F A;  3I9S A;  3JVN A;  2GAN A;  2VQY A;  3FRM A;  2P0W A;  2G3T A;  2CNM A;  2B4D B;  4J3G A;  2C27 A;  4U9Z A;  4AG9 A;  3EXN A;  3S6K A;  5ISV A;  4HNX B;  2CY2 A;  3TT2 A;  2BSW A;  1XE4 A;  1NMT A;  4NF1 A;  1L0C A;  4IUS A;  2JDC A;  2P6F A;  2FIW A;  1I12 A;  4QB9 A;  4NEX A;  4AB7 A;  5KTA A;  3WR7 A;  1PUA A;  1Z4R A;  3CXP A;  2J8N A;  1S7K A;  4KOU A;  4KVX A;  5F48 A;  1ON0 A;  1YRE A;  4U9Y A;  4CRY B;  5JQ4 A;  2H5M A;  3TE4 A;  1KUY A;  1YLE A;  4RS2 A;  3TOA A;  4KOY A;  1N71 A;  3G8W A;  2WPW A;  3D3S A;  3I3G A;  1S60 A;  3T9Y A;  2Q4Y A;  4Y49 C;  2WPX A;  5J8C A;  1NSL A;  3UY5 A;  2FSR A;  2QML A;  2CNT A;  3DDD A;  3F8K A;  2K5T A;  3P2H A;  4JXR A;  5C88 A;  2B3V A;  4AVB A;  4PV6 A;  1P4N A;  2QIR A;  2B58 A;  2D4O A;  3F0A A;  4XPD C;  4BMH A;  1M4G A;  3CXS A;  2PQ8 A;  4E8O A;  1YVO A;  1Z4E A;  1FY7 A;  3R9G A;  3D8P A;  4NSQ A;  4JJX A;  3TCV A;  3S6H A;  2I79 A;  4II9 A;  4IF5 A;  3KKW A;  2VZZ A;  4NCZ A;  1XEB A;  2FIA A;  2FS5 A;  3PGP A;  2VI7 A;  3LD2 A;  1KZF A;  2P6G A;  2B4D A;  1YK3 A;  4CAX A;  4Y49 B;  4CAV A;  3QB8 A;  3R1K A;  5H86 A;  2PSW A;  1XF8 A;  4OLL A;  2FXF A;  2JDD A;  3W91 A;  2X7B A;  4KOX A;  3V8I A;  1M4I A;  2G3A A;  3ZZI A;  2FT0 A;  2REE A;  2OB0 A;  2AE6 A;  4JLY A;  2Q04 A;  4HKF A;  3R9E A;  1Q2C A;  1RO5 A;  4MHD A;  4KVM E;  1Y9K A;  4XPD B;  4B5P A;  3FXT A;  3DSB A;  2VXK A;  1M44 A;  5IV0 A;  3B8G A;  4JD6 A;  5FVJ A;  3C26 A;  5DWM A;  4K30 A;  2VEZ A;  2OZU A;  4X5K A;  4KOW A;  1B87 A;  4MI4 A;  2GE3 A;  3H4Q A;  1K4J A;  2NMT A;  4H6U A;  4KOR A;  1KUV A;  4M85 A;  2R98 A;  2ZW7 A;  2EVN A;  3TO7 A;  4B5P B;  1GHE A;  1NE9 A;  3G3S A;  4F6A A;  1QSN A;  4FD5 A;  4CAW A;  2GIV A;  1PU9 A;  4R3L A;  1U6M A;  5IX3 A;  1OZP A;  4ORF A;  1J4J A;  3TO9 A;  1WK4 A;  3TO6 A;  1YGH A;  1S7N A;  1VKC A;  4PSX A;  2A4N A;  1WWZ A;  2FCK A;  2IL4 A;  4XNH C;  3BJ8 A;  2PR8 A;  2OZG A;  5J8F A;  4H6Z A;  4AVC A;  4YFJ A;  4FD6 A;  4PK3 A;  1M1D A;  2JLM A;  1IIC A;  2EUI A;  4OAE A;  4R57 A;  2ZW5 A;  5F46 A;  1MJA A;  4MJ8 A;  2Q4V A;  5H84 A;  1XMT A;  1Q2D A;  2G0B A;  2O28 A;  1CJW A;  4AG7 A;  4RI1 A;  1Z9U A;  3PZJ A;  3T90 A;  5IB0 A;  2J8M A;  2BL1 A;  2JEV A;  4LUA A;  1QSR A;  3R95 A;  2J8R A;  4E2A A;  3TFY A;  1BO4 A;  3BJ7 A;  2Y0M A;  1YVK A;  3W6S A;  1BOB A;  2OH1 A;  3E0K A;  1MK4 A;  1M4D A;  1QSO A;  4KLV A;  4NXY A;  5HMN A;  5I0C A;  1I21 A;  2ZW4 A;  4XPL A;  3PP9 A;  5F47 A;  4XNH B;  4E0A A;  3SXO A;  3D2P A;  1IYK A;  2FE7 A;  2FL4 A;  4QBJ A;  2REF A;  4DNC A;  3S6G A;  3EO4 A;  4JWP A;  1RXT A;  2PRB A;  3FBU A;  4QVT A;  2DXQ A;  2HUZ A;  2R8V A; 
#chains in the Genus database with same CATH topology
 4OC5 A;  1QQ9 A;  1VIX A;  4ZI6 A;  2WUU A;  2B4B A;  2HQY A;  4KZT A;  2IJZ A;  3D2M A;  4H2K A;  3IWW A;  3FB3 A;  1BPN A;  2CTB A;  3ZJ0 A;  1S5K A;  1B6B A;  2Z11 A;  3B2Y A;  4F9V A;  5EC4 A;  4KSF A;  3KGQ A;  3FYN A;  3KR5 A;  3LAC A;  4R9M A;  1Y0R A;  4NGR A;  2V8D A;  3KI9 A;  1ARL A;  4M3S A;  4KOV A;  3TTH A;  4CS0 B;  2JEW A;  5KTD A;  3SHP A;  2BUE A;  2WZN A;  3VAR A;  4PPZ A;  4A30 A;  1F57 A;  3VWE A;  5LRG A;  5EBV A;  4YWY A;  3IU1 A;  4ZBG A;  2OZH A;  3W6X A;  1IOI A;  3BI0 A;  2VZY A;  1IYL A;  2YNE A;  2GRE A;  3PB4 X;  3QAY A;  2D4P A;  2I00 A;  1Q2Y A;  1XRY A;  2EK9 A;  3H8G A;  4UWJ A;  3RO0 A;  3VAT A;  2RC4 A;  3DR8 A;  3SXN A;  2R1I A;  3S9L A;  3SJE A;  1UWY A;  4ONU A;  4B11 A;  4R3K A;  4ONW A;  4WJB A;  3DNS A;  3R96 A;  1EE3 P;  2PR1 A;  1Z8W A;  4QC6 A;  2EWB A;  2Z0Z A;  4W9Y A;  4RN7 A;  4DJL A;  2HV2 A;  2PJ0 A;  1XOV A;  2B5G A;  4KOS A;  4CRZ B;  1JWQ A;  2Q7S A;  4P4E A;  3R9F A;  1QST A;  1Y9W A;  3WC5 A;  5K8M A;  1GYT A;  3SJG A;  3MGD A;  1SQH A;  4UWI A;  1Z8L A;  2AFM A;  1ZG9 A;  4L8A A;  2G9D A;  4UEZ A;  4MXU A;  4MY0 A;  4CYP A;  3BLN A;  4R87 A;  5HVG A;  3L2N A;  4KUB A;  3FIX A;  3KHX A;  4ZY1 A;  2PJ7 A;  3D67 A;  4FD7 A;  1YX0 A;  4OC1 A;  2PJB A;  2PJ3 A;  1LOK A;  2NYQ A;  1P0H A;  3DR6 A;  4C68 A;  4MFQ A;  4UF4 A;  1A2Z A;  1IB1 E;  1CM0 A;  1LAP A;  5AGE A;  4FAI A;  1R57 A;  1YSJ A;  3MRU A;  2NSM A;  3B3S A;  4YGO A;  5D8N A;  5EMI A;  1ZLI A;  5GCN A;  3SJX A;  1YR0 A;  4OC2 A;  5E96 A;  3KQX A;  4CGL A;  4MFZ A;  3IJ3 A;  1I1D A;  2B5G B;  1S7L A;  4UFW A;  4CGM A;  4CYO A;  2HC9 A;  3PB8 X;  4H89 A;  4JXQ A;  4MBU A;  2QEC A;  1S3Z A;  2PC1 A;  5C82 A;  1Z8X A;  3SI2 A;  4PK2 A;  3GKR A;  3WC7 A;  4UBR A;  4A94 A;  4MHZ A;  5F49 A;  4I49 A;  5JM6 A;  1V0C A;  3D7H A;  3QAH A;  5LRK A;  4B5O A;  3SI0 A;  1YQE A;  2Q7B A;  3D4U A;  2R7H A;  2P6E A;  4KOT A;  5THW A;  1CX8 A;  1UFH A;  2ZEP A;  4HNY B;  3KZW A;  2PJA A;  5HH1 A;  4PXC A;  3H5Z A;  2YND A;  4UIB A;  3IGR A;  5KTC A;  4HPS A;  4EFD A;  1TKF A;  4B12 A;  1DTD A;  2BEI A;  4U5Y A;  1NSA A;  3IWG A;  3FNC A;  4JYW A;  4R76 A;  4F0X A;  4QUS A;  3PBE A;  1XIX A;  4NJR A;  3S9M A;  2IQ6 A;  1LAN A;  2Q43 A;  3KHZ A;  4MCS A;  2B3U A;  4GS4 A;  4OIW A;  3IIB A;  3S9N A;  3H8F A;  4O23 A;  4OAD A;  1ZG8 A;  2PRQ A;  4OKO A;  3EC4 A;  3NE8 A;  4EWT A;  2PIZ A;  2VBQ A;  2C6C A;  2ZPA A;  3N7Z A;  3FVL A;  4P4J A;  3TOB A;  2ZW6 A;  4IAV A;  2Q51 A;  1XFO A;  5CNP A;  3GYA A;  3KL9 A;  5DS0 A;  2WYR A;  4DUK A;  3TC8 A;  4BIN A;  1TIQ A;  1DE4 C;  2BO9 A;  2Z10 A;  1BAV A;  1Q7L A;  1HDQ A;  3JUW A;  3KAS A;  3LWU A;  4PSW A;  3D66 A;  5G20 A;  3WC6 A;  2XEI A;  4KUA A;  1IID A;  5LYI A;  1HEE A;  3B3C A;  3RYO A;  2GLJ A;  3NE7 A;  4KVO E;  1ARM A;  5CPA A;  5G1Z A;  2EO8 A;  2ZXV A;  2F5I A;  4HNW B;  4ZX8 A;  1Z8T A;  3F5B A;  4AVA A;  4P6Y A;  5DWN A;  1MJB A;  3FEC A;  2DPS A;  4KLW A;  4B13 A;  2Q44 A;  1MJ9 A;  4OC3 A;  2ATR A;  2HB6 A;  1LFW A;  1KUX A;  2ARH A;  3K9U A;  2Z3P A;  4Q7A A;  3EY5 A;  2PDO A;  2AJ6 A;  4XPK A;  3OWC A;  4Q36 A;  1QSM A;  1FT7 A;  2AFU A;  2PIY A;  3KQZ A;  1R43 A;  4A32 A;  3CXQ A;  2VL1 A;  2ODF A;  2OU2 A;  5G22 A;  3FX6 A;  2F8H A;  2ZEM A;  3BXM A;  4YRH A;  2CNS A;  4UCP A;  4FD4 A;  3GY9 A;  3IO1 A;  4UA3 A;  1JQG A;  2C1C A;  4B6Z A;  4Q38 A;  3LOD A;  2V8V A;  1VHS A;  2DF5 A;  2Q4Z A;  4P44 A;  4MY3 A;  2KCW A;  4OC4 A;  3IEH A;  3I1U A;  3VWD A;  4LX9 A;  3FED A;  4UCM A;  1LRZ A;  3EFA A;  3GIU A;  4F8Z A;  3PBB A;  4L89 A;  4MFP A;  4EVY A;  1S7F A;  3P2F A;  4FBE A;  1F2O A;  2ZEO A;  3GLJ A;  4UEF A;  5JPH A;  4GM5 A;  3T8W A;  1Y7R A;  2Q0Y A;  3S6F A;  3I9S A;  3JVN A;  2GAN A;  3B3V A;  2VQY A;  3FRM A;  4OME A;  4P4B A;  1ELM P;  2P0W A;  2G3T A;  2CNM A;  2B4D B;  4J3G A;  2C27 A;  1ELL P;  4R8F A;  2PJC A;  4U9Z A;  4AG9 A;  2C6P A;  3EXN A;  2EBJ A;  4NGM A;  3FH4 A;  3S6K A;  5ISV A;  4HNX B;  2CY2 A;  3TT2 A;  2BSW A;  1XE4 A;  1NMT A;  2ZEG A;  4NF1 A;  1L0C A;  3TX8 A;  3JRU A;  4UEE A;  2JDC A;  4IUS A;  2P6F A;  2FIW A;  4A39 A;  1I12 A;  4QB9 A;  2ZOG A;  4NEX A;  4CYN A;  1AUG A;  3GB0 A;  4AB7 A;  3B3T A;  1Y0Y A;  4EME A;  5KTA A;  3WR7 A;  1PUA A;  4Z65 A;  1Z4R A;  3CXP A;  2J8N A;  3V7Z A;  1PYT B;  1S7K A;  4KOU A;  4MRI A;  4NGS A;  4KVX A;  5F48 A;  5BWA B;  5I4M A;  1ON0 A;  3HUV A;  1YRE A;  4KSI A;  2CF4 A;  4U9Y A;  2PJ8 A;  4CRY B;  2RB7 A;  4CGN A;  5JQ4 A;  2H5M A;  3TE4 A;  3NFZ A;  3PEI A;  8CPA A;  1FNO A;  1KUY A;  4A95 A;  1YLE A;  4RS2 A;  3TOA A;  3RNZ A;  4KOY A;  1N71 A;  3G8W A;  3IFE A;  3PB7 X;  2ZEL A;  2WPW A;  3BHX A;  3D3S A;  3I3G A;  1S60 A;  3T9Y A;  4ZY2 A;  2Q4Y A;  4Y49 C;  3DGV A;  3CDX A;  1CPS A;  4WWV A;  7CPA A;  2WPX A;  2OOT A;  5J8C A;  1NSL A;  4X2T A;  1YME A;  3UY5 A;  2FSR A;  2QML A;  3SI1 A;  2CNT A;  4UFX A;  2PCU A;  1CBX A;  1OBR A;  2F7V A;  3DDD A;  2ZEH A;  2YGW A;  3F8K A;  4OID A;  2K5T A;  3P2H A;  4JXR A;  2IMO A;  3B35 A;  4M6I A;  2B3V A;  5C88 A;  3KR4 A;  4GXH A;  2AFS A;  4AVB A;  1TXR A;  4MMO A;  1AYE A;  4CAF A;  4PV6 A;  3GUX A;  1P4N A;  5G21 A;  2QIR A;  3CPA A;  4CYQ A;  2B58 A;  2CTC A;  2D4O A;  2V8H A;  5LYL A;  3H8E A;  1ZO0 A;  3FMC A;  3F0A A;  4F0Y A;  2PJ5 A;  4XPD C;  4BMH A;  3V38 A;  5F09 A;  4MCR A;  5AG6 A;  1M4G A;  3B7I A;  2AFO A;  3CXS A;  2PQ8 A;  3NH4 A;  3RZA A;  3BI1 A;  1YVO A;  3PFE A;  3RBU A;  2XEG A;  4E8O A;  1Z4E A;  5IB9 A;  1FY7 A;  1IOF A;  3PB6 X;  1H8L A;  3R9G A;  2I3C A;  4MHP A;  1QMU A;  3PRT A;  3D8P A;  4NSQ A;  5HVF A;  1IY7 A;  4JJX A;  4X3R A;  3TCV A;  2C6G A;  4KSA A;  1CP7 A;  4MCP A;  4NGP A;  1F2P A;  3FF3 A;  5D29 A;  3S6H A;  2I79 A;  3D7F A;  4II9 A;  2PJ4 A;  3KKW A;  1TKJ A;  2VZZ A;  3NH8 A;  4IF5 A;  4A38 A;  4NCZ A;  1XEB A;  2ZEF A;  4JZ0 A;  2PVV A;  2FIA A;  2FS5 A;  3PGP A;  4LQ6 A;  4B14 A;  3JTK A;  4UCN A;  2VI7 A;  1CG2 A;  1LAM A;  4C2Y A;  4F9U A;  3LD2 A;  4BBH A;  1KZF A;  5HVH A;  2P6G A;  4NGT A;  4DYO A;  2B4D A;  2ZEN A;  1YK3 A;  1XMB A;  4CAX A;  4P10 A;  4Y49 B;  1TKH A;  4CAV A;  4ZGY B;  2EK8 A;  3QB8 A;  4A31 A;  5AG7 A;  5HXD A;  3R1K A;  5H86 A;  2PSW A;  2GU2 A;  1XF8 A;  2J9A A;  2OR4 A;  4OLL A;  2FXF A;  2WSA A;  3LMS A;  4A37 A;  3QNV A;  2JDD A;  3W91 A;  2X7B A;  4KOX A;  3SJF A;  3V8I A;  3WT4 A;  1M4I A;  2QJ8 A;  2AFZ A;  3HLP A;  2G3A A;  2PJ1 A;  2XEJ A;  4UIA A;  3FJU A;  3ZZI A;  1Z2L A;  3CT9 A;  5A28 A;  2FT0 A;  1ZLH A;  3IC1 A;  4R7M A;  1YW4 A;  2REE A;  2OB0 A;  2AE6 A;  5ELY A;  5K8O A;  3NH5 A;  4X8I A;  2Z3L A;  4P45 A;  2Q04 A;  4JLY A;  4HKF A;  3D7G A;  4LQG A;  1Q2C A;  1RO5 A;  4OC0 A;  4R6T A;  3R9E A;  4TWE A;  4MHD A;  4KVM E;  4MFK A;  1Y9K A;  4XPD B;  2POK A;  2QVP A;  4B5P A;  2ZEE A;  3FXT A;  2Z3N A;  1VHE A;  3DSB A;  2VXK A;  1M44 A;  3PB9 X;  4M6H A;  5IV0 A;  3IU2 A;  3B8G A;  5LYD A;  2V8G A;  4JD6 A;  3B3W A;  4NFR A;  4OP4 A;  5FVJ A;  3VH9 A;  4NGQ A;  1R3N A;  3C26 A;  4TNU A;  5DWM A;  1M4L A;  4IK2 A;  4K30 A;  4C2X A;  4C7H A;  2VEZ A;  1IU8 A;  4P4D A;  2OZU A;  4X5K A;  4KOW A;  2PJ6 A;  1B87 A;  4ZYQ A;  4MI4 A;  3FEE A;  2JBJ A;  2GE3 A;  1HDU A;  3H4Q A;  1K4J A;  2NMT A;  5J1Q A;  4H6U A;  4K3N A;  1Z5R A;  1KUV A;  2PE3 A;  4G1P A;  4KOR A;  2ANP A;  4M85 A;  1XJO A;  2R98 A;  2YNC C;  1CP6 A;  2ZW7 A;  2EVN A;  1CPX A;  4IHM A;  3TO7 A;  4B5P B;  1VGY A;  1GHE A;  1NE9 A;  2XEF A;  2GLF A;  3G3S A;  4F6A A;  1QSN A;  4MFJ A;  4FD5 A;  1VHO A;  4CAW A;  2GIV A;  4PXD A;  1PU9 A;  4MFL A;  1U6M A;  4R3L A;  1OZP A;  4A2Z A;  4ZY0 A;  5IX3 A;  4ORF A;  3A9L A;  1J4J A;  3TO9 A;  4BD9 A;  1WK4 A;  4CPA A;  3TO6 A;  4KS9 A;  1YGH A;  3ISZ A;  1TF9 A;  1IGB A;  2CXA A;  1S7N A;  1VKC A;  4PSX A;  2A4N A;  2BCO A;  2O4H A;  1WWZ A;  1BPM A;  2FCK A;  1YW6 A;  2IL4 A;  4XNH C;  3BJ8 A;  2ABZ A;  2YNC A;  2PR8 A;  1AMP A;  4CGO A;  4MHN A;  2OZG A;  5LRJ A;  5J8F A;  4AXV A;  3NA6 A;  4H6Z A;  3D68 A;  4AVC A;  4YFJ A;  6CPA A;  4FD6 A;  4M6G A;  2BOA A;  4PK3 A;  1M1D A;  2JLM A;  1IIC A;  2EUI A;  4OAE A;  4R57 A;  1X10 A;  2ZW5 A;  4ZX9 A;  5F46 A;  3DLJ A;  1LCP A;  3CPX A;  5JH9 A;  1MJA A;  3D7D A;  3K2K A;  1ZG7 A;  3CZX A;  1YLO A;  2Q4V A;  4MJ8 A;  4UFV A;  5H84 A;  4RUH A;  1XMT A;  4PXB A;  1Q2D A;  2G0B A;  2O28 A;  1CJW A;  4YU9 A;  2V77 A;  4AG7 A;  4RI1 A;  5CBM A;  1Z9U A;  5K8N A;  4FWU A;  3PZJ A;  4B10 A;  3T90 A;  2Z3O A;  1KWM A;  2PJ2 A;  2JBK A;  2ZED A;  5IB0 A;  2PVW A;  2GFQ A;  2J8M A;  4FUU A;  2BL1 A;  2JEV A;  4LUA A;  4MCQ A;  1QSR A;  1BLL E;  3R95 A;  4C7I A;  4C2Z A;  4CAE A;  5JGF A;  2J8R A;  4E2A A;  2FVG A;  3TFY A;  1BO4 A;  4MHY A;  3BJ7 A;  2RFH A;  2Y0M A;  1YVK A;  5K8P A;  3W6S A;  3RAM A;  3WAB A;  4P4I A;  2ZOF A;  1BOB A;  2OH1 A;  3E0K A;  3K9T A;  5A27 A;  1MK4 A;  1M4D A;  1QSO A;  1RTQ A;  2Z3K A;  4KLV A;  4NXY A;  1I21 A;  4NGN A;  3IWE A;  5HMN A;  2ZW4 A;  3PFO A;  4XPL A;  3PP9 A;  5AG4 A;  3ISX A;  4PXE A;  5AG5 A;  5F47 A;  5I0C A;  1TF8 A;  2AFX A;  4XNH B;  4E0A A;  4CGP A;  3SXO A;  3D2P A;  1IYK A;  2DPT A;  2FE7 A;  2AFW A;  1XBU A;  2FL4 A;  2REF A;  2Z3M A;  4QBJ A;  4DNC A;  3MN8 A;  3S6G A;  2CIJ A;  4NJQ A;  5LYF A;  1Y7E A;  3EO4 A;  3N5F A;  4JWP A;  1RXT A;  4A33 A;  2PRB A;  1X12 A;  3FBU A;  2QYV A;  4QVT A;  4PQA A;  2DXQ A;  2PJ9 A;  2HUZ A;  2R8V A;  2DEA A;  2O53 A;  4P4F A;  1PCA A; 
#chains in the Genus database with same CATH homology
 2WUU A;  2B4B A;  2HQY A;  4KZT A;  3D2M A;  3FB3 A;  3ZJ0 A;  1S5K A;  1B6B A;  2Z11 A;  5EC4 A;  4KSF A;  3FYN A;  4R9M A;  4M3S A;  4KOV A;  3TTH A;  4CS0 B;  5KTD A;  3SHP A;  2BUE A;  4A30 A;  3VWE A;  5EBV A;  3IU1 A;  4ZBG A;  2OZH A;  3W6X A;  2VZY A;  1IYL A;  2YNE A;  2D4P A;  1Q2Y A;  2I00 A;  4UWJ A;  2RC4 A;  3DR8 A;  3SXN A;  2R1I A;  4B11 A;  4ONU A;  4R3K A;  3DNS A;  3R96 A;  2PR1 A;  4QC6 A;  2Z0Z A;  2HV2 A;  2B5G A;  4KOS A;  4CRZ B;  3R9F A;  1QST A;  1Y9W A;  3MGD A;  1SQH A;  4UWI A;  4L8A A;  4MY0 A;  4CYP A;  3BLN A;  4R87 A;  4KUB A;  3FIX A;  4FD7 A;  1YX0 A;  3DR6 A;  1P0H A;  4C68 A;  4MFQ A;  1IB1 E;  1CM0 A;  5AGE A;  1R57 A;  5GCN A;  4YGO A;  1YR0 A;  5E96 A;  4CGL A;  4MFZ A;  1I1D A;  2B5G B;  1S7L A;  4UFW A;  4CGM A;  4CYO A;  4H89 A;  4JXQ A;  4MBU A;  2QEC A;  1S3Z A;  2PC1 A;  5C82 A;  4PK2 A;  3GKR A;  4UBR A;  5F49 A;  4I49 A;  1V0C A;  3QAH A;  4B5O A;  2Q7B A;  2R7H A;  2P6E A;  4KOT A;  1UFH A;  4HNY B;  5HH1 A;  3H5Z A;  2YND A;  3IGR A;  5KTC A;  4B12 A;  2BEI A;  4U5Y A;  3IWG A;  3FNC A;  4F0X A;  4QUS A;  1XIX A;  2B3U A;  4GS4 A;  4OAD A;  3EC4 A;  4F0Y A;  3TOB A;  2VBQ A;  2ZPA A;  3N7Z A;  2ZW6 A;  5CNP A;  3GYA A;  1TIQ A;  4PSW A;  2Z10 A;  5G20 A;  3JUW A;  4KUA A;  1IID A;  3RYO A;  3NE7 A;  4KVO E;  5G1Z A;  2ZXV A;  2F5I A;  4HNW B;  3F5B A;  4AVA A;  5DWN A;  1MJB A;  4KLW A;  2DPS A;  4B13 A;  2Q44 A;  1MJ9 A;  2ATR A;  1KUX A;  2ARH A;  3K9U A;  2Z3P A;  3EY5 A;  2PDO A;  2AJ6 A;  4XPK A;  3OWC A;  4Q36 A;  1QSM A;  4A32 A;  3CXQ A;  2OU2 A;  5G22 A;  4YRH A;  2CNS A;  4UCP A;  4FD4 A;  3GY9 A;  4UA3 A;  4Q38 A;  3LOD A;  1VHS A;  4MY3 A;  2KCW A;  3VWD A;  4LX9 A;  4UCM A;  1LRZ A;  3EFA A;  4L89 A;  4MFP A;  4EVY A;  1S7F A;  3P2F A;  5JPH A;  1Y7R A;  2Q0Y A;  3S6F A;  3I9S A;  3JVN A;  2GAN A;  2VQY A;  3FRM A;  2P0W A;  2G3T A;  2CNM A;  2B4D B;  4J3G A;  2C27 A;  4U9Z A;  4AG9 A;  3EXN A;  3S6K A;  5ISV A;  4HNX B;  2CY2 A;  3TT2 A;  2BSW A;  1XE4 A;  1NMT A;  4NF1 A;  1L0C A;  4IUS A;  2JDC A;  2P6F A;  2FIW A;  1I12 A;  4QB9 A;  4NEX A;  4CYN A;  4AB7 A;  5KTA A;  3WR7 A;  1PUA A;  1Z4R A;  3CXP A;  2J8N A;  1S7K A;  4KOU A;  4KVX A;  5F48 A;  5BWA B;  1ON0 A;  1YRE A;  4U9Y A;  4CRY B;  4CGN A;  5JQ4 A;  2H5M A;  3TE4 A;  1KUY A;  4A95 A;  1YLE A;  4RS2 A;  3TOA A;  4KOY A;  1N71 A;  3G8W A;  2WPW A;  3D3S A;  3I3G A;  1S60 A;  3T9Y A;  2Q4Y A;  4Y49 C;  2WPX A;  5J8C A;  1NSL A;  3UY5 A;  2FSR A;  2QML A;  2CNT A;  4UFX A;  3DDD A;  2YGW A;  3F8K A;  2K5T A;  3P2H A;  4JXR A;  5C88 A;  2B3V A;  4AVB A;  4CAF A;  4PV6 A;  1P4N A;  5G21 A;  2QIR A;  4CYQ A;  2B58 A;  2D4O A;  1ZO0 A;  3F0A A;  4XPD C;  4BMH A;  5AG6 A;  1M4G A;  3CXS A;  2PQ8 A;  4E8O A;  1YVO A;  1Z4E A;  1FY7 A;  3R9G A;  3D8P A;  4NSQ A;  4JJX A;  3TCV A;  4KSA A;  3S6H A;  2I79 A;  4II9 A;  4IF5 A;  3KKW A;  2VZZ A;  4NCZ A;  1XEB A;  2FIA A;  2FS5 A;  3PGP A;  4B14 A;  3JTK A;  4UCN A;  2VI7 A;  4C2Y A;  3LD2 A;  4BBH A;  1KZF A;  2P6G A;  2B4D A;  1YK3 A;  4CAX A;  4Y49 B;  4CAV A;  4ZGY B;  3QB8 A;  4A31 A;  5AG7 A;  3R1K A;  5H86 A;  2PSW A;  1XF8 A;  4OLL A;  2FXF A;  2WSA A;  2JDD A;  3W91 A;  2X7B A;  4KOX A;  3V8I A;  1M4I A;  2G3A A;  3ZZI A;  5A28 A;  2FT0 A;  2REE A;  2OB0 A;  2AE6 A;  2Z3L A;  4JLY A;  2Q04 A;  4HKF A;  3R9E A;  1Q2C A;  1RO5 A;  4MHD A;  4KVM E;  4MFK A;  1Y9K A;  4XPD B;  4B5P A;  3FXT A;  2Z3N A;  3DSB A;  2VXK A;  1M44 A;  5IV0 A;  3IU2 A;  3B8G A;  4JD6 A;  5FVJ A;  3C26 A;  5DWM A;  4K30 A;  4C2X A;  4C7H A;  2VEZ A;  2OZU A;  4X5K A;  4KOW A;  1B87 A;  4MI4 A;  2GE3 A;  3H4Q A;  1K4J A;  2NMT A;  4H6U A;  4KOR A;  1KUV A;  4M85 A;  2R98 A;  2YNC C;  2ZW7 A;  2EVN A;  3TO7 A;  4B5P B;  1GHE A;  1NE9 A;  3G3S A;  4F6A A;  1QSN A;  4MFJ A;  4FD5 A;  4CAW A;  2GIV A;  1PU9 A;  4MFL A;  1U6M A;  4R3L A;  1OZP A;  4A2Z A;  5IX3 A;  4ORF A;  3A9L A;  1J4J A;  3TO9 A;  1WK4 A;  3TO6 A;  4KS9 A;  1YGH A;  2CXA A;  1S7N A;  1VKC A;  4PSX A;  2A4N A;  1WWZ A;  2FCK A;  2IL4 A;  4XNH C;  3BJ8 A;  2YNC A;  2PR8 A;  4CGO A;  2OZG A;  5J8F A;  4H6Z A;  4AVC A;  4YFJ A;  4FD6 A;  4PK3 A;  1M1D A;  2JLM A;  1IIC A;  2EUI A;  4OAE A;  4R57 A;  2ZW5 A;  5F46 A;  1MJA A;  4UFV A;  4MJ8 A;  2Q4V A;  5H84 A;  1XMT A;  1Q2D A;  2G0B A;  2O28 A;  1CJW A;  4AG7 A;  4RI1 A;  1Z9U A;  3PZJ A;  4B10 A;  3T90 A;  2Z3O A;  5IB0 A;  2J8M A;  2BL1 A;  2JEV A;  4LUA A;  1QSR A;  3R95 A;  4C7I A;  4C2Z A;  4CAE A;  2J8R A;  4E2A A;  3TFY A;  1BO4 A;  3BJ7 A;  2Y0M A;  1YVK A;  3W6S A;  1BOB A;  2OH1 A;  3E0K A;  5A27 A;  1MK4 A;  1M4D A;  1QSO A;  2Z3K A;  4KLV A;  4NXY A;  5HMN A;  1I21 A;  5I0C A;  3IWE A;  2ZW4 A;  4XPL A;  3PP9 A;  5AG4 A;  5AG5 A;  5F47 A;  4XNH B;  4E0A A;  4CGP A;  3SXO A;  3D2P A;  1IYK A;  2DPT A;  2FE7 A;  2FL4 A;  2Z3M A;  4QBJ A;  2REF A;  4DNC A;  3S6G A;  3EO4 A;  4JWP A;  1RXT A;  4A33 A;  2PRB A;  3FBU A;  4QVT A;  2DXQ A;  2HUZ A;  2R8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...