2J8NA

Structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
SIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title l-Methionine sulfoximine, but not phosphinothricin, is a substrate for an acetyltransferase (gene PA4866) from Pseudomonas aeruginosa: structural and functional studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8nA00
5F48A 3VWEA 3S6GA 2H5MA 4FD4A 4GS4A 2VEZA 4KUAA 4NXYA 5C82A 1BO4A 1P4NA 5FVJA 2AJ6A 1B6BA 3T90A 3FB3A 3CXSA 1S7FA 2R98A 4R87A 2FIAA 3TTHA 3GYAA 4CS0B 1Z4EA 4Y49B 2VZZA 3QB8A 1RXTA 1XF8A 4UWIA 2BL1A 4FD7A 2FT0A 1K4JA 1XEBA 2Q4YA 4HNWB 1M4GA 2CNSA 4U9ZA 1YK3A 1BOBA 2RC4A 1QSRA 3KKWA 1ON0A 1QSOA 5KTDA 2GANA 1S7NA 2I00A 2OH1A 2QECA 1R57A 2Q4VA 2HV2A 3FNCA 2Z10A 4B5PB 4AVBA 3F5BA 2J8RA 1M4IA 4NEXA 4H89A 4FD5A 4XPDC 4YFJA 2A4NA 3MGDA 3D2PA 2PDOA 4OAEA 4EVYA 4ONUA 3QAHA 4HKFA 4MY3A 3SXNA 2PSWA 2R8VA 4KLWA 2Z0ZA 3FRMA 2HQYA 3F0AA 2CNMA 5IX3A 2FXFA 4AVCA 4KVME 3R95A 4YGOA 3BJ7A 4I49A 3FIXA 2FCKA 1QSTA 3IWGA 2IL4A 1YREA 4B5OA 4FD6A 1I12A 4OADA 1CM0A 1WWZA 1YX0A 2ZW5A 3DDDA 1YLEA 4R3LA 4RS2A 5IB0A 5J8CA 4Y49C 2B4DB 2Q7BA 4XPLA 4HNYB 1PU9A 3FBUA 4PSXA 3TOAA 2K5TA 4MY0A 2Z11A 5JQ4A 5DWNA 4KVOE 4KOSA 2QMLA 2JEVA 4II9A 4KUBA 4NF1A 2CY2A 1Q2DA 1Y9KA 2Q04A 1NE9A 4KZTA 1YVKA 2Q0YA 1Y9WA 1RO5A 3N7ZA 2BSWA 4YRHA 4UBRA 3P2HA 1M1DA 4QBJA 3R9FA 2VZYA 3D2MA 1GHEA 2OZHA 3PP9A 4XPKA 2DXQA 5EBVA 3DSBA 3EO4A 2FS5A 1Y7RA 3JVNA 4NCZA 2ZW6A 3RYOA 4AG7A 5C88A 2PC1A 4KOVA 4AVAA 1S60A 4U9YA 4F6AA 4QB9A 5F46A 2FSRA 1IB1E 4JWPA 1S5KA 1SQHA 1J4JA 3C26A 4PK3A 5ISVA 4H6UA 4JXQA 4KOYA 1NSLA 5HMNA 3EXNA 3UY5A 2P6EA 1FY7A 3B8GA 3OWCA 2B4DA 3TO9A 2BUEA 4XNHB 5GCNA 3BJ8A 1Z4RA 4QC6A 4X5KA 2JLMA 1MJAA 1YR0A 1MJ9A 3D8PA 3DR6A 3F8KA 5H86A 1QSMA 3CXPA 4IUSA 2OZUA 3S6FA 1U6MA 5F47A 1CJWA 3GY9A 3GKRA 4KOWA 4JXRA 2R7HA 3W6XA 1LRZA 4CAVA 2FIWA 4KLVA 2REFA 4PSWA 3R96A 5J8FA 1IYKA 4MJ8A 4UA3A 1YGHA 2OZGA 2F5IA 1S7KA 3IGRA 3PGPA 2X7BA 4J3GA 4CAWA 1P0HA 1S7LA 4H6ZA 1M4DA 2OU2A 5KTCA 4ZBGA 3R1KA 2OB0A 2R1IA 3SHPA 1MK4A 4AB7A 1M44A 3WR7A 4RI1A 1QSNA 4E8OA 2D4PA 5H84A 1I21A 4QVTA 3TOBA 3DR8A 1XMTA 1IIDA 3CXQA 5HH1A 4KOXA 3W91A 1XIXA 2PR1A 2JDDA 4UWJA 4CRYB 5I0CA 4R3KA 1NMTA 2JDCA 4OLLA 3R9EA 3LD2A 1KZFA 1IYLA 2ARHA 3R9GA 4R57A 3BLNA 3G3SA 2EVNA 2C27A 1B87A 4KOUA 3FYNA 2J8NA 4MHDA 4B5PA 1OZPA 2FE7A 4IF5A 1PUAA 4AG9A 3I9SA 2BEIA 3TCVA 5EC4A 5IV0A 2D4OA 1Z9UA 4XPDB 2B5GB 5JPHA 4QUSA 4JD6A 3P2FA 3EY5A 4F0YA 2B58A 3TO7A 2VI7A 3PZJA 5F49A 2GIVA 1V0CA 2REEA 1Q2CA 4M3SA 2ATRA 4LUAA 2I79A 4CRZB 2ZW7A 1N71A 2VXKA 3I3GA 1S3ZA 2KCWA 2Q44A 2ZW4A 3E0KA 4U5YA 1I1DA 3ZZIA 2EUIA 4DNCA 2GE3A 2P0WA 4JJXA 2P6FA 1MJBA 4KORA 4MI4A 1KUYA 2VQYA 3V8IA 3TT2A 3NE7A 2PRBA 3JUWA 1XE4A 4NSQA 1KUXA 1UFHA 1VHSA 2G0BA 3EFAA 2PQ8A 2WPWA 3EC4A 2ZPAA 2WPXA 2B5GA 1WK4A 2B4BA 4K30A 2AE6A 1KUVA 1TIQA 2VBQA 2FL4A 5CNPA 2CNTA 4E2AA 3DNSA 1IICA 3S6KA 1YVOA 5E96A 4HNXB 5DWMA 3K9UA 3SXOA 4L89A 3G8WA 2O28A 3FXTA 3TE4A 1Q2YA 2J8MA 2P6GA 3S6HA 4MBUA 4JLYA 2QIRA 4ORFA 4LX9A 4PK2A 4R9MA 4CAXA 3LODA 4E0AA 3D3SA 4KVXA 3TFYA 2G3TA 4L8AA 2B3VA 4PV6A 2Y0MA 4KOTA 2G3AA 2B3UA 3H4QA 2ZXVA 3ZJ0A 3T9YA 2HUZA 2PR8A 3W6SA 4M85A 1L0CA 4XNHC 4BMHA 2NMTA 3TO6A 3VWDA 1VKCA 5KTAA
chains in the Genus database with same CATH superfamily
5F48A 4CPAA 3VWEA 4F8ZA 3KR5A 1IGBA 3S6GA 4A38A 2H5MA 4FD4A 4IAVA 4GS4A 2VEZA 4KUAA 4NXYA 3H5ZA 1Y0YA 2V8DA 5C82A 3LMSA 1BO4A 1P4NA 5FVJA 1DTDA 3WABA 2AJ6A 2PJBA 4MHPA 4JYWA 1B6BA 1CP7A 3T90A 3S9NA 3FB3A 3CXSA 1F57A 1S7FA 2R98A 3SJFA 2OR4A 3D7DA 4LQ6A 4P4FA 1PYTB 3KASA 4R87A 4P6YA 2Z3KA 3PBBA 2FIAA 5G21A 3TTHA 4P10A 3GYAA 5K8MA 4CS0B 2EK9A 2POKA 2XEFA 1Z4EA 4MFJA 1YMEA 4Y49B 5D29A 2I3CA 2VZZA 3QB8A 1RXTA 3PB9X 1BLLE 1XF8A 1QMUA 4UWIA 5A27A 2BL1A 3D66A 4B12A 4FD7A 4MCPA 2GFQA 3IIBA 3NH8A 2FT0A 4M6HA 3RAMA 2QVPA 1K4JA 5K8NA 1XEBA 2Q4YA 4HNWB 1M4GA 2CNSA 3QAYA 3CZXA 1UWYA 4U9ZA 2PJ9A 4W9YA 1YK3A 3FEDA 1BOBA 2RC4A 4P4JA 1QSRA 2C6CA 1ON0A 1QSOA 3KKWA 5KTDA 4CGOA 4Q36A 1NSAA 1DE4C 3CT9A 5LRJA 2F7VA 2GANA 4RUHA 2XEIA 3KQZA 4JZ0A 1S7NA 1KWMA 2I00A 3D7GA 5D8NA 2OH1A 1CG2A 4WWVA 1RTQA 2BO9A 2QECA 4R8FA 1R57A 2Q4VA 2ZEOA 3RNZA 3FEEA 4BBHA 3PRTA 2HV2A 3FNCA 2PJ7A 4B10A 2Z10A 3SI0A 4B5PB 3B3TA 4LQGA 4AVBA 3NE8A 5AG7A 3F5BA 4EFDA 2EBJA 2J8RA 2BOAA 1XOVA 5LYFA 4F0XA 1M4IA 4NEXA 1PCAA 2BCOA 1BPMA 4H89A 4R6TA 1FT7A 3RO0A 4OP4A 4FD5A 5ELYA 4P4EA 4XPDC 4A31A 2RB7A 3WC6A 4YFJA 5F09A 5LYLA 1CPSA 2A4NA 2G9DA 2Q51A 3MGDA 1LANA 3D2PA 2PDOA 2Q4ZA 2WUUA 4OAEA 5DS0A 4EVYA 4ONUA 4P44A 3QAHA 4HKFA 4MY3A 1HEEA 3SXNA 2PSWA 2R8VA 3D67A 3GUXA 4KLWA 1VHOA 2Z0ZA 3FRMA 1A2ZA 1XBUA 2HQYA 3F0AA 4P4IA 2CNMA 5IX3A 3B7IA 2FXFA 3LACA 4KVME 4AVCA 4MFKA 3R95A 4TNUA 3B3VA 2V77A 2HC9A 1X12A 4YGOA 3BJ7A 4I49A 3FIXA 2FCKA 3PBEA 1QSTA 4OIWA 3IWGA 2IL4A 2V8GA 1YREA 3DLJA 4B5OA 4FD6A 1I12A 4OADA 2F8HA 1CM0A 1WWZA 2IQ6A 1YX0A 2ZW5A 2DPTA 3B3SA 3CPAA 3DDDA 1YLEA 4R3LA 4RS2A 4UCMA 5JM6A 3KL9A 2PJ1A 4CGNA 5IB0A 5J8CA 2PIZA 2ZENA 2AFXA 4HPSA 4Y49C 2AFOA 2B4DB 1ZLHA 4XPLA 1Y7EA 2Q7BA 5AG5A 1FNOA 1ZLIA 4HNYB 3JRUA 5G22A 1PU9A 4EMEA 4R76A 3FBUA 8CPAA 3H8EA 4PSXA 1Z2LA 3TOAA 1IU8A 4A32A 1ZG7A 2K5TA 4MY0A 2Z11A 5JQ4A 1ARMA 5DWNA 3S9LA 3PB8X 4KVOE 2CIJA 2PJ6A 2C1CA 4KOSA 2QMLA 3SI2A 2CXAA 2JEVA 2PJ5A 4II9A 4KUBA 4NF1A 5LRGA 2CY2A 1Q2DA 1Y9KA 2Q04A 4B11A 3KI9A 1EE3P 4A95A 1NE9A 4KZTA 1YVKA 2Q0YA 1Y9WA 4KSAA 4YWYA 1GYTA 1RO5A 3N7ZA 2BSWA 4NJQA 4FBEA 4YRHA 4UBRA 4F9VA 3P2HA 4Q38A 1M1DA 3WC7A 4QBJA 3R9FA 4NJRA 4OKOA 2VZYA 1ZO0A 3L2NA 2PJ4A 4NGPA 5LYIA 3D2MA 1GHEA 2OZHA 2YNEA 3PP9A 4X8IA 4XPKA 2DXQA 5EBVA 1ZG9A 3DSBA 2ZEHA 1LFWA 3EO4A 3PB4X 3JTKA 3ISZA 2FS5A 4X3RA 1Y7RA 4B13A 3JVNA 3KHXA 4NCZA 5G1ZA 4C7HA 2ZW6A 3RYOA 2GREA 4AG7A 5C88A 2PC1A 1TXRA 3D7FA 1ZG8A 1CPXA 4KOVA 5AG6A 4CAFA 1AUGA 4PQAA 3KHZA 5J1QA 2EO8A 2GU2A 3RBUA 4MCRA 3PEIA 4AVAA 3BI0A 1S60A 3SJXA 4U9YA 3VATA 4CGLA 4P45A 3SJGA 4F6AA 4QB9A 5F46A 2FSRA 1IB1E 4JWPA 1IOIA 4ZY2A 3MRUA 4C68A 2Z3MA 1HDQA 1S5KA 1SQHA 4UIAA 1J4JA 3C26A 4PK3A 5ISVA 4CYNA 4H6UA 4JXQA 4KOYA 1NSLA 5HMNA 3EXNA 3UY5A 3KGQA 4H2KA 2P6EA 4P4DA 4YU9A 4Q7AA 1FY7A 3B8GA 1XFOA 2Z3OA 2B4DA 2DEAA 3OWCA 1Q7LA 3TO9A 2BUEA 1R43A 4XNHB 5GCNA 1Z8TA 1F2OA 3BJ8A 3NH4A 1Z4RA 4QC6A 4X5KA 3WC5A 2Q7SA 3D7HA 2JLMA 1MJAA 1YR0A 3K2KA 4R7MA 1MJ9A 2ABZA 4FAIA 4Z65A 3D8PA 3DR6A 2OOTA 3F8KA 4CGPA 5JGFA 2C6GA 5H86A 1QSMA 3CXPA 4IUSA 2OZUA 3RZAA 3S6FA 1U6MA 4PPZA 2O4HA 5F47A 1CJWA 1ELMP 4O23A 3H8FA 3GY9A 5K8OA 3GKRA 4PXCA 7CPAA 4KOWA 4CYQA 4JXRA 4C2ZA 2R7HA 3W6XA 1LRZA 4CAVA 2ANPA 2FIWA 4A37A 4KLVA 1IOFA 2REFA 4PSWA 3R96A 3LWUA 5J8FA 1IYKA 4MJ8A 4UA3A 1YGHA 3GIUA 2OZGA 2F5IA 4UFXA 1S7KA 3IGRA 3IEHA 1Z8WA 5HVGA 3FJUA 1LOKA 3IFEA 3PGPA 1CBXA 2Z3NA 2X7BA 2ZEDA 4J3GA 2PIYA 1JQGA 1VHEA 2RFHA 3FX6A 1P0HA 4MXUA 4CAWA 1S7LA 1X10A 4OMEA 2PCUA 4H6ZA 3K9TA 1M4DA 2ZEMA 2OU2A 5KTCA 4ZBGA 2PE3A 3R1KA 1TF8A 3TX8A 2OB0A 2R1IA 3IJ3A 3SHPA 1MK4A 4AB7A 1M44A 3PB7X 4MFLA 4P4BA 4RI1A 3WR7A 1QSNA 2V8VA 2PJAA 2D4PA 5H84A 4E8OA 1I21A 4QVTA 1R3NA 1TKHA 2GLFA 5HXDA 3FECA 3TOBA 4ZI6A 3DR8A 4ZYQA 4NGTA 1XMTA 1IIDA 1OBRA 3CXQA 3IC1A 4KSIA 5EMIA 5HH1A 3S9MA 4KOXA 3W91A 1XIXA 4UF4A 2PR1A 2JDDA 3NH5A 4UWJA 2ZEPA 4CRYB 2WZNA 5I0CA 4R3KA 1NMTA 1LCPA 2JDCA 4MRIA 1Z5RA 3QNVA 4OLLA 4OC5A 4UEEA 4MFQA 3D68A 3R9EA 2PJ8A 2DPSA 3LD2A 2ZOGA 1KZFA 1IYLA 2ARHA 3R9GA 4X2TA 4R57A 3BLNA 3G3SA 2EVNA 2C27A 1B87A 4KOUA 2FVGA 3FYNA 3SI1A 4OC1A 5BWAB 2J8NA 4MHDA 2VL1A 4CYOA 4B5PA 4ZY0A 1OZPA 5A28A 2FE7A 1IY7A 4IF5A 1YSJA 1PUAA 3HLPA 4UCPA 4UEFA 3IO1A 4PXDA 4MMOA 3BI1A 2C6PA 4AG9A 3I9SA 2BEIA 4UFVA 1HDUA 3ISXA 3TCVA 4A94A 5EC4A 5IV0A 2D4OA 1Z9UA 4C7IA 4CAEA 4FUUA 4XPDB 2B5GB 1XJOA 4C2XA 1CP6A 5JPHA 2AFMA 4MCSA 4QUSA 4JD6A 3HUVA 3P2FA 3EY5A 4WJBA 4F0YA 4ZGYB 2B58A 1Y0RA 2NSMA 2QYVA 2VI7A 3NA6A 3TO7A 3PZJA 5F49A 2J9AA 2GIVA 4NGSA 3TC8A 4B14A 3T8WA 1V0CA 2REEA 2PJ3A 1Q2CA 4ONWA 4M3SA 4NGRA 3A9LA 2ATRA 1LAPA 4DJLA 4LUAA 3H8GA 3IU2A 4IHMA 3PFEA 2I79A 4CRZB 4UEZA 2AFSA 2ZW7A 4B6ZA 1BAVA 2EK8A 4OC2A 1N71A 3FMCA 2VXKA 3I3GA 1S3ZA 2AFUA 1VGYA 1AYEA 2GLJA 3V38A 2KCWA 3PFOA 2Q44A 4MHZA 4DUKA 5JH9A 5CBMA 2ZW4A 2CF4A 3E0KA 4U5YA 1I1DA 4BINA 4G1PA 3ZZIA 1M4LA 2EUIA 4DNCA 3NFZA 4F9UA 2GE3A 2P0WA 3CPXA 4JJXA 4NGMA 4AXVA 2P6FA 3IWEA 4A2ZA 1MJBA 4KORA 2PRQA 4KS9A 4MI4A 1KUYA 4OC4A 2Z3PA 2VQYA 3B2YA 3V8IA 1AMPA 4M6IA 1Z8XA 2CTBA 2O53A 3TT2A 3D4UA 4UIBA 3VH9A 3NE7A 1QQ9A 4ZX9A 2PRBA 3JUWA 1XE4A 2YGWA 3KZWA 4NSQA 4ZY1A 1KUXA 1UFHA 3B35A 2XEGA 3FVLA 1VHSA 4IK2A 4UCNA 2G0BA 4GM5A 4NFRA 3EFAA 3IWWA 4C2YA 2PQ8A 2WPWA 3EC4A 2ZPAA 1TKFA 2WPXA 1F2PA 2B5GA 3DGVA 2QJ8A 2PJ2A 3PB6X 4K3NA 1WK4A 2B4BA 5AGEA 1YW6A 4K30A 2AE6A 1KUVA 4GXHA 2NYQA 2Q43A 4OC0A 1ARLA 2PJ0A 4M6GA 5I4MA 1TIQA 4MCQA 4OC3A 3WT4A 4CYPA 2VBQA 1YQEA 2FL4A 4MHNA 5CNPA 2CNTA 4MFZA 6CPAA 4E2AA 1H8LA 2PVVA 4A33A 1XMBA 2IJZA 2ZEGA 3DNSA 3I1UA 3MN8A 2V8HA 4BD9A 4PXEA 1IICA 2DF5A 5CPAA 3S6KA 1YVOA 3FH4A 5E96A 4HNXB 1TF9A 5DWMA 3K9UA 3SXOA 4L89A 3G8WA 3GB0A 3V7ZA 2O28A 3FXTA 2YNCA 1Q2YA 3KQXA 3BXMA 3GLJA 4MFPA 3FF3A 2AFWA 5AG4A 3TE4A 2J8MA 2P6GA 3S6HA 1JWQA 4MBUA 2WSAA 4CGMA 4JLYA 2QIRA 2PJCA 4ORFA 2WYRA 4LX9A 1BPNA 3N5FA 4PK2A 4R9MA 4CAXA 5K8PA 3BHXA 5G20A 3LODA 2IMOA 4OIDA 4E0AA 2PVWA 2AFZA 3D3SA 2YNDA 4RN7A 1YW4A 2JBJA 2YNCC 4KVXA 4NGNA 3TFYA 2G3TA 4L8AA 2B3VA 4PV6A 2Y0MA 5IB9A 4KOTA 2G3AA 2B3UA 5LRKA 5HVFA 1CX8A 3H4QA 2ZXVA 3ZJ0A 2JEWA 3CDXA 3T9YA 5LYDA 4DYOA 2HUZA 1YLOA 1LAMA 2PR8A 2ZEFA 4KSFA 1XRYA 4UFWA 3VARA 2CTCA 3W6SA 2ZELA 4M85A 1ELLP 4A30A 4EWTA 2ZEEA 3B3CA 5HVHA 4PXBA 3IU1A 1L0CA 4FWUA 3B3WA 4XNHC 2HB6A 3KR4A 2NMTA 3TO6A 4TWEA 4BMHA 3SJEA 2EWBA 5THWA 1Z8LA 4NGQA 3VWDA 1VKCA 4MHYA 5KTAA 4A39A 2XEJA 2Z3LA 1TKJA 1VIXA 2ODFA 2ZOFA 2JBKA 4ZX8A
chains in the Genus database with same CATH topology
5F48A 3VWEA 3S6GA 2H5MA 4FD4A 4GS4A 2VEZA 4KUAA 4NXYA 3H5ZA 5C82A 1BO4A 1P4NA 5FVJA 2AJ6A 1B6BA 3T90A 3FB3A 3CXSA 1S7FA 2R98A 4R87A 2Z3KA 2FIAA 5G21A 3TTHA 3GYAA 4CS0B 1Z4EA 4MFJA 4Y49B 2VZZA 3QB8A 1RXTA 1XF8A 4UWIA 5A27A 2BL1A 4B12A 4FD7A 2FT0A 1K4JA 1XEBA 2Q4YA 4HNWB 1M4GA 2CNSA 4U9ZA 1YK3A 1BOBA 2RC4A 1QSRA 3KKWA 1ON0A 1QSOA 5KTDA 4CGOA 4Q36A 2GANA 1S7NA 2I00A 2OH1A 4BBHA 2QECA 1R57A 2Q4VA 2HV2A 3FNCA 4B10A 2Z10A 4B5PB 4AVBA 5AG7A 3F5BA 2J8RA 4F0XA 1M4IA 4NEXA 4H89A 4FD5A 4XPDC 4A31A 4YFJA 2A4NA 3MGDA 3D2PA 2PDOA 2WUUA 4OAEA 4EVYA 4ONUA 3QAHA 4HKFA 4MY3A 3SXNA 2PSWA 2R8VA 4KLWA 2Z0ZA 3FRMA 2HQYA 3F0AA 2CNMA 5IX3A 2FXFA 4AVCA 4KVME 4MFKA 3R95A 4YGOA 3BJ7A 4I49A 3FIXA 2FCKA 1QSTA 3IWGA 2IL4A 1YREA 4B5OA 4FD6A 1I12A 4OADA 1CM0A 1WWZA 1YX0A 2ZW5A 2DPTA 3DDDA 1YLEA 4R3LA 4RS2A 4UCMA 4CGNA 5IB0A 5J8CA 4Y49C 2B4DB 2Q7BA 4XPLA 5AG5A 5G22A 4HNYB 1PU9A 3FBUA 4PSXA 3TOAA 4A32A 2K5TA 4MY0A 2Z11A 5JQ4A 5DWNA 4KVOE 4KOSA 2QMLA 2CXAA 2JEVA 4II9A 4KUBA 4NF1A 2CY2A 1Q2DA 1Y9KA 2Q04A 4B11A 4A95A 1NE9A 4KZTA 1YVKA 2Q0YA 1Y9WA 4KSAA 1RO5A 3N7ZA 2BSWA 4YRHA 4UBRA 3P2HA 4Q38A 1M1DA 4QBJA 3R9FA 2VZYA 1ZO0A 3D2MA 1GHEA 2OZHA 2YNEA 3PP9A 4XPKA 2DXQA 5EBVA 3DSBA 3EO4A 3JTKA 2FS5A 1Y7RA 4B13A 3JVNA 4NCZA 5G1ZA 4C7HA 2ZW6A 3RYOA 4AG7A 5C88A 2PC1A 4KOVA 5AG6A 4CAFA 4AVAA 1S60A 4U9YA 4CGLA 4F6AA 4QB9A 5F46A 2FSRA 1IB1E 4JWPA 4C68A 2Z3MA 1S5KA 1SQHA 1J4JA 3C26A 4PK3A 5ISVA 4CYNA 4H6UA 4JXQA 4KOYA 1NSLA 5HMNA 3EXNA 3UY5A 2P6EA 1FY7A 3B8GA 2Z3OA 3OWCA 2B4DA 3TO9A 2BUEA 4XNHB 5GCNA 3BJ8A 1Z4RA 4QC6A 4X5KA 2JLMA 1MJAA 1YR0A 1MJ9A 3D8PA 3DR6A 3F8KA 4CGPA 5H86A 1QSMA 3CXPA 4IUSA 2OZUA 3S6FA 1U6MA 5F47A 1CJWA 3GY9A 3GKRA 4KOWA 4CYQA 4JXRA 4C2ZA 2R7HA 3W6XA 1LRZA 4CAVA 2FIWA 4KLVA 2REFA 4PSWA 3R96A 5J8FA 1IYKA 4MJ8A 4UA3A 1YGHA 2OZGA 2F5IA 4UFXA 1S7KA 3IGRA 3PGPA 2Z3NA 2X7BA 4J3GA 4CAWA 1P0HA 1S7LA 4H6ZA 1M4DA 2OU2A 5KTCA 4ZBGA 3R1KA 2OB0A 2R1IA 3SHPA 1MK4A 4AB7A 1M44A 4MFLA 3WR7A 4RI1A 1QSNA 4E8OA 2D4PA 5H84A 1I21A 4QVTA 3TOBA 3DR8A 1XMTA 1IIDA 3CXQA 5HH1A 4KOXA 3W91A 1XIXA 2PR1A 2JDDA 4UWJA 4CRYB 5I0CA 4R3KA 1NMTA 2JDCA 4OLLA 4MFQA 3R9EA 3LD2A 2DPSA 1KZFA 1IYLA 2ARHA 3R9GA 4R57A 3BLNA 3G3SA 2EVNA 2C27A 1B87A 4KOUA 3FYNA 5BWAB 2J8NA 4MHDA 4CYOA 4B5PA 1OZPA 5A28A 2FE7A 4IF5A 1PUAA 4UCPA 4AG9A 3I9SA 2BEIA 4UFVA 3TCVA 5EC4A 5IV0A 2D4OA 1Z9UA 4C7IA 4CAEA 4XPDB 2B5GB 4C2XA 5JPHA 4QUSA 4JD6A 3P2FA 3EY5A 4F0YA 4ZGYB 2B58A 3TO7A 2VI7A 3PZJA 5F49A 2GIVA 4B14A 1V0CA 2REEA 1Q2CA 4M3SA 3A9LA 2ATRA 4LUAA 3IU2A 2I79A 4CRZB 2ZW7A 1N71A 2VXKA 3I3GA 1S3ZA 2KCWA 2Q44A 2ZW4A 3E0KA 4U5YA 1I1DA 3ZZIA 2EUIA 4DNCA 2GE3A 2P0WA 4JJXA 2P6FA 3IWEA 4A2ZA 1MJBA 4KORA 4KS9A 4MI4A 1KUYA 2Z3PA 2VQYA 3V8IA 3TT2A 3NE7A 2PRBA 3JUWA 1XE4A 2YGWA 4NSQA 1KUXA 1UFHA 1VHSA 4UCNA 2G0BA 3EFAA 4C2YA 2PQ8A 2WPWA 3EC4A 2ZPAA 2WPXA 2B5GA 1WK4A 2B4BA 5AGEA 4K30A 2AE6A 1KUVA 1TIQA 4CYPA 2VBQA 2FL4A 5CNPA 2CNTA 4MFZA 4E2AA 4A33A 3DNSA 1IICA 3S6KA 1YVOA 5E96A 4HNXB 5DWMA 3K9UA 3SXOA 4L89A 3G8WA 2O28A 3FXTA 2YNCA 1Q2YA 4MFPA 5AG4A 3TE4A 2J8MA 2P6GA 3S6HA 4MBUA 2WSAA 4CGMA 4JLYA 2QIRA 4ORFA 4LX9A 4PK2A 4R9MA 4CAXA 5G20A 3LODA 4E0AA 3D3SA 2YNDA 2YNCC 4KVXA 3TFYA 2G3TA 4L8AA 2B3VA 4PV6A 2Y0MA 4KOTA 2G3AA 2B3UA 3H4QA 2ZXVA 3ZJ0A 3T9YA 2HUZA 2PR8A 4KSFA 4UFWA 3W6SA 4M85A 4A30A 3IU1A 1L0CA 4XNHC 4BMHA 2NMTA 3TO6A 3VWDA 1VKCA 5KTAA 2Z3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F48 A;  3VWE A;  3S6G A;  2H5M A;  4FD4 A;  4GS4 A;  2VEZ A;  4KUA A;  4NXY A;  5C82 A;  1BO4 A;  1P4N A;  5FVJ A;  2AJ6 A;  1B6B A;  3T90 A;  3FB3 A;  3CXS A;  1S7F A;  2R98 A;  4R87 A;  2FIA A;  3TTH A;  3GYA A;  4CS0 B;  1Z4E A;  4Y49 B;  2VZZ A;  3QB8 A;  1RXT A;  1XF8 A;  4UWI A;  2BL1 A;  4FD7 A;  2FT0 A;  1K4J A;  1XEB A;  2Q4Y A;  4HNW B;  1M4G A;  2CNS A;  4U9Z A;  1YK3 A;  1BOB A;  2RC4 A;  1QSR A;  3KKW A;  1ON0 A;  1QSO A;  5KTD A;  2GAN A;  1S7N A;  2I00 A;  2OH1 A;  2QEC A;  1R57 A;  2Q4V A;  2HV2 A;  3FNC A;  2Z10 A;  4B5P B;  4AVB A;  3F5B A;  2J8R A;  1M4I A;  4NEX A;  4H89 A;  4FD5 A;  4XPD C;  4YFJ A;  2A4N A;  3MGD A;  3D2P A;  2PDO A;  4OAE A;  4EVY A;  4ONU A;  3QAH A;  4HKF A;  4MY3 A;  3SXN A;  2PSW A;  2R8V A;  4KLW A;  2Z0Z A;  3FRM A;  2HQY A;  3F0A A;  2CNM A;  5IX3 A;  2FXF A;  4AVC A;  4KVM E;  3R95 A;  4YGO A;  3BJ7 A;  4I49 A;  3FIX A;  2FCK A;  1QST A;  3IWG A;  2IL4 A;  1YRE A;  4B5O A;  4FD6 A;  1I12 A;  4OAD A;  1CM0 A;  1WWZ A;  1YX0 A;  2ZW5 A;  3DDD A;  1YLE A;  4R3L A;  4RS2 A;  5IB0 A;  5J8C A;  4Y49 C;  2B4D B;  2Q7B A;  4XPL A;  4HNY B;  1PU9 A;  3FBU A;  4PSX A;  3TOA A;  2K5T A;  4MY0 A;  2Z11 A;  5JQ4 A;  5DWN A;  4KVO E;  4KOS A;  2QML A;  2JEV A;  4II9 A;  4KUB A;  4NF1 A;  2CY2 A;  1Q2D A;  1Y9K A;  2Q04 A;  1NE9 A;  4KZT A;  1YVK A;  2Q0Y A;  1Y9W A;  1RO5 A;  3N7Z A;  2BSW A;  4YRH A;  4UBR A;  3P2H A;  1M1D A;  4QBJ A;  3R9F A;  2VZY A;  3D2M A;  1GHE A;  2OZH A;  3PP9 A;  4XPK A;  2DXQ A;  5EBV A;  3DSB A;  3EO4 A;  2FS5 A;  1Y7R A;  3JVN A;  4NCZ A;  2ZW6 A;  3RYO A;  4AG7 A;  5C88 A;  2PC1 A;  4KOV A;  4AVA A;  1S60 A;  4U9Y A;  4F6A A;  4QB9 A;  5F46 A;  2FSR A;  1IB1 E;  4JWP A;  1S5K A;  1SQH A;  1J4J A;  3C26 A;  4PK3 A;  5ISV A;  4H6U A;  4JXQ A;  4KOY A;  1NSL A;  5HMN A;  3EXN A;  3UY5 A;  2P6E A;  1FY7 A;  3B8G A;  3OWC A;  2B4D A;  3TO9 A;  2BUE A;  4XNH B;  5GCN A;  3BJ8 A;  1Z4R A;  4QC6 A;  4X5K A;  2JLM A;  1MJA A;  1YR0 A;  1MJ9 A;  3D8P A;  3DR6 A;  3F8K A;  5H86 A;  1QSM A;  3CXP A;  4IUS A;  2OZU A;  3S6F A;  1U6M A;  5F47 A;  1CJW A;  3GY9 A;  3GKR A;  4KOW A;  4JXR A;  2R7H A;  3W6X A;  1LRZ A;  4CAV A;  2FIW A;  4KLV A;  2REF A;  4PSW A;  3R96 A;  5J8F A;  1IYK A;  4MJ8 A;  4UA3 A;  1YGH A;  2OZG A;  2F5I A;  1S7K A;  3IGR A;  3PGP A;  2X7B A;  4J3G A;  4CAW A;  1P0H A;  1S7L A;  4H6Z A;  1M4D A;  2OU2 A;  5KTC A;  4ZBG A;  3R1K A;  2OB0 A;  2R1I A;  3SHP A;  1MK4 A;  4AB7 A;  1M44 A;  3WR7 A;  4RI1 A;  1QSN A;  4E8O A;  2D4P A;  5H84 A;  1I21 A;  4QVT A;  3TOB A;  3DR8 A;  1XMT A;  1IID A;  3CXQ A;  5HH1 A;  4KOX A;  3W91 A;  1XIX A;  2PR1 A;  2JDD A;  4UWJ A;  4CRY B;  5I0C A;  4R3K A;  1NMT A;  2JDC A;  4OLL A;  3R9E A;  3LD2 A;  1KZF A;  1IYL A;  2ARH A;  3R9G A;  4R57 A;  3BLN A;  3G3S A;  2EVN A;  2C27 A;  1B87 A;  4KOU A;  3FYN A;  2J8N A;  4MHD A;  4B5P A;  1OZP A;  2FE7 A;  4IF5 A;  1PUA A;  4AG9 A;  3I9S A;  2BEI A;  3TCV A;  5EC4 A;  5IV0 A;  2D4O A;  1Z9U A;  4XPD B;  2B5G B;  5JPH A;  4QUS A;  4JD6 A;  3P2F A;  3EY5 A;  4F0Y A;  2B58 A;  3TO7 A;  2VI7 A;  3PZJ A;  5F49 A;  2GIV A;  1V0C A;  2REE A;  1Q2C A;  4M3S A;  2ATR A;  4LUA A;  2I79 A;  4CRZ B;  2ZW7 A;  1N71 A;  2VXK A;  3I3G A;  1S3Z A;  2KCW A;  2Q44 A;  2ZW4 A;  3E0K A;  4U5Y A;  1I1D A;  3ZZI A;  2EUI A;  4DNC A;  2GE3 A;  2P0W A;  4JJX A;  2P6F A;  1MJB A;  4KOR A;  4MI4 A;  1KUY A;  2VQY A;  3V8I A;  3TT2 A;  3NE7 A;  2PRB A;  3JUW A;  1XE4 A;  4NSQ A;  1KUX A;  1UFH A;  1VHS A;  2G0B A;  3EFA A;  2PQ8 A;  2WPW A;  3EC4 A;  2ZPA A;  2WPX A;  2B5G A;  1WK4 A;  2B4B A;  4K30 A;  2AE6 A;  1KUV A;  1TIQ A;  2VBQ A;  2FL4 A;  5CNP A;  2CNT A;  4E2A A;  3DNS A;  1IIC A;  3S6K A;  1YVO A;  5E96 A;  4HNX B;  5DWM A;  3K9U A;  3SXO A;  4L89 A;  3G8W A;  2O28 A;  3FXT A;  3TE4 A;  1Q2Y A;  2J8M A;  2P6G A;  3S6H A;  4MBU A;  4JLY A;  2QIR A;  4ORF A;  4LX9 A;  4PK2 A;  4R9M A;  4CAX A;  3LOD A;  4E0A A;  3D3S A;  4KVX A;  3TFY A;  2G3T A;  4L8A A;  2B3V A;  4PV6 A;  2Y0M A;  4KOT A;  2G3A A;  2B3U A;  3H4Q A;  2ZXV A;  3ZJ0 A;  3T9Y A;  2HUZ A;  2PR8 A;  3W6S A;  4M85 A;  1L0C A;  4XNH C;  4BMH A;  2NMT A;  3TO6 A;  3VWD A;  1VKC A;  5KTA A; 
#chains in the Genus database with same CATH topology
 5F48 A;  4CPA A;  3VWE A;  4F8Z A;  3KR5 A;  1IGB A;  3S6G A;  4A38 A;  2H5M A;  4FD4 A;  4IAV A;  4GS4 A;  2VEZ A;  4KUA A;  4NXY A;  3H5Z A;  1Y0Y A;  2V8D A;  5C82 A;  3LMS A;  1BO4 A;  1P4N A;  5FVJ A;  1DTD A;  3WAB A;  2AJ6 A;  2PJB A;  4MHP A;  4JYW A;  1B6B A;  1CP7 A;  3T90 A;  3S9N A;  3FB3 A;  3CXS A;  1F57 A;  1S7F A;  2R98 A;  3SJF A;  2OR4 A;  3D7D A;  4LQ6 A;  4P4F A;  1PYT B;  3KAS A;  4R87 A;  4P6Y A;  2Z3K A;  3PBB A;  2FIA A;  5G21 A;  3TTH A;  4P10 A;  3GYA A;  5K8M A;  4CS0 B;  2EK9 A;  2POK A;  2XEF A;  1Z4E A;  4MFJ A;  1YME A;  4Y49 B;  5D29 A;  2I3C A;  2VZZ A;  3QB8 A;  1RXT A;  3PB9 X;  1BLL E;  1XF8 A;  1QMU A;  4UWI A;  5A27 A;  2BL1 A;  3D66 A;  4B12 A;  4FD7 A;  4MCP A;  2GFQ A;  3IIB A;  3NH8 A;  2FT0 A;  4M6H A;  3RAM A;  2QVP A;  1K4J A;  5K8N A;  1XEB A;  2Q4Y A;  4HNW B;  1M4G A;  2CNS A;  3QAY A;  3CZX A;  1UWY A;  4U9Z A;  2PJ9 A;  4W9Y A;  1YK3 A;  3FED A;  1BOB A;  2RC4 A;  4P4J A;  1QSR A;  2C6C A;  1ON0 A;  1QSO A;  3KKW A;  5KTD A;  4CGO A;  4Q36 A;  1NSA A;  1DE4 C;  3CT9 A;  5LRJ A;  2F7V A;  2GAN A;  4RUH A;  2XEI A;  3KQZ A;  4JZ0 A;  1S7N A;  1KWM A;  2I00 A;  3D7G A;  5D8N A;  2OH1 A;  1CG2 A;  4WWV A;  1RTQ A;  2BO9 A;  2QEC A;  4R8F A;  1R57 A;  2Q4V A;  2ZEO A;  3RNZ A;  3FEE A;  4BBH A;  3PRT A;  2HV2 A;  3FNC A;  2PJ7 A;  4B10 A;  2Z10 A;  3SI0 A;  4B5P B;  3B3T A;  4LQG A;  4AVB A;  3NE8 A;  5AG7 A;  3F5B A;  4EFD A;  2EBJ A;  2J8R A;  2BOA A;  1XOV A;  5LYF A;  4F0X A;  1M4I A;  4NEX A;  1PCA A;  2BCO A;  1BPM A;  4H89 A;  4R6T A;  1FT7 A;  3RO0 A;  4OP4 A;  4FD5 A;  5ELY A;  4P4E A;  4XPD C;  4A31 A;  2RB7 A;  3WC6 A;  4YFJ A;  5F09 A;  5LYL A;  1CPS A;  2A4N A;  2G9D A;  2Q51 A;  3MGD A;  1LAN A;  3D2P A;  2PDO A;  2Q4Z A;  2WUU A;  4OAE A;  5DS0 A;  4EVY A;  4ONU A;  4P44 A;  3QAH A;  4HKF A;  4MY3 A;  1HEE A;  3SXN A;  2PSW A;  2R8V A;  3D67 A;  3GUX A;  4KLW A;  1VHO A;  2Z0Z A;  3FRM A;  1A2Z A;  1XBU A;  2HQY A;  3F0A A;  4P4I A;  2CNM A;  5IX3 A;  3B7I A;  2FXF A;  3LAC A;  4KVM E;  4AVC A;  4MFK A;  3R95 A;  4TNU A;  3B3V A;  2V77 A;  2HC9 A;  1X12 A;  4YGO A;  3BJ7 A;  4I49 A;  3FIX A;  2FCK A;  3PBE A;  1QST A;  4OIW A;  3IWG A;  2IL4 A;  2V8G A;  1YRE A;  3DLJ A;  4B5O A;  4FD6 A;  1I12 A;  4OAD A;  2F8H A;  1CM0 A;  1WWZ A;  2IQ6 A;  1YX0 A;  2ZW5 A;  2DPT A;  3B3S A;  3CPA A;  3DDD A;  1YLE A;  4R3L A;  4RS2 A;  4UCM A;  5JM6 A;  3KL9 A;  2PJ1 A;  4CGN A;  5IB0 A;  5J8C A;  2PIZ A;  2ZEN A;  2AFX A;  4HPS A;  4Y49 C;  2AFO A;  2B4D B;  1ZLH A;  4XPL A;  1Y7E A;  2Q7B A;  5AG5 A;  1FNO A;  1ZLI A;  4HNY B;  3JRU A;  5G22 A;  1PU9 A;  4EME A;  4R76 A;  3FBU A;  8CPA A;  3H8E A;  4PSX A;  1Z2L A;  3TOA A;  1IU8 A;  4A32 A;  1ZG7 A;  2K5T A;  4MY0 A;  2Z11 A;  5JQ4 A;  1ARM A;  5DWN A;  3S9L A;  3PB8 X;  4KVO E;  2CIJ A;  2PJ6 A;  2C1C A;  4KOS A;  2QML A;  3SI2 A;  2CXA A;  2JEV A;  2PJ5 A;  4II9 A;  4KUB A;  4NF1 A;  5LRG A;  2CY2 A;  1Q2D A;  1Y9K A;  2Q04 A;  4B11 A;  3KI9 A;  1EE3 P;  4A95 A;  1NE9 A;  4KZT A;  1YVK A;  2Q0Y A;  1Y9W A;  4KSA A;  4YWY A;  1GYT A;  1RO5 A;  3N7Z A;  2BSW A;  4NJQ A;  4FBE A;  4YRH A;  4UBR A;  4F9V A;  3P2H A;  4Q38 A;  1M1D A;  3WC7 A;  4QBJ A;  3R9F A;  4NJR A;  4OKO A;  2VZY A;  1ZO0 A;  3L2N A;  2PJ4 A;  4NGP A;  5LYI A;  3D2M A;  1GHE A;  2OZH A;  2YNE A;  3PP9 A;  4X8I A;  4XPK A;  2DXQ A;  5EBV A;  1ZG9 A;  3DSB A;  2ZEH A;  1LFW A;  3EO4 A;  3PB4 X;  3JTK A;  3ISZ A;  2FS5 A;  4X3R A;  1Y7R A;  4B13 A;  3JVN A;  3KHX A;  4NCZ A;  5G1Z A;  4C7H A;  2ZW6 A;  3RYO A;  2GRE A;  4AG7 A;  5C88 A;  2PC1 A;  1TXR A;  3D7F A;  1ZG8 A;  1CPX A;  4KOV A;  5AG6 A;  4CAF A;  1AUG A;  4PQA A;  3KHZ A;  5J1Q A;  2EO8 A;  2GU2 A;  3RBU A;  4MCR A;  3PEI A;  4AVA A;  3BI0 A;  1S60 A;  3SJX A;  4U9Y A;  3VAT A;  4CGL A;  4P45 A;  3SJG A;  4F6A A;  4QB9 A;  5F46 A;  2FSR A;  1IB1 E;  4JWP A;  1IOI A;  4ZY2 A;  3MRU A;  4C68 A;  2Z3M A;  1HDQ A;  1S5K A;  1SQH A;  4UIA A;  1J4J A;  3C26 A;  4PK3 A;  5ISV A;  4CYN A;  4H6U A;  4JXQ A;  4KOY A;  1NSL A;  5HMN A;  3EXN A;  3UY5 A;  3KGQ A;  4H2K A;  2P6E A;  4P4D A;  4YU9 A;  4Q7A A;  1FY7 A;  3B8G A;  1XFO A;  2Z3O A;  2B4D A;  2DEA A;  3OWC A;  1Q7L A;  3TO9 A;  2BUE A;  1R43 A;  4XNH B;  5GCN A;  1Z8T A;  1F2O A;  3BJ8 A;  3NH4 A;  1Z4R A;  4QC6 A;  4X5K A;  3WC5 A;  2Q7S A;  3D7H A;  2JLM A;  1MJA A;  1YR0 A;  3K2K A;  4R7M A;  1MJ9 A;  2ABZ A;  4FAI A;  4Z65 A;  3D8P A;  3DR6 A;  2OOT A;  3F8K A;  4CGP A;  5JGF A;  2C6G A;  5H86 A;  1QSM A;  3CXP A;  4IUS A;  2OZU A;  3RZA A;  3S6F A;  1U6M A;  4PPZ A;  2O4H A;  5F47 A;  1CJW A;  1ELM P;  4O23 A;  3H8F A;  3GY9 A;  5K8O A;  3GKR A;  4PXC A;  7CPA A;  4KOW A;  4CYQ A;  4JXR A;  4C2Z A;  2R7H A;  3W6X A;  1LRZ A;  4CAV A;  2ANP A;  2FIW A;  4A37 A;  4KLV A;  1IOF A;  2REF A;  4PSW A;  3R96 A;  3LWU A;  5J8F A;  1IYK A;  4MJ8 A;  4UA3 A;  1YGH A;  3GIU A;  2OZG A;  2F5I A;  4UFX A;  1S7K A;  3IGR A;  3IEH A;  1Z8W A;  5HVG A;  3FJU A;  1LOK A;  3IFE A;  3PGP A;  1CBX A;  2Z3N A;  2X7B A;  2ZED A;  4J3G A;  2PIY A;  1JQG A;  1VHE A;  2RFH A;  3FX6 A;  1P0H A;  4MXU A;  4CAW A;  1S7L A;  1X10 A;  4OME A;  2PCU A;  4H6Z A;  3K9T A;  1M4D A;  2ZEM A;  2OU2 A;  5KTC A;  4ZBG A;  2PE3 A;  3R1K A;  1TF8 A;  3TX8 A;  2OB0 A;  2R1I A;  3IJ3 A;  3SHP A;  1MK4 A;  4AB7 A;  1M44 A;  3PB7 X;  4MFL A;  4P4B A;  4RI1 A;  3WR7 A;  1QSN A;  2V8V A;  2PJA A;  2D4P A;  5H84 A;  4E8O A;  1I21 A;  4QVT A;  1R3N A;  1TKH A;  2GLF A;  5HXD A;  3FEC A;  3TOB A;  4ZI6 A;  3DR8 A;  4ZYQ A;  4NGT A;  1XMT A;  1IID A;  1OBR A;  3CXQ A;  3IC1 A;  4KSI A;  5EMI A;  5HH1 A;  3S9M A;  4KOX A;  3W91 A;  1XIX A;  4UF4 A;  2PR1 A;  2JDD A;  3NH5 A;  4UWJ A;  2ZEP A;  4CRY B;  2WZN A;  5I0C A;  4R3K A;  1NMT A;  1LCP A;  2JDC A;  4MRI A;  1Z5R A;  3QNV A;  4OLL A;  4OC5 A;  4UEE A;  4MFQ A;  3D68 A;  3R9E A;  2PJ8 A;  2DPS A;  3LD2 A;  2ZOG A;  1KZF A;  1IYL A;  2ARH A;  3R9G A;  4X2T A;  4R57 A;  3BLN A;  3G3S A;  2EVN A;  2C27 A;  1B87 A;  4KOU A;  2FVG A;  3FYN A;  3SI1 A;  4OC1 A;  5BWA B;  2J8N A;  4MHD A;  2VL1 A;  4CYO A;  4B5P A;  4ZY0 A;  1OZP A;  5A28 A;  2FE7 A;  1IY7 A;  4IF5 A;  1YSJ A;  1PUA A;  3HLP A;  4UCP A;  4UEF A;  3IO1 A;  4PXD A;  4MMO A;  3BI1 A;  2C6P A;  4AG9 A;  3I9S A;  2BEI A;  4UFV A;  1HDU A;  3ISX A;  3TCV A;  4A94 A;  5EC4 A;  5IV0 A;  2D4O A;  1Z9U A;  4C7I A;  4CAE A;  4FUU A;  4XPD B;  2B5G B;  1XJO A;  4C2X A;  1CP6 A;  5JPH A;  2AFM A;  4MCS A;  4QUS A;  4JD6 A;  3HUV A;  3P2F A;  3EY5 A;  4WJB A;  4F0Y A;  4ZGY B;  2B58 A;  1Y0R A;  2NSM A;  2QYV A;  2VI7 A;  3NA6 A;  3TO7 A;  3PZJ A;  5F49 A;  2J9A A;  2GIV A;  4NGS A;  3TC8 A;  4B14 A;  3T8W A;  1V0C A;  2REE A;  2PJ3 A;  1Q2C A;  4ONW A;  4M3S A;  4NGR A;  3A9L A;  2ATR A;  1LAP A;  4DJL A;  4LUA A;  3H8G A;  3IU2 A;  4IHM A;  3PFE A;  2I79 A;  4CRZ B;  4UEZ A;  2AFS A;  2ZW7 A;  4B6Z A;  1BAV A;  2EK8 A;  4OC2 A;  1N71 A;  3FMC A;  2VXK A;  3I3G A;  1S3Z A;  2AFU A;  1VGY A;  1AYE A;  2GLJ A;  3V38 A;  2KCW A;  3PFO A;  2Q44 A;  4MHZ A;  4DUK A;  5JH9 A;  5CBM A;  2ZW4 A;  2CF4 A;  3E0K A;  4U5Y A;  1I1D A;  4BIN A;  4G1P A;  3ZZI A;  1M4L A;  2EUI A;  4DNC A;  3NFZ A;  4F9U A;  2GE3 A;  2P0W A;  3CPX A;  4JJX A;  4NGM A;  4AXV A;  2P6F A;  3IWE A;  4A2Z A;  1MJB A;  4KOR A;  2PRQ A;  4KS9 A;  4MI4 A;  1KUY A;  4OC4 A;  2Z3P A;  2VQY A;  3B2Y A;  3V8I A;  1AMP A;  4M6I A;  1Z8X A;  2CTB A;  2O53 A;  3TT2 A;  3D4U A;  4UIB A;  3VH9 A;  3NE7 A;  1QQ9 A;  4ZX9 A;  2PRB A;  3JUW A;  1XE4 A;  2YGW A;  3KZW A;  4NSQ A;  4ZY1 A;  1KUX A;  1UFH A;  3B35 A;  2XEG A;  3FVL A;  1VHS A;  4IK2 A;  4UCN A;  2G0B A;  4GM5 A;  4NFR A;  3EFA A;  3IWW A;  4C2Y A;  2PQ8 A;  2WPW A;  3EC4 A;  2ZPA A;  1TKF A;  2WPX A;  1F2P A;  2B5G A;  3DGV A;  2QJ8 A;  2PJ2 A;  3PB6 X;  4K3N A;  1WK4 A;  2B4B A;  5AGE A;  1YW6 A;  4K30 A;  2AE6 A;  1KUV A;  4GXH A;  2NYQ A;  2Q43 A;  4OC0 A;  1ARL A;  2PJ0 A;  4M6G A;  5I4M A;  1TIQ A;  4MCQ A;  4OC3 A;  3WT4 A;  4CYP A;  2VBQ A;  1YQE A;  2FL4 A;  4MHN A;  5CNP A;  2CNT A;  4MFZ A;  6CPA A;  4E2A A;  1H8L A;  2PVV A;  4A33 A;  1XMB A;  2IJZ A;  2ZEG A;  3DNS A;  3I1U A;  3MN8 A;  2V8H A;  4BD9 A;  4PXE A;  1IIC A;  2DF5 A;  5CPA A;  3S6K A;  1YVO A;  3FH4 A;  5E96 A;  4HNX B;  1TF9 A;  5DWM A;  3K9U A;  3SXO A;  4L89 A;  3G8W A;  3GB0 A;  3V7Z A;  2O28 A;  3FXT A;  2YNC A;  1Q2Y A;  3KQX A;  3BXM A;  3GLJ A;  4MFP A;  3FF3 A;  2AFW A;  5AG4 A;  3TE4 A;  2J8M A;  2P6G A;  3S6H A;  1JWQ A;  4MBU A;  2WSA A;  4CGM A;  4JLY A;  2QIR A;  2PJC A;  4ORF A;  2WYR A;  4LX9 A;  1BPN A;  3N5F A;  4PK2 A;  4R9M A;  4CAX A;  5K8P A;  3BHX A;  5G20 A;  3LOD A;  2IMO A;  4OID A;  4E0A A;  2PVW A;  2AFZ A;  3D3S A;  2YND A;  4RN7 A;  1YW4 A;  2JBJ A;  2YNC C;  4KVX A;  4NGN A;  3TFY A;  2G3T A;  4L8A A;  2B3V A;  4PV6 A;  2Y0M A;  5IB9 A;  4KOT A;  2G3A A;  2B3U A;  5LRK A;  5HVF A;  1CX8 A;  3H4Q A;  2ZXV A;  3ZJ0 A;  2JEW A;  3CDX A;  3T9Y A;  5LYD A;  4DYO A;  2HUZ A;  1YLO A;  1LAM A;  2PR8 A;  2ZEF A;  4KSF A;  1XRY A;  4UFW A;  3VAR A;  2CTC A;  3W6S A;  2ZEL A;  4M85 A;  1ELL P;  4A30 A;  4EWT A;  2ZEE A;  3B3C A;  5HVH A;  4PXB A;  3IU1 A;  1L0C A;  4FWU A;  3B3W A;  4XNH C;  2HB6 A;  3KR4 A;  2NMT A;  3TO6 A;  4TWE A;  4BMH A;  3SJE A;  2EWB A;  5THW A;  1Z8L A;  4NGQ A;  3VWD A;  1VKC A;  4MHY A;  5KTA A;  4A39 A;  2XEJ A;  2Z3L A;  1TKJ A;  1VIX A;  2ODF A;  2ZOF A;  2JBK A;  4ZX8 A; 
#chains in the Genus database with same CATH homology
 5F48 A;  3VWE A;  3S6G A;  2H5M A;  4FD4 A;  4GS4 A;  2VEZ A;  4KUA A;  4NXY A;  3H5Z A;  5C82 A;  1BO4 A;  1P4N A;  5FVJ A;  2AJ6 A;  1B6B A;  3T90 A;  3FB3 A;  3CXS A;  1S7F A;  2R98 A;  4R87 A;  2Z3K A;  2FIA A;  5G21 A;  3TTH A;  3GYA A;  4CS0 B;  1Z4E A;  4MFJ A;  4Y49 B;  2VZZ A;  3QB8 A;  1RXT A;  1XF8 A;  4UWI A;  5A27 A;  2BL1 A;  4B12 A;  4FD7 A;  2FT0 A;  1K4J A;  1XEB A;  2Q4Y A;  4HNW B;  1M4G A;  2CNS A;  4U9Z A;  1YK3 A;  1BOB A;  2RC4 A;  1QSR A;  3KKW A;  1ON0 A;  1QSO A;  5KTD A;  4CGO A;  4Q36 A;  2GAN A;  1S7N A;  2I00 A;  2OH1 A;  4BBH A;  2QEC A;  1R57 A;  2Q4V A;  2HV2 A;  3FNC A;  4B10 A;  2Z10 A;  4B5P B;  4AVB A;  5AG7 A;  3F5B A;  2J8R A;  4F0X A;  1M4I A;  4NEX A;  4H89 A;  4FD5 A;  4XPD C;  4A31 A;  4YFJ A;  2A4N A;  3MGD A;  3D2P A;  2PDO A;  2WUU A;  4OAE A;  4EVY A;  4ONU A;  3QAH A;  4HKF A;  4MY3 A;  3SXN A;  2PSW A;  2R8V A;  4KLW A;  2Z0Z A;  3FRM A;  2HQY A;  3F0A A;  2CNM A;  5IX3 A;  2FXF A;  4AVC A;  4KVM E;  4MFK A;  3R95 A;  4YGO A;  3BJ7 A;  4I49 A;  3FIX A;  2FCK A;  1QST A;  3IWG A;  2IL4 A;  1YRE A;  4B5O A;  4FD6 A;  1I12 A;  4OAD A;  1CM0 A;  1WWZ A;  1YX0 A;  2ZW5 A;  2DPT A;  3DDD A;  1YLE A;  4R3L A;  4RS2 A;  4UCM A;  4CGN A;  5IB0 A;  5J8C A;  4Y49 C;  2B4D B;  2Q7B A;  4XPL A;  5AG5 A;  5G22 A;  4HNY B;  1PU9 A;  3FBU A;  4PSX A;  3TOA A;  4A32 A;  2K5T A;  4MY0 A;  2Z11 A;  5JQ4 A;  5DWN A;  4KVO E;  4KOS A;  2QML A;  2CXA A;  2JEV A;  4II9 A;  4KUB A;  4NF1 A;  2CY2 A;  1Q2D A;  1Y9K A;  2Q04 A;  4B11 A;  4A95 A;  1NE9 A;  4KZT A;  1YVK A;  2Q0Y A;  1Y9W A;  4KSA A;  1RO5 A;  3N7Z A;  2BSW A;  4YRH A;  4UBR A;  3P2H A;  4Q38 A;  1M1D A;  4QBJ A;  3R9F A;  2VZY A;  1ZO0 A;  3D2M A;  1GHE A;  2OZH A;  2YNE A;  3PP9 A;  4XPK A;  2DXQ A;  5EBV A;  3DSB A;  3EO4 A;  3JTK A;  2FS5 A;  1Y7R A;  4B13 A;  3JVN A;  4NCZ A;  5G1Z A;  4C7H A;  2ZW6 A;  3RYO A;  4AG7 A;  5C88 A;  2PC1 A;  4KOV A;  5AG6 A;  4CAF A;  4AVA A;  1S60 A;  4U9Y A;  4CGL A;  4F6A A;  4QB9 A;  5F46 A;  2FSR A;  1IB1 E;  4JWP A;  4C68 A;  2Z3M A;  1S5K A;  1SQH A;  1J4J A;  3C26 A;  4PK3 A;  5ISV A;  4CYN A;  4H6U A;  4JXQ A;  4KOY A;  1NSL A;  5HMN A;  3EXN A;  3UY5 A;  2P6E A;  1FY7 A;  3B8G A;  2Z3O A;  3OWC A;  2B4D A;  3TO9 A;  2BUE A;  4XNH B;  5GCN A;  3BJ8 A;  1Z4R A;  4QC6 A;  4X5K A;  2JLM A;  1MJA A;  1YR0 A;  1MJ9 A;  3D8P A;  3DR6 A;  3F8K A;  4CGP A;  5H86 A;  1QSM A;  3CXP A;  4IUS A;  2OZU A;  3S6F A;  1U6M A;  5F47 A;  1CJW A;  3GY9 A;  3GKR A;  4KOW A;  4CYQ A;  4JXR A;  4C2Z A;  2R7H A;  3W6X A;  1LRZ A;  4CAV A;  2FIW A;  4KLV A;  2REF A;  4PSW A;  3R96 A;  5J8F A;  1IYK A;  4MJ8 A;  4UA3 A;  1YGH A;  2OZG A;  2F5I A;  4UFX A;  1S7K A;  3IGR A;  3PGP A;  2Z3N A;  2X7B A;  4J3G A;  4CAW A;  1P0H A;  1S7L A;  4H6Z A;  1M4D A;  2OU2 A;  5KTC A;  4ZBG A;  3R1K A;  2OB0 A;  2R1I A;  3SHP A;  1MK4 A;  4AB7 A;  1M44 A;  4MFL A;  3WR7 A;  4RI1 A;  1QSN A;  4E8O A;  2D4P A;  5H84 A;  1I21 A;  4QVT A;  3TOB A;  3DR8 A;  1XMT A;  1IID A;  3CXQ A;  5HH1 A;  4KOX A;  3W91 A;  1XIX A;  2PR1 A;  2JDD A;  4UWJ A;  4CRY B;  5I0C A;  4R3K A;  1NMT A;  2JDC A;  4OLL A;  4MFQ A;  3R9E A;  3LD2 A;  2DPS A;  1KZF A;  1IYL A;  2ARH A;  3R9G A;  4R57 A;  3BLN A;  3G3S A;  2EVN A;  2C27 A;  1B87 A;  4KOU A;  3FYN A;  5BWA B;  2J8N A;  4MHD A;  4CYO A;  4B5P A;  1OZP A;  5A28 A;  2FE7 A;  4IF5 A;  1PUA A;  4UCP A;  4AG9 A;  3I9S A;  2BEI A;  4UFV A;  3TCV A;  5EC4 A;  5IV0 A;  2D4O A;  1Z9U A;  4C7I A;  4CAE A;  4XPD B;  2B5G B;  4C2X A;  5JPH A;  4QUS A;  4JD6 A;  3P2F A;  3EY5 A;  4F0Y A;  4ZGY B;  2B58 A;  3TO7 A;  2VI7 A;  3PZJ A;  5F49 A;  2GIV A;  4B14 A;  1V0C A;  2REE A;  1Q2C A;  4M3S A;  3A9L A;  2ATR A;  4LUA A;  3IU2 A;  2I79 A;  4CRZ B;  2ZW7 A;  1N71 A;  2VXK A;  3I3G A;  1S3Z A;  2KCW A;  2Q44 A;  2ZW4 A;  3E0K A;  4U5Y A;  1I1D A;  3ZZI A;  2EUI A;  4DNC A;  2GE3 A;  2P0W A;  4JJX A;  2P6F A;  3IWE A;  4A2Z A;  1MJB A;  4KOR A;  4KS9 A;  4MI4 A;  1KUY A;  2Z3P A;  2VQY A;  3V8I A;  3TT2 A;  3NE7 A;  2PRB A;  3JUW A;  1XE4 A;  2YGW A;  4NSQ A;  1KUX A;  1UFH A;  1VHS A;  4UCN A;  2G0B A;  3EFA A;  4C2Y A;  2PQ8 A;  2WPW A;  3EC4 A;  2ZPA A;  2WPX A;  2B5G A;  1WK4 A;  2B4B A;  5AGE A;  4K30 A;  2AE6 A;  1KUV A;  1TIQ A;  4CYP A;  2VBQ A;  2FL4 A;  5CNP A;  2CNT A;  4MFZ A;  4E2A A;  4A33 A;  3DNS A;  1IIC A;  3S6K A;  1YVO A;  5E96 A;  4HNX B;  5DWM A;  3K9U A;  3SXO A;  4L89 A;  3G8W A;  2O28 A;  3FXT A;  2YNC A;  1Q2Y A;  4MFP A;  5AG4 A;  3TE4 A;  2J8M A;  2P6G A;  3S6H A;  4MBU A;  2WSA A;  4CGM A;  4JLY A;  2QIR A;  4ORF A;  4LX9 A;  4PK2 A;  4R9M A;  4CAX A;  5G20 A;  3LOD A;  4E0A A;  3D3S A;  2YND A;  2YNC C;  4KVX A;  3TFY A;  2G3T A;  4L8A A;  2B3V A;  4PV6 A;  2Y0M A;  4KOT A;  2G3A A;  2B3U A;  3H4Q A;  2ZXV A;  3ZJ0 A;  3T9Y A;  2HUZ A;  2PR8 A;  4KSF A;  4UFW A;  3W6S A;  4M85 A;  4A30 A;  3IU1 A;  1L0C A;  4XNH C;  4BMH A;  2NMT A;  3TO6 A;  3VWD A;  1VKC A;  5KTA A;  2Z3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...