4CAEA

Plasmodium vivax n-myristoyltransferase in complex with a benzothiophene inhibitor (compound 20b)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of High Affinity Inhibitors of Plasmodium Falciparum and Plasmodium Vivax N-Myristoyltransferases Directed by Ligand Efficiency Dependent Lipophilicity (Lelp).
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4caeA00
3JTKA 4CGPA 4C68A 3H5ZA 4BBHA 4CYPA 5AG5A 5G22A 4C2YA 2YNCC 4A32A 5AG7A 4UCMA 4UFVA 4B13A 4B14A 2YNDA 4UFWA 4A31A 5A28A 4UCPA 2WUUA 2YNEA 4CGOA 4CYQA 5A27A 4UCNA 4C7HA 4B10A 4CYOA 5G21A 4CGLA 4C2XA 4UFXA 4CAEA 4CYNA 5G1ZA 4A2ZA 4C7IA 4CGMA 4B11A 3IU2A 2WSAA 5AG6A 4A95A 2YNCA 4CGNA 5AG4A 4CAFA 4A30A 4A33A 5AGEA 4B12A 4C2ZA 3IU1A 3IWEA 5G20A
chains in the Genus database with same CATH superfamily
2I79A 1Z4EA 4C68A 1YX0A 4KOYA 2Z3KA 2PDOA 1TKHA 1F2PA 3QAYA 2V77A 1QSTA 2PSWA 4NGMA 4P4IA 5HMNA 2PJ9A 4UF4A 2GLJA 4FD4A 4OC4A 1PU9A 1RTQA 1S60A 5IX3A 3MN8A 4CGMA 4RUHA 2GLFA 4B11A 4YGOA 3I3GA 4UEZA 2GIVA 2BO9A 5J1QA 4KZTA 3DNSA 2B5GA 2FCKA 3IWEA 1S3ZA 4CAVA 4MHDA 3JTKA 4MJ8A 5CPAA 1XBUA 2VL1A 3WABA 1M4IA 1TKFA 3D7HA 4KSAA 1IICA 3WT4A 4XPLA 5HVGA 3I9SA 2D4PA 3D3SA 4Y49C 1CBXA 1CX8A 2Q4ZA 1F57A 3CPAA 4B14A 3S9LA 1MK4A 2G0BA 2PJ3A 4QUSA 4CGOA 2GFQA 3H8FA 2BSWA 3RYOA 3DGVA 3LODA 4K3NA 3ZJ0A 4AG9A 5C82A 4B10A 2O4HA 4B5PB 2F7VA 3CT9A 4CGLA 1S7NA 2ZW4A 3KL9A 4PK2A 5HXDA 3G3SA 1M44A 3K9UA 2XEJA 2PQ8A 1K4JA 2Q7SA 4PQAA 4MCPA 4EVYA 5FVJA 1BLLE 3F5BA 2Q4YA 3H4QA 4KLVA 5EC4A 3R9FA 5LYFA 1AMPA 4YRHA 2ODFA 5LRKA 4KVME 2KCWA 4L8AA 1XF8A 4OMEA 1KWMA 2CTBA 2P6EA 4HPSA 1Z8WA 2PJ0A 4PXCA 4B13A 3K9TA 4H6UA 4OC0A 5D29A 3IO1A 2CTCA 4P45A 4FUUA 5ELYA 1H8LA 5LYIA 3VH9A 2WPWA 4MHPA 7CPAA 2AFZA 4M6GA 1KUVA 4EWTA 2AFOA 1VGYA 3D67A 3IGRA 2BOAA 2WPXA 2YNCA 4P4EA 5H84A 4ZI6A 4XNHC 1CM0A 4NEXA 2Q7BA 5DWNA 4TWEA 4MHYA 2V8VA 2VI7A 3ISXA 4Q38A 5IB0A 1X12A 4M85A 4NF1A 5G22A 1XIXA 4MFPA 4ONUA 2POKA 2PVVA 1KUYA 3BXMA 2ABZA 4KSIA 2B4BA 4I49A 1S7FA 3IEHA 2ZEEA 2PRBA 4MFQA 2FSRA 4R57A 3TOAA 1R57A 1YVOA 2PJ1A 3BI1A 3TO6A 5EBVA 2AFMA 5BWAB 1MJAA 2PVWA 4CYQA 4F8ZA 1NSLA 2EBJA 3D2MA 2QJ8A 3W6XA 1BPNA 4CAEA 3SJEA 4IAVA 1Y9WA 4CAXA 1AUGA 2OOTA 2PIYA 3KQZA 1XEBA 3RAMA 4Y49B 2RC4A 2OZHA 2EWBA 1CP6A 4XPDC 2Q04A 2C27A 4JJXA 4ZX8A 3JUWA 4UBRA 4WWVA 2CF4A 2CIJA 3NH4A 1YREA 2Z0ZA 4OC3A 1IOIA 1QSOA 2XEIA 2HC9A 5D8NA 2VBQA 4MFLA 2ZEFA 1P4NA 4C2YA 1TIQA 2ZPAA 2R7HA 3PFOA 4Q7AA 4UCMA 4UFVA 1F2OA 4UFWA 3PB6X 1ELMP 4CRZB 3D7FA 3FRMA 4JYWA 5DS0A 3T8WA 4KOSA 3LACA 4FAIA 4ZGYB 1Q2DA 2Y0MA 4MHNA 2ZEOA 3GKRA 3B2YA 2Z3NA 5THWA 5CBMA 3D68A 1LAMA 3KI9A 4H6ZA 2B4DA 4CGNA 3B3VA 4MHZA 4NSQA 3TT2A 2ZEPA 2OB0A 3PB7X 1A2ZA 1M4DA 2EO8A 3CXSA 1TF9A 1CPXA 1Y0YA 4RI1A 3GB0A 3SJGA 4PK3A 4DJLA 3L2NA 5K8PA 3DR8A 4OC2A 4P6YA 2GANA 3D2PA 4FD7A 5K8MA 3MGDA 2EUIA 3CXQA 3B7IA 4H2KA 4NFRA 4P4DA 2AE6A 2NYQA 2J9AA 4MFJA 3KZWA 4A31A 5F49A 4UCPA 3V38A 2CXAA 2FXFA 2F5IA 2PRQA 2EK9A 4J3GA 3S6KA 1AYEA 2IMOA 4XNHB 5J8FA 4DUKA 4Q36A 4X5KA 3TX8A 5J8CA 1YLEA 2B58A 2OR4A 4OIDA 4R87A 3KKWA 1VHSA 1OZPA 2WSAA 3BI0A 2REFA 4R7MA 2FIAA 1GHEA 5AG4A 4QVTA 4MFZA 4A39A 4OAEA 2D4OA 3R1KA 3NE7A 4PV6A 4IHMA 4NCZA 1QSRA 2FVGA 4AVCA 2FS5A 1M1DA 2O28A 4UIBA 4DYOA 3PB4X 5H86A 3KR5A 2IL4A 4X3RA 1TF8A 3G8WA 4CYOA 2NMTA 3D7GA 5E96A 4A38A 4XPDB 3LD2A 1ZG8A 4IUSA 1YSJA 4KOVA 2R8VA 1XFOA 3SXOA 3T90A 4KUBA 3F0AA 1YW6A 1M4LA 4NXYA 4F9UA 5IB9A 4NJQA 1Y7RA 4RN7A 4B5OA 3BHXA 4C2ZA 3TOBA 3W91A 2C6CA 1XMTA 2CNMA 1BO4A 3P2HA 4HNYB 5CNPA 3OWCA 3A9LA 4FD5A 2CY2A 3UY5A 1M4GA 1BAVA 4QBJA 2YNDA 3VARA 3JVNA 1Q2YA 2V8DA 4FD6A 4P10A 3S6GA 4MCQA 3CXPA 4UA3A 3P2FA 3TTHA 2I00A 1YQEA 3KHXA 4XPKA 4C7IA 2VQYA 2PR8A 3VWEA 3B3SA 1CJWA 5G1ZA 1FY7A 2JBJA 2HUZA 3VWDA 1Q2CA 2ANPA 2Z3LA 2ZW5A 2GU2A 2PJ7A 4P4JA 2AFUA 2B4DB 3NH5A 4R76A 5AG6A 4NGRA 5LRJA 3TFYA 2OZUA 4P4BA 3W6SA 4CAFA 2P6FA 4M6IA 4OADA 3IU1A 5F47A 4CGPA 5K8NA 3C26A 4JXRA 4BBHA 2JEWA 3B3CA 4PXDA 2PJ5A 4LUAA 2WZNA 4M3SA 5AG5A 4E0AA 4ZY1A 2YNCC 4ZY2A 5DWMA 4NGPA 1YLOA 4QB9A 3KASA 2EK8A 2VXKA 3EFAA 5HH1A 1QQ9A 1Z8LA 1R43A 3HLPA 4M6HA 1HDUA 1P0HA 4Z65A 2ZELA 4R8FA 2OU2A 3D66A 2PCUA 4CYNA 4HKFA 1YW4A 1YMEA 2BL1A 3FNCA 1WK4A 4PPZA 3VATA 4CRYB 3FX6A 4KOUA 5F09A 1VHEA 1OBRA 1QMUA 1PYTB 3IWGA 3FMCA 1Z4RA 3FVLA 1HEEA 1JQGA 2PJCA 4KUAA 2ARHA 3HUVA 3PB9X 2ZEHA 4YWYA 4ONWA 4A33A 4F6AA 8CPAA 2B5GB 1TXRA 2OH1A 4R9MA 4FBEA 2DPSA 5HVHA 5LYLA 2C1CA 2ZEDA 4OIWA 4A32A 2VZZA 4BD9A 3GUXA 4AVAA 4O23A 3LWUA 4FWUA 4UEEA 3S6FA 2R1IA 4IF5A 3TE4A 1IYLA 4B5PA 4UCNA 4C7HA 3F8KA 1I1DA 1SQHA 3I1UA 3E0KA 2CNTA 4MRIA 2DEAA 4P4FA 4JWPA 2JBKA 3TO7A 4ZBGA 3RNZA 4YFJA 1Q7LA 4IK2A 1R3NA 2ZW6A 4CS0B 5JPHA 3NE8A 1ON0A 2DPTA 1PCAA 4PSXA 5JH9A 1FT7A 1GYTA 1CG2A 1NE9A 2GE3A 2H5MA 2OZGA 1FNOA 2BEIA 2QMLA 2QYVA 3H5ZA 4P44A 4KS9A 1XE4A 4MMOA 4GS4A 1Z8XA 2IJZA 4OP4A 4AG7A 2PR1A 4JLYA 4JD6A 5AG7A 3FEEA 1IB1E 2PJBA 3D7DA 3B8GA 3N5FA 3TCVA 1Z2LA 2PJAA 4NGNA 4NJRA 3FEDA 3V7ZA 2JEVA 3R96A 3BJ8A 2P0WA 1VKCA 3FBUA 3RZAA 4UFXA 2R98A 2Q44A 3WC7A 1LCPA 4R3LA 2PC1A 1NSAA 1Y7EA 1ARMA 2Z11A 4AB7A 1Z5RA 3V8IA 1VHOA 1YR0A 2J8MA 1XRYA 3DSBA 3GYAA 4PXEA 1ZLIA 1UWYA 3S6HA 1MJBA 2O53A 3NA6A 2B3UA 3PB8X 3KQXA 3PRTA 4HNWB 3GY9A 4A37A 3H8EA 2ZOFA 3KHZA 2NSMA 5K8OA 1Y0RA 5I0CA 2PJ4A 3JRUA 3H8GA 1DTDA 3LMSA 2I3CA 4X8IA 5A28A 2Z10A 2G3TA 2HQYA 2K5TA 3DR6A 3FH4A 1Z9UA 4ZY0A 1RO5A 4OKOA 1N71A 3D4UA 1PUAA 2P6GA 5G21A 4C2XA 3CDXA 3RO0A 4QC6A 1Y9KA 3KR4A 3PEIA 5F46A 5C88A 3EC4A 3S9MA 4UEFA 4NGQA 5LRGA 3N7ZA 3SI1A 1IU8A 2B3VA 2JDDA 4KOXA 1I12A 3DLJA 2Q51A 5AGEA 3SI2A 1I21A 1JWQA 2AFWA 4AXVA 3B35A 4RS2A 3FJUA 2X7BA 2FL4A 1ZG7A 2FT0A 2V8GA 4ZX9A 2Z3PA 3TO9A 5KTAA 1IOFA 4UIAA 4U9ZA 1HDQA 4KORA 2J8NA 2CNSA 1S7LA 2G3AA 2XEFA 3PBEA 2HB6A 3BJ7A 1J4JA 1RXTA 2DXQA 5A27A 4OC1A 3TC8A 2JLMA 3R9GA 2PJ6A 4HNXB 4AVBA 2Z3MA 5JQ4A 2ZXVA 3NFZA 1B6BA 3IIBA 4A2ZA 3CZXA 1DE4C 1XMBA 2FE7A 6CPAA 4F0XA 5I4MA 1IGBA 4OC5A 1LFWA 3IFEA 1LRZA 1YGHA 3KGQA 1LOKA 4A30A 5JM6A 2V8HA 2G9DA 3WC6A 4B6ZA 4DNCA 4KOTA 5G20A 2DF5A 2Q4VA 2AJ6A 3QAHA 2Q0YA 1X10A 1NMTA 4MY0A 2AFSA 2PE3A 2AFXA 2ZENA 4MCSA 4BINA 3R9EA 2YNEA 4PSWA 4L89A 2XEGA 2RFHA 2EVNA 4UWJA 4E2AA 3ISZA 1Z8TA 3DDDA 2PIZA 1YVKA 1LANA 4II9A 3PP9A 3EO4A 2REEA 5HVFA 4U5YA 4GM5A 5KTCA 4E8OA 4CAWA 1KUXA 1UFHA 1S7KA 2J8RA 2VEZA 3PBBA 4UWIA 5EMIA 3SI0A 1XOVA 3PGPA 4KLWA 3K2KA 1MJ9A 3PZJA 2WYRA 3FF3A 3RBUA 3SHPA 3ZZIA 4PXBA 3QNVA 1CP7A 1S5KA 4NGSA 3S9NA 4KVOE 1ZO0A 1YK3A 1ELLP 4H89A 2WUUA 4BMHA 2ZOGA 4MBUA 1LAPA 2ZEMA 4ZYQA 2HV2A 3IWWA 2GREA 4WJBA 3FXTA 4R3KA 2C6GA 3R95A 4LQGA 4JXQA 4CPAA 3CPXA 1BOBA 2QIRA 2A4NA 3SJFA 3NH8A 2JDCA 4GXHA 3IC1A 2VZYA 3EXNA 3GLJA 3QB8A 1WWZA 5LYDA 4EMEA 4LQ6A 4A95A 1VIXA 1IYKA 3WR7A 2QVPA 3MRUA 3D8PA 4LX9A 4NGTA 2PJ2A 3IJ3A 1V0CA 1EE3P 2ZW7A 3BLNA 4MY3A 5GCNA 2QECA 4OLLA 3B3WA 3PFEA 2F8HA 3FB3A 3SXNA 4CYPA 2FIWA 4YU9A 3SJXA 4K30A 2BCOA 1B87A 5JGFA 3FIXA 4TNUA 3B3TA 3EY5A 4W9YA 1ARLA 1ZLHA 4KSFA 2Q43A 4ORFA 1IY7A 4U9YA 3FECA 3WC5A 3T9YA 2YGWA 4A94A 5KTDA 1IIDA 2BUEA 4EFDA 2IQ6A 2ATRA 4F9VA 3GIUA 1CPSA 4MXUA 5F48A 2PJ8A 1L0CA 1XJOA 1KZFA 2RB7A 4MFKA 4JZ0A 1ZG9A 4KOWA 4MCRA 4X2TA 1U6MA 1TKJA 2Z3OA 3IU2A 1QSNA 4KVXA 4R6TA 4MI4A 1BPMA 2C6PA 4F0YA 4G1PA 5IV0A 5ISVA 3FYNA 4B12A 2ZEGA 1QSMA
chains in the Genus database with same CATH topology
2I79A 1Z4EA 4C68A 1YX0A 4KOYA 2Z3KA 2PDOA 1QSTA 2PSWA 5HMNA 4FD4A 1PU9A 1S60A 5IX3A 4CGMA 4B11A 4YGOA 3I3GA 2GIVA 4KZTA 3DNSA 2B5GA 2FCKA 3IWEA 1S3ZA 4CAVA 4MHDA 3JTKA 4MJ8A 1M4IA 4KSAA 1IICA 4XPLA 3I9SA 2D4PA 3D3SA 4Y49C 4B14A 1MK4A 2G0BA 4QUSA 4CGOA 2BSWA 3RYOA 3LODA 3ZJ0A 4AG9A 5C82A 4B10A 4B5PB 4CGLA 1S7NA 2ZW4A 4PK2A 3G3SA 1M44A 3K9UA 2PQ8A 1K4JA 4EVYA 5FVJA 3F5BA 2Q4YA 3H4QA 4KLVA 5EC4A 3R9FA 4YRHA 4KVME 2KCWA 4L8AA 1XF8A 2P6EA 4B13A 4H6UA 2WPWA 1KUVA 3IGRA 2WPXA 2YNCA 5H84A 4XNHC 1CM0A 4NEXA 2Q7BA 5DWNA 2VI7A 4Q38A 5IB0A 4M85A 4NF1A 5G22A 1XIXA 4MFPA 4ONUA 1KUYA 2B4BA 4I49A 1S7FA 4R57A 2PRBA 4MFQA 2FSRA 3TOAA 1R57A 1YVOA 3TO6A 5BWAB 5EBVA 1MJAA 4CYQA 1NSLA 3D2MA 3W6XA 4CAEA 1Y9WA 4CAXA 1XEBA 4Y49B 2RC4A 2OZHA 4XPDC 2Q04A 4JJXA 2C27A 3JUWA 4UBRA 1YREA 2Z0ZA 1QSOA 2VBQA 4MFLA 4C2YA 1P4NA 1TIQA 2ZPAA 2R7HA 4UCMA 4UFVA 4UFWA 4CRZB 3FRMA 4KOSA 4ZGYB 1Q2DA 2Y0MA 3GKRA 2Z3NA 4H6ZA 2B4DA 4CGNA 3TT2A 4NSQA 2OB0A 3CXSA 1M4DA 4RI1A 4PK3A 3DR8A 2GANA 3D2PA 4FD7A 3MGDA 2EUIA 3CXQA 2AE6A 4MFJA 4A31A 5F49A 4UCPA 2CXAA 2FXFA 2F5IA 4J3GA 3S6KA 4XNHB 5J8FA 4Q36A 4X5KA 5J8CA 1YLEA 2B58A 4R87A 3KKWA 1VHSA 1OZPA 2WSAA 2REFA 2FIAA 1GHEA 5AG4A 4QVTA 4MFZA 4OAEA 2D4OA 3R1KA 3NE7A 4PV6A 4NCZA 1QSRA 2FS5A 1M1DA 2O28A 5H86A 2IL4A 3G8WA 4CYOA 2NMTA 5E96A 4XPDB 3LD2A 4IUSA 4KOVA 2R8VA 3SXOA 3T90A 4KUBA 3F0AA 4NXYA 1Y7RA 4B5OA 4C2ZA 3TOBA 3W91A 1XMTA 2CNMA 1BO4A 3P2HA 4HNYB 5CNPA 3OWCA 3A9LA 4FD5A 2CY2A 3UY5A 1M4GA 4QBJA 2YNDA 3JVNA 1Q2YA 4FD6A 3S6GA 3CXPA 4UA3A 3P2FA 3TTHA 2I00A 4XPKA 2VQYA 2PR8A 3VWEA 1CJWA 5G1ZA 1FY7A 4C7IA 2HUZA 3VWDA 1Q2CA 2Z3LA 2ZW5A 5AG6A 2B4DB 3TFYA 2OZUA 3W6SA 4CAFA 2P6FA 4OADA 3IU1A 5F47A 4CGPA 3C26A 4JXRA 4BBHA 4LUAA 5AG5A 4M3SA 4E0AA 2YNCC 5DWMA 4QB9A 2VXKA 3EFAA 5HH1A 1P0HA 2OU2A 4CYNA 4HKFA 2BL1A 3FNCA 4CRYB 1WK4A 4KOUA 3IWGA 1Z4RA 4KUAA 4A33A 2ARHA 4F6AA 2B5GB 2OH1A 4R9MA 2DPSA 4A32A 2VZZA 4AVAA 3S6FA 2R1IA 4IF5A 3TE4A 1IYLA 4B5PA 4UCNA 4C7HA 3F8KA 1I1DA 1SQHA 3E0KA 2CNTA 4JWPA 3TO7A 4ZBGA 4YFJA 2ZW6A 4CS0B 5JPHA 1ON0A 2DPTA 4PSXA 1NE9A 2GE3A 2H5MA 2OZGA 2QMLA 2BEIA 3H5ZA 4AVCA 4KS9A 1XE4A 4GS4A 4AG7A 2PR1A 4JLYA 4JD6A 5AG7A 1IB1E 3B8GA 3TCVA 2JEVA 3R96A 3BJ8A 2P0WA 1VKCA 3FBUA 4UFXA 2R98A 2Q44A 4R3LA 2PC1A 4AB7A 2Z11A 3V8IA 2J8MA 1YR0A 3DSBA 3GYAA 3S6HA 1MJBA 2B3UA 4HNWB 3GY9A 5I0CA 5A28A 2Z10A 2G3TA 2HQYA 2K5TA 3DR6A 1Z9UA 1RO5A 1N71A 5G21A 1PUAA 2P6GA 4C2XA 4QC6A 1Y9KA 5F46A 5C88A 3EC4A 3N7ZA 2B3VA 4KOXA 2JDDA 1I12A 5AGEA 1I21A 4RS2A 2X7BA 2FL4A 2FT0A 2Z3PA 3TO9A 5KTAA 4U9ZA 4KORA 2J8NA 2CNSA 1S7LA 2G3AA 3BJ7A 1J4JA 1RXTA 2DXQA 5A27A 2JLMA 3R9GA 4AVBA 4HNXB 5JQ4A 2Z3MA 2ZXVA 1B6BA 4A2ZA 2FE7A 4F0XA 1LRZA 1YGHA 4A30A 4DNCA 4KOTA 5G20A 2Q4VA 2AJ6A 3QAHA 2Q0YA 1NMTA 4MY0A 3R9EA 2YNEA 4PSWA 4L89A 2EVNA 4UWJA 4E2AA 3DDDA 1YVKA 4II9A 3PP9A 3EO4A 2REEA 4U5YA 5KTCA 4E8OA 4CAWA 1KUXA 2VEZA 1UFHA 1S7KA 2J8RA 4UWIA 3PGPA 4KLWA 3SHPA 1MJ9A 3PZJA 3ZZIA 1S5KA 4KVOE 1ZO0A 1YK3A 4H89A 2WUUA 4BMHA 4MBUA 2HV2A 3FXTA 4R3KA 3R95A 4JXQA 1BOBA 2QIRA 2A4NA 2JDCA 2VZYA 3EXNA 3QB8A 1WWZA 4A95A 1IYKA 3WR7A 3D8PA 4LX9A 1V0CA 2ZW7A 3BLNA 4MY3A 5GCNA 2QECA 4OLLA 3FB3A 3SXNA 4CYPA 2FIWA 4K30A 1B87A 3FIXA 3EY5A 4KSFA 4ORFA 4U9YA 3T9YA 2YGWA 5KTDA 1IIDA 2BUEA 2ATRA 5F48A 1L0CA 1KZFA 4MFKA 4KOWA 1U6MA 2Z3OA 3IU2A 4KVXA 1QSNA 4MI4A 4F0YA 5IV0A 5ISVA 3FYNA 4B12A 1QSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTK A;  4CGP A;  4C68 A;  3H5Z A;  4BBH A;  4CYP A;  5AG5 A;  5G22 A;  4C2Y A;  2YNC C;  4A32 A;  5AG7 A;  4UCM A;  4UFV A;  4B13 A;  4B14 A;  2YND A;  4UFW A;  4A31 A;  5A28 A;  4UCP A;  2WUU A;  2YNE A;  4CGO A;  4CYQ A;  5A27 A;  4UCN A;  4C7H A;  4B10 A;  4CYO A;  5G21 A;  4CGL A;  4C2X A;  4UFX A;  4CAE A;  4CYN A;  5G1Z A;  4A2Z A;  4C7I A;  4CGM A;  4B11 A;  3IU2 A;  2WSA A;  5AG6 A;  4A95 A;  2YNC A;  4CGN A;  5AG4 A;  4CAF A;  4A30 A;  4A33 A;  5AGE A;  4B12 A;  4C2Z A;  3IU1 A;  3IWE A;  5G20 A; 
#chains in the Genus database with same CATH topology
 2I79 A;  1Z4E A;  4C68 A;  1YX0 A;  4KOY A;  2Z3K A;  2PDO A;  1TKH A;  1F2P A;  3QAY A;  2V77 A;  1QST A;  2PSW A;  4NGM A;  4P4I A;  5HMN A;  2PJ9 A;  4UF4 A;  2GLJ A;  4FD4 A;  4OC4 A;  1PU9 A;  1RTQ A;  1S60 A;  5IX3 A;  3MN8 A;  4CGM A;  4RUH A;  2GLF A;  4B11 A;  4YGO A;  3I3G A;  4UEZ A;  2GIV A;  2BO9 A;  5J1Q A;  4KZT A;  3DNS A;  2B5G A;  2FCK A;  3IWE A;  1S3Z A;  4CAV A;  4MHD A;  3JTK A;  4MJ8 A;  5CPA A;  1XBU A;  2VL1 A;  3WAB A;  1M4I A;  1TKF A;  3D7H A;  4KSA A;  1IIC A;  3WT4 A;  4XPL A;  5HVG A;  3I9S A;  2D4P A;  3D3S A;  4Y49 C;  1CBX A;  1CX8 A;  2Q4Z A;  1F57 A;  3CPA A;  4B14 A;  3S9L A;  1MK4 A;  2G0B A;  2PJ3 A;  4QUS A;  4CGO A;  2GFQ A;  3H8F A;  2BSW A;  3RYO A;  3DGV A;  3LOD A;  4K3N A;  3ZJ0 A;  4AG9 A;  5C82 A;  4B10 A;  2O4H A;  4B5P B;  2F7V A;  3CT9 A;  4CGL A;  1S7N A;  2ZW4 A;  3KL9 A;  4PK2 A;  5HXD A;  3G3S A;  1M44 A;  3K9U A;  2XEJ A;  2PQ8 A;  1K4J A;  2Q7S A;  4PQA A;  4MCP A;  4EVY A;  5FVJ A;  1BLL E;  3F5B A;  2Q4Y A;  3H4Q A;  4KLV A;  5EC4 A;  3R9F A;  5LYF A;  1AMP A;  4YRH A;  2ODF A;  5LRK A;  4KVM E;  2KCW A;  4L8A A;  1XF8 A;  4OME A;  1KWM A;  2CTB A;  2P6E A;  4HPS A;  1Z8W A;  2PJ0 A;  4PXC A;  4B13 A;  3K9T A;  4H6U A;  4OC0 A;  5D29 A;  3IO1 A;  2CTC A;  4P45 A;  4FUU A;  5ELY A;  1H8L A;  5LYI A;  3VH9 A;  2WPW A;  4MHP A;  7CPA A;  2AFZ A;  4M6G A;  1KUV A;  4EWT A;  2AFO A;  1VGY A;  3D67 A;  3IGR A;  2BOA A;  2WPX A;  2YNC A;  4P4E A;  5H84 A;  4ZI6 A;  4XNH C;  1CM0 A;  4NEX A;  2Q7B A;  5DWN A;  4TWE A;  4MHY A;  2V8V A;  2VI7 A;  3ISX A;  4Q38 A;  5IB0 A;  1X12 A;  4M85 A;  4NF1 A;  5G22 A;  1XIX A;  4MFP A;  4ONU A;  2POK A;  2PVV A;  1KUY A;  3BXM A;  2ABZ A;  4KSI A;  2B4B A;  4I49 A;  1S7F A;  3IEH A;  2ZEE A;  2PRB A;  4MFQ A;  2FSR A;  4R57 A;  3TOA A;  1R57 A;  1YVO A;  2PJ1 A;  3BI1 A;  3TO6 A;  5EBV A;  2AFM A;  5BWA B;  1MJA A;  2PVW A;  4CYQ A;  4F8Z A;  1NSL A;  2EBJ A;  3D2M A;  2QJ8 A;  3W6X A;  1BPN A;  4CAE A;  3SJE A;  4IAV A;  1Y9W A;  4CAX A;  1AUG A;  2OOT A;  2PIY A;  3KQZ A;  1XEB A;  3RAM A;  4Y49 B;  2RC4 A;  2OZH A;  2EWB A;  1CP6 A;  4XPD C;  2Q04 A;  2C27 A;  4JJX A;  4ZX8 A;  3JUW A;  4UBR A;  4WWV A;  2CF4 A;  2CIJ A;  3NH4 A;  1YRE A;  2Z0Z A;  4OC3 A;  1IOI A;  1QSO A;  2XEI A;  2HC9 A;  5D8N A;  2VBQ A;  4MFL A;  2ZEF A;  1P4N A;  4C2Y A;  1TIQ A;  2ZPA A;  2R7H A;  3PFO A;  4Q7A A;  4UCM A;  4UFV A;  1F2O A;  4UFW A;  3PB6 X;  1ELM P;  4CRZ B;  3D7F A;  3FRM A;  4JYW A;  5DS0 A;  3T8W A;  4KOS A;  3LAC A;  4FAI A;  4ZGY B;  1Q2D A;  2Y0M A;  4MHN A;  2ZEO A;  3GKR A;  3B2Y A;  2Z3N A;  5THW A;  5CBM A;  3D68 A;  1LAM A;  3KI9 A;  4H6Z A;  2B4D A;  4CGN A;  3B3V A;  4MHZ A;  4NSQ A;  3TT2 A;  2ZEP A;  2OB0 A;  3PB7 X;  1A2Z A;  1M4D A;  2EO8 A;  3CXS A;  1TF9 A;  1CPX A;  1Y0Y A;  4RI1 A;  3GB0 A;  3SJG A;  4PK3 A;  4DJL A;  3L2N A;  5K8P A;  3DR8 A;  4OC2 A;  4P6Y A;  2GAN A;  3D2P A;  4FD7 A;  5K8M A;  3MGD A;  2EUI A;  3CXQ A;  3B7I A;  4H2K A;  4NFR A;  4P4D A;  2AE6 A;  2NYQ A;  2J9A A;  4MFJ A;  3KZW A;  4A31 A;  5F49 A;  4UCP A;  3V38 A;  2CXA A;  2FXF A;  2F5I A;  2PRQ A;  2EK9 A;  4J3G A;  3S6K A;  1AYE A;  2IMO A;  4XNH B;  5J8F A;  4DUK A;  4Q36 A;  4X5K A;  3TX8 A;  5J8C A;  1YLE A;  2B58 A;  2OR4 A;  4OID A;  4R87 A;  3KKW A;  1VHS A;  1OZP A;  2WSA A;  3BI0 A;  2REF A;  4R7M A;  2FIA A;  1GHE A;  5AG4 A;  4QVT A;  4MFZ A;  4A39 A;  4OAE A;  2D4O A;  3R1K A;  3NE7 A;  4PV6 A;  4IHM A;  4NCZ A;  1QSR A;  2FVG A;  4AVC A;  2FS5 A;  1M1D A;  2O28 A;  4UIB A;  4DYO A;  3PB4 X;  5H86 A;  3KR5 A;  2IL4 A;  4X3R A;  1TF8 A;  3G8W A;  4CYO A;  2NMT A;  3D7G A;  5E96 A;  4A38 A;  4XPD B;  3LD2 A;  1ZG8 A;  4IUS A;  1YSJ A;  4KOV A;  2R8V A;  1XFO A;  3SXO A;  3T90 A;  4KUB A;  3F0A A;  1YW6 A;  1M4L A;  4NXY A;  4F9U A;  5IB9 A;  4NJQ A;  1Y7R A;  4RN7 A;  4B5O A;  3BHX A;  4C2Z A;  3TOB A;  3W91 A;  2C6C A;  1XMT A;  2CNM A;  1BO4 A;  3P2H A;  4HNY B;  5CNP A;  3OWC A;  3A9L A;  4FD5 A;  2CY2 A;  3UY5 A;  1M4G A;  1BAV A;  4QBJ A;  2YND A;  3VAR A;  3JVN A;  1Q2Y A;  2V8D A;  4FD6 A;  4P10 A;  3S6G A;  4MCQ A;  3CXP A;  4UA3 A;  3P2F A;  3TTH A;  2I00 A;  1YQE A;  3KHX A;  4XPK A;  4C7I A;  2VQY A;  2PR8 A;  3VWE A;  3B3S A;  1CJW A;  5G1Z A;  1FY7 A;  2JBJ A;  2HUZ A;  3VWD A;  1Q2C A;  2ANP A;  2Z3L A;  2ZW5 A;  2GU2 A;  2PJ7 A;  4P4J A;  2AFU A;  2B4D B;  3NH5 A;  4R76 A;  5AG6 A;  4NGR A;  5LRJ A;  3TFY A;  2OZU A;  4P4B A;  3W6S A;  4CAF A;  2P6F A;  4M6I A;  4OAD A;  3IU1 A;  5F47 A;  4CGP A;  5K8N A;  3C26 A;  4JXR A;  4BBH A;  2JEW A;  3B3C A;  4PXD A;  2PJ5 A;  4LUA A;  2WZN A;  4M3S A;  5AG5 A;  4E0A A;  4ZY1 A;  2YNC C;  4ZY2 A;  5DWM A;  4NGP A;  1YLO A;  4QB9 A;  3KAS A;  2EK8 A;  2VXK A;  3EFA A;  5HH1 A;  1QQ9 A;  1Z8L A;  1R43 A;  3HLP A;  4M6H A;  1HDU A;  1P0H A;  4Z65 A;  2ZEL A;  4R8F A;  2OU2 A;  3D66 A;  2PCU A;  4CYN A;  4HKF A;  1YW4 A;  1YME A;  2BL1 A;  3FNC A;  1WK4 A;  4PPZ A;  3VAT A;  4CRY B;  3FX6 A;  4KOU A;  5F09 A;  1VHE A;  1OBR A;  1QMU A;  1PYT B;  3IWG A;  3FMC A;  1Z4R A;  3FVL A;  1HEE A;  1JQG A;  2PJC A;  4KUA A;  2ARH A;  3HUV A;  3PB9 X;  2ZEH A;  4YWY A;  4ONW A;  4A33 A;  4F6A A;  8CPA A;  2B5G B;  1TXR A;  2OH1 A;  4R9M A;  4FBE A;  2DPS A;  5HVH A;  5LYL A;  2C1C A;  2ZED A;  4OIW A;  4A32 A;  2VZZ A;  4BD9 A;  3GUX A;  4AVA A;  4O23 A;  3LWU A;  4FWU A;  4UEE A;  3S6F A;  2R1I A;  4IF5 A;  3TE4 A;  1IYL A;  4B5P A;  4UCN A;  4C7H A;  3F8K A;  1I1D A;  1SQH A;  3I1U A;  3E0K A;  2CNT A;  4MRI A;  2DEA A;  4P4F A;  4JWP A;  2JBK A;  3TO7 A;  4ZBG A;  3RNZ A;  4YFJ A;  1Q7L A;  4IK2 A;  1R3N A;  2ZW6 A;  4CS0 B;  5JPH A;  3NE8 A;  1ON0 A;  2DPT A;  1PCA A;  4PSX A;  5JH9 A;  1FT7 A;  1GYT A;  1CG2 A;  1NE9 A;  2GE3 A;  2H5M A;  2OZG A;  1FNO A;  2BEI A;  2QML A;  2QYV A;  3H5Z A;  4P44 A;  4KS9 A;  1XE4 A;  4MMO A;  4GS4 A;  1Z8X A;  2IJZ A;  4OP4 A;  4AG7 A;  2PR1 A;  4JLY A;  4JD6 A;  5AG7 A;  3FEE A;  1IB1 E;  2PJB A;  3D7D A;  3B8G A;  3N5F A;  3TCV A;  1Z2L A;  2PJA A;  4NGN A;  4NJR A;  3FED A;  3V7Z A;  2JEV A;  3R96 A;  3BJ8 A;  2P0W A;  1VKC A;  3FBU A;  3RZA A;  4UFX A;  2R98 A;  2Q44 A;  3WC7 A;  1LCP A;  4R3L A;  2PC1 A;  1NSA A;  1Y7E A;  1ARM A;  2Z11 A;  4AB7 A;  1Z5R A;  3V8I A;  1VHO A;  1YR0 A;  2J8M A;  1XRY A;  3DSB A;  3GYA A;  4PXE A;  1ZLI A;  1UWY A;  3S6H A;  1MJB A;  2O53 A;  3NA6 A;  2B3U A;  3PB8 X;  3KQX A;  3PRT A;  4HNW B;  3GY9 A;  4A37 A;  3H8E A;  2ZOF A;  3KHZ A;  2NSM A;  5K8O A;  1Y0R A;  5I0C A;  2PJ4 A;  3JRU A;  3H8G A;  1DTD A;  3LMS A;  2I3C A;  4X8I A;  5A28 A;  2Z10 A;  2G3T A;  2HQY A;  2K5T A;  3DR6 A;  3FH4 A;  1Z9U A;  4ZY0 A;  1RO5 A;  4OKO A;  1N71 A;  3D4U A;  1PUA A;  2P6G A;  5G21 A;  4C2X A;  3CDX A;  3RO0 A;  4QC6 A;  1Y9K A;  3KR4 A;  3PEI A;  5F46 A;  5C88 A;  3EC4 A;  3S9M A;  4UEF A;  4NGQ A;  5LRG A;  3N7Z A;  3SI1 A;  1IU8 A;  2B3V A;  2JDD A;  4KOX A;  1I12 A;  3DLJ A;  2Q51 A;  5AGE A;  3SI2 A;  1I21 A;  1JWQ A;  2AFW A;  4AXV A;  3B35 A;  4RS2 A;  3FJU A;  2X7B A;  2FL4 A;  1ZG7 A;  2FT0 A;  2V8G A;  4ZX9 A;  2Z3P A;  3TO9 A;  5KTA A;  1IOF A;  4UIA A;  4U9Z A;  1HDQ A;  4KOR A;  2J8N A;  2CNS A;  1S7L A;  2G3A A;  2XEF A;  3PBE A;  2HB6 A;  3BJ7 A;  1J4J A;  1RXT A;  2DXQ A;  5A27 A;  4OC1 A;  3TC8 A;  2JLM A;  3R9G A;  2PJ6 A;  4HNX B;  4AVB A;  2Z3M A;  5JQ4 A;  2ZXV A;  3NFZ A;  1B6B A;  3IIB A;  4A2Z A;  3CZX A;  1DE4 C;  1XMB A;  2FE7 A;  6CPA A;  4F0X A;  5I4M A;  1IGB A;  4OC5 A;  1LFW A;  3IFE A;  1LRZ A;  1YGH A;  3KGQ A;  1LOK A;  4A30 A;  5JM6 A;  2V8H A;  2G9D A;  3WC6 A;  4B6Z A;  4DNC A;  4KOT A;  5G20 A;  2DF5 A;  2Q4V A;  2AJ6 A;  3QAH A;  2Q0Y A;  1X10 A;  1NMT A;  4MY0 A;  2AFS A;  2PE3 A;  2AFX A;  2ZEN A;  4MCS A;  4BIN A;  3R9E A;  2YNE A;  4PSW A;  4L89 A;  2XEG A;  2RFH A;  2EVN A;  4UWJ A;  4E2A A;  3ISZ A;  1Z8T A;  3DDD A;  2PIZ A;  1YVK A;  1LAN A;  4II9 A;  3PP9 A;  3EO4 A;  2REE A;  5HVF A;  4U5Y A;  4GM5 A;  5KTC A;  4E8O A;  4CAW A;  1KUX A;  1UFH A;  1S7K A;  2J8R A;  2VEZ A;  3PBB A;  4UWI A;  5EMI A;  3SI0 A;  1XOV A;  3PGP A;  4KLW A;  3K2K A;  1MJ9 A;  3PZJ A;  2WYR A;  3FF3 A;  3RBU A;  3SHP A;  3ZZI A;  4PXB A;  3QNV A;  1CP7 A;  1S5K A;  4NGS A;  3S9N A;  4KVO E;  1ZO0 A;  1YK3 A;  1ELL P;  4H89 A;  2WUU A;  4BMH A;  2ZOG A;  4MBU A;  1LAP A;  2ZEM A;  4ZYQ A;  2HV2 A;  3IWW A;  2GRE A;  4WJB A;  3FXT A;  4R3K A;  2C6G A;  3R95 A;  4LQG A;  4JXQ A;  4CPA A;  3CPX A;  1BOB A;  2QIR A;  2A4N A;  3SJF A;  3NH8 A;  2JDC A;  4GXH A;  3IC1 A;  2VZY A;  3EXN A;  3GLJ A;  3QB8 A;  1WWZ A;  5LYD A;  4EME A;  4LQ6 A;  4A95 A;  1VIX A;  1IYK A;  3WR7 A;  2QVP A;  3MRU A;  3D8P A;  4LX9 A;  4NGT A;  2PJ2 A;  3IJ3 A;  1V0C A;  1EE3 P;  2ZW7 A;  3BLN A;  4MY3 A;  5GCN A;  2QEC A;  4OLL A;  3B3W A;  3PFE A;  2F8H A;  3FB3 A;  3SXN A;  4CYP A;  2FIW A;  4YU9 A;  3SJX A;  4K30 A;  2BCO A;  1B87 A;  5JGF A;  3FIX A;  4TNU A;  3B3T A;  3EY5 A;  4W9Y A;  1ARL A;  1ZLH A;  4KSF A;  2Q43 A;  4ORF A;  1IY7 A;  4U9Y A;  3FEC A;  3WC5 A;  3T9Y A;  2YGW A;  4A94 A;  5KTD A;  1IID A;  2BUE A;  4EFD A;  2IQ6 A;  2ATR A;  4F9V A;  3GIU A;  1CPS A;  4MXU A;  5F48 A;  2PJ8 A;  1L0C A;  1XJO A;  1KZF A;  2RB7 A;  4MFK A;  4JZ0 A;  1ZG9 A;  4KOW A;  4MCR A;  4X2T A;  1U6M A;  1TKJ A;  2Z3O A;  3IU2 A;  1QSN A;  4KVX A;  4R6T A;  4MI4 A;  1BPM A;  2C6P A;  4F0Y A;  4G1P A;  5IV0 A;  5ISV A;  3FYN A;  4B12 A;  2ZEG A;  1QSM A; 
#chains in the Genus database with same CATH homology
 2I79 A;  1Z4E A;  4C68 A;  1YX0 A;  4KOY A;  2Z3K A;  2PDO A;  1QST A;  2PSW A;  5HMN A;  4FD4 A;  1PU9 A;  1S60 A;  5IX3 A;  4CGM A;  4B11 A;  4YGO A;  3I3G A;  2GIV A;  4KZT A;  3DNS A;  2B5G A;  2FCK A;  3IWE A;  1S3Z A;  4CAV A;  4MHD A;  3JTK A;  4MJ8 A;  1M4I A;  4KSA A;  1IIC A;  4XPL A;  3I9S A;  2D4P A;  3D3S A;  4Y49 C;  4B14 A;  1MK4 A;  2G0B A;  4QUS A;  4CGO A;  2BSW A;  3RYO A;  3LOD A;  3ZJ0 A;  4AG9 A;  5C82 A;  4B10 A;  4B5P B;  4CGL A;  1S7N A;  2ZW4 A;  4PK2 A;  3G3S A;  1M44 A;  3K9U A;  2PQ8 A;  1K4J A;  4EVY A;  5FVJ A;  3F5B A;  2Q4Y A;  3H4Q A;  4KLV A;  5EC4 A;  3R9F A;  4YRH A;  4KVM E;  2KCW A;  4L8A A;  1XF8 A;  2P6E A;  4B13 A;  4H6U A;  2WPW A;  1KUV A;  3IGR A;  2WPX A;  2YNC A;  5H84 A;  4XNH C;  1CM0 A;  4NEX A;  2Q7B A;  5DWN A;  2VI7 A;  4Q38 A;  5IB0 A;  4M85 A;  4NF1 A;  5G22 A;  1XIX A;  4MFP A;  4ONU A;  1KUY A;  2B4B A;  4I49 A;  1S7F A;  4R57 A;  2PRB A;  4MFQ A;  2FSR A;  3TOA A;  1R57 A;  1YVO A;  3TO6 A;  5BWA B;  5EBV A;  1MJA A;  4CYQ A;  1NSL A;  3D2M A;  3W6X A;  4CAE A;  1Y9W A;  4CAX A;  1XEB A;  4Y49 B;  2RC4 A;  2OZH A;  4XPD C;  2Q04 A;  4JJX A;  2C27 A;  3JUW A;  4UBR A;  1YRE A;  2Z0Z A;  1QSO A;  2VBQ A;  4MFL A;  4C2Y A;  1P4N A;  1TIQ A;  2ZPA A;  2R7H A;  4UCM A;  4UFV A;  4UFW A;  4CRZ B;  3FRM A;  4KOS A;  4ZGY B;  1Q2D A;  2Y0M A;  3GKR A;  2Z3N A;  4H6Z A;  2B4D A;  4CGN A;  3TT2 A;  4NSQ A;  2OB0 A;  3CXS A;  1M4D A;  4RI1 A;  4PK3 A;  3DR8 A;  2GAN A;  3D2P A;  4FD7 A;  3MGD A;  2EUI A;  3CXQ A;  2AE6 A;  4MFJ A;  4A31 A;  5F49 A;  4UCP A;  2CXA A;  2FXF A;  2F5I A;  4J3G A;  3S6K A;  4XNH B;  5J8F A;  4Q36 A;  4X5K A;  5J8C A;  1YLE A;  2B58 A;  4R87 A;  3KKW A;  1VHS A;  1OZP A;  2WSA A;  2REF A;  2FIA A;  1GHE A;  5AG4 A;  4QVT A;  4MFZ A;  4OAE A;  2D4O A;  3R1K A;  3NE7 A;  4PV6 A;  4NCZ A;  1QSR A;  2FS5 A;  1M1D A;  2O28 A;  5H86 A;  2IL4 A;  3G8W A;  4CYO A;  2NMT A;  5E96 A;  4XPD B;  3LD2 A;  4IUS A;  4KOV A;  2R8V A;  3SXO A;  3T90 A;  4KUB A;  3F0A A;  4NXY A;  1Y7R A;  4B5O A;  4C2Z A;  3TOB A;  3W91 A;  1XMT A;  2CNM A;  1BO4 A;  3P2H A;  4HNY B;  5CNP A;  3OWC A;  3A9L A;  4FD5 A;  2CY2 A;  3UY5 A;  1M4G A;  4QBJ A;  2YND A;  3JVN A;  1Q2Y A;  4FD6 A;  3S6G A;  3CXP A;  4UA3 A;  3P2F A;  3TTH A;  2I00 A;  4XPK A;  2VQY A;  2PR8 A;  3VWE A;  1CJW A;  5G1Z A;  1FY7 A;  4C7I A;  2HUZ A;  3VWD A;  1Q2C A;  2Z3L A;  2ZW5 A;  5AG6 A;  2B4D B;  3TFY A;  2OZU A;  3W6S A;  4CAF A;  2P6F A;  4OAD A;  3IU1 A;  5F47 A;  4CGP A;  3C26 A;  4JXR A;  4BBH A;  4LUA A;  5AG5 A;  4M3S A;  4E0A A;  2YNC C;  5DWM A;  4QB9 A;  2VXK A;  3EFA A;  5HH1 A;  1P0H A;  2OU2 A;  4CYN A;  4HKF A;  2BL1 A;  3FNC A;  4CRY B;  1WK4 A;  4KOU A;  3IWG A;  1Z4R A;  4KUA A;  4A33 A;  2ARH A;  4F6A A;  2B5G B;  2OH1 A;  4R9M A;  2DPS A;  4A32 A;  2VZZ A;  4AVA A;  3S6F A;  2R1I A;  4IF5 A;  3TE4 A;  1IYL A;  4B5P A;  4UCN A;  4C7H A;  3F8K A;  1I1D A;  1SQH A;  3E0K A;  2CNT A;  4JWP A;  3TO7 A;  4ZBG A;  4YFJ A;  2ZW6 A;  4CS0 B;  5JPH A;  1ON0 A;  2DPT A;  4PSX A;  1NE9 A;  2GE3 A;  2H5M A;  2OZG A;  2QML A;  2BEI A;  3H5Z A;  4AVC A;  4KS9 A;  1XE4 A;  4GS4 A;  4AG7 A;  2PR1 A;  4JLY A;  4JD6 A;  5AG7 A;  1IB1 E;  3B8G A;  3TCV A;  2JEV A;  3R96 A;  3BJ8 A;  2P0W A;  1VKC A;  3FBU A;  4UFX A;  2R98 A;  2Q44 A;  4R3L A;  2PC1 A;  4AB7 A;  2Z11 A;  3V8I A;  2J8M A;  1YR0 A;  3DSB A;  3GYA A;  3S6H A;  1MJB A;  2B3U A;  4HNW B;  3GY9 A;  5I0C A;  5A28 A;  2Z10 A;  2G3T A;  2HQY A;  2K5T A;  3DR6 A;  1Z9U A;  1RO5 A;  1N71 A;  5G21 A;  1PUA A;  2P6G A;  4C2X A;  4QC6 A;  1Y9K A;  5F46 A;  5C88 A;  3EC4 A;  3N7Z A;  2B3V A;  4KOX A;  2JDD A;  1I12 A;  5AGE A;  1I21 A;  4RS2 A;  2X7B A;  2FL4 A;  2FT0 A;  2Z3P A;  3TO9 A;  5KTA A;  4U9Z A;  4KOR A;  2J8N A;  2CNS A;  1S7L A;  2G3A A;  3BJ7 A;  1J4J A;  1RXT A;  2DXQ A;  5A27 A;  2JLM A;  3R9G A;  4AVB A;  4HNX B;  5JQ4 A;  2Z3M A;  2ZXV A;  1B6B A;  4A2Z A;  2FE7 A;  4F0X A;  1LRZ A;  1YGH A;  4A30 A;  4DNC A;  4KOT A;  5G20 A;  2Q4V A;  2AJ6 A;  3QAH A;  2Q0Y A;  1NMT A;  4MY0 A;  3R9E A;  2YNE A;  4PSW A;  4L89 A;  2EVN A;  4UWJ A;  4E2A A;  3DDD A;  1YVK A;  4II9 A;  3PP9 A;  3EO4 A;  2REE A;  4U5Y A;  5KTC A;  4E8O A;  4CAW A;  1KUX A;  2VEZ A;  1UFH A;  1S7K A;  2J8R A;  4UWI A;  3PGP A;  4KLW A;  3SHP A;  1MJ9 A;  3PZJ A;  3ZZI A;  1S5K A;  4KVO E;  1ZO0 A;  1YK3 A;  4H89 A;  2WUU A;  4BMH A;  4MBU A;  2HV2 A;  3FXT A;  4R3K A;  3R95 A;  4JXQ A;  1BOB A;  2QIR A;  2A4N A;  2JDC A;  2VZY A;  3EXN A;  3QB8 A;  1WWZ A;  4A95 A;  1IYK A;  3WR7 A;  3D8P A;  4LX9 A;  1V0C A;  2ZW7 A;  3BLN A;  4MY3 A;  5GCN A;  2QEC A;  4OLL A;  3FB3 A;  3SXN A;  4CYP A;  2FIW A;  4K30 A;  1B87 A;  3FIX A;  3EY5 A;  4KSF A;  4ORF A;  4U9Y A;  3T9Y A;  2YGW A;  5KTD A;  1IID A;  2BUE A;  2ATR A;  5F48 A;  1L0C A;  1KZF A;  4MFK A;  4KOW A;  1U6M A;  2Z3O A;  3IU2 A;  4KVX A;  1QSN A;  4MI4 A;  4F0Y A;  5IV0 A;  5ISV A;  3FYN A;  4B12 A;  1QSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...