4CAEA

Plasmodium vivax n-myristoyltransferase in complex with a benzothiophene inhibitor (compound 20b)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of High Affinity Inhibitors of Plasmodium Falciparum and Plasmodium Vivax N-Myristoyltransferases Directed by Ligand Efficiency Dependent Lipophilicity (Lelp).
pubmed doi rcsb
source organism Plasmodium vivax
total genus 119
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4caeA00
4A32A 5G21A 2YNCC 3JTKA 4B12A 4C7HA 5AG4A 5AGEA 3IU2A 4A33A 4A31A 4A2ZA 4B14A 4C2YA 4C2XA 4UCNA 5A27A 4UFVA 4CGOA 4CYNA 4UCMA 5AG6A 4CYOA 3IWEA 3IU1A 5AG5A 4A95A 4CAFA 4BBHA 4CAEA 4CGLA 4CYPA 4CYQA 4B13A 4UCPA 4CGNA 4CGPA 4C68A 4B11A 4UFWA 5AG7A 2WUUA 2YNDA 2WSAA 4B10A 2YNEA 4C7IA 5A28A 5G20A 4CGMA 5G1ZA 4C2ZA 5G22A 4UFXA 3H5ZA 2YNCA 4A30A
chains in the Genus database with same CATH superfamily
4HPSA 4B12A 4NCZA 2EO8A 5FVJA 4R57A 5HXDA 2BOAA 5LRJA 1BLLE 5HVFA 4E0AA 1YX0A 2F5IA 3V7ZA 4F0XA 4MHZA 2ANPA 4UFVA 3RNZA 2ZW7A 1PYTB 5LYIA 5DS0A 1S7LA 3PB7X 2REEA 1Z8XA 1Y9WA 1YMEA 2B58A 2V8GA 3D4UA 2HQYA 2Z3LA 4B13A 3IEHA 2PSWA 4QC6A 1TF8A 1QQ9A 1NSLA 4AB7A 1ZO0A 4PQAA 4MFJA 2QECA 5F09A 1S3ZA 4M6HA 2GANA 3SHPA 4PPZA 4E8OA 1BO4A 4I49A 4YRHA 1Y7EA 3CDXA 3FIXA 1Y0YA 1YVOA 2GLFA 3JRUA 1PU9A 3JTKA 3PB4X 4K3NA 3R96A 4DJLA 4FWUA 1XJOA 4P4IA 4QUSA 3TO6A 4JYWA 3TE4A 1M4DA 1YQEA 5LRGA 2PC1A 1QMUA 5JPHA 3BJ8A 3MN8A 3CXPA 3B3VA 3D67A 4WJBA 4AVBA 1X10A 4OC0A 3R9EA 4KSFA 1PCAA 3KI9A 1OZPA 5F49A 1YK3A 1Y0RA 1IYKA 1GHEA 3CZXA 3NFZA 2Q04A 2BO9A 2PJAA 1HDQA 4MHPA 4FD5A 3S6FA 2VEZA 3FECA 2Z10A 3B7IA 4NGNA 1Y9KA 2NMTA 4A39A 1YW6A 2ODFA 3FBUA 4TWEA 1XBUA 2A4NA 2G3TA 4C7HA 4JWPA 2AFMA 4C2XA 2FIAA 3SI1A 2AFOA 2Q0YA 2Z11A 4UWJA 4E2AA 4MY0A 2DF5A 4OC3A 2RB7A 3K9TA 5JQ4A 1Z8WA 1CP7A 1AYEA 5HVGA 4F0YA 5AG5A 1Z4EA 4CYPA 2VQYA 1BAVA 2O28A 4K30A 2ABZA 2H5MA 5AG7A 3TO9A 4R7MA 4C7IA 1VHSA 2Y0MA 4XPLA 3S9NA 1CP6A 2HUZA 4OIWA 4CRYB 4HNYB 2NSMA 5G1ZA 4EVYA 2CXAA 1ARMA 2AFUA 2JEVA 1YGHA 4KVOE 1S7FA 2VL1A 3SXNA 4HNWB 3VWDA 2ZELA 4R3LA 4B6ZA 1BPNA 3DR8A 5G21A 1Z8TA 1FT7A 3FH4A 2WPWA 4M3SA 3KR5A 4MY3A 2PJ9A 4JXRA 4JXQA 2R7HA 3HLPA 4KVME 3V38A 1MJAA 2VZYA 4AG7A 1M44A 2GLJA 2IQ6A 4DNCA 5J8FA 1J4JA 1UWYA 4OKOA 2ZEEA 4F9VA 1ARLA 2CNMA 1HEEA 1LOKA 3LD2A 4MFLA 5K8PA 3RZAA 3CPAA 4F9UA 4KSAA 3N5FA 1RXTA 2EK8A 3BLNA 3SJEA 3MGDA 4P4JA 3DGVA 4GM5A 4PK3A 5HH1A 3BI0A 5EC4A 1AMPA 1R3NA 2GE3A 4O23A 4UBRA 2CNSA 1XEBA 2BSWA 1CPXA 1LFWA 3JUWA 4MI4A 4UA3A 1FY7A 3QAHA 2QIRA 3H8EA 3WC7A 3PP9A 4MXUA 4CYNA 3ZJ0A 2C27A 1F2PA 2PCUA 2WYRA 2V8VA 2ZEGA 3KQXA 1FNOA 4J3GA 2V77A 3PRTA 1M1DA 5ELYA 5THWA 4A95A 2POKA 4UCPA 3HUVA 2PRQA 1LANA 1B6BA 1XF8A 4NF1A 4CRZB 4AXVA 4FD7A 3NE7A 2QVPA 2AFZA 3BJ7A 3FEEA 4MHYA 4NEXA 5CBMA 1TKFA 5BWAB 3T8WA 2JEWA 4U9ZA 3H8GA 4KORA 2Z3MA 2VZZA 3D2MA 3UY5A 1I21A 2X7BA 4ZX9A 2DPTA 5EBVA 3D8PA 3QAYA 3TO7A 3SJGA 3KL9A 3LODA 4L89A 2D4OA 3B3CA 4RS2A 3TOBA 3PGPA 3B3TA 3I1UA 3KQZA 4FD4A 4R6TA 4KOSA 3S9MA 2B3UA 4CYOA 4NXYA 4MRIA 3SXOA 2O4HA 1RTQA 1UFHA 3WABA 4OIDA 1GYTA 4CYQA 3ISZA 3FXTA 4X2TA 4XPDC 4DUKA 3B2YA 1VHEA 2FL4A 2FT0A 2F8HA 2YNEA 2V8DA 4OMEA 5JH9A 3S6KA 3DNSA 3FEDA 5A28A 2CNTA 1V0CA 4RUHA 2OZGA 2DXQA 4JJXA 2PDOA 5F47A 1SQHA 2G3AA 4P4FA 4KZTA 4TNUA 2PJCA 4PXDA 3DDDA 4IUSA 4A33A 2FS5A 4A31A 4IK2A 5DWMA 4PSWA 5H84A 4A37A 5DWNA 1PUAA 1M4IA 5IB9A 1IU8A 4L8AA 4BD9A 4PXEA 4JLYA 1MJ9A 5GCNA 4R3KA 4R76A 4X8IA 3T9YA 5KTAA 3GUXA 4P44A 4CGPA 4HNXB 2XEJA 2GFQA 3PB6X 3PFOA 1H8LA 4YGOA 1IYLA 2JDDA 5LYDA 5HMNA 3KGQA 1R43A 3B8GA 3EO4A 3FYNA 3NH8A 1ELLP 1VHOA 3W6XA 4FBEA 2PJ7A 1Z5RA 3SJXA 4X3RA 2CTCA 3H5ZA 5H86A 4NFRA 1IICA 4UEFA 2Z3OA 4PSXA 4UIAA 5E96A 4KOUA 5AGEA 2FSRA 4UIBA 1ZLHA 3QNVA 1P0HA 4FUUA 4OC4A 4OLLA 5D8NA 2B4DA 2DEAA 3R1KA 4X5KA 5CPAA 1F2OA 2PJBA 4M85A 5EMIA 3GIUA 1ZG9A 2I00A 2Z3PA 5I0CA 2NYQA 4CS0B 3LWUA 2XEIA 4H6ZA 2G0BA 3D3SA 1YVKA 4BBHA 4ZGYB 3IO1A 2C6PA 4H2KA 3B3WA 4XPDB 3I3GA 3TOAA 4B11A 3PBBA 2C1CA 3GB0A 2PIYA 2R98A 2Q43A 5J8CA 3FMCA 2R1IA 2AFXA 2OH1A 1LAPA 2CTBA 2ZPAA 3T90A 3TX8A 4UFXA 1TKHA 1QSOA 2AJ6A 4Y49B 3GYAA 1YR0A 2K5TA 1ZG7A 3R9FA 3H4QA 1Z2LA 2F7VA 4GXHA 4BINA 2O53A 2PIZA 3VH9A 5JM6A 4LQGA 3PB8X 2GREA 2PR8A 4ZY1A 5KTDA 2WPXA 4KUAA 1MJBA 4P4EA 2ZXVA 4LX9A 4NJRA 4P6YA 5K8MA 3KZWA 1KUVA 2HB6A 1KWMA 4A38A 2PJ6A 1Y7RA 2P6EA 1F57A 3IWGA 2WSAA 4PXBA 2J8NA 4AVCA 3W91A 3D7DA 3ISXA 3WT4A 2CY2A 4UWIA 2J8MA 4MJ8A 2Q51A 3DR6A 2ZW4A 3I9SA 3FJUA 2Z0ZA 3VATA 7CPAA 2FCKA 2REFA 2YNCA 4KLVA 5LRKA 2C6CA 1ZLIA 4UEZA 1YW4A 3D7GA 5LYFA 5AG4A 1XMBA 3FRMA 4A2ZA 3IIBA 4C2YA 6CPAA 2J9AA 2OB0A 3F5BA 4IF5A 2PJ1A 2B4DB 5AG6A 1BOBA 5I4MA 2OR4A 2RC4A 2CIJA 4MBUA 3NA6A 4ZBGA 3G3SA 3FVLA 3IU1A 3PZJA 3EXNA 4CAWA 3KHZA 4UF4A 2ZEPA 4MFZA 3SI0A 4F8ZA 4YFJA 1S7NA 5IV0A 3S9LA 3TC8A 2YNDA 4ONUA 4B10A 1M4LA 3A9LA 2P0WA 4EWTA 2J8RA 1CJWA 2ZOFA 1QSMA 1P4NA 3TCVA 2AFWA 4H89A 3D68A 2PVWA 4LQ6A 2AE6A 4YU9A 3S6HA 3P2FA 1MK4A 1S7KA 4OAEA 2EK9A 5C82A 1IB1E 3E0KA 3N7ZA 3GY9A 1Q2DA 1YLOA 4UCMA 1I12A 2PJ3A 2B5GA 2QJ8A 2Z3KA 3BI1A 4P4DA 4R8FA 4NSQA 1U6MA 2PRBA 4GS4A 3OWCA 1ZG8A 2OU2A 4CAEA 3ZZIA 4CGLA 4U5YA 1IIDA 2JBJA 4R9MA 4RI1A 2GU2A 4KOYA 3RBUA 1R57A 3C26A 1XOVA 1XIXA 2QYVA 4NGSA 2JLMA 2PQ8A 4U9YA 1XRYA 1EE3P 2PJ0A 4XPKA 4Z65A 4Y49C 4KS9A 4HKFA 3RYOA 3VWEA 4A32A 2ZEMA 1IOFA 4P10A 3D2PA 4B5PA 1TKJA 3TT2A 4B14A 4NJQA 3V8IA 3B3SA 1Q2YA 2Q7BA 2KCWA 3P2HA 3TTHA 5HVHA 4KLWA 1Z9UA 2XEFA 4QB9A 3IWEA 2AFSA 4Q7AA 3KASA 2ZEOA 4ZY2A 1Z8LA 2IJZA 2Q4VA 3FNCA 2PJ2A 2ZEFA 3DSBA 4CGNA 1NMTA 2PJ8A 2VXKA 3IWWA 3L2NA 3D66A 4F6AA 3CPXA 4MFPA 3MRUA 4G1PA 3SI2A 1M4GA 5G20A 2XEGA 1B87A 4IHMA 2PVVA 3D7FA 4R87A 1QSRA 3CXSA 3EY5A 4XNHB 5LYLA 2R8VA 4MHNA 4ORFA 2OOTA 5IB0A 1XE4A 1DE4C 3F0AA 3WC6A 4A30A 1BPMA 4AVAA 4DYOA 2WZNA 3PBEA 2HC9A 1CPSA 5K8OA 4H6UA 3GKRA 4NGMA 1TIQA 3IFEA 4NGRA 3CT9A 5KTCA 2ZENA 3D7HA 3FB3A 4KOVA 2EWBA 4M6IA 4EFDA 2ZW6A 3IGRA 3KR4A 1IY7A 4MFQA 4OC2A 3F8KA 4KOTA 2B5GB 2Q4YA 1XFOA 2G9DA 3KKWA 4OC5A 4CAXA 1QSTA 1DTDA 2FVGA 1YREA 2DPSA 2FXFA 1HDUA 4OP4A 2C6GA 2ZEHA 3JVNA 3RAMA 4PV6A 3LMSA 2HV2A 4W9YA 2PJ5A 1TXRA 1TF9A 1YSJA 3R95A 3WR7A 1YLEA 2BCOA 2ATRA 1S60A 2Q44A 4MCQA 1LAMA 1OBRA 2CF4A 2YGWA 2P6GA 3EFAA 3NE8A 1L0CA 2RFHA 1LRZA 4B5PB 4EMEA 1K4JA 3RO0A 4PK2A 4IAVA 2GIVA 3H8FA 3KHXA 3R9GA 2BUEA 3NH5A 1Q7LA 4MFKA 5JGFA 1JWQA 4YWYA 2Q4ZA 4ZX8A 3EC4A 2IMOA 3FX6A 2WUUA 3K9UA 4MMOA 4Q38A 4A94A 2JDCA 2FIWA 2OZHA 1CX8A 2I3CA 4QVTA 3NH4A 4QBJA 1NE9A 2VBQA 5G22A 1N71A 2EBJA 3FF3A 2QMLA 4KVXA 4NGPA 4KSIA 3IJ3A 2EVNA 1S5KA 2OZUA 3QB8A 3S6GA 2YNCC 1WK4A 1AUGA 2D4PA 1RO5A 1VIXA 4KUBA 3WC5A 4B5OA 4ZI6A 1Z4RA 4UCNA 2ZW5A 4MHDA 1XMTA 3SJFA 3VARA 8CPAA 3TFYA 4WWVA 1KZFA 5K8NA 1CBXA 2V8HA 2JBKA 4JZ0A 2BL1A 4MCSA 4FD6A 4KOXA 4P4BA 2FE7A 4AG9A 1CG2A 3PFEA 1ELMP 1ON0A 2EUIA 1QSNA 4II9A 2VI7A 5CNPA 4OC1A 1X12A 2B4BA 2ZEDA 4PXCA 4C68A 4UFWA 4NGQA 4FAIA 3BXMA 2PE3A 4Q36A 3CXQA 3DLJA 4KOWA 3W6SA 1VGYA 1WWZA 1NSAA 3LACA 4P45A 4XNHC 4C2ZA 3IC1A 4UEEA 5F46A 4JD6A 2BEIA 4MCPA 4RN7A 4CAVA 4LUAA 3GLJA 5C88A 3IU2A 1IOIA 5A27A 1Q2CA 4BMHA 4CGOA 3BHXA 3B35A 2I79A 2IL4A 1I1DA 3PB9X 2B3VA 3PEIA 5IX3A 4ZYQA 1VKCA 4CAFA 5F48A 3K2KA 5D29A 1JQGA 1KUXA 4NGTA 5J1QA 4MCRA 1KUYA 1IGBA 2P6FA 4CPAA 4M6GA 1CM0A 2Z3NA 2PR1A 2ZOGA 4OADA 2Q7SA 1A2ZA 2ARHA 4CGMA 5ISVA 3G8WA 4ONWA 1LCPA 2PJ4A 4ZY0A
chains in the Genus database with same CATH topology
4B12A 4NCZA 5FVJA 4R57A 4E0AA 1YX0A 2F5IA 4F0XA 4UFVA 2ZW7A 1S7LA 2REEA 1Y9WA 2B58A 2HQYA 2Z3LA 4B13A 4QC6A 2PSWA 1NSLA 4AB7A 1ZO0A 4MFJA 2QECA 1S3ZA 2GANA 3SHPA 4E8OA 1BO4A 4I49A 4YRHA 4JWPA 3FIXA 3JTKA 1YVOA 3R96A 5KTCA 1PU9A 3TO6A 4QUSA 3TE4A 1M4DA 2PC1A 5JPHA 3BJ8A 3CXPA 4AVBA 3R9EA 4KSFA 1OZPA 5F49A 1YK3A 1IYKA 1GHEA 2Q04A 4FD5A 3S6FA 2VEZA 2Z10A 1Y9KA 2NMTA 3FBUA 2G3TA 2A4NA 4C7HA 4C2XA 2FIAA 2Q0YA 2Z11A 4UWJA 4E2AA 4MY0A 5JQ4A 4F0YA 5AG5A 1Z4EA 4CYPA 2VQYA 2O28A 4K30A 2H5MA 5AG7A 3TO9A 4C7IA 1VHSA 2Y0MA 4XPLA 2HUZA 4CRYB 4HNYB 5G1ZA 4EVYA 2CXAA 2JEVA 4KVOE 1YGHA 3VWDA 1S7FA 3SXNA 4HNWB 4R3LA 3DR8A 5G21A 2WPWA 4M3SA 4MY3A 4JXRA 4JXQA 2R7HA 4KVME 1MJAA 2VZYA 4AG7A 1M44A 5J8FA 1J4JA 2CNMA 3LD2A 4MFLA 4KSAA 1RXTA 3BLNA 3MGDA 4PK3A 5HH1A 5EC4A 2GE3A 4UBRA 2CNSA 1XEBA 2BSWA 3JUWA 4MI4A 4UA3A 1FY7A 3QAHA 2QIRA 3PP9A 4CYNA 3ZJ0A 2C27A 4J3GA 1M1DA 4A95A 4UCPA 1B6BA 1XF8A 4NF1A 4CRZB 4FD7A 3NE7A 3BJ7A 4NEXA 5BWAB 4U9ZA 4KORA 2Z3MA 2VZZA 3D2MA 3UY5A 1I21A 2X7BA 2DPTA 5EBVA 3D8PA 3TO7A 3LODA 4L89A 4RS2A 2D4OA 3TOBA 3PGPA 4FD4A 4KOSA 2B3UA 4CYOA 4NXYA 3SXOA 1UFHA 4CYQA 4XPDC 3FXTA 2FL4A 2FT0A 2YNEA 3S6KA 3DNSA 5A28A 2CNTA 1V0CA 2OZGA 2DXQA 4JJXA 2PDOA 5F47A 1SQHA 2G3AA 4KZTA 3DDDA 4IUSA 4A33A 2FS5A 4A31A 5DWMA 4PSWA 5H84A 5DWNA 1PUAA 1M4IA 4L8AA 4JLYA 1MJ9A 5GCNA 4R3KA 3T9YA 5KTAA 4CGPA 4HNXB 4YGOA 1IYLA 2JDDA 5HMNA 3B8GA 3EO4A 3FYNA 3W6XA 3H5ZA 5H86A 1IICA 2Z3OA 4PSXA 5E96A 4KOUA 5AGEA 2FSRA 1P0HA 4OLLA 2B4DA 3R1KA 4X5KA 4M85A 2I00A 2Z3PA 5I0CA 4CS0B 4H6ZA 2G0BA 3D3SA 1YVKA 4BBHA 4ZGYB 4XPDB 3I3GA 3TOAA 4B11A 2R98A 5J8CA 2R1IA 2OH1A 2ZPAA 3T90A 4UFXA 1QSOA 4Y49B 2AJ6A 3GYAA 1YR0A 2K5TA 3R9FA 3H4QA 2PR8A 5KTDA 2WPXA 4KUAA 1MJBA 2ZXVA 4LX9A 1KUVA 3IWGA 1Y7RA 2P6EA 2WSAA 2J8NA 4AVCA 3W91A 2CY2A 4UWIA 2J8MA 4MJ8A 3DR6A 2ZW4A 3I9SA 2Z0ZA 2FCKA 2REFA 2YNCA 4KLVA 5AG4A 3FRMA 4A2ZA 4C2YA 2OB0A 3F5BA 4IF5A 2B4DB 5AG6A 1BOBA 2RC4A 4MBUA 4ZBGA 3G3SA 3IU1A 4CAWA 3PZJA 3EXNA 4MFZA 4YFJA 1S7NA 5IV0A 2YNDA 4ONUA 4B10A 3A9LA 2P0WA 2J8RA 1CJWA 1QSMA 1P4NA 3TCVA 4H89A 2AE6A 3S6HA 3P2FA 1MK4A 1S7KA 4OAEA 5C82A 1IB1E 3E0KA 3N7ZA 3GY9A 1Q2DA 4UCMA 1I12A 2B5GA 2Z3KA 4NSQA 1U6MA 2PRBA 4GS4A 3OWCA 2OU2A 4CAEA 3ZZIA 4CGLA 4U5YA 1IIDA 4R9MA 4RI1A 4KOYA 1R57A 3C26A 1XIXA 2JLMA 2PQ8A 4U9YA 4XPKA 4Y49C 4KS9A 4HKFA 3RYOA 3VWEA 4A32A 3D2PA 4B5PA 4B14A 3TT2A 3V8IA 1Q2YA 2Q7BA 2KCWA 3P2HA 3TTHA 4KLWA 1Z9UA 4QB9A 3IWEA 2Q4VA 3FNCA 3DSBA 4CGNA 1NMTA 2VXKA 4F6AA 4MFPA 1M4GA 5G20A 4DNCA 1B87A 4R87A 1QSRA 3CXSA 3EY5A 4XNHB 2R8VA 4ORFA 5IB0A 1XE4A 3F0AA 4AVAA 4A30A 4H6UA 3GKRA 1TIQA 3FB3A 4KOVA 2ZW6A 3IGRA 4MFQA 3F8KA 4KOTA 2B5GB 2Q4YA 3KKWA 4CAXA 1QSTA 1YREA 2DPSA 2FXFA 3JVNA 4PV6A 2HV2A 3R95A 3WR7A 1YLEA 2ATRA 1S60A 2Q44A 2YGWA 2P6GA 3EFAA 1L0CA 1LRZA 4B5PB 1K4JA 4PK2A 2GIVA 3R9GA 2BUEA 4MFKA 3EC4A 2WUUA 3K9UA 4Q38A 2JDCA 2FIWA 2OZHA 4QVTA 4QBJA 1NE9A 2VBQA 5G22A 1N71A 2QMLA 4KVXA 2EVNA 1S5KA 2OZUA 3QB8A 3S6GA 2YNCC 1WK4A 2D4PA 1RO5A 4KUBA 4B5OA 1Z4RA 4UCNA 2ZW5A 4MHDA 1XMTA 3TFYA 1KZFA 2BL1A 4FD6A 4KOXA 4AG9A 2FE7A 1ON0A 2EUIA 1QSNA 4II9A 2VI7A 5CNPA 2B4BA 4C68A 4UFWA 4Q36A 3CXQA 4KOWA 3W6SA 4C2ZA 1WWZA 4XNHC 5F46A 4JD6A 2BEIA 4CAVA 4LUAA 5C88A 3IU2A 5A27A 1Q2CA 4BMHA 4CGOA 2I79A 2IL4A 1I1DA 2B3VA 5IX3A 1VKCA 4CAFA 5F48A 1KUXA 1KUYA 2P6FA 1CM0A 2Z3NA 2PR1A 4OADA 2ARHA 4CGMA 5ISVA 3G8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A32 A;  5G21 A;  2YNC C;  3JTK A;  4B12 A;  4C7H A;  5AG4 A;  5AGE A;  3IU2 A;  4A33 A;  4A31 A;  4A2Z A;  4B14 A;  4C2Y A;  4C2X A;  4UCN A;  5A27 A;  4UFV A;  4CGO A;  4CYN A;  4UCM A;  5AG6 A;  4CYO A;  3IWE A;  3IU1 A;  5AG5 A;  4A95 A;  4CAF A;  4BBH A;  4CAE A;  4CGL A;  4CYP A;  4CYQ A;  4B13 A;  4UCP A;  4CGN A;  4CGP A;  4C68 A;  4B11 A;  4UFW A;  5AG7 A;  2WUU A;  2YND A;  2WSA A;  4B10 A;  2YNE A;  4C7I A;  5A28 A;  5G20 A;  4CGM A;  5G1Z A;  4C2Z A;  5G22 A;  4UFX A;  3H5Z A;  2YNC A;  4A30 A; 
#chains in the Genus database with same CATH topology
 4HPS A;  4B12 A;  4NCZ A;  2EO8 A;  5FVJ A;  4R57 A;  5HXD A;  2BOA A;  5LRJ A;  1BLL E;  5HVF A;  4E0A A;  1YX0 A;  2F5I A;  3V7Z A;  4F0X A;  4MHZ A;  2ANP A;  4UFV A;  3RNZ A;  2ZW7 A;  1PYT B;  5LYI A;  5DS0 A;  1S7L A;  3PB7 X;  2REE A;  1Z8X A;  1Y9W A;  1YME A;  2B58 A;  2V8G A;  3D4U A;  2HQY A;  2Z3L A;  4B13 A;  3IEH A;  2PSW A;  4QC6 A;  1TF8 A;  1QQ9 A;  1NSL A;  4AB7 A;  1ZO0 A;  4PQA A;  4MFJ A;  2QEC A;  5F09 A;  1S3Z A;  4M6H A;  2GAN A;  3SHP A;  4PPZ A;  4E8O A;  1BO4 A;  4I49 A;  4YRH A;  1Y7E A;  3CDX A;  3FIX A;  1Y0Y A;  1YVO A;  2GLF A;  3JRU A;  1PU9 A;  3JTK A;  3PB4 X;  4K3N A;  3R96 A;  4DJL A;  4FWU A;  1XJO A;  4P4I A;  4QUS A;  3TO6 A;  4JYW A;  3TE4 A;  1M4D A;  1YQE A;  5LRG A;  2PC1 A;  1QMU A;  5JPH A;  3BJ8 A;  3MN8 A;  3CXP A;  3B3V A;  3D67 A;  4WJB A;  4AVB A;  1X10 A;  4OC0 A;  3R9E A;  4KSF A;  1PCA A;  3KI9 A;  1OZP A;  5F49 A;  1YK3 A;  1Y0R A;  1IYK A;  1GHE A;  3CZX A;  3NFZ A;  2Q04 A;  2BO9 A;  2PJA A;  1HDQ A;  4MHP A;  4FD5 A;  3S6F A;  2VEZ A;  3FEC A;  2Z10 A;  3B7I A;  4NGN A;  1Y9K A;  2NMT A;  4A39 A;  1YW6 A;  2ODF A;  3FBU A;  4TWE A;  1XBU A;  2A4N A;  2G3T A;  4C7H A;  4JWP A;  2AFM A;  4C2X A;  2FIA A;  3SI1 A;  2AFO A;  2Q0Y A;  2Z11 A;  4UWJ A;  4E2A A;  4MY0 A;  2DF5 A;  4OC3 A;  2RB7 A;  3K9T A;  5JQ4 A;  1Z8W A;  1CP7 A;  1AYE A;  5HVG A;  4F0Y A;  5AG5 A;  1Z4E A;  4CYP A;  2VQY A;  1BAV A;  2O28 A;  4K30 A;  2ABZ A;  2H5M A;  5AG7 A;  3TO9 A;  4R7M A;  4C7I A;  1VHS A;  2Y0M A;  4XPL A;  3S9N A;  1CP6 A;  2HUZ A;  4OIW A;  4CRY B;  4HNY B;  2NSM A;  5G1Z A;  4EVY A;  2CXA A;  1ARM A;  2AFU A;  2JEV A;  1YGH A;  4KVO E;  1S7F A;  2VL1 A;  3SXN A;  4HNW B;  3VWD A;  2ZEL A;  4R3L A;  4B6Z A;  1BPN A;  3DR8 A;  5G21 A;  1Z8T A;  1FT7 A;  3FH4 A;  2WPW A;  4M3S A;  3KR5 A;  4MY3 A;  2PJ9 A;  4JXR A;  4JXQ A;  2R7H A;  3HLP A;  4KVM E;  3V38 A;  1MJA A;  2VZY A;  4AG7 A;  1M44 A;  2GLJ A;  2IQ6 A;  4DNC A;  5J8F A;  1J4J A;  1UWY A;  4OKO A;  2ZEE A;  4F9V A;  1ARL A;  2CNM A;  1HEE A;  1LOK A;  3LD2 A;  4MFL A;  5K8P A;  3RZA A;  3CPA A;  4F9U A;  4KSA A;  3N5F A;  1RXT A;  2EK8 A;  3BLN A;  3SJE A;  3MGD A;  4P4J A;  3DGV A;  4GM5 A;  4PK3 A;  5HH1 A;  3BI0 A;  5EC4 A;  1AMP A;  1R3N A;  2GE3 A;  4O23 A;  4UBR A;  2CNS A;  1XEB A;  2BSW A;  1CPX A;  1LFW A;  3JUW A;  4MI4 A;  4UA3 A;  1FY7 A;  3QAH A;  2QIR A;  3H8E A;  3WC7 A;  3PP9 A;  4MXU A;  4CYN A;  3ZJ0 A;  2C27 A;  1F2P A;  2PCU A;  2WYR A;  2V8V A;  2ZEG A;  3KQX A;  1FNO A;  4J3G A;  2V77 A;  3PRT A;  1M1D A;  5ELY A;  5THW A;  4A95 A;  2POK A;  4UCP A;  3HUV A;  2PRQ A;  1LAN A;  1B6B A;  1XF8 A;  4NF1 A;  4CRZ B;  4AXV A;  4FD7 A;  3NE7 A;  2QVP A;  2AFZ A;  3BJ7 A;  3FEE A;  4MHY A;  4NEX A;  5CBM A;  1TKF A;  5BWA B;  3T8W A;  2JEW A;  4U9Z A;  3H8G A;  4KOR A;  2Z3M A;  2VZZ A;  3D2M A;  3UY5 A;  1I21 A;  2X7B A;  4ZX9 A;  2DPT A;  5EBV A;  3D8P A;  3QAY A;  3TO7 A;  3SJG A;  3KL9 A;  3LOD A;  4L89 A;  2D4O A;  3B3C A;  4RS2 A;  3TOB A;  3PGP A;  3B3T A;  3I1U A;  3KQZ A;  4FD4 A;  4R6T A;  4KOS A;  3S9M A;  2B3U A;  4CYO A;  4NXY A;  4MRI A;  3SXO A;  2O4H A;  1RTQ A;  1UFH A;  3WAB A;  4OID A;  1GYT A;  4CYQ A;  3ISZ A;  3FXT A;  4X2T A;  4XPD C;  4DUK A;  3B2Y A;  1VHE A;  2FL4 A;  2FT0 A;  2F8H A;  2YNE A;  2V8D A;  4OME A;  5JH9 A;  3S6K A;  3DNS A;  3FED A;  5A28 A;  2CNT A;  1V0C A;  4RUH A;  2OZG A;  2DXQ A;  4JJX A;  2PDO A;  5F47 A;  1SQH A;  2G3A A;  4P4F A;  4KZT A;  4TNU A;  2PJC A;  4PXD A;  3DDD A;  4IUS A;  4A33 A;  2FS5 A;  4A31 A;  4IK2 A;  5DWM A;  4PSW A;  5H84 A;  4A37 A;  5DWN A;  1PUA A;  1M4I A;  5IB9 A;  1IU8 A;  4L8A A;  4BD9 A;  4PXE A;  4JLY A;  1MJ9 A;  5GCN A;  4R3K A;  4R76 A;  4X8I A;  3T9Y A;  5KTA A;  3GUX A;  4P44 A;  4CGP A;  4HNX B;  2XEJ A;  2GFQ A;  3PB6 X;  3PFO A;  1H8L A;  4YGO A;  1IYL A;  2JDD A;  5LYD A;  5HMN A;  3KGQ A;  1R43 A;  3B8G A;  3EO4 A;  3FYN A;  3NH8 A;  1ELL P;  1VHO A;  3W6X A;  4FBE A;  2PJ7 A;  1Z5R A;  3SJX A;  4X3R A;  2CTC A;  3H5Z A;  5H86 A;  4NFR A;  1IIC A;  4UEF A;  2Z3O A;  4PSX A;  4UIA A;  5E96 A;  4KOU A;  5AGE A;  2FSR A;  4UIB A;  1ZLH A;  3QNV A;  1P0H A;  4FUU A;  4OC4 A;  4OLL A;  5D8N A;  2B4D A;  2DEA A;  3R1K A;  4X5K A;  5CPA A;  1F2O A;  2PJB A;  4M85 A;  5EMI A;  3GIU A;  1ZG9 A;  2I00 A;  2Z3P A;  5I0C A;  2NYQ A;  4CS0 B;  3LWU A;  2XEI A;  4H6Z A;  2G0B A;  3D3S A;  1YVK A;  4BBH A;  4ZGY B;  3IO1 A;  2C6P A;  4H2K A;  3B3W A;  4XPD B;  3I3G A;  3TOA A;  4B11 A;  3PBB A;  2C1C A;  3GB0 A;  2PIY A;  2R98 A;  2Q43 A;  5J8C A;  3FMC A;  2R1I A;  2AFX A;  2OH1 A;  1LAP A;  2CTB A;  2ZPA A;  3T90 A;  3TX8 A;  4UFX A;  1TKH A;  1QSO A;  2AJ6 A;  4Y49 B;  3GYA A;  1YR0 A;  2K5T A;  1ZG7 A;  3R9F A;  3H4Q A;  1Z2L A;  2F7V A;  4GXH A;  4BIN A;  2O53 A;  2PIZ A;  3VH9 A;  5JM6 A;  4LQG A;  3PB8 X;  2GRE A;  2PR8 A;  4ZY1 A;  5KTD A;  2WPX A;  4KUA A;  1MJB A;  4P4E A;  2ZXV A;  4LX9 A;  4NJR A;  4P6Y A;  5K8M A;  3KZW A;  1KUV A;  2HB6 A;  1KWM A;  4A38 A;  2PJ6 A;  1Y7R A;  2P6E A;  1F57 A;  3IWG A;  2WSA A;  4PXB A;  2J8N A;  4AVC A;  3W91 A;  3D7D A;  3ISX A;  3WT4 A;  2CY2 A;  4UWI A;  2J8M A;  4MJ8 A;  2Q51 A;  3DR6 A;  2ZW4 A;  3I9S A;  3FJU A;  2Z0Z A;  3VAT A;  7CPA A;  2FCK A;  2REF A;  2YNC A;  4KLV A;  5LRK A;  2C6C A;  1ZLI A;  4UEZ A;  1YW4 A;  3D7G A;  5LYF A;  5AG4 A;  1XMB A;  3FRM A;  4A2Z A;  3IIB A;  4C2Y A;  6CPA A;  2J9A A;  2OB0 A;  3F5B A;  4IF5 A;  2PJ1 A;  2B4D B;  5AG6 A;  1BOB A;  5I4M A;  2OR4 A;  2RC4 A;  2CIJ A;  4MBU A;  3NA6 A;  4ZBG A;  3G3S A;  3FVL A;  3IU1 A;  3PZJ A;  3EXN A;  4CAW A;  3KHZ A;  4UF4 A;  2ZEP A;  4MFZ A;  3SI0 A;  4F8Z A;  4YFJ A;  1S7N A;  5IV0 A;  3S9L A;  3TC8 A;  2YND A;  4ONU A;  4B10 A;  1M4L A;  3A9L A;  2P0W A;  4EWT A;  2J8R A;  1CJW A;  2ZOF A;  1QSM A;  1P4N A;  3TCV A;  2AFW A;  4H89 A;  3D68 A;  2PVW A;  4LQ6 A;  2AE6 A;  4YU9 A;  3S6H A;  3P2F A;  1MK4 A;  1S7K A;  4OAE A;  2EK9 A;  5C82 A;  1IB1 E;  3E0K A;  3N7Z A;  3GY9 A;  1Q2D A;  1YLO A;  4UCM A;  1I12 A;  2PJ3 A;  2B5G A;  2QJ8 A;  2Z3K A;  3BI1 A;  4P4D A;  4R8F A;  4NSQ A;  1U6M A;  2PRB A;  4GS4 A;  3OWC A;  1ZG8 A;  2OU2 A;  4CAE A;  3ZZI A;  4CGL A;  4U5Y A;  1IID A;  2JBJ A;  4R9M A;  4RI1 A;  2GU2 A;  4KOY A;  3RBU A;  1R57 A;  3C26 A;  1XOV A;  1XIX A;  2QYV A;  4NGS A;  2JLM A;  2PQ8 A;  4U9Y A;  1XRY A;  1EE3 P;  2PJ0 A;  4XPK A;  4Z65 A;  4Y49 C;  4KS9 A;  4HKF A;  3RYO A;  3VWE A;  4A32 A;  2ZEM A;  1IOF A;  4P10 A;  3D2P A;  4B5P A;  1TKJ A;  3TT2 A;  4B14 A;  4NJQ A;  3V8I A;  3B3S A;  1Q2Y A;  2Q7B A;  2KCW A;  3P2H A;  3TTH A;  5HVH A;  4KLW A;  1Z9U A;  2XEF A;  4QB9 A;  3IWE A;  2AFS A;  4Q7A A;  3KAS A;  2ZEO A;  4ZY2 A;  1Z8L A;  2IJZ A;  2Q4V A;  3FNC A;  2PJ2 A;  2ZEF A;  3DSB A;  4CGN A;  1NMT A;  2PJ8 A;  2VXK A;  3IWW A;  3L2N A;  3D66 A;  4F6A A;  3CPX A;  4MFP A;  3MRU A;  4G1P A;  3SI2 A;  1M4G A;  5G20 A;  2XEG A;  1B87 A;  4IHM A;  2PVV A;  3D7F A;  4R87 A;  1QSR A;  3CXS A;  3EY5 A;  4XNH B;  5LYL A;  2R8V A;  4MHN A;  4ORF A;  2OOT A;  5IB0 A;  1XE4 A;  1DE4 C;  3F0A A;  3WC6 A;  4A30 A;  1BPM A;  4AVA A;  4DYO A;  2WZN A;  3PBE A;  2HC9 A;  1CPS A;  5K8O A;  4H6U A;  3GKR A;  4NGM A;  1TIQ A;  3IFE A;  4NGR A;  3CT9 A;  5KTC A;  2ZEN A;  3D7H A;  3FB3 A;  4KOV A;  2EWB A;  4M6I A;  4EFD A;  2ZW6 A;  3IGR A;  3KR4 A;  1IY7 A;  4MFQ A;  4OC2 A;  3F8K A;  4KOT A;  2B5G B;  2Q4Y A;  1XFO A;  2G9D A;  3KKW A;  4OC5 A;  4CAX A;  1QST A;  1DTD A;  2FVG A;  1YRE A;  2DPS A;  2FXF A;  1HDU A;  4OP4 A;  2C6G A;  2ZEH A;  3JVN A;  3RAM A;  4PV6 A;  3LMS A;  2HV2 A;  4W9Y A;  2PJ5 A;  1TXR A;  1TF9 A;  1YSJ A;  3R95 A;  3WR7 A;  1YLE A;  2BCO A;  2ATR A;  1S60 A;  2Q44 A;  4MCQ A;  1LAM A;  1OBR A;  2CF4 A;  2YGW A;  2P6G A;  3EFA A;  3NE8 A;  1L0C A;  2RFH A;  1LRZ A;  4B5P B;  4EME A;  1K4J A;  3RO0 A;  4PK2 A;  4IAV A;  2GIV A;  3H8F A;  3KHX A;  3R9G A;  2BUE A;  3NH5 A;  1Q7L A;  4MFK A;  5JGF A;  1JWQ A;  4YWY A;  2Q4Z A;  4ZX8 A;  3EC4 A;  2IMO A;  3FX6 A;  2WUU A;  3K9U A;  4MMO A;  4Q38 A;  4A94 A;  2JDC A;  2FIW A;  2OZH A;  1CX8 A;  2I3C A;  4QVT A;  3NH4 A;  4QBJ A;  1NE9 A;  2VBQ A;  5G22 A;  1N71 A;  2EBJ A;  3FF3 A;  2QML A;  4KVX A;  4NGP A;  4KSI A;  3IJ3 A;  2EVN A;  1S5K A;  2OZU A;  3QB8 A;  3S6G A;  2YNC C;  1WK4 A;  1AUG A;  2D4P A;  1RO5 A;  1VIX A;  4KUB A;  3WC5 A;  4B5O A;  4ZI6 A;  1Z4R A;  4UCN A;  2ZW5 A;  4MHD A;  1XMT A;  3SJF A;  3VAR A;  8CPA A;  3TFY A;  4WWV A;  1KZF A;  5K8N A;  1CBX A;  2V8H A;  2JBK A;  4JZ0 A;  2BL1 A;  4MCS A;  4FD6 A;  4KOX A;  4P4B A;  2FE7 A;  4AG9 A;  1CG2 A;  3PFE A;  1ELM P;  1ON0 A;  2EUI A;  1QSN A;  4II9 A;  2VI7 A;  5CNP A;  4OC1 A;  1X12 A;  2B4B A;  2ZED A;  4PXC A;  4C68 A;  4UFW A;  4NGQ A;  4FAI A;  3BXM A;  2PE3 A;  4Q36 A;  3CXQ A;  3DLJ A;  4KOW A;  3W6S A;  1VGY A;  1WWZ A;  1NSA A;  3LAC A;  4P45 A;  4XNH C;  4C2Z A;  3IC1 A;  4UEE A;  5F46 A;  4JD6 A;  2BEI A;  4MCP A;  4RN7 A;  4CAV A;  4LUA A;  3GLJ A;  5C88 A;  3IU2 A;  1IOI A;  5A27 A;  1Q2C A;  4BMH A;  4CGO A;  3BHX A;  3B35 A;  2I79 A;  2IL4 A;  1I1D A;  3PB9 X;  2B3V A;  3PEI A;  5IX3 A;  4ZYQ A;  1VKC A;  4CAF A;  5F48 A;  3K2K A;  5D29 A;  1JQG A;  1KUX A;  4NGT A;  5J1Q A;  4MCR A;  1KUY A;  1IGB A;  2P6F A;  4CPA A;  4M6G A;  1CM0 A;  2Z3N A;  2PR1 A;  2ZOG A;  4OAD A;  2Q7S A;  1A2Z A;  2ARH A;  4CGM A;  5ISV A;  3G8W A;  4ONW A;  1LCP A;  2PJ4 A;  4ZY0 A; 
#chains in the Genus database with same CATH homology
 4B12 A;  4NCZ A;  5FVJ A;  4R57 A;  4E0A A;  1YX0 A;  2F5I A;  4F0X A;  4UFV A;  2ZW7 A;  1S7L A;  2REE A;  1Y9W A;  2B58 A;  2HQY A;  2Z3L A;  4B13 A;  4QC6 A;  2PSW A;  1NSL A;  4AB7 A;  1ZO0 A;  4MFJ A;  2QEC A;  1S3Z A;  2GAN A;  3SHP A;  4E8O A;  1BO4 A;  4I49 A;  4YRH A;  4JWP A;  3FIX A;  3JTK A;  1YVO A;  3R96 A;  5KTC A;  1PU9 A;  3TO6 A;  4QUS A;  3TE4 A;  1M4D A;  2PC1 A;  5JPH A;  3BJ8 A;  3CXP A;  4AVB A;  3R9E A;  4KSF A;  1OZP A;  5F49 A;  1YK3 A;  1IYK A;  1GHE A;  2Q04 A;  4FD5 A;  3S6F A;  2VEZ A;  2Z10 A;  1Y9K A;  2NMT A;  3FBU A;  2G3T A;  2A4N A;  4C7H A;  4C2X A;  2FIA A;  2Q0Y A;  2Z11 A;  4UWJ A;  4E2A A;  4MY0 A;  5JQ4 A;  4F0Y A;  5AG5 A;  1Z4E A;  4CYP A;  2VQY A;  2O28 A;  4K30 A;  2H5M A;  5AG7 A;  3TO9 A;  4C7I A;  1VHS A;  2Y0M A;  4XPL A;  2HUZ A;  4CRY B;  4HNY B;  5G1Z A;  4EVY A;  2CXA A;  2JEV A;  4KVO E;  1YGH A;  3VWD A;  1S7F A;  3SXN A;  4HNW B;  4R3L A;  3DR8 A;  5G21 A;  2WPW A;  4M3S A;  4MY3 A;  4JXR A;  4JXQ A;  2R7H A;  4KVM E;  1MJA A;  2VZY A;  4AG7 A;  1M44 A;  5J8F A;  1J4J A;  2CNM A;  3LD2 A;  4MFL A;  4KSA A;  1RXT A;  3BLN A;  3MGD A;  4PK3 A;  5HH1 A;  5EC4 A;  2GE3 A;  4UBR A;  2CNS A;  1XEB A;  2BSW A;  3JUW A;  4MI4 A;  4UA3 A;  1FY7 A;  3QAH A;  2QIR A;  3PP9 A;  4CYN A;  3ZJ0 A;  2C27 A;  4J3G A;  1M1D A;  4A95 A;  4UCP A;  1B6B A;  1XF8 A;  4NF1 A;  4CRZ B;  4FD7 A;  3NE7 A;  3BJ7 A;  4NEX A;  5BWA B;  4U9Z A;  4KOR A;  2Z3M A;  2VZZ A;  3D2M A;  3UY5 A;  1I21 A;  2X7B A;  2DPT A;  5EBV A;  3D8P A;  3TO7 A;  3LOD A;  4L89 A;  4RS2 A;  2D4O A;  3TOB A;  3PGP A;  4FD4 A;  4KOS A;  2B3U A;  4CYO A;  4NXY A;  3SXO A;  1UFH A;  4CYQ A;  4XPD C;  3FXT A;  2FL4 A;  2FT0 A;  2YNE A;  3S6K A;  3DNS A;  5A28 A;  2CNT A;  1V0C A;  2OZG A;  2DXQ A;  4JJX A;  2PDO A;  5F47 A;  1SQH A;  2G3A A;  4KZT A;  3DDD A;  4IUS A;  4A33 A;  2FS5 A;  4A31 A;  5DWM A;  4PSW A;  5H84 A;  5DWN A;  1PUA A;  1M4I A;  4L8A A;  4JLY A;  1MJ9 A;  5GCN A;  4R3K A;  3T9Y A;  5KTA A;  4CGP A;  4HNX B;  4YGO A;  1IYL A;  2JDD A;  5HMN A;  3B8G A;  3EO4 A;  3FYN A;  3W6X A;  3H5Z A;  5H86 A;  1IIC A;  2Z3O A;  4PSX A;  5E96 A;  4KOU A;  5AGE A;  2FSR A;  1P0H A;  4OLL A;  2B4D A;  3R1K A;  4X5K A;  4M85 A;  2I00 A;  2Z3P A;  5I0C A;  4CS0 B;  4H6Z A;  2G0B A;  3D3S A;  1YVK A;  4BBH A;  4ZGY B;  4XPD B;  3I3G A;  3TOA A;  4B11 A;  2R98 A;  5J8C A;  2R1I A;  2OH1 A;  2ZPA A;  3T90 A;  4UFX A;  1QSO A;  4Y49 B;  2AJ6 A;  3GYA A;  1YR0 A;  2K5T A;  3R9F A;  3H4Q A;  2PR8 A;  5KTD A;  2WPX A;  4KUA A;  1MJB A;  2ZXV A;  4LX9 A;  1KUV A;  3IWG A;  1Y7R A;  2P6E A;  2WSA A;  2J8N A;  4AVC A;  3W91 A;  2CY2 A;  4UWI A;  2J8M A;  4MJ8 A;  3DR6 A;  2ZW4 A;  3I9S A;  2Z0Z A;  2FCK A;  2REF A;  2YNC A;  4KLV A;  5AG4 A;  3FRM A;  4A2Z A;  4C2Y A;  2OB0 A;  3F5B A;  4IF5 A;  2B4D B;  5AG6 A;  1BOB A;  2RC4 A;  4MBU A;  4ZBG A;  3G3S A;  3IU1 A;  4CAW A;  3PZJ A;  3EXN A;  4MFZ A;  4YFJ A;  1S7N A;  5IV0 A;  2YND A;  4ONU A;  4B10 A;  3A9L A;  2P0W A;  2J8R A;  1CJW A;  1QSM A;  1P4N A;  3TCV A;  4H89 A;  2AE6 A;  3S6H A;  3P2F A;  1MK4 A;  1S7K A;  4OAE A;  5C82 A;  1IB1 E;  3E0K A;  3N7Z A;  3GY9 A;  1Q2D A;  4UCM A;  1I12 A;  2B5G A;  2Z3K A;  4NSQ A;  1U6M A;  2PRB A;  4GS4 A;  3OWC A;  2OU2 A;  4CAE A;  3ZZI A;  4CGL A;  4U5Y A;  1IID A;  4R9M A;  4RI1 A;  4KOY A;  1R57 A;  3C26 A;  1XIX A;  2JLM A;  2PQ8 A;  4U9Y A;  4XPK A;  4Y49 C;  4KS9 A;  4HKF A;  3RYO A;  3VWE A;  4A32 A;  3D2P A;  4B5P A;  4B14 A;  3TT2 A;  3V8I A;  1Q2Y A;  2Q7B A;  2KCW A;  3P2H A;  3TTH A;  4KLW A;  1Z9U A;  4QB9 A;  3IWE A;  2Q4V A;  3FNC A;  3DSB A;  4CGN A;  1NMT A;  2VXK A;  4F6A A;  4MFP A;  1M4G A;  5G20 A;  4DNC A;  1B87 A;  4R87 A;  1QSR A;  3CXS A;  3EY5 A;  4XNH B;  2R8V A;  4ORF A;  5IB0 A;  1XE4 A;  3F0A A;  4AVA A;  4A30 A;  4H6U A;  3GKR A;  1TIQ A;  3FB3 A;  4KOV A;  2ZW6 A;  3IGR A;  4MFQ A;  3F8K A;  4KOT A;  2B5G B;  2Q4Y A;  3KKW A;  4CAX A;  1QST A;  1YRE A;  2DPS A;  2FXF A;  3JVN A;  4PV6 A;  2HV2 A;  3R95 A;  3WR7 A;  1YLE A;  2ATR A;  1S60 A;  2Q44 A;  2YGW A;  2P6G A;  3EFA A;  1L0C A;  1LRZ A;  4B5P B;  1K4J A;  4PK2 A;  2GIV A;  3R9G A;  2BUE A;  4MFK A;  3EC4 A;  2WUU A;  3K9U A;  4Q38 A;  2JDC A;  2FIW A;  2OZH A;  4QVT A;  4QBJ A;  1NE9 A;  2VBQ A;  5G22 A;  1N71 A;  2QML A;  4KVX A;  2EVN A;  1S5K A;  2OZU A;  3QB8 A;  3S6G A;  2YNC C;  1WK4 A;  2D4P A;  1RO5 A;  4KUB A;  4B5O A;  1Z4R A;  4UCN A;  2ZW5 A;  4MHD A;  1XMT A;  3TFY A;  1KZF A;  2BL1 A;  4FD6 A;  4KOX A;  4AG9 A;  2FE7 A;  1ON0 A;  2EUI A;  1QSN A;  4II9 A;  2VI7 A;  5CNP A;  2B4B A;  4C68 A;  4UFW A;  4Q36 A;  3CXQ A;  4KOW A;  3W6S A;  4C2Z A;  1WWZ A;  4XNH C;  5F46 A;  4JD6 A;  2BEI A;  4CAV A;  4LUA A;  5C88 A;  3IU2 A;  5A27 A;  1Q2C A;  4BMH A;  4CGO A;  2I79 A;  2IL4 A;  1I1D A;  2B3V A;  5IX3 A;  1VKC A;  4CAF A;  5F48 A;  1KUX A;  1KUY A;  2P6F A;  1CM0 A;  2Z3N A;  2PR1 A;  4OAD A;  2ARH A;  4CGM A;  5ISV A;  3G8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...