4ZGYB

Structure of human ornithine decarboxylase in complex with a c-terminal fragment of antizyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
FYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Ornithine decarboxylase
publication title Structural basis of antizyme-mediated regulation of polyamine homeostasis
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4zgyB00
4ZGYB 1ZO0A 5BWAB
chains in the Genus database with same CATH superfamily
2PQ8A 4G1PA 3W91A 3EY5A 3L2NA 2PJ0A 5HVGA 4A37A 3B35A 3WR7A 4A95A 2ZEHA 3R95A 1LFWA 1XFOA 3I3GA 3PP9A 4A31A 5KTAA 1RXTA 4NJQA 1IOFA 1B6BA 1KUXA 1Y7RA 3HUVA 5CNPA 4A33A 4AVBA 2BCOA 5EMIA 1MJ9A 2I79A 2WSAA 4JWPA 2REFA 4OIDA 1UFHA 3RO0A 4CAFA 2XEGA 2PR1A 3D68A 3SJXA 4CGLA 4CRYB 3TO9A 5H84A 2Q51A 1A2ZA 2BOAA 4ZY0A 2GANA 4KVME 2PJ9A 2J8RA 5K8NA 3KKWA 3LACA 2GU2A 2POKA 4O23A 4BINA 5I4MA 2WPXA 2P6GA 4OC5A 4MI4A 3NH5A 1S7NA 3B3VA 3H8GA 2RFHA 2Q4YA 2EWBA 1BAVA 4FAIA 3V7ZA 4HNYB 4C7HA 3B3SA 3I9SA 1NE9A 3GUXA 3P2HA 4MHZA 4Y49B 4ONWA 5AGEA 1TKJA 1VKCA 1PYTB 1QSOA 2Q44A 4IHMA 3OWCA 4UIBA 4OC4A 3RZAA 4LUAA 1QMUA 3GIUA 1NSAA 4GS4A 2O4HA 4PSWA 1UWYA 3JRUA 1Z8LA 2AFSA 4IK2A 4MFZA 4MHYA 4UCNA 4CAEA 3C26A 3QNVA 1CX8A 2EK8A 4B10A 4FD4A 4P4JA 2GREA 2PJ8A 3R9EA 2FT0A 3G8WA 3F5BA 1P4NA 1YR0A 2ZW5A 3B3CA 4FWUA 5F09A 5JM6A 2B5GA 2PJ3A 3FBUA 1VGYA 1XMTA 2B5GB 3IWGA 1ZLHA 4ZY1A 1X12A 1XOVA 2WYRA 4QC6A 4B14A 3T9YA 5JH9A 2ZXVA 1XF8A 2BEIA 3CXQA 2YGWA 4IF5A 4U9ZA 3S9LA 2OB0A 1NMTA 1QSTA 5DWNA 3KASA 1Y0YA 4FD5A 3EC4A 3LD2A 1K4JA 2GLJA 5C88A 3PZJA 1CM0A 2PDOA 1VHEA 4NEXA 2BL1A 4M3SA 2WZNA 4E2AA 1PUAA 1MJBA 3CZXA 1LANA 2ZENA 3GKRA 1YW4A 4R57A 2R1IA 3D7DA 1FY7A 4JXQA 8CPAA 3TE4A 3TFYA 2Q4ZA 5ISVA 5G21A 7CPAA 4EVYA 2NYQA 2PJ1A 5K8MA 5AG6A 2J8MA 2X7BA 1AYEA 1CG2A 3N5FA 4MFQA 4B6ZA 3PB4X 1FNOA 1Q2DA 1S5KA 3IWEA 3NE7A 3DNSA 1MK4A 2GIVA 3F8KA 4XPDB 2IJZA 2HC9A 4Z65A 3BJ8A 2PIZA 3ZJ0A 4A32A 4F9VA 3LODA 4ZGYB 2H5MA 4W9YA 1B87A 2B4DB 2JDCA 5G1ZA 4UFXA 4ZI6A 3FIXA 3VATA 4FD7A 1BPNA 3PB8X 3S6GA 3F0AA 2HQYA 2B3UA 4P4IA 4C2YA 1Y0RA 2YNCA 4RN7A 4AB7A 4R76A 3B2YA 1YMEA 2Q7BA 3PRTA 1S7KA 3BXMA 4DJLA 5JQ4A 4ZY2A 4NCZA 4YU9A 2NMTA 2PJ7A 4C7IA 3LWUA 1TXRA 4FD6A 4DNCA 1S3ZA 4E8OA 2PIYA 3MGDA 3TC8A 4KOVA 3D7HA 4R8FA 2V77A 2JBJA 1F2PA 2BSWA 2ZEOA 3LMSA 2I3CA 2CNMA 4FBEA 2EVNA 3T90A 1IIDA 2B3VA 2PJ2A 1JQGA 3FXTA 2AE6A 4X3RA 4P4BA 4P4EA 4BBHA 2PJ6A 2A4NA 2Z3KA 4L8AA 1XE4A 4A30A 3QAYA 4KORA 4KSIA 2HB6A 4PXEA 4J3GA 2VXKA 5K8PA 1CPSA 3KHZA 1IYKA 2CNSA 1CPXA 2XEJA 4QBJA 4MY0A 4X5KA 4PXDA 4H89A 3FRMA 4KSAA 3SI0A 3SXOA 4XNHC 4WWVA 2ODFA 4NSQA 4EMEA 1KWMA 3QAHA 1XRYA 5IV0A 3FF3A 4GXHA 1KUYA 1P0HA 1YGHA 5BWAB 3IWWA 1S60A 3CXSA 2NSMA 4H2KA 4UWIA 5JGFA 2VI7A 1IICA 4NGNA 1KZFA 3CT9A 4KLWA 4DYOA 2CXAA 3K2KA 3K9TA 1I12A 3R96A 5KTDA 3CPAA 2AFXA 2O53A 4UEZA 2DXQA 3B3WA 1YREA 1M4DA 2FS5A 4P4DA 5F49A 2GLFA 1V0CA 2IL4A 4YWYA 4CPAA 1Y9KA 3W6XA 2EUIA 3WC7A 4PXBA 4R9MA 3DR6A 3TTHA 4MMOA 4F9UA 3TT2A 1Z4EA 4MCQA 2PR8A 5I0CA 2ZEMA 3PGPA 4JJXA 4P4FA 3RBUA 2ARHA 1S7LA 3FEDA 4B5PA 4NGQA 4B5PB 2DF5A 4JZ0A 1ZG8A 4AVCA 4KLVA 2PSWA 4QVTA 1XIXA 4KOTA 2JEWA 4UFWA 5HXDA 3FMCA 5IX3A 3SJEA 2BO9A 2R98A 2AFUA 2G3AA 1TF8A 2OZUA 2FXFA 1H8LA 5F46A 1S7FA 3D8PA 4KUBA 3IFEA 5G22A 5LRGA 1N71A 3DR8A 3JVNA 5EC4A 3PB7X 2ZELA 5CPAA 5J8FA 2CF4A 4I49A 2EK9A 4MRIA 2V8GA 1M4LA 3FYNA 3H4QA 1LAMA 2OH1A 3N7ZA 5K8OA 4MFJA 2P0WA 4NGMA 4K30A 2Q0YA 3PB6X 4II9A 2ZW6A 2HV2A 3RYOA 3EFAA 3I1UA 2F8HA 4UCMA 3A9LA 2PRQA 1YSJA 4M6GA 2ABZA 2AFZA 2GFQA 3D7FA 1YQEA 4R3KA 3RAMA 3GB0A 3KQXA 2C27A 4KOUA 1ZG7A 2BUEA 4CRZB 2ZEEA 3SJGA 4MY3A 4MFPA 1BLLE 4KVXA 1HEEA 3DLJA 2QJ8A 4NGSA 3WT4A 3CXPA 4PSXA 4ZBGA 2DPSA 3PFOA 4A94A 4B13A 4GM5A 2OR4A 2O28A 2G9DA 1LOKA 4C2XA 4F6AA 5A27A 2JBKA 1QSRA 2AJ6A 4PPZA 3ZZIA 3IJ3A 3P2FA 3D7GA 1TF9A 4IAVA 2AFMA 4MBUA 4WJBA 2QIRA 3D4UA 4OC1A 3KGQA 4R7MA 4PXCA 1QSNA 4KOYA 4B5OA 4X8IA 3R9GA 1ELMP 3GYAA 4H6UA 3B7IA 5EBVA 2FE7A 2YNDA 2B4DA 1JWQA 4UEEA 3IGRA 3FVLA 1LAPA 2CTBA 3IU2A 2HUZA 4AXVA 4UIAA 4CAWA 4DUKA 3D2MA 1X10A 4XPKA 1YLEA 2AFWA 2Q4VA 4K3NA 3R9FA 1J4JA 2ZEGA 3FH4A 4A38A 4Q38A 1WK4A 3PB9X 1IYLA 4F0YA 2PVWA 1MJAA 1TKHA 2YNCC 1KUVA 3DSBA 2K5TA 2C6PA 3KHXA 3MN8A 4KOWA 3S6FA 4PK2A 5J8CA 3GY9A 4KSFA 4P44A 5ELYA 2EO8A 1PCAA 3PEIA 2AFOA 3BI1A 3DGVA 4IUSA 3W6SA 4LQ6A 1U6MA 1YW6A 1SQHA 3H5ZA 4M6HA 1PU9A 1XMBA 2JEVA 1M44A 2D4PA 2R8VA 2VEZA 1M4IA 2Z3MA 4NF1A 4UEFA 4YRHA 5G20A 4JD6A 4B12A 3NE8A 2ZEFA 2PJAA 3TOBA 2VZYA 3FEEA 2B58A 4CYOA 4NGRA 5IB0A 1QSMA 3RNZA 5HVHA 3KZWA 4L89A 5F47A 1BPMA 1ZO0A 2FVGA 2FIWA 1ELLP 4ORFA 4MHDA 2C6GA 4X2TA 4UBRA 4CGNA 4QUSA 3E0KA 2DEAA 3H8FA 1M4GA 2WUUA 5AG5A 5IB9A 1ARLA 3SI2A 3KI9A 1OBRA 4RI1A 4CAXA 1XBUA 5A28A 4OLLA 2C6CA 2RB7A 2P6FA 1Y9WA 4AG9A 2QVPA 1CP7A 1TKFA 2VQYA 1Q7LA 4UCPA 4HPSA 4YFJA 1VHSA 2OU2A 5HH1A 2R7HA 3JUWA 2REEA 4Q36A 4ZYQA 4UFVA 3S9NA 2VZZA 4UWJA 1RO5A 4ZX9A 3TCVA 4CGPA 3D66A 3PBBA 1CBXA 1EE3P 3ISXA 2OZHA 1M1DA 1BO4A 2PRBA 2F5IA 1R3NA 1Z9UA 3KR5A 4MFLA 2WPWA 4R87A 4CGOA 2ANPA 2D4OA 4UA3A 5C82A 2ATRA 2C1CA 4PK3A 5LRJA 4BD9A 4R6TA 2Y0MA 2CTCA 4JYWA 4TWEA 3B8GA 4OC0A 5FVJA 2FL4A 3VWDA 1BOBA 2VBQA 4OADA 4Q7AA 2G0BA 3D3SA 2JLMA 4FUUA 2VL1A 4OKOA 4Y49C 1GHEA 2RC4A 4KOXA 5CBMA 4NJRA 4NGPA 4JXRA 1F57A 3KL9A 3KR4A 2ZPAA 4ONUA 5AG7A 1YX0A 4E0AA 3R1KA 4JLYA 4EFDA 4OP4A 2JDDA 2OOTA 4P6YA 3IO1A 2KCWA 2Z3LA 3BLNA 1IY7A 3PBEA 3T8WA 4RUHA 1NSLA 4NGTA 2OZGA 3NH4A 1WWZA 2IMOA 3TO7A 3NA6A 2J8NA 1GYTA 4F8ZA 2CNTA 2V8VA 4A2ZA 1CP6A 4RS2A 5LYIA 1DE4C 4BMHA 5HVFA 3EO4A 2PJCA 1AUGA 2F7VA 4H6ZA 4HNXB 5H86A 2XEIA 1DTDA 2Z0ZA 4MCPA 1IU8A 4MHPA 4P45A 3WABA 2QMLA 3S9MA 1Z8XA 3CPXA 4LX9A 3V8IA 2V8HA 4B11A 1Q2CA 3IC1A 1I21A 4MCSA 2QECA 3G3SA 1Z4RA 4MHNA 4YGOA 2QYVA 2PJ4A 3VWEA 6CPAA 3K9UA 4TNUA 3IEHA 4MCRA 4C2ZA 2GE3A 2ZOGA 4AG7A 3FNCA 4OC3A 4PV6A 2PCUA 3H8EA 3SHPA 4U5YA 1XJOA 1I1DA 1ON0A 2CIJA 2Z3PA 2PE3A 5LRKA 1ARMA 5DWMA 4CAVA 3B3TA 3FECA 4XPDC 3VARA 4OMEA 3SJFA 3HLPA 3VH9A 3TO6A 4OC2A 3IIBA 2YNEA 1Z5RA 3IU1A 1IGBA 4C68A 1R43A 3PFEA 3D67A 1YVKA 4CYQA 1ZLIA 2Q43A 1YLOA 4M6IA 4U9YA 3KQZA 2ZW7A 5LYLA 4M85A 4ZX8A 5D8NA 1L0CA 4P10A 4CYNA 2V8DA 1YVOA 3DDDA 2Z11A 3WC5A 1OZPA 2ZEDA 4EWTA 1VIXA 1Y7EA 4KS9A 3NH8A 1XEBA 4MFKA 1Z2LA 2Z3OA 1F2OA 4NXYA 4CGMA 2PC1A 3D2PA 1IB1E 2Z3NA 2Z10A 2J9AA 3MRUA 2DPTA 2I00A 2XEFA 3BJ7A 2CY2A 3BHXA 4KVOE 4MJ8A 5JPHA 1VHOA 5LYFA 4A39A 5DS0A 1Z8WA 1QQ9A 5LYDA 2FSRA 2G3TA 2PJ5A 4UF4A 3SXNA 2Q7SA 3S6KA 5E96A 1ZG9A 3ISZA 1IOIA 1FT7A 1TIQA 2B4BA 2EBJA 4OIWA 3WC6A 1LCPA 5THWA 2Q04A 3SI1A 4AVAA 4KUAA 1HDUA 4KZTA 1Q2YA 3EXNA 1HDQA 3TOAA 3CDXA 2PJBA 2FIAA 2IQ6A 3V38A 5HMNA 4MXUA 1LRZA 4CYPA 3FX6A 4QB9A 3QB8A 4XNHB 1R57A 4HKFA 4R3LA 3UY5A 5KTCA 4HNWB 3S6HA 2ZW4A 2ZEPA 3BI0A 3JTKA 4NFRA 1Z8TA 2P6EA 2PVVA 3FJUA 4PQAA 5D29A 4CS0B 5J1QA 5F48A 4OAEA 3NFZA 1RTQA 4XPLA 4F0XA 5AG4A 2ZOFA 1AMPA 2FCKA 1YK3A 3FB3A 3GLJA 4KOSA 4LQGA 1CJWA 5GCNA 3TX8A
chains in the Genus database with same CATH topology
2PQ8A 3W91A 3EY5A 3WR7A 4A95A 4A31A 3I3GA 3PP9A 5KTAA 1RXTA 1KUXA 1B6BA 1Y7RA 5CNPA 4A33A 4AVBA 1MJ9A 2I79A 2WSAA 4JWPA 2REFA 4CAFA 1UFHA 2PR1A 4CGLA 4CRYB 3TO9A 5H84A 2GANA 4KVME 2J8RA 3KKWA 2WPXA 2P6GA 4MI4A 1S7NA 2Q4YA 4HNYB 4C7HA 3I9SA 1NE9A 4Y49B 3P2HA 5AGEA 1VKCA 1QSOA 2Q44A 3OWCA 4LUAA 4GS4A 4PSWA 4MFZA 4UCNA 4CAEA 3C26A 4B10A 4FD4A 3R9EA 2FT0A 3G8WA 3F5BA 1P4NA 1YR0A 2ZW5A 2B5GA 3FBUA 1XMTA 2B5GB 3IWGA 4QC6A 4B14A 3T9YA 2ZXVA 1XF8A 2BEIA 3CXQA 2YGWA 4IF5A 4U9ZA 2OB0A 1NMTA 1QSTA 5DWNA 4FD5A 3EC4A 3LD2A 1K4JA 5C88A 3PZJA 1CM0A 2PDOA 4NEXA 2BL1A 4M3SA 4E2AA 1PUAA 1MJBA 3GKRA 4R57A 2R1IA 4JXQA 1FY7A 3TE4A 3TFYA 5ISVA 5G21A 4EVYA 5AG6A 2J8MA 2X7BA 4MFQA 1S5KA 1Q2DA 3IWEA 3NE7A 3DNSA 1MK4A 2GIVA 3F8KA 4XPDB 3BJ8A 3ZJ0A 4A32A 3LODA 4ZGYB 2H5MA 1B87A 2B4DB 2JDCA 5G1ZA 4UFXA 3FIXA 4FD7A 3S6GA 3F0AA 2HQYA 2B3UA 4C2YA 2YNCA 4AB7A 2Q7BA 1S7KA 5JQ4A 4NCZA 2NMTA 4C7IA 4FD6A 4DNCA 1S3ZA 4E8OA 3MGDA 4KOVA 2BSWA 2CNMA 2EVNA 3T90A 1IIDA 2B3VA 3FXTA 2AE6A 4BBHA 2A4NA 2Z3KA 4L8AA 1XE4A 4A30A 4KORA 4J3GA 2VXKA 1IYKA 2CNSA 4QBJA 4MY0A 4X5KA 4H89A 3FRMA 4KSAA 3SXOA 4XNHC 4NSQA 3QAHA 5IV0A 1KUYA 1P0HA 1YGHA 5BWAB 1S60A 3CXSA 4UWIA 2VI7A 1IICA 1KZFA 4KLWA 2CXAA 1I12A 3R96A 5KTDA 2DXQA 1YREA 1M4DA 2FS5A 5F49A 1V0CA 2IL4A 1Y9KA 3W6XA 2EUIA 4R9MA 3DR6A 3TTHA 3TT2A 1Z4EA 2PR8A 5I0CA 3PGPA 4JJXA 2ARHA 1S7LA 4B5PA 4B5PB 4AVCA 4KLVA 2PSWA 4QVTA 1XIXA 4KOTA 4UFWA 5IX3A 2R98A 2G3AA 2OZUA 2FXFA 5F46A 1S7FA 3D8PA 4KUBA 5G22A 1N71A 3DR8A 3JVNA 5EC4A 5J8FA 4I49A 3FYNA 3H4QA 2OH1A 3N7ZA 4MFJA 2P0WA 4K30A 2Q0YA 4II9A 2ZW6A 2HV2A 3RYOA 3EFAA 4UCMA 3A9LA 4R3KA 2C27A 4KOUA 2BUEA 4CRZB 4MY3A 4MFPA 4KVXA 3CXPA 4PSXA 4ZBGA 2DPSA 4B13A 4C2XA 2O28A 4F6AA 5A27A 1QSRA 2AJ6A 3ZZIA 3P2FA 4MBUA 2QIRA 4B5OA 1QSNA 4KOYA 3R9GA 3GYAA 4H6UA 5EBVA 2FE7A 2YNDA 2B4DA 3IGRA 3IU2A 2HUZA 4CAWA 3D2MA 4XPKA 1YLEA 2Q4VA 3R9FA 1J4JA 4Q38A 1WK4A 4F0YA 1IYLA 1MJAA 2YNCC 3DSBA 1KUVA 2K5TA 4KOWA 5J8CA 3S6FA 4PK2A 3GY9A 4KSFA 4IUSA 3W6SA 1U6MA 1SQHA 3H5ZA 1PU9A 2VEZA 1M44A 2D4PA 2JEVA 2R8VA 1M4IA 2Z3MA 4NF1A 4YRHA 5G20A 4B12A 4JD6A 3TOBA 2VZYA 2B58A 4CYOA 5IB0A 1QSMA 4L89A 5F47A 1ZO0A 2FIWA 4ORFA 4MHDA 4CGNA 4UBRA 4QUSA 3E0KA 1M4GA 2WUUA 5AG5A 4RI1A 4CAXA 5A28A 4OLLA 4AG9A 2P6FA 1Y9WA 2VQYA 4UCPA 4YFJA 1VHSA 2OU2A 5HH1A 2R7HA 3JUWA 2REEA 4Q36A 4UFVA 2VZZA 4UWJA 1RO5A 3TCVA 4CGPA 2OZHA 1M1DA 1BO4A 2PRBA 2F5IA 1Z9UA 4MFLA 2WPWA 4R87A 4CGOA 2D4OA 4UA3A 5C82A 2ATRA 4PK3A 2Y0MA 3B8GA 5FVJA 2FL4A 3VWDA 1BOBA 2VBQA 4OADA 2G0BA 3D3SA 2JLMA 4Y49C 1GHEA 2RC4A 4KOXA 4JXRA 2ZPAA 4ONUA 5AG7A 1YX0A 4E0AA 3R1KA 4JLYA 2JDDA 2KCWA 2Z3LA 3BLNA 1NSLA 2OZGA 1WWZA 3TO7A 2J8NA 2CNTA 4A2ZA 4RS2A 4BMHA 3EO4A 4H6ZA 4HNXB 5H86A 2Z0ZA 2QMLA 4LX9A 3V8IA 4B11A 1Q2CA 1I21A 2QECA 3G3SA 1Z4RA 4YGOA 3VWEA 3K9UA 4C2ZA 2GE3A 4AG7A 3FNCA 4PV6A 3SHPA 4U5YA 1I1DA 1ON0A 2Z3PA 5DWMA 4CAVA 4XPDC 3TO6A 2YNEA 3IU1A 4C68A 1YVKA 4CYQA 4U9YA 2ZW7A 4M85A 1L0CA 4CYNA 1YVOA 3DDDA 2Z11A 1OZPA 4KS9A 1XEBA 4MFKA 2Z3OA 4NXYA 4CGMA 2PC1A 3D2PA 1IB1E 2Z3NA 2Z10A 2DPTA 2I00A 3BJ7A 4MJ8A 2CY2A 4KVOE 5JPHA 2FSRA 2G3TA 3SXNA 3S6KA 5E96A 1TIQA 2B4BA 2Q04A 4AVAA 4KUAA 4KZTA 1Q2YA 3EXNA 3TOAA 2FIAA 5HMNA 1LRZA 4CYPA 4QB9A 3QB8A 4XNHB 1R57A 4HKFA 4R3LA 3UY5A 5KTCA 4HNWB 3S6HA 2ZW4A 3JTKA 4CS0B 2P6EA 5F48A 4OAEA 4XPLA 5AG4A 4F0XA 3FB3A 2FCKA 5GCNA 1YK3A 4KOSA 3R95A 1CJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGY B;  1ZO0 A;  5BWA B; 
#chains in the Genus database with same CATH topology
 2PQ8 A;  4G1P A;  3W91 A;  3EY5 A;  3L2N A;  2PJ0 A;  5HVG A;  4A37 A;  3B35 A;  3WR7 A;  4A95 A;  2ZEH A;  3R95 A;  1LFW A;  1XFO A;  3I3G A;  3PP9 A;  4A31 A;  5KTA A;  1RXT A;  4NJQ A;  1IOF A;  1B6B A;  1KUX A;  1Y7R A;  3HUV A;  5CNP A;  4A33 A;  4AVB A;  2BCO A;  5EMI A;  1MJ9 A;  2I79 A;  2WSA A;  4JWP A;  2REF A;  4OID A;  1UFH A;  3RO0 A;  4CAF A;  2XEG A;  2PR1 A;  3D68 A;  3SJX A;  4CGL A;  4CRY B;  3TO9 A;  5H84 A;  2Q51 A;  1A2Z A;  2BOA A;  4ZY0 A;  2GAN A;  4KVM E;  2PJ9 A;  2J8R A;  5K8N A;  3KKW A;  3LAC A;  2GU2 A;  2POK A;  4O23 A;  4BIN A;  5I4M A;  2WPX A;  2P6G A;  4OC5 A;  4MI4 A;  3NH5 A;  1S7N A;  3B3V A;  3H8G A;  2RFH A;  2Q4Y A;  2EWB A;  1BAV A;  4FAI A;  3V7Z A;  4HNY B;  4C7H A;  3B3S A;  3I9S A;  1NE9 A;  3GUX A;  3P2H A;  4MHZ A;  4Y49 B;  4ONW A;  5AGE A;  1TKJ A;  1VKC A;  1PYT B;  1QSO A;  2Q44 A;  4IHM A;  3OWC A;  4UIB A;  4OC4 A;  3RZA A;  4LUA A;  1QMU A;  3GIU A;  1NSA A;  4GS4 A;  2O4H A;  4PSW A;  1UWY A;  3JRU A;  1Z8L A;  2AFS A;  4IK2 A;  4MFZ A;  4MHY A;  4UCN A;  4CAE A;  3C26 A;  3QNV A;  1CX8 A;  2EK8 A;  4B10 A;  4FD4 A;  4P4J A;  2GRE A;  2PJ8 A;  3R9E A;  2FT0 A;  3G8W A;  3F5B A;  1P4N A;  1YR0 A;  2ZW5 A;  3B3C A;  4FWU A;  5F09 A;  5JM6 A;  2B5G A;  2PJ3 A;  3FBU A;  1VGY A;  1XMT A;  2B5G B;  3IWG A;  1ZLH A;  4ZY1 A;  1X12 A;  1XOV A;  2WYR A;  4QC6 A;  4B14 A;  3T9Y A;  5JH9 A;  2ZXV A;  1XF8 A;  2BEI A;  3CXQ A;  2YGW A;  4IF5 A;  4U9Z A;  3S9L A;  2OB0 A;  1NMT A;  1QST A;  5DWN A;  3KAS A;  1Y0Y A;  4FD5 A;  3EC4 A;  3LD2 A;  1K4J A;  2GLJ A;  5C88 A;  3PZJ A;  1CM0 A;  2PDO A;  1VHE A;  4NEX A;  2BL1 A;  4M3S A;  2WZN A;  4E2A A;  1PUA A;  1MJB A;  3CZX A;  1LAN A;  2ZEN A;  3GKR A;  1YW4 A;  4R57 A;  2R1I A;  3D7D A;  1FY7 A;  4JXQ A;  8CPA A;  3TE4 A;  3TFY A;  2Q4Z A;  5ISV A;  5G21 A;  7CPA A;  4EVY A;  2NYQ A;  2PJ1 A;  5K8M A;  5AG6 A;  2J8M A;  2X7B A;  1AYE A;  1CG2 A;  3N5F A;  4MFQ A;  4B6Z A;  3PB4 X;  1FNO A;  1Q2D A;  1S5K A;  3IWE A;  3NE7 A;  3DNS A;  1MK4 A;  2GIV A;  3F8K A;  4XPD B;  2IJZ A;  2HC9 A;  4Z65 A;  3BJ8 A;  2PIZ A;  3ZJ0 A;  4A32 A;  4F9V A;  3LOD A;  4ZGY B;  2H5M A;  4W9Y A;  1B87 A;  2B4D B;  2JDC A;  5G1Z A;  4UFX A;  4ZI6 A;  3FIX A;  3VAT A;  4FD7 A;  1BPN A;  3PB8 X;  3S6G A;  3F0A A;  2HQY A;  2B3U A;  4P4I A;  4C2Y A;  1Y0R A;  2YNC A;  4RN7 A;  4AB7 A;  4R76 A;  3B2Y A;  1YME A;  2Q7B A;  3PRT A;  1S7K A;  3BXM A;  4DJL A;  5JQ4 A;  4ZY2 A;  4NCZ A;  4YU9 A;  2NMT A;  2PJ7 A;  4C7I A;  3LWU A;  1TXR A;  4FD6 A;  4DNC A;  1S3Z A;  4E8O A;  2PIY A;  3MGD A;  3TC8 A;  4KOV A;  3D7H A;  4R8F A;  2V77 A;  2JBJ A;  1F2P A;  2BSW A;  2ZEO A;  3LMS A;  2I3C A;  2CNM A;  4FBE A;  2EVN A;  3T90 A;  1IID A;  2B3V A;  2PJ2 A;  1JQG A;  3FXT A;  2AE6 A;  4X3R A;  4P4B A;  4P4E A;  4BBH A;  2PJ6 A;  2A4N A;  2Z3K A;  4L8A A;  1XE4 A;  4A30 A;  3QAY A;  4KOR A;  4KSI A;  2HB6 A;  4PXE A;  4J3G A;  2VXK A;  5K8P A;  1CPS A;  3KHZ A;  1IYK A;  2CNS A;  1CPX A;  2XEJ A;  4QBJ A;  4MY0 A;  4X5K A;  4PXD A;  4H89 A;  3FRM A;  4KSA A;  3SI0 A;  3SXO A;  4XNH C;  4WWV A;  2ODF A;  4NSQ A;  4EME A;  1KWM A;  3QAH A;  1XRY A;  5IV0 A;  3FF3 A;  4GXH A;  1KUY A;  1P0H A;  1YGH A;  5BWA B;  3IWW A;  1S60 A;  3CXS A;  2NSM A;  4H2K A;  4UWI A;  5JGF A;  2VI7 A;  1IIC A;  4NGN A;  1KZF A;  3CT9 A;  4KLW A;  4DYO A;  2CXA A;  3K2K A;  3K9T A;  1I12 A;  3R96 A;  5KTD A;  3CPA A;  2AFX A;  2O53 A;  4UEZ A;  2DXQ A;  3B3W A;  1YRE A;  1M4D A;  2FS5 A;  4P4D A;  5F49 A;  2GLF A;  1V0C A;  2IL4 A;  4YWY A;  4CPA A;  1Y9K A;  3W6X A;  2EUI A;  3WC7 A;  4PXB A;  4R9M A;  3DR6 A;  3TTH A;  4MMO A;  4F9U A;  3TT2 A;  1Z4E A;  4MCQ A;  2PR8 A;  5I0C A;  2ZEM A;  3PGP A;  4JJX A;  4P4F A;  3RBU A;  2ARH A;  1S7L A;  3FED A;  4B5P A;  4NGQ A;  4B5P B;  2DF5 A;  4JZ0 A;  1ZG8 A;  4AVC A;  4KLV A;  2PSW A;  4QVT A;  1XIX A;  4KOT A;  2JEW A;  4UFW A;  5HXD A;  3FMC A;  5IX3 A;  3SJE A;  2BO9 A;  2R98 A;  2AFU A;  2G3A A;  1TF8 A;  2OZU A;  2FXF A;  1H8L A;  5F46 A;  1S7F A;  3D8P A;  4KUB A;  3IFE A;  5G22 A;  5LRG A;  1N71 A;  3DR8 A;  3JVN A;  5EC4 A;  3PB7 X;  2ZEL A;  5CPA A;  5J8F A;  2CF4 A;  4I49 A;  2EK9 A;  4MRI A;  2V8G A;  1M4L A;  3FYN A;  3H4Q A;  1LAM A;  2OH1 A;  3N7Z A;  5K8O A;  4MFJ A;  2P0W A;  4NGM A;  4K30 A;  2Q0Y A;  3PB6 X;  4II9 A;  2ZW6 A;  2HV2 A;  3RYO A;  3EFA A;  3I1U A;  2F8H A;  4UCM A;  3A9L A;  2PRQ A;  1YSJ A;  4M6G A;  2ABZ A;  2AFZ A;  2GFQ A;  3D7F A;  1YQE A;  4R3K A;  3RAM A;  3GB0 A;  3KQX A;  2C27 A;  4KOU A;  1ZG7 A;  2BUE A;  4CRZ B;  2ZEE A;  3SJG A;  4MY3 A;  4MFP A;  1BLL E;  4KVX A;  1HEE A;  3DLJ A;  2QJ8 A;  4NGS A;  3WT4 A;  3CXP A;  4PSX A;  4ZBG A;  2DPS A;  3PFO A;  4A94 A;  4B13 A;  4GM5 A;  2OR4 A;  2O28 A;  2G9D A;  1LOK A;  4C2X A;  4F6A A;  5A27 A;  2JBK A;  1QSR A;  2AJ6 A;  4PPZ A;  3ZZI A;  3IJ3 A;  3P2F A;  3D7G A;  1TF9 A;  4IAV A;  2AFM A;  4MBU A;  4WJB A;  2QIR A;  3D4U A;  4OC1 A;  3KGQ A;  4R7M A;  4PXC A;  1QSN A;  4KOY A;  4B5O A;  4X8I A;  3R9G A;  1ELM P;  3GYA A;  4H6U A;  3B7I A;  5EBV A;  2FE7 A;  2YND A;  2B4D A;  1JWQ A;  4UEE A;  3IGR A;  3FVL A;  1LAP A;  2CTB A;  3IU2 A;  2HUZ A;  4AXV A;  4UIA A;  4CAW A;  4DUK A;  3D2M A;  1X10 A;  4XPK A;  1YLE A;  2AFW A;  2Q4V A;  4K3N A;  3R9F A;  1J4J A;  2ZEG A;  3FH4 A;  4A38 A;  4Q38 A;  1WK4 A;  3PB9 X;  1IYL A;  4F0Y A;  2PVW A;  1MJA A;  1TKH A;  2YNC C;  1KUV A;  3DSB A;  2K5T A;  2C6P A;  3KHX A;  3MN8 A;  4KOW A;  3S6F A;  4PK2 A;  5J8C A;  3GY9 A;  4KSF A;  4P44 A;  5ELY A;  2EO8 A;  1PCA A;  3PEI A;  2AFO A;  3BI1 A;  3DGV A;  4IUS A;  3W6S A;  4LQ6 A;  1U6M A;  1YW6 A;  1SQH A;  3H5Z A;  4M6H A;  1PU9 A;  1XMB A;  2JEV A;  1M44 A;  2D4P A;  2R8V A;  2VEZ A;  1M4I A;  2Z3M A;  4NF1 A;  4UEF A;  4YRH A;  5G20 A;  4JD6 A;  4B12 A;  3NE8 A;  2ZEF A;  2PJA A;  3TOB A;  2VZY A;  3FEE A;  2B58 A;  4CYO A;  4NGR A;  5IB0 A;  1QSM A;  3RNZ A;  5HVH A;  3KZW A;  4L89 A;  5F47 A;  1BPM A;  1ZO0 A;  2FVG A;  2FIW A;  1ELL P;  4ORF A;  4MHD A;  2C6G A;  4X2T A;  4UBR A;  4CGN A;  4QUS A;  3E0K A;  2DEA A;  3H8F A;  1M4G A;  2WUU A;  5AG5 A;  5IB9 A;  1ARL A;  3SI2 A;  3KI9 A;  1OBR A;  4RI1 A;  4CAX A;  1XBU A;  5A28 A;  4OLL A;  2C6C A;  2RB7 A;  2P6F A;  1Y9W A;  4AG9 A;  2QVP A;  1CP7 A;  1TKF A;  2VQY A;  1Q7L A;  4UCP A;  4HPS A;  4YFJ A;  1VHS A;  2OU2 A;  5HH1 A;  2R7H A;  3JUW A;  2REE A;  4Q36 A;  4ZYQ A;  4UFV A;  3S9N A;  2VZZ A;  4UWJ A;  1RO5 A;  4ZX9 A;  3TCV A;  4CGP A;  3D66 A;  3PBB A;  1CBX A;  1EE3 P;  3ISX A;  2OZH A;  1M1D A;  1BO4 A;  2PRB A;  2F5I A;  1R3N A;  1Z9U A;  3KR5 A;  4MFL A;  2WPW A;  4R87 A;  4CGO A;  2ANP A;  2D4O A;  4UA3 A;  5C82 A;  2ATR A;  2C1C A;  4PK3 A;  5LRJ A;  4BD9 A;  4R6T A;  2Y0M A;  2CTC A;  4JYW A;  4TWE A;  3B8G A;  4OC0 A;  5FVJ A;  2FL4 A;  3VWD A;  1BOB A;  2VBQ A;  4OAD A;  4Q7A A;  2G0B A;  3D3S A;  2JLM A;  4FUU A;  2VL1 A;  4OKO A;  4Y49 C;  1GHE A;  2RC4 A;  4KOX A;  5CBM A;  4NJR A;  4NGP A;  4JXR A;  1F57 A;  3KL9 A;  3KR4 A;  2ZPA A;  4ONU A;  5AG7 A;  1YX0 A;  4E0A A;  3R1K A;  4JLY A;  4EFD A;  4OP4 A;  2JDD A;  2OOT A;  4P6Y A;  3IO1 A;  2KCW A;  2Z3L A;  3BLN A;  1IY7 A;  3PBE A;  3T8W A;  4RUH A;  1NSL A;  4NGT A;  2OZG A;  3NH4 A;  1WWZ A;  2IMO A;  3TO7 A;  3NA6 A;  2J8N A;  1GYT A;  4F8Z A;  2CNT A;  2V8V A;  4A2Z A;  1CP6 A;  4RS2 A;  5LYI A;  1DE4 C;  4BMH A;  5HVF A;  3EO4 A;  2PJC A;  1AUG A;  2F7V A;  4H6Z A;  4HNX B;  5H86 A;  2XEI A;  1DTD A;  2Z0Z A;  4MCP A;  1IU8 A;  4MHP A;  4P45 A;  3WAB A;  2QML A;  3S9M A;  1Z8X A;  3CPX A;  4LX9 A;  3V8I A;  2V8H A;  4B11 A;  1Q2C A;  3IC1 A;  1I21 A;  4MCS A;  2QEC A;  3G3S A;  1Z4R A;  4MHN A;  4YGO A;  2QYV A;  2PJ4 A;  3VWE A;  6CPA A;  3K9U A;  4TNU A;  3IEH A;  4MCR A;  4C2Z A;  2GE3 A;  2ZOG A;  4AG7 A;  3FNC A;  4OC3 A;  4PV6 A;  2PCU A;  3H8E A;  3SHP A;  4U5Y A;  1XJO A;  1I1D A;  1ON0 A;  2CIJ A;  2Z3P A;  2PE3 A;  5LRK A;  1ARM A;  5DWM A;  4CAV A;  3B3T A;  3FEC A;  4XPD C;  3VAR A;  4OME A;  3SJF A;  3HLP A;  3VH9 A;  3TO6 A;  4OC2 A;  3IIB A;  2YNE A;  1Z5R A;  3IU1 A;  1IGB A;  4C68 A;  1R43 A;  3PFE A;  3D67 A;  1YVK A;  4CYQ A;  1ZLI A;  2Q43 A;  1YLO A;  4M6I A;  4U9Y A;  3KQZ A;  2ZW7 A;  5LYL A;  4M85 A;  4ZX8 A;  5D8N A;  1L0C A;  4P10 A;  4CYN A;  2V8D A;  1YVO A;  3DDD A;  2Z11 A;  3WC5 A;  1OZP A;  2ZED A;  4EWT A;  1VIX A;  1Y7E A;  4KS9 A;  3NH8 A;  1XEB A;  4MFK A;  1Z2L A;  2Z3O A;  1F2O A;  4NXY A;  4CGM A;  2PC1 A;  3D2P A;  1IB1 E;  2Z3N A;  2Z10 A;  2J9A A;  3MRU A;  2DPT A;  2I00 A;  2XEF A;  3BJ7 A;  2CY2 A;  3BHX A;  4KVO E;  4MJ8 A;  5JPH A;  1VHO A;  5LYF A;  4A39 A;  5DS0 A;  1Z8W A;  1QQ9 A;  5LYD A;  2FSR A;  2G3T A;  2PJ5 A;  4UF4 A;  3SXN A;  2Q7S A;  3S6K A;  5E96 A;  1ZG9 A;  3ISZ A;  1IOI A;  1FT7 A;  1TIQ A;  2B4B A;  2EBJ A;  4OIW A;  3WC6 A;  1LCP A;  5THW A;  2Q04 A;  3SI1 A;  4AVA A;  4KUA A;  1HDU A;  4KZT A;  1Q2Y A;  3EXN A;  1HDQ A;  3TOA A;  3CDX A;  2PJB A;  2FIA A;  2IQ6 A;  3V38 A;  5HMN A;  4MXU A;  1LRZ A;  4CYP A;  3FX6 A;  4QB9 A;  3QB8 A;  4XNH B;  1R57 A;  4HKF A;  4R3L A;  3UY5 A;  5KTC A;  4HNW B;  3S6H A;  2ZW4 A;  2ZEP A;  3BI0 A;  3JTK A;  4NFR A;  1Z8T A;  2P6E A;  2PVV A;  3FJU A;  4PQA A;  5D29 A;  4CS0 B;  5J1Q A;  5F48 A;  4OAE A;  3NFZ A;  1RTQ A;  4XPL A;  4F0X A;  5AG4 A;  2ZOF A;  1AMP A;  2FCK A;  1YK3 A;  3FB3 A;  3GLJ A;  4KOS A;  4LQG A;  1CJW A;  5GCN A;  3TX8 A; 
#chains in the Genus database with same CATH homology
 2PQ8 A;  3W91 A;  3EY5 A;  3WR7 A;  4A95 A;  4A31 A;  3I3G A;  3PP9 A;  5KTA A;  1RXT A;  1KUX A;  1B6B A;  1Y7R A;  5CNP A;  4A33 A;  4AVB A;  1MJ9 A;  2I79 A;  2WSA A;  4JWP A;  2REF A;  4CAF A;  1UFH A;  2PR1 A;  4CGL A;  4CRY B;  3TO9 A;  5H84 A;  2GAN A;  4KVM E;  2J8R A;  3KKW A;  2WPX A;  2P6G A;  4MI4 A;  1S7N A;  2Q4Y A;  4HNY B;  4C7H A;  3I9S A;  1NE9 A;  4Y49 B;  3P2H A;  5AGE A;  1VKC A;  1QSO A;  2Q44 A;  3OWC A;  4LUA A;  4GS4 A;  4PSW A;  4MFZ A;  4UCN A;  4CAE A;  3C26 A;  4B10 A;  4FD4 A;  3R9E A;  2FT0 A;  3G8W A;  3F5B A;  1P4N A;  1YR0 A;  2ZW5 A;  2B5G A;  3FBU A;  1XMT A;  2B5G B;  3IWG A;  4QC6 A;  4B14 A;  3T9Y A;  2ZXV A;  1XF8 A;  2BEI A;  3CXQ A;  2YGW A;  4IF5 A;  4U9Z A;  2OB0 A;  1NMT A;  1QST A;  5DWN A;  4FD5 A;  3EC4 A;  3LD2 A;  1K4J A;  5C88 A;  3PZJ A;  1CM0 A;  2PDO A;  4NEX A;  2BL1 A;  4M3S A;  4E2A A;  1PUA A;  1MJB A;  3GKR A;  4R57 A;  2R1I A;  4JXQ A;  1FY7 A;  3TE4 A;  3TFY A;  5ISV A;  5G21 A;  4EVY A;  5AG6 A;  2J8M A;  2X7B A;  4MFQ A;  1S5K A;  1Q2D A;  3IWE A;  3NE7 A;  3DNS A;  1MK4 A;  2GIV A;  3F8K A;  4XPD B;  3BJ8 A;  3ZJ0 A;  4A32 A;  3LOD A;  4ZGY B;  2H5M A;  1B87 A;  2B4D B;  2JDC A;  5G1Z A;  4UFX A;  3FIX A;  4FD7 A;  3S6G A;  3F0A A;  2HQY A;  2B3U A;  4C2Y A;  2YNC A;  4AB7 A;  2Q7B A;  1S7K A;  5JQ4 A;  4NCZ A;  2NMT A;  4C7I A;  4FD6 A;  4DNC A;  1S3Z A;  4E8O A;  3MGD A;  4KOV A;  2BSW A;  2CNM A;  2EVN A;  3T90 A;  1IID A;  2B3V A;  3FXT A;  2AE6 A;  4BBH A;  2A4N A;  2Z3K A;  4L8A A;  1XE4 A;  4A30 A;  4KOR A;  4J3G A;  2VXK A;  1IYK A;  2CNS A;  4QBJ A;  4MY0 A;  4X5K A;  4H89 A;  3FRM A;  4KSA A;  3SXO A;  4XNH C;  4NSQ A;  3QAH A;  5IV0 A;  1KUY A;  1P0H A;  1YGH A;  5BWA B;  1S60 A;  3CXS A;  4UWI A;  2VI7 A;  1IIC A;  1KZF A;  4KLW A;  2CXA A;  1I12 A;  3R96 A;  5KTD A;  2DXQ A;  1YRE A;  1M4D A;  2FS5 A;  5F49 A;  1V0C A;  2IL4 A;  1Y9K A;  3W6X A;  2EUI A;  4R9M A;  3DR6 A;  3TTH A;  3TT2 A;  1Z4E A;  2PR8 A;  5I0C A;  3PGP A;  4JJX A;  2ARH A;  1S7L A;  4B5P A;  4B5P B;  4AVC A;  4KLV A;  2PSW A;  4QVT A;  1XIX A;  4KOT A;  4UFW A;  5IX3 A;  2R98 A;  2G3A A;  2OZU A;  2FXF A;  5F46 A;  1S7F A;  3D8P A;  4KUB A;  5G22 A;  1N71 A;  3DR8 A;  3JVN A;  5EC4 A;  5J8F A;  4I49 A;  3FYN A;  3H4Q A;  2OH1 A;  3N7Z A;  4MFJ A;  2P0W A;  4K30 A;  2Q0Y A;  4II9 A;  2ZW6 A;  2HV2 A;  3RYO A;  3EFA A;  4UCM A;  3A9L A;  4R3K A;  2C27 A;  4KOU A;  2BUE A;  4CRZ B;  4MY3 A;  4MFP A;  4KVX A;  3CXP A;  4PSX A;  4ZBG A;  2DPS A;  4B13 A;  4C2X A;  2O28 A;  4F6A A;  5A27 A;  1QSR A;  2AJ6 A;  3ZZI A;  3P2F A;  4MBU A;  2QIR A;  4B5O A;  1QSN A;  4KOY A;  3R9G A;  3GYA A;  4H6U A;  5EBV A;  2FE7 A;  2YND A;  2B4D A;  3IGR A;  3IU2 A;  2HUZ A;  4CAW A;  3D2M A;  4XPK A;  1YLE A;  2Q4V A;  3R9F A;  1J4J A;  4Q38 A;  1WK4 A;  4F0Y A;  1IYL A;  1MJA A;  2YNC C;  3DSB A;  1KUV A;  2K5T A;  4KOW A;  5J8C A;  3S6F A;  4PK2 A;  3GY9 A;  4KSF A;  4IUS A;  3W6S A;  1U6M A;  1SQH A;  3H5Z A;  1PU9 A;  2VEZ A;  1M44 A;  2D4P A;  2JEV A;  2R8V A;  1M4I A;  2Z3M A;  4NF1 A;  4YRH A;  5G20 A;  4B12 A;  4JD6 A;  3TOB A;  2VZY A;  2B58 A;  4CYO A;  5IB0 A;  1QSM A;  4L89 A;  5F47 A;  1ZO0 A;  2FIW A;  4ORF A;  4MHD A;  4CGN A;  4UBR A;  4QUS A;  3E0K A;  1M4G A;  2WUU A;  5AG5 A;  4RI1 A;  4CAX A;  5A28 A;  4OLL A;  4AG9 A;  2P6F A;  1Y9W A;  2VQY A;  4UCP A;  4YFJ A;  1VHS A;  2OU2 A;  5HH1 A;  2R7H A;  3JUW A;  2REE A;  4Q36 A;  4UFV A;  2VZZ A;  4UWJ A;  1RO5 A;  3TCV A;  4CGP A;  2OZH A;  1M1D A;  1BO4 A;  2PRB A;  2F5I A;  1Z9U A;  4MFL A;  2WPW A;  4R87 A;  4CGO A;  2D4O A;  4UA3 A;  5C82 A;  2ATR A;  4PK3 A;  2Y0M A;  3B8G A;  5FVJ A;  2FL4 A;  3VWD A;  1BOB A;  2VBQ A;  4OAD A;  2G0B A;  3D3S A;  2JLM A;  4Y49 C;  1GHE A;  2RC4 A;  4KOX A;  4JXR A;  2ZPA A;  4ONU A;  5AG7 A;  1YX0 A;  4E0A A;  3R1K A;  4JLY A;  2JDD A;  2KCW A;  2Z3L A;  3BLN A;  1NSL A;  2OZG A;  1WWZ A;  3TO7 A;  2J8N A;  2CNT A;  4A2Z A;  4RS2 A;  4BMH A;  3EO4 A;  4H6Z A;  4HNX B;  5H86 A;  2Z0Z A;  2QML A;  4LX9 A;  3V8I A;  4B11 A;  1Q2C A;  1I21 A;  2QEC A;  3G3S A;  1Z4R A;  4YGO A;  3VWE A;  3K9U A;  4C2Z A;  2GE3 A;  4AG7 A;  3FNC A;  4PV6 A;  3SHP A;  4U5Y A;  1I1D A;  1ON0 A;  2Z3P A;  5DWM A;  4CAV A;  4XPD C;  3TO6 A;  2YNE A;  3IU1 A;  4C68 A;  1YVK A;  4CYQ A;  4U9Y A;  2ZW7 A;  4M85 A;  1L0C A;  4CYN A;  1YVO A;  3DDD A;  2Z11 A;  1OZP A;  4KS9 A;  1XEB A;  4MFK A;  2Z3O A;  4NXY A;  4CGM A;  2PC1 A;  3D2P A;  1IB1 E;  2Z3N A;  2Z10 A;  2DPT A;  2I00 A;  3BJ7 A;  4MJ8 A;  2CY2 A;  4KVO E;  5JPH A;  2FSR A;  2G3T A;  3SXN A;  3S6K A;  5E96 A;  1TIQ A;  2B4B A;  2Q04 A;  4AVA A;  4KUA A;  4KZT A;  1Q2Y A;  3EXN A;  3TOA A;  2FIA A;  5HMN A;  1LRZ A;  4CYP A;  4QB9 A;  3QB8 A;  4XNH B;  1R57 A;  4HKF A;  4R3L A;  3UY5 A;  5KTC A;  4HNW B;  3S6H A;  2ZW4 A;  3JTK A;  4CS0 B;  2P6E A;  5F48 A;  4OAE A;  4XPL A;  5AG4 A;  4F0X A;  3FB3 A;  2FCK A;  5GCN A;  1YK3 A;  4KOS A;  3R95 A;  1CJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...