4ZGYB

Structure of human ornithine decarboxylase in complex with a c-terminal fragment of antizyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
FYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of antizyme-mediated regulation of polyamine homeostasis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
molecule keywords Ornithine decarboxylase
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4zgyB00
5BWAB 4ZGYB 1ZO0A
chains in the Genus database with same CATH superfamily
4A31A 3FXTA 1ELMP 1X12A 3RYOA 4CAVA 4CAXA 2EK9A 5AG4A 4C2YA 4AG7A 4X3RA 4Q38A 3K2KA 5LYLA 2RFHA 1IY7A 3IU1A 2B5GB 2EWBA 4P10A 2Z3NA 4MFPA 4PQAA 5THWA 2ABZA 2Q51A 3FYNA 4K3NA 3F5BA 5DWMA 3S6HA 2ZW7A 2DF5A 1IU8A 2P0WA 5LRJA 1B6BA 5HH1A 2ZEMA 2V8HA 3QB8A 2PJAA 2ZEOA 4QUSA 4F0YA 3DDDA 4CGOA 4PXDA 2VQYA 4R76A 1AUGA 1YSJA 4A30A 3B35A 4KVME 4Y49B 2G0BA 1Z4RA 2ZEGA 3I3GA 1CP6A 4MY0A 4F9VA 4KS9A 3PZJA 4IUSA 1ELLP 1F57A 4E0AA 3D2PA 1IYKA 1MJAA 2Z3PA 5LRKA 4OIWA 4QBJA 4KORA 2H5MA 4YWYA 2QIRA 1V0CA 2WUUA 3D67A 4OC2A 2QMLA 1ZG9A 4O23A 3KR5A 4JD6A 1ZG7A 4PSXA 3PB7X 1LRZA 3WC7A 2R8VA 5G21A 4GS4A 3TOAA 1CBXA 3FF3A 5IV0A 3QNVA 5LRGA 4UEFA 3S6GA 2Q7SA 1Y9KA 4BINA 2JLMA 4B14A 1XOVA 1H8LA 1YR0A 3OWCA 2B58A 2B4DB 4AVBA 4BMHA 2PR8A 4MI4A 3GKRA 2CY2A 4JYWA 4CYNA 5A27A 3S9NA 1XEBA 2R7HA 8CPAA 3BI0A 2D4PA 4IF5A 4M3SA 3FECA 4NGNA 1N71A 1Z8WA 1QSOA 4OADA 4X5KA 2Q44A 2VBQA 3GY9A 4F9UA 2CNSA 4UIBA 4B13A 2EVNA 1KUXA 1NMTA 4A32A 2PJCA 4KUAA 1LAMA 2GANA 3KHXA 2POKA 2C1CA 4B6ZA 3D4UA 4MFLA 3TO9A 3SI0A 2F7VA 1XJOA 4MHZA 3D66A 1P4NA 4RN7A 3V8IA 4XPDB 3EY5A 1FNOA 2YGWA 2FXFA 3D68A 4AVAA 5HXDA 1S60A 2I00A 2A4NA 3GUXA 2JBKA 3PB4X 1DE4C 2OZUA 4MFJA 1EE3P 4G1PA 1LFWA 3KKWA 2GREA 2Z10A 4HNXB 4AB7A 2XEFA 3P2HA 2ZOFA 2JDCA 2EK8A 4NJQA 4NGMA 3H5ZA 2PCUA 1UWYA 4QB9A 5CPAA 4JXRA 1IOIA 4XNHC 2FL4A 3TT2A 2ZOGA 5I4MA 3SJXA 3GLJA 2OZGA 4MRIA 4R3LA 5HVFA 2C27A 4CGPA 4B5PA 3H8FA 1IB1E 1BPMA 4DNCA 1I1DA 4CPAA 3JUWA 3LACA 3JTKA 2JDDA 1YQEA 4J3GA 4OLLA 4LX9A 2AFZA 2GFQA 4KOXA 2QYVA 4KOVA 1IIDA 5F49A 4AG9A 4AVCA 2PJ0A 2XEJA 4MFQA 4OC3A 2VEZA 1GHEA 5IB9A 1Z2LA 2PRQA 1M4IA 3TFYA 2HC9A 1SQHA 1K4JA 2ZW4A 5A28A 2GIVA 4P4DA 3IWWA 4RI1A 2B5GA 3FJUA 4R87A 1J4JA 3EFAA 1QSTA 2WYRA 1HEEA 2J8RA 3V7ZA 1CP7A 4HNYB 5JGFA 3FB3A 1Q2CA 2ZELA 1QSMA 2V8GA 1YVKA 4R9MA 1S5KA 3R9FA 4UWIA 4F8ZA 4CGNA 2NMTA 1S3ZA 1MJBA 2Q4VA 4OP4A 1M4GA 2FS5A 2PVVA 4H6UA 4EWTA 3D7DA 4FUUA 3VWEA 1IGBA 4UFWA 4DJLA 5KTAA 1TF8A 3SI1A 1IYLA 4FBEA 4DUKA 3FBUA 2CNMA 3RBUA 1YW4A 4B10A 3KGQA 4IAVA 1YLOA 5DS0A 1Z8TA 1MK4A 2EBJA 4KOWA 3TE4A 4U9YA 1B87A 3HUVA 4CYQA 5K8NA 2X7BA 3BJ7A 2C6PA 3WABA 4YFJA 2GLJA 2OB0A 2R1IA 1M1DA 4ZY1A 2ZENA 3A9LA 5AG6A 2Z3MA 3B8GA 3R1KA 4PK2A 1S7LA 3R96A 3FIXA 4M6GA 3V38A 4F6AA 4KSAA 3HLPA 3ISZA 1Z8LA 3IIBA 4W9YA 1L0CA 5C88A 3TOBA 3NFZA 5J8FA 3H4QA 4XPDC 2J8NA 1Z8XA 2ZXVA 5G1ZA 4JJXA 5HMNA 2PE3A 5HVGA 4YU9A 4K30A 4PXCA 3K9UA 1YW6A 1Q7LA 1VHSA 2BL1A 1ZLIA 2P6EA 4EMEA 2DPSA 1XFOA 3KHZA 4Z65A 4XNHB 3KI9A 2I79A 3ISXA 4R8FA 1YMEA 3TO7A 4CGLA 3S9LA 1FY7A 5KTDA 2ZEDA 1TKFA 4LQGA 4XPKA 1NSLA 4IHMA 1IOFA 4R57A 4MBUA 2C6CA 2XEGA 2WPXA 2DPTA 4A33A 5BWAB 4KZTA 1XMBA 3GB0A 4LQ6A 5DWNA 1CJWA 1QSNA 2CTCA 4JWPA 2CIJA 2PJ2A 1IICA 2QJ8A 3LMSA 4M85A 1NSAA 2VZZA 4CS0B 4KOUA 3PBEA 4DYOA 5IX3A 3KASA 1TIQA 2REFA 1F2PA 4II9A 1LCPA 2R98A 4ZY0A 4MHYA 2Q7BA 2JBJA 2P6GA 3CZXA 3EXNA 1I12A 2IMOA 3KQXA 3L2NA 4M6IA 2B3UA 1Z9UA 5C82A 1WWZA 2FCKA 3F0AA 4CRZB 2ODFA 2BEIA 2PQ8A 4FD5A 3CXQA 3KL9A 4I49A 5IB0A 1Y7RA 3KR4A 3SHPA 3IU2A 4FD4A 4ZX9A 3TO6A 3DLJA 3IWGA 3B3SA 4OC0A 5JQ4A 4B5PB 5JH9A 1HDQA 2PJ7A 3WR7A 1TKJA 1R57A 5LYFA 2HB6A 1M44A 4NEXA 4CGMA 4C7HA 4P4FA 3PB8X 4UF4A 2VZYA 4GXHA 4BD9A 1OBRA 3KQZA 5EMIA 2OH1A 4E2AA 2OZHA 4CYOA 2HV2A 4NGQA 2PR1A 3I1UA 1WK4A 3LD2A 1CPSA 2YNCC 1CG2A 2F5IA 3DGVA 5ELYA 2I3CA 2PIZA 4KVXA 4TNUA 2PJ1A 3PBBA 4OIDA 1A2ZA 3WC5A 2WPWA 2Z11A 4PPZA 2VL1A 5FVJA 3PB6X 3SXNA 3B3WA 1QMUA 1LOKA 3B3CA 5JM6A 5F47A 3T8WA 1S7KA 2Q4YA 1F2OA 3SJFA 1Y0RA 4A38A 3LWUA 4FD6A 3IEHA 3T9YA 1AYEA 3G8WA 4X8IA 1KWMA 1YLEA 2Z3OA 3SJGA 4NGPA 2O53A 4F0XA 4LUAA 2ARHA 2K5TA 3PB9X 3F8KA 4PSWA 4JXQA 4U9ZA 2REEA 5AG5A 1BPNA 3TX8A 3RAMA 2O4HA 2Q0YA 4KOTA 1TXRA 4MJ8A 1PCAA 3B2YA 1CX8A 2FE7A 3DR8A 3EO4A 4MFZA 3IFEA 1NE9A 2B3VA 2JEVA 3C26A 4OAEA 4PK3A 4UEZA 5D8NA 3D8PA 4OC4A 2BSWA 2G9DA 3BLNA 3DSBA 4R6TA 5LYDA 1VHEA 3IGRA 4IK2A 1UFHA 2YNDA 4MHPA 4RUHA 3P2FA 4YRHA 2OU2A 2ZEEA 4UCMA 5AGEA 1CM0A 3NA6A 1KUYA 3PRTA 5CNPA 3SJEA 1VKCA 2P6FA 2OOTA 3TC8A 4NGTA 4QC6A 5F48A 1U6MA 4ONWA 4MFKA 4KVOE 1FT7A 1S7NA 2AFUA 2FIAA 2PC1A 2Z0ZA 4ONUA 1S7FA 3EC4A 1Y9WA 2NSMA 3NH8A 2PJ4A 4C2ZA 3CT9A 7CPAA 4C68A 2BO9A 3FEDA 2BOAA 4MHDA 4UIAA 2XEIA 4P4BA 4TWEA 3CDXA 3PEIA 4ZI6A 5F09A 4FD7A 1YK3A 2PVWA 5K8PA 5E96A 3DR6A 4HNWB 1AMPA 4GM5A 1VIXA 4EFDA 4CAEA 3FRMA 1ZO0A 1Y7EA 4A95A 4KLVA 1HDUA 3PFEA 1XMTA 5G22A 2Z3KA 2ZPAA 4P4IA 4X2TA 4ZX8A 5F46A 4HKFA 3BXMA 2PJ5A 2PJ3A 3GYAA 3D7GA 4NXYA 3T90A 4AXVA 1RXTA 3PGPA 5HVHA 3NE8A 1BOBA 4RS2A 3QAYA 2WSAA 2DXQA 3I9SA 1MJ9A 1TF9A 4M6HA 4ZGYB 3D7FA 4OC1A 4PV6A 1VHOA 2FIWA 5G20A 2C6GA 2V8DA 5KTCA 1ZLHA 4PXBA 4CRYB 3RO0A 1GYTA 3FX6A 2AFXA 2PJ6A 1XIXA 2ATRA 4CYPA 2G3TA 2FT0A 5D29A 3TTHA 2YNEA 4YGOA 1CPXA 3RNZA 2AFMA 2O28A 1QSRA 1OZPA 4ZYQA 1ARMA 3H8GA 1Z5RA 2G3AA 4OC5A 5H86A 4UCPA 3DNSA 4KOYA 1KZFA 1R43A 4Q36A 1RO5A 1P0HA 2EO8A 2J9AA 1M4DA 2V8VA 4NGRA 3QAHA 4L8AA 1XF8A 4MCQA 3ZZIA 2ZEPA 2B4BA 2PRBA 2PSWA 4CAFA 1X10A 3ZJ0A 1LAPA 3FVLA 3VATA 1QQ9A 3B3TA 2JEWA 2IQ6A 3RZAA 1YX0A 2EUIA 4R3KA 4PXEA 2GE3A 2PJ8A 4HPSA 4NFRA 2VXKA 3H8EA 3WC6A 2PJ9A 2Q4ZA 2ZW6A 3VWDA 4FAIA 4UEEA 2DEAA 3BI1A 5JPHA 3VARA 3BHXA 1PU9A 2PJBA 1YREA 3G3SA 5ISVA 1R3NA 2BCOA 2ANPA 2CXAA 5LYIA 4B5OA 3D2MA 4L89A 5GCNA 3W6XA 4CAWA 4A37A 2AE6A 3W91A 3FEEA 3MN8A 4A2ZA 3VH9A 1ARLA 3SXOA 4P45A 4UWJA 3S6KA 4A94A 4BBHA 1Q2DA 2GLFA 3MGDA 4UFXA 1RTQA 2CNTA 2OR4A 2D4OA 1BAVA 2Q04A 3R95A 3W6SA 1VGYA 1ON0A 3WT4A 2ZW5A 1KUVA 3B3VA 2BUEA 4WWVA 4C7IA 3FNCA 2Q43A 6CPAA 2IJZA 2NYQA 4MCRA 5J1QA 3IC1A 3PP9A 4FWUA 2B4DA 4NGSA 3JVNA 4P6YA 3CPXA 2CF4A 4Y49C 2AJ6A 1Z4EA 4MHNA 3FMCA 4XPLA 4WJBA 3K9TA 3B7IA 2RC4A 1BLLE 1BO4A 2F8HA 4KLWA 2VI7A 4UFVA 5K8OA 1TKHA 2J8MA 3D7HA 1XE4A 2ZEFA 3FH4A 4MCPA 4ORFA 4OMEA 4QVTA 3S9MA 2HQYA 3NH5A 2GU2A 5CBMA 4R7MA 3CPAA 1JWQA 1JQGA 2FVGA 1Y0YA 5J8CA 4NF1A 3JRUA 5H84A 1Q2YA 2QECA 1LANA 3IWEA 4U5YA 1PUAA 3E0KA 4MCSA 2AFSA 2FSRA 4MY3A 3N7ZA 5K8MA 1XBUA 4H6ZA 4P4JA 4C2XA 3KZWA 1DTDA 1I21A 3N5FA 4JLYA 4EVYA 4P4EA 3IJ3A 1M4LA 4P44A 4NCZA 3R9GA 3BJ8A 2PDOA 3GIUA 4KSFA 5I0CA 4KSIA 4UCNA 4JZ0A 5EC4A 1ZG8A 3MRUA 2WZNA 3PFOA 4KOSA 1YGHA 4Q7AA 4E8OA 2V77A 3NE7A 2KCWA 4NJRA 2ZEHA 3CXSA 1YVOA 3IO1A 4UBRA 2Z3LA 3LODA 2YNCA 4MXUA 3CXPA 3TCVA 3R9EA 4UA3A 2Y0MA 2AFOA 3S6FA 1XRYA 4MMOA 1PYTB 4NSQA 2QVPA 3SI2A 4H2KA 4H89A 4A39A 5EBVA 4ZBGA 3UY5A 4OKOA 4ZY2A 3D3SA 2RB7A 2HUZA 2IL4A 4B11A 2PIYA 4B12A 4KUBA 3NH4A 2AFWA 2CTBA 5AG7A
chains in the Genus database with same CATH topology
4A31A 3FXTA 4CAVA 3RYOA 5AG4A 4CAXA 4C2YA 4AG7A 4Q38A 3IU1A 2B5GB 2Z3NA 4MFPA 3FYNA 3F5BA 5DWMA 3S6HA 2ZW7A 2P0WA 1B6BA 5HH1A 3QB8A 4QUSA 4F0YA 3DDDA 4CGOA 2VQYA 4A30A 4KVME 4Y49B 2G0BA 1Z4RA 3I3GA 4MY0A 4KS9A 3PZJA 4IUSA 4E0AA 3D2PA 1IYKA 1MJAA 2Z3PA 4QBJA 4KORA 2H5MA 2QIRA 1V0CA 2WUUA 2QMLA 4JD6A 4PSXA 1LRZA 2R8VA 5G21A 4GS4A 3TOAA 5IV0A 3S6GA 1Y9KA 2JLMA 4B14A 1YR0A 3OWCA 2B58A 2B4DB 4AVBA 4BMHA 2PR8A 4MI4A 3GKRA 2CY2A 4CYNA 5A27A 1XEBA 2R7HA 2D4PA 4IF5A 4M3SA 1N71A 1QSOA 4OADA 4X5KA 2Q44A 2VBQA 3GY9A 2CNSA 4B13A 2EVNA 1KUXA 1NMTA 4A32A 4KUAA 2GANA 4MFLA 3TO9A 1P4NA 3V8IA 4XPDB 3EY5A 2YGWA 2FXFA 4AVAA 1S60A 2I00A 2A4NA 2OZUA 4MFJA 3KKWA 4HNXB 2Z10A 4AB7A 3P2HA 2JDCA 3H5ZA 4QB9A 4JXRA 4XNHC 2FL4A 3TT2A 2OZGA 4R3LA 2C27A 4CGPA 4B5PA 4DNCA 1IB1E 1I1DA 3JUWA 3JTKA 2JDDA 4J3GA 4OLLA 4LX9A 4KOXA 5F49A 4KOVA 1IIDA 4AG9A 4AVCA 4MFQA 2VEZA 1GHEA 3TFYA 1M4IA 2ZW4A 1SQHA 1K4JA 5A28A 2GIVA 4RI1A 2B5GA 4R87A 1J4JA 3EFAA 1QSTA 2J8RA 4HNYB 3FB3A 1Q2CA 1QSMA 1YVKA 4R9MA 1S5KA 3R9FA 4UWIA 4CGNA 2NMTA 1S3ZA 1MJBA 2Q4VA 1M4GA 2FS5A 4H6UA 3VWEA 4UFWA 5KTAA 1IYLA 3FBUA 2CNMA 4B10A 3TE4A 1MK4A 4KOWA 4U9YA 1B87A 4CYQA 2X7BA 3BJ7A 4YFJA 2OB0A 2R1IA 1M1DA 3A9LA 5AG6A 2Z3MA 3B8GA 3R1KA 4PK2A 1S7LA 3R96A 3FIXA 4F6AA 4KSAA 1L0CA 5C88A 3TOBA 5J8FA 3H4QA 4XPDC 2J8NA 2ZXVA 5G1ZA 4JJXA 5HMNA 4K30A 3K9UA 1VHSA 2BL1A 2P6EA 2DPSA 4XNHB 2I79A 3TO7A 4CGLA 1FY7A 5KTDA 4XPKA 1NSLA 4R57A 4MBUA 2WPXA 2DPTA 4A33A 5BWAB 4KZTA 5DWNA 1CJWA 1QSNA 4JWPA 1IICA 4M85A 2VZZA 4CS0B 4KOUA 1TIQA 2REFA 4II9A 2R98A 2Q7BA 2P6GA 3EXNA 1I12A 2B3UA 1Z9UA 5C82A 1WWZA 2FCKA 3F0AA 4CRZB 4FD5A 2BEIA 2PQ8A 3CXQA 4I49A 5IB0A 1Y7RA 3SHPA 3IU2A 4FD4A 3TO6A 3IWGA 5JQ4A 4B5PB 3WR7A 1R57A 4NEXA 1M44A 4CGMA 4C7HA 2VZYA 4E2AA 2OH1A 2OZHA 4CYOA 2HV2A 2PR1A 1WK4A 3LD2A 2YNCC 2F5IA 4KVXA 2WPWA 2Z11A 5FVJA 3SXNA 5F47A 1S7KA 2Q4YA 4FD6A 3T9YA 3G8WA 1YLEA 2Z3OA 4F0XA 4LUAA 2ARHA 2K5TA 3F8KA 4PSWA 4JXQA 4U9ZA 2REEA 5AG5A 2Q0YA 4KOTA 4MJ8A 3EO4A 3DR8A 2FE7A 4MFZA 4OAEA 1NE9A 2B3VA 2JEVA 3C26A 4PK3A 3D8PA 2BSWA 3BLNA 3DSBA 3IGRA 1UFHA 2YNDA 3P2FA 4YRHA 2OU2A 4UCMA 5AGEA 1CM0A 1KUYA 5CNPA 1VKCA 2P6FA 4QC6A 5F48A 1U6MA 4MFKA 4KVOE 2FIAA 1S7NA 2PC1A 2Z0ZA 4ONUA 1S7FA 3EC4A 1Y9WA 4C2ZA 4C68A 4MHDA 5IX3A 4FD7A 1YK3A 5E96A 3DR6A 4HNWB 4CAEA 3FRMA 1ZO0A 4A95A 4KLVA 1XMTA 5G22A 2Z3KA 2ZPAA 5F46A 4HKFA 3GYAA 4NXYA 3T90A 1RXTA 3PGPA 1BOBA 4RS2A 2WSAA 2DXQA 3I9SA 1MJ9A 4ZGYB 4PV6A 2FIWA 5G20A 5KTCA 4CRYB 2ATRA 1XIXA 4CYPA 2G3TA 2FT0A 3TTHA 2YNEA 4YGOA 2O28A 1QSRA 1OZPA 5H86A 2G3AA 4UCPA 3DNSA 4KOYA 1KZFA 4Q36A 1RO5A 1P0HA 1M4DA 4L8AA 3QAHA 1XF8A 3ZZIA 2B4BA 2PRBA 2PSWA 4CAFA 3ZJ0A 1YX0A 2EUIA 4R3KA 2GE3A 2VXKA 2ZW6A 3VWDA 5JPHA 1PU9A 3G3SA 1YREA 5ISVA 2CXAA 4B5OA 3D2MA 5GCNA 3W6XA 4CAWA 2AE6A 3W91A 4A2ZA 3SXOA 4UWJA 3S6KA 4BBHA 1Q2DA 3MGDA 4UFXA 2CNTA 2Q04A 2D4OA 3R95A 3W6SA 1ON0A 2ZW5A 1KUVA 2BUEA 4C7IA 3FNCA 3PP9A 2B4DA 3JVNA 4Y49C 2AJ6A 1Z4EA 4XPLA 2RC4A 1BO4A 4KLWA 2VI7A 4UFVA 2J8MA 1XE4A 4QVTA 4ORFA 2HQYA 5J8CA 4NF1A 5H84A 1Q2YA 2QECA 3IWEA 4U5YA 1PUAA 3E0KA 2FSRA 4MY3A 3N7ZA 4H6ZA 4C2XA 1I21A 4JLYA 4EVYA 4NCZA 3R9GA 3BJ8A 2PDOA 4KSFA 5I0CA 4UCNA 5EC4A 4E8OA 4KOSA 1YGHA 3NE7A 2KCWA 3CXSA 1YVOA 4UBRA 2Z3LA 3LODA 2YNCA 3CXPA 3TCVA 3R9EA 4UA3A 2Y0MA 3S6FA 4NSQA 4H89A 5EBVA 4ZBGA 3UY5A 3D3SA 2HUZA 2IL4A 4B11A 4B12A 4KUBA 4L89A 5AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BWA B;  4ZGY B;  1ZO0 A; 
#chains in the Genus database with same CATH topology
 4A31 A;  3FXT A;  1ELM P;  1X12 A;  3RYO A;  4CAV A;  4CAX A;  2EK9 A;  5AG4 A;  4C2Y A;  4AG7 A;  4X3R A;  4Q38 A;  3K2K A;  5LYL A;  2RFH A;  1IY7 A;  3IU1 A;  2B5G B;  2EWB A;  4P10 A;  2Z3N A;  4MFP A;  4PQA A;  5THW A;  2ABZ A;  2Q51 A;  3FYN A;  4K3N A;  3F5B A;  5DWM A;  3S6H A;  2ZW7 A;  2DF5 A;  1IU8 A;  2P0W A;  5LRJ A;  1B6B A;  5HH1 A;  2ZEM A;  2V8H A;  3QB8 A;  2PJA A;  2ZEO A;  4QUS A;  4F0Y A;  3DDD A;  4CGO A;  4PXD A;  2VQY A;  4R76 A;  1AUG A;  1YSJ A;  4A30 A;  3B35 A;  4KVM E;  4Y49 B;  2G0B A;  1Z4R A;  2ZEG A;  3I3G A;  1CP6 A;  4MY0 A;  4F9V A;  4KS9 A;  3PZJ A;  4IUS A;  1ELL P;  1F57 A;  4E0A A;  3D2P A;  1IYK A;  1MJA A;  2Z3P A;  5LRK A;  4OIW A;  4QBJ A;  4KOR A;  2H5M A;  4YWY A;  2QIR A;  1V0C A;  2WUU A;  3D67 A;  4OC2 A;  2QML A;  1ZG9 A;  4O23 A;  3KR5 A;  4JD6 A;  1ZG7 A;  4PSX A;  3PB7 X;  1LRZ A;  3WC7 A;  2R8V A;  5G21 A;  4GS4 A;  3TOA A;  1CBX A;  3FF3 A;  5IV0 A;  3QNV A;  5LRG A;  4UEF A;  3S6G A;  2Q7S A;  1Y9K A;  4BIN A;  2JLM A;  4B14 A;  1XOV A;  1H8L A;  1YR0 A;  3OWC A;  2B58 A;  2B4D B;  4AVB A;  4BMH A;  2PR8 A;  4MI4 A;  3GKR A;  2CY2 A;  4JYW A;  4CYN A;  5A27 A;  3S9N A;  1XEB A;  2R7H A;  8CPA A;  3BI0 A;  2D4P A;  4IF5 A;  4M3S A;  3FEC A;  4NGN A;  1N71 A;  1Z8W A;  1QSO A;  4OAD A;  4X5K A;  2Q44 A;  2VBQ A;  3GY9 A;  4F9U A;  2CNS A;  4UIB A;  4B13 A;  2EVN A;  1KUX A;  1NMT A;  4A32 A;  2PJC A;  4KUA A;  1LAM A;  2GAN A;  3KHX A;  2POK A;  2C1C A;  4B6Z A;  3D4U A;  4MFL A;  3TO9 A;  3SI0 A;  2F7V A;  1XJO A;  4MHZ A;  3D66 A;  1P4N A;  4RN7 A;  3V8I A;  4XPD B;  3EY5 A;  1FNO A;  2YGW A;  2FXF A;  3D68 A;  4AVA A;  5HXD A;  1S60 A;  2I00 A;  2A4N A;  3GUX A;  2JBK A;  3PB4 X;  1DE4 C;  2OZU A;  4MFJ A;  1EE3 P;  4G1P A;  1LFW A;  3KKW A;  2GRE A;  2Z10 A;  4HNX B;  4AB7 A;  2XEF A;  3P2H A;  2ZOF A;  2JDC A;  2EK8 A;  4NJQ A;  4NGM A;  3H5Z A;  2PCU A;  1UWY A;  4QB9 A;  5CPA A;  4JXR A;  1IOI A;  4XNH C;  2FL4 A;  3TT2 A;  2ZOG A;  5I4M A;  3SJX A;  3GLJ A;  2OZG A;  4MRI A;  4R3L A;  5HVF A;  2C27 A;  4CGP A;  4B5P A;  3H8F A;  1IB1 E;  1BPM A;  4DNC A;  1I1D A;  4CPA A;  3JUW A;  3LAC A;  3JTK A;  2JDD A;  1YQE A;  4J3G A;  4OLL A;  4LX9 A;  2AFZ A;  2GFQ A;  4KOX A;  2QYV A;  4KOV A;  1IID A;  5F49 A;  4AG9 A;  4AVC A;  2PJ0 A;  2XEJ A;  4MFQ A;  4OC3 A;  2VEZ A;  1GHE A;  5IB9 A;  1Z2L A;  2PRQ A;  1M4I A;  3TFY A;  2HC9 A;  1SQH A;  1K4J A;  2ZW4 A;  5A28 A;  2GIV A;  4P4D A;  3IWW A;  4RI1 A;  2B5G A;  3FJU A;  4R87 A;  1J4J A;  3EFA A;  1QST A;  2WYR A;  1HEE A;  2J8R A;  3V7Z A;  1CP7 A;  4HNY B;  5JGF A;  3FB3 A;  1Q2C A;  2ZEL A;  1QSM A;  2V8G A;  1YVK A;  4R9M A;  1S5K A;  3R9F A;  4UWI A;  4F8Z A;  4CGN A;  2NMT A;  1S3Z A;  1MJB A;  2Q4V A;  4OP4 A;  1M4G A;  2FS5 A;  2PVV A;  4H6U A;  4EWT A;  3D7D A;  4FUU A;  3VWE A;  1IGB A;  4UFW A;  4DJL A;  5KTA A;  1TF8 A;  3SI1 A;  1IYL A;  4FBE A;  4DUK A;  3FBU A;  2CNM A;  3RBU A;  1YW4 A;  4B10 A;  3KGQ A;  4IAV A;  1YLO A;  5DS0 A;  1Z8T A;  1MK4 A;  2EBJ A;  4KOW A;  3TE4 A;  4U9Y A;  1B87 A;  3HUV A;  4CYQ A;  5K8N A;  2X7B A;  3BJ7 A;  2C6P A;  3WAB A;  4YFJ A;  2GLJ A;  2OB0 A;  2R1I A;  1M1D A;  4ZY1 A;  2ZEN A;  3A9L A;  5AG6 A;  2Z3M A;  3B8G A;  3R1K A;  4PK2 A;  1S7L A;  3R96 A;  3FIX A;  4M6G A;  3V38 A;  4F6A A;  4KSA A;  3HLP A;  3ISZ A;  1Z8L A;  3IIB A;  4W9Y A;  1L0C A;  5C88 A;  3TOB A;  3NFZ A;  5J8F A;  3H4Q A;  4XPD C;  2J8N A;  1Z8X A;  2ZXV A;  5G1Z A;  4JJX A;  5HMN A;  2PE3 A;  5HVG A;  4YU9 A;  4K30 A;  4PXC A;  3K9U A;  1YW6 A;  1Q7L A;  1VHS A;  2BL1 A;  1ZLI A;  2P6E A;  4EME A;  2DPS A;  1XFO A;  3KHZ A;  4Z65 A;  4XNH B;  3KI9 A;  2I79 A;  3ISX A;  4R8F A;  1YME A;  3TO7 A;  4CGL A;  3S9L A;  1FY7 A;  5KTD A;  2ZED A;  1TKF A;  4LQG A;  4XPK A;  1NSL A;  4IHM A;  1IOF A;  4R57 A;  4MBU A;  2C6C A;  2XEG A;  2WPX A;  2DPT A;  4A33 A;  5BWA B;  4KZT A;  1XMB A;  3GB0 A;  4LQ6 A;  5DWN A;  1CJW A;  1QSN A;  2CTC A;  4JWP A;  2CIJ A;  2PJ2 A;  1IIC A;  2QJ8 A;  3LMS A;  4M85 A;  1NSA A;  2VZZ A;  4CS0 B;  4KOU A;  3PBE A;  4DYO A;  5IX3 A;  3KAS A;  1TIQ A;  2REF A;  1F2P A;  4II9 A;  1LCP A;  2R98 A;  4ZY0 A;  4MHY A;  2Q7B A;  2JBJ A;  2P6G A;  3CZX A;  3EXN A;  1I12 A;  2IMO A;  3KQX A;  3L2N A;  4M6I A;  2B3U A;  1Z9U A;  5C82 A;  1WWZ A;  2FCK A;  3F0A A;  4CRZ B;  2ODF A;  2BEI A;  2PQ8 A;  4FD5 A;  3CXQ A;  3KL9 A;  4I49 A;  5IB0 A;  1Y7R A;  3KR4 A;  3SHP A;  3IU2 A;  4FD4 A;  4ZX9 A;  3TO6 A;  3DLJ A;  3IWG A;  3B3S A;  4OC0 A;  5JQ4 A;  4B5P B;  5JH9 A;  1HDQ A;  2PJ7 A;  3WR7 A;  1TKJ A;  1R57 A;  5LYF A;  2HB6 A;  1M44 A;  4NEX A;  4CGM A;  4C7H A;  4P4F A;  3PB8 X;  4UF4 A;  2VZY A;  4GXH A;  4BD9 A;  1OBR A;  3KQZ A;  5EMI A;  2OH1 A;  4E2A A;  2OZH A;  4CYO A;  2HV2 A;  4NGQ A;  2PR1 A;  3I1U A;  1WK4 A;  3LD2 A;  1CPS A;  2YNC C;  1CG2 A;  2F5I A;  3DGV A;  5ELY A;  2I3C A;  2PIZ A;  4KVX A;  4TNU A;  2PJ1 A;  3PBB A;  4OID A;  1A2Z A;  3WC5 A;  2WPW A;  2Z11 A;  4PPZ A;  2VL1 A;  5FVJ A;  3PB6 X;  3SXN A;  3B3W A;  1QMU A;  1LOK A;  3B3C A;  5JM6 A;  5F47 A;  3T8W A;  1S7K A;  2Q4Y A;  1F2O A;  3SJF A;  1Y0R A;  4A38 A;  3LWU A;  4FD6 A;  3IEH A;  3T9Y A;  1AYE A;  3G8W A;  4X8I A;  1KWM A;  1YLE A;  2Z3O A;  3SJG A;  4NGP A;  2O53 A;  4F0X A;  4LUA A;  2ARH A;  2K5T A;  3PB9 X;  3F8K A;  4PSW A;  4JXQ A;  4U9Z A;  2REE A;  5AG5 A;  1BPN A;  3TX8 A;  3RAM A;  2O4H A;  2Q0Y A;  4KOT A;  1TXR A;  4MJ8 A;  1PCA A;  3B2Y A;  1CX8 A;  2FE7 A;  3DR8 A;  3EO4 A;  4MFZ A;  3IFE A;  1NE9 A;  2B3V A;  2JEV A;  3C26 A;  4OAE A;  4PK3 A;  4UEZ A;  5D8N A;  3D8P A;  4OC4 A;  2BSW A;  2G9D A;  3BLN A;  3DSB A;  4R6T A;  5LYD A;  1VHE A;  3IGR A;  4IK2 A;  1UFH A;  2YND A;  4MHP A;  4RUH A;  3P2F A;  4YRH A;  2OU2 A;  2ZEE A;  4UCM A;  5AGE A;  1CM0 A;  3NA6 A;  1KUY A;  3PRT A;  5CNP A;  3SJE A;  1VKC A;  2P6F A;  2OOT A;  3TC8 A;  4NGT A;  4QC6 A;  5F48 A;  1U6M A;  4ONW A;  4MFK A;  4KVO E;  1FT7 A;  1S7N A;  2AFU A;  2FIA A;  2PC1 A;  2Z0Z A;  4ONU A;  1S7F A;  3EC4 A;  1Y9W A;  2NSM A;  3NH8 A;  2PJ4 A;  4C2Z A;  3CT9 A;  7CPA A;  4C68 A;  2BO9 A;  3FED A;  2BOA A;  4MHD A;  4UIA A;  2XEI A;  4P4B A;  4TWE A;  3CDX A;  3PEI A;  4ZI6 A;  5F09 A;  4FD7 A;  1YK3 A;  2PVW A;  5K8P A;  5E96 A;  3DR6 A;  4HNW B;  1AMP A;  4GM5 A;  1VIX A;  4EFD A;  4CAE A;  3FRM A;  1ZO0 A;  1Y7E A;  4A95 A;  4KLV A;  1HDU A;  3PFE A;  1XMT A;  5G22 A;  2Z3K A;  2ZPA A;  4P4I A;  4X2T A;  4ZX8 A;  5F46 A;  4HKF A;  3BXM A;  2PJ5 A;  2PJ3 A;  3GYA A;  3D7G A;  4NXY A;  3T90 A;  4AXV A;  1RXT A;  3PGP A;  5HVH A;  3NE8 A;  1BOB A;  4RS2 A;  3QAY A;  2WSA A;  2DXQ A;  3I9S A;  1MJ9 A;  1TF9 A;  4M6H A;  4ZGY B;  3D7F A;  4OC1 A;  4PV6 A;  1VHO A;  2FIW A;  5G20 A;  2C6G A;  2V8D A;  5KTC A;  1ZLH A;  4PXB A;  4CRY B;  3RO0 A;  1GYT A;  3FX6 A;  2AFX A;  2PJ6 A;  1XIX A;  2ATR A;  4CYP A;  2G3T A;  2FT0 A;  5D29 A;  3TTH A;  2YNE A;  4YGO A;  1CPX A;  3RNZ A;  2AFM A;  2O28 A;  1QSR A;  1OZP A;  4ZYQ A;  1ARM A;  3H8G A;  1Z5R A;  2G3A A;  4OC5 A;  5H86 A;  4UCP A;  3DNS A;  4KOY A;  1KZF A;  1R43 A;  4Q36 A;  1RO5 A;  1P0H A;  2EO8 A;  2J9A A;  1M4D A;  2V8V A;  4NGR A;  3QAH A;  4L8A A;  1XF8 A;  4MCQ A;  3ZZI A;  2ZEP A;  2B4B A;  2PRB A;  2PSW A;  4CAF A;  1X10 A;  3ZJ0 A;  1LAP A;  3FVL A;  3VAT A;  1QQ9 A;  3B3T A;  2JEW A;  2IQ6 A;  3RZA A;  1YX0 A;  2EUI A;  4R3K A;  4PXE A;  2GE3 A;  2PJ8 A;  4HPS A;  4NFR A;  2VXK A;  3H8E A;  3WC6 A;  2PJ9 A;  2Q4Z A;  2ZW6 A;  3VWD A;  4FAI A;  4UEE A;  2DEA A;  3BI1 A;  5JPH A;  3VAR A;  3BHX A;  1PU9 A;  2PJB A;  1YRE A;  3G3S A;  5ISV A;  1R3N A;  2BCO A;  2ANP A;  2CXA A;  5LYI A;  4B5O A;  3D2M A;  4L89 A;  5GCN A;  3W6X A;  4CAW A;  4A37 A;  2AE6 A;  3W91 A;  3FEE A;  3MN8 A;  4A2Z A;  3VH9 A;  1ARL A;  3SXO A;  4P45 A;  4UWJ A;  3S6K A;  4A94 A;  4BBH A;  1Q2D A;  2GLF A;  3MGD A;  4UFX A;  1RTQ A;  2CNT A;  2OR4 A;  2D4O A;  1BAV A;  2Q04 A;  3R95 A;  3W6S A;  1VGY A;  1ON0 A;  3WT4 A;  2ZW5 A;  1KUV A;  3B3V A;  2BUE A;  4WWV A;  4C7I A;  3FNC A;  2Q43 A;  6CPA A;  2IJZ A;  2NYQ A;  4MCR A;  5J1Q A;  3IC1 A;  3PP9 A;  4FWU A;  2B4D A;  4NGS A;  3JVN A;  4P6Y A;  3CPX A;  2CF4 A;  4Y49 C;  2AJ6 A;  1Z4E A;  4MHN A;  3FMC A;  4XPL A;  4WJB A;  3K9T A;  3B7I A;  2RC4 A;  1BLL E;  1BO4 A;  2F8H A;  4KLW A;  2VI7 A;  4UFV A;  5K8O A;  1TKH A;  2J8M A;  3D7H A;  1XE4 A;  2ZEF A;  3FH4 A;  4MCP A;  4ORF A;  4OME A;  4QVT A;  3S9M A;  2HQY A;  3NH5 A;  2GU2 A;  5CBM A;  4R7M A;  3CPA A;  1JWQ A;  1JQG A;  2FVG A;  1Y0Y A;  5J8C A;  4NF1 A;  3JRU A;  5H84 A;  1Q2Y A;  2QEC A;  1LAN A;  3IWE A;  4U5Y A;  1PUA A;  3E0K A;  4MCS A;  2AFS A;  2FSR A;  4MY3 A;  3N7Z A;  5K8M A;  1XBU A;  4H6Z A;  4P4J A;  4C2X A;  3KZW A;  1DTD A;  1I21 A;  3N5F A;  4JLY A;  4EVY A;  4P4E A;  3IJ3 A;  1M4L A;  4P44 A;  4NCZ A;  3R9G A;  3BJ8 A;  2PDO A;  3GIU A;  4KSF A;  5I0C A;  4KSI A;  4UCN A;  4JZ0 A;  5EC4 A;  1ZG8 A;  3MRU A;  2WZN A;  3PFO A;  4KOS A;  1YGH A;  4Q7A A;  4E8O A;  2V77 A;  3NE7 A;  2KCW A;  4NJR A;  2ZEH A;  3CXS A;  1YVO A;  3IO1 A;  4UBR A;  2Z3L A;  3LOD A;  2YNC A;  4MXU A;  3CXP A;  3TCV A;  3R9E A;  4UA3 A;  2Y0M A;  2AFO A;  3S6F A;  1XRY A;  4MMO A;  1PYT B;  4NSQ A;  2QVP A;  3SI2 A;  4H2K A;  4H89 A;  4A39 A;  5EBV A;  4ZBG A;  3UY5 A;  4OKO A;  4ZY2 A;  3D3S A;  2RB7 A;  2HUZ A;  2IL4 A;  4B11 A;  2PIY A;  4B12 A;  4KUB A;  3NH4 A;  2AFW A;  2CTB A;  5AG7 A; 
#chains in the Genus database with same CATH homology
 4A31 A;  3FXT A;  4CAV A;  3RYO A;  5AG4 A;  4CAX A;  4C2Y A;  4AG7 A;  4Q38 A;  3IU1 A;  2B5G B;  2Z3N A;  4MFP A;  3FYN A;  3F5B A;  5DWM A;  3S6H A;  2ZW7 A;  2P0W A;  1B6B A;  5HH1 A;  3QB8 A;  4QUS A;  4F0Y A;  3DDD A;  4CGO A;  2VQY A;  4A30 A;  4KVM E;  4Y49 B;  2G0B A;  1Z4R A;  3I3G A;  4MY0 A;  4KS9 A;  3PZJ A;  4IUS A;  4E0A A;  3D2P A;  1IYK A;  1MJA A;  2Z3P A;  4QBJ A;  4KOR A;  2H5M A;  2QIR A;  1V0C A;  2WUU A;  2QML A;  4JD6 A;  4PSX A;  1LRZ A;  2R8V A;  5G21 A;  4GS4 A;  3TOA A;  5IV0 A;  3S6G A;  1Y9K A;  2JLM A;  4B14 A;  1YR0 A;  3OWC A;  2B58 A;  2B4D B;  4AVB A;  4BMH A;  2PR8 A;  4MI4 A;  3GKR A;  2CY2 A;  4CYN A;  5A27 A;  1XEB A;  2R7H A;  2D4P A;  4IF5 A;  4M3S A;  1N71 A;  1QSO A;  4OAD A;  4X5K A;  2Q44 A;  2VBQ A;  3GY9 A;  2CNS A;  4B13 A;  2EVN A;  1KUX A;  1NMT A;  4A32 A;  4KUA A;  2GAN A;  4MFL A;  3TO9 A;  1P4N A;  3V8I A;  4XPD B;  3EY5 A;  2YGW A;  2FXF A;  4AVA A;  1S60 A;  2I00 A;  2A4N A;  2OZU A;  4MFJ A;  3KKW A;  4HNX B;  2Z10 A;  4AB7 A;  3P2H A;  2JDC A;  3H5Z A;  4QB9 A;  4JXR A;  4XNH C;  2FL4 A;  3TT2 A;  2OZG A;  4R3L A;  2C27 A;  4CGP A;  4B5P A;  4DNC A;  1IB1 E;  1I1D A;  3JUW A;  3JTK A;  2JDD A;  4J3G A;  4OLL A;  4LX9 A;  4KOX A;  5F49 A;  4KOV A;  1IID A;  4AG9 A;  4AVC A;  4MFQ A;  2VEZ A;  1GHE A;  3TFY A;  1M4I A;  2ZW4 A;  1SQH A;  1K4J A;  5A28 A;  2GIV A;  4RI1 A;  2B5G A;  4R87 A;  1J4J A;  3EFA A;  1QST A;  2J8R A;  4HNY B;  3FB3 A;  1Q2C A;  1QSM A;  1YVK A;  4R9M A;  1S5K A;  3R9F A;  4UWI A;  4CGN A;  2NMT A;  1S3Z A;  1MJB A;  2Q4V A;  1M4G A;  2FS5 A;  4H6U A;  3VWE A;  4UFW A;  5KTA A;  1IYL A;  3FBU A;  2CNM A;  4B10 A;  3TE4 A;  1MK4 A;  4KOW A;  4U9Y A;  1B87 A;  4CYQ A;  2X7B A;  3BJ7 A;  4YFJ A;  2OB0 A;  2R1I A;  1M1D A;  3A9L A;  5AG6 A;  2Z3M A;  3B8G A;  3R1K A;  4PK2 A;  1S7L A;  3R96 A;  3FIX A;  4F6A A;  4KSA A;  1L0C A;  5C88 A;  3TOB A;  5J8F A;  3H4Q A;  4XPD C;  2J8N A;  2ZXV A;  5G1Z A;  4JJX A;  5HMN A;  4K30 A;  3K9U A;  1VHS A;  2BL1 A;  2P6E A;  2DPS A;  4XNH B;  2I79 A;  3TO7 A;  4CGL A;  1FY7 A;  5KTD A;  4XPK A;  1NSL A;  4R57 A;  4MBU A;  2WPX A;  2DPT A;  4A33 A;  5BWA B;  4KZT A;  5DWN A;  1CJW A;  1QSN A;  4JWP A;  1IIC A;  4M85 A;  2VZZ A;  4CS0 B;  4KOU A;  1TIQ A;  2REF A;  4II9 A;  2R98 A;  2Q7B A;  2P6G A;  3EXN A;  1I12 A;  2B3U A;  1Z9U A;  5C82 A;  1WWZ A;  2FCK A;  3F0A A;  4CRZ B;  4FD5 A;  2BEI A;  2PQ8 A;  3CXQ A;  4I49 A;  5IB0 A;  1Y7R A;  3SHP A;  3IU2 A;  4FD4 A;  3TO6 A;  3IWG A;  5JQ4 A;  4B5P B;  3WR7 A;  1R57 A;  4NEX A;  1M44 A;  4CGM A;  4C7H A;  2VZY A;  4E2A A;  2OH1 A;  2OZH A;  4CYO A;  2HV2 A;  2PR1 A;  1WK4 A;  3LD2 A;  2YNC C;  2F5I A;  4KVX A;  2WPW A;  2Z11 A;  5FVJ A;  3SXN A;  5F47 A;  1S7K A;  2Q4Y A;  4FD6 A;  3T9Y A;  3G8W A;  1YLE A;  2Z3O A;  4F0X A;  4LUA A;  2ARH A;  2K5T A;  3F8K A;  4PSW A;  4JXQ A;  4U9Z A;  2REE A;  5AG5 A;  2Q0Y A;  4KOT A;  4MJ8 A;  3EO4 A;  3DR8 A;  2FE7 A;  4MFZ A;  4OAE A;  1NE9 A;  2B3V A;  2JEV A;  3C26 A;  4PK3 A;  3D8P A;  2BSW A;  3BLN A;  3DSB A;  3IGR A;  1UFH A;  2YND A;  3P2F A;  4YRH A;  2OU2 A;  4UCM A;  5AGE A;  1CM0 A;  1KUY A;  5CNP A;  1VKC A;  2P6F A;  4QC6 A;  5F48 A;  1U6M A;  4MFK A;  4KVO E;  2FIA A;  1S7N A;  2PC1 A;  2Z0Z A;  4ONU A;  1S7F A;  3EC4 A;  1Y9W A;  4C2Z A;  4C68 A;  4MHD A;  5IX3 A;  4FD7 A;  1YK3 A;  5E96 A;  3DR6 A;  4HNW B;  4CAE A;  3FRM A;  1ZO0 A;  4A95 A;  4KLV A;  1XMT A;  5G22 A;  2Z3K A;  2ZPA A;  5F46 A;  4HKF A;  3GYA A;  4NXY A;  3T90 A;  1RXT A;  3PGP A;  1BOB A;  4RS2 A;  2WSA A;  2DXQ A;  3I9S A;  1MJ9 A;  4ZGY B;  4PV6 A;  2FIW A;  5G20 A;  5KTC A;  4CRY B;  2ATR A;  1XIX A;  4CYP A;  2G3T A;  2FT0 A;  3TTH A;  2YNE A;  4YGO A;  2O28 A;  1QSR A;  1OZP A;  5H86 A;  2G3A A;  4UCP A;  3DNS A;  4KOY A;  1KZF A;  4Q36 A;  1RO5 A;  1P0H A;  1M4D A;  4L8A A;  3QAH A;  1XF8 A;  3ZZI A;  2B4B A;  2PRB A;  2PSW A;  4CAF A;  3ZJ0 A;  1YX0 A;  2EUI A;  4R3K A;  2GE3 A;  2VXK A;  2ZW6 A;  3VWD A;  5JPH A;  1PU9 A;  3G3S A;  1YRE A;  5ISV A;  2CXA A;  4B5O A;  3D2M A;  5GCN A;  3W6X A;  4CAW A;  2AE6 A;  3W91 A;  4A2Z A;  3SXO A;  4UWJ A;  3S6K A;  4BBH A;  1Q2D A;  3MGD A;  4UFX A;  2CNT A;  2Q04 A;  2D4O A;  3R95 A;  3W6S A;  1ON0 A;  2ZW5 A;  1KUV A;  2BUE A;  4C7I A;  3FNC A;  3PP9 A;  2B4D A;  3JVN A;  4Y49 C;  2AJ6 A;  1Z4E A;  4XPL A;  2RC4 A;  1BO4 A;  4KLW A;  2VI7 A;  4UFV A;  2J8M A;  1XE4 A;  4QVT A;  4ORF A;  2HQY A;  5J8C A;  4NF1 A;  5H84 A;  1Q2Y A;  2QEC A;  3IWE A;  4U5Y A;  1PUA A;  3E0K A;  2FSR A;  4MY3 A;  3N7Z A;  4H6Z A;  4C2X A;  1I21 A;  4JLY A;  4EVY A;  4NCZ A;  3R9G A;  3BJ8 A;  2PDO A;  4KSF A;  5I0C A;  4UCN A;  5EC4 A;  4E8O A;  4KOS A;  1YGH A;  3NE7 A;  2KCW A;  3CXS A;  1YVO A;  4UBR A;  2Z3L A;  3LOD A;  2YNC A;  3CXP A;  3TCV A;  3R9E A;  4UA3 A;  2Y0M A;  3S6F A;  4NSQ A;  4H89 A;  5EBV A;  4ZBG A;  3UY5 A;  3D3S A;  2HUZ A;  2IL4 A;  4B11 A;  4B12 A;  4KUB A;  4L89 A;  5AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...