4ZGYB

Structure of human ornithine decarboxylase in complex with a c-terminal fragment of antizyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
FYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine decarboxylase
publication title Structural basis of antizyme-mediated regulation of polyamine homeostasis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4zgyB00
4ZGYB 1ZO0A 5BWAB
chains in the Genus database with same CATH superfamily
5CBMA 4NXYA 3FIXA 3V7ZA 4ZGYB 2FVGA 1BPMA 1LFWA 1RTQA 4MFLA 2PJBA 1LCPA 4CS0B 2PVWA 4B5PB 4KORA 2OOTA 1VIXA 3RAMA 4R76A 2Q0YA 2ZW7A 3PFEA 2ZEFA 2Q44A 3GLJA 4Q36A 2D4PA 2QIRA 3C26A 2ODFA 3R1KA 4Q7AA 3R9EA 2GFQA 2VL1A 3S6KA 4MCQA 8CPAA 1CJWA 5I4MA 1LOKA 3KL9A 2ZPAA 2K5TA 3D7HA 5IV0A 4MCSA 3TC8A 4DJLA 3FF3A 3FH4A 4NGSA 3I1UA 2PJ3A 3K9TA 1QQ9A 4OIDA 4NGMA 2EVNA 4DUKA 2J8MA 2ZENA 4KOYA 2V8DA 4R6TA 3FNCA 2ZOFA 4MY0A 3WC6A 1YK3A 4P4DA 5K8NA 5JM6A 3FJUA 4OMEA 2AFSA 2ZEGA 4MI4A 2P6FA 2I3CA 2EBJA 1CX8A 1M4IA 1A2ZA 1ZG8A 4YGOA 4QC6A 4C7IA 2RC4A 1F2PA 1AUGA 1QSRA 4CPAA 3S9NA 2GLFA 2EO8A 4CGOA 5HVGA 3RNZA 5K8OA 1Y9KA 5JGFA 2PJ0A 2REEA 2WZNA 5LRKA 1ZLHA 2WYRA 4RS2A 2EK8A 3CPAA 3GY9A 2POKA 5F09A 3S9MA 4KSAA 5LYLA 1J4JA 3MGDA 3IEHA 5LYDA 1M4GA 1VHSA 1S5KA 3B7IA 2P0WA 2PC1A 3DGVA 2OR4A 2ZW6A 3T9YA 2OZHA 4R57A 2A4NA 1IB1E 1GHEA 1XMBA 2B3UA 4NCZA 2R8VA 4NGPA 4KS9A 1IU8A 4P6YA 4ZBGA 3VARA 3N5FA 1VHEA 2PJ9A 1BOBA 4YU9A 2ZEMA 1PCAA 3CT9A 4II9A 3FRMA 4NFRA 4NGTA 4UCNA 3PP9A 4BMHA 2ZEDA 2Z3NA 4A31A 4G1PA 1Q2YA 1YGHA 5HH1A 2JDDA 4JYWA 3T8WA 4RN7A 2YGWA 3CPXA 3TOBA 3EXNA 1P4NA 4JXRA 4M6GA 5DWMA 3TCVA 3B3WA 1R57A 1ZG9A 4YFJA 3K2KA 5HXDA 1TF8A 2BL1A 2WPXA 1BAVA 5CPAA 3TO9A 4L89A 1NSLA 4CRYB 4ZI6A 4OIWA 4A33A 2FXFA 1K4JA 3FBUA 2O4HA 2XEFA 4UF4A 4CGPA 3GYAA 3JVNA 4KZTA 2PR8A 1KWMA 2ATRA 4KLVA 4MHPA 4R8FA 5EMIA 4C68A 3D3SA 3RZAA 3VATA 2Z3PA 1VGYA 1ZO0A 3TX8A 5HVHA 2PSWA 4M85A 1TF9A 1XJOA 4MMOA 4CGMA 3IJ3A 4KVXA 2VZZA 1CP7A 5KTDA 2IQ6A 3NH4A 2R98A 1KUXA 4AVBA 5J8FA 2J9AA 2JBJA 3R96A 5LRJA 1WWZA 3IWWA 5G20A 2YNDA 3P2FA 5HMNA 2VQYA 2CNTA 2D4OA 1MJBA 4H2KA 1Y7RA 1Z4EA 3LODA 1WK4A 3WABA 1BPNA 1HDUA 2OB0A 4A38A 5FVJA 4KOVA 2OH1A 1I1DA 1CM0A 5JQ4A 2RFHA 5LRGA 2YNCC 3K9UA 1MK4A 5CNPA 2DPTA 3H5ZA 4MY3A 5G21A 4MJ8A 2HC9A 3FYNA 3PEIA 4NSQA 1YVKA 4UWIA 4NJQA 2CTBA 4MFPA 3NE8A 3A9LA 3MRUA 2GLJA 3G3SA 4CYOA 4P10A 2OZGA 3FVLA 4YRHA 3CZXA 3JTKA 4XNHB 2FIWA 3PB7X 2P6EA 2XEJA 4HNWB 2GIVA 2ZW4A 1HDQA 4E8OA 5KTCA 5ISVA 4NGNA 4F9UA 4BD9A 5LYIA 2IJZA 1M4LA 3PFOA 1X12A 1QSNA 4QVTA 3BXMA 2IMOA 1Y0YA 1CPSA 4MFQA 1YLOA 1ARLA 3RYOA 4CRZB 4AVCA 1M44A 3CXQA 4O23A 4KOWA 3LACA 4MFJA 4NGQA 2JLMA 2JBKA 4ZY2A 3SI0A 1FY7A 1LAMA 3NA6A 4U9ZA 5JH9A 4JLYA 3FX6A 3BHXA 4GM5A 4BBHA 5F46A 2AFWA 3CDXA 4P45A 1F57A 4FD7A 2PJ7A 4AXVA 3L2NA 1Q7LA 4QB9A 4HKFA 3IU1A 2JEWA 4HNXB 3B3VA 3F8KA 1TIQA 3WT4A 5GCNA 6CPAA 2FT0A 4R3KA 2AFOA 2B4DB 3WC5A 4ZYQA 2BOAA 1LANA 3JUWA 1IOFA 4K30A 4Y49C 1HEEA 1Z8WA 2DPSA 2NSMA 2ZW5A 2GREA 4NGRA 1XE4A 2PJAA 1PYTB 4NF1A 2ARHA 4B13A 4ZX9A 2PDOA 4P4JA 1S7KA 5ELYA 4A39A 4B5PA 4MXUA 2EK9A 4P4BA 2C6GA 3IGRA 2BCOA 5G1ZA 3LD2A 5H84A 3SJFA 2Z3MA 1UFHA 2CNSA 3BLNA 1FT7A 3DDDA 3D2MA 4A95A 1ELLP 3D7GA 3PBEA 3D7DA 3I3GA 4FWUA 4XPDC 3IU2A 4ZY1A 1R3NA 4OKOA 1LRZA 3V8IA 7CPAA 3DSBA 3FECA 3IWGA 4MFKA 3QB8A 3LMSA 4LQ6A 3B8GA 2JEVA 2FCKA 4I49A 1DTDA 4CGNA 1N71A 1ON0A 3KI9A 2B4DA 5F49A 2Z3KA 4CYPA 3SI1A 3D68A 3PB4X 1V0CA 2PJCA 3H8GA 2YNCA 2F8HA 5BWAB 1XRYA 2C1CA 2FS5A 4M3SA 4U5YA 4WJBA 3KQXA 1IIDA 2AFMA 2P6GA 2AFUA 3B3SA 4JWPA 5HVFA 2PJ5A 2DEAA 5C82A 2VXKA 5LYFA 3NE7A 3SXOA 5EC4A 4Y49B 1KZFA 3HUVA 4KLWA 1Z2LA 1Z9UA 4UA3A 4OAEA 1BLLE 1IGBA 2RB7A 3SJGA 2J8RA 3H8EA 4WWVA 4XNHC 4C7HA 3S6GA 4FD5A 1JQGA 4MHDA 4CAWA 1B87A 4KSFA 2Q7BA 4JD6A 4E2AA 1U6MA 4UFVA 4MFZA 2FSRA 5D29A 3QNVA 5K8MA 4E0AA 2H5MA 3DNSA 4LUAA 1GYTA 2V8HA 1FNOA 4GXHA 5AG6A 2ZELA 5JPHA 4TWEA 4OP4A 1LAPA 5H86A 4X8IA 4XPDB 2B5GB 2PVVA 3B3CA 3JRUA 2VEZA 1XFOA 2BUEA 2Z3OA 1PU9A 1QMUA 3PGPA 2HQYA 4J3GA 3MN8A 2I79A 4R9MA 2R7HA 3CXSA 3TOAA 3B3TA 5IB0A 2BSWA 3DR6A 4P4EA 2G0BA 1KUVA 4AB7A 4KUBA 1DE4C 2Q51A 3KKWA 2C27A 1ARMA 3VH9A 3FXTA 4A37A 4AG7A 3NFZA 4CAFA 5J8CA 4GS4A 4QBJA 3ZZIA 2Z11A 2O28A 4OC3A 5IB9A 3SI2A 1XEBA 4TNUA 2BO9A 3V38A 4CGLA 3EO4A 1R43A 1B6BA 2Q4ZA 4UCPA 1IY7A 3LWUA 2Z0ZA 4FD4A 4UIBA 4R3LA 4OADA 2GU2A 3D4UA 4IAVA 2FL4A 4NJRA 2V8VA 4KSIA 1S60A 4X2TA 3WC7A 4LX9A 1KUYA 4FUUA 4PPZA 1XOVA 2OU2A 2B5GA 3H4QA 3W91A 2GANA 2XEGA 4LQGA 3EFAA 4A94A 2PR1A 3HLPA 2NYQA 4DNCA 2F5IA 2ZEPA 2CF4A 3EC4A 4OC5A 3FEDA 4AG9A 4ZX8A 4MCRA 1ZLIA 4Q38A 3S9LA 5C88A 1H8LA 1L0CA 1MJAA 2XEIA 2HB6A 2WPWA 1VKCA 2QYVA 4HNYB 4JJXA 4X5KA 4CAXA 3T90A 4UWJA 4W9YA 4PXBA 3NH5A 5AG5A 4XPKA 4A30A 3B2YA 3D66A 4A32A 4KOTA 4EWTA 5THWA 2O53A 2B3VA 1Z4RA 4F0YA 2WUUA 4F9VA 1SQHA 3P2HA 3PB6X 1Y7EA 3DLJA 2CIJA 2VZYA 4AVAA 2YNEA 3KQZA 3TT2A 2EWBA 2PRQA 1UWYA 2FE7A 3BI1A 4FD6A 3F0AA 4B14A 2ZEEA 4C2YA 1YMEA 4JXQA 4R7MA 4YWYA 3G8WA 3ISXA 4X3RA 4KVOE 2ANPA 4H6UA 1IOIA 4H89A 2B58A 4K3NA 2X7BA 5IX3A 1QSMA 1TXRA 2Y0MA 2DF5A 1JWQA 4PQAA 1X10A 4ORFA 2I00A 3F5BA 4MBUA 4OC0A 1Z8LA 2PIYA 3SJXA 1XMTA 2QJ8A 1Z5RA 4Z65A 4PXCA 4B5OA 2Q7SA 3NH8A 3KR5A 5AGEA 3VWDA 1Y9WA 3SJEA 3SXNA 1NMTA 1Y0RA 4U9YA 1AYEA 2C6PA 1MJ9A 4ONWA 3SHPA 3S6HA 5J1QA 3D2PA 3BJ8A 3FB3A 4H6ZA 3R95A 3ZJ0A 2J8NA 3B35A 1QSTA 2FIAA 1NSAA 1IICA 2Q43A 4KOXA 3PB9X 1ZG7A 4UFXA 4A2ZA 1CBXA 4IF5A 3BI0A 4C2ZA 5G22A 3IFEA 4CAVA 1QSOA 2HV2A 4MRIA 1RO5A 2CTCA 4B12A 2PJ1A 5DWNA 4B10A 3H8FA 2PE3A 3CXPA 3R9FA 2PQ8A 2G3AA 4XPLA 4FAIA 2CY2A 1TKFA 4F6AA 2ABZA 4KUAA 3ISZA 4MHZA 1OZPA 2JDCA 5F48A 3RO0A 3TO6A 5A27A 2ZXVA 2Q04A 2QVPA 4EVYA 5AG4A 2PJ4A 1XF8A 3GB0A 4IK2A 1CPXA 3DR8A 4OLLA 1IYKA 4CYNA 3IIBA 4OC1A 2AFZA 1I12A 2PIZA 4DYOA 3IC1A 2Q4YA 4B6ZA 3IWEA 1Z8TA 3I9SA 3QAYA 4MCPA 3KHZA 1ELMP 4BINA 4RUHA 2Z3LA 4P44A 4OC4A 1YVOA 1NE9A 1YLEA 3KASA 1F2OA 3D7FA 4CAEA 4JZ0A 5E96A 5AG7A 1YQEA 4M6HA 4KOSA 1BO4A 3WR7A 4CYQA 1PUAA 4PK3A 3KHXA 3PB8X 2VBQA 2REFA 3W6XA 3TFYA 3GIUA 3KGQA 1M4DA 4QUSA 3TE4A 3N7ZA 1CG2A 2PRBA 4UIAA 4L8AA 3GKRA 4PV6A 4KVME 3TTHA 1OBRA 3D8PA 2PCUA 3VWEA 2R1IA 2C6CA 2V8GA 5I0CA 1CP6A 3D67A 3KR4A 4R87A 1AMPA 5KTAA 2B4BA 5F47A 2G3TA 1RXTA 2ZEOA 1YW4A 3PZJA 3QAHA 4PXDA 4UBRA 4PXEA 4F8ZA 1Q2CA 2V77A 3UY5A 2DXQA 3IO1A 2VI7A 2GE3A 3OWCA 3E0KA 4IUSA 2KCWA 3PRTA 4F0XA 4MHYA 5K8PA 4PK2A 4P4FA 1YX0A 3TO7A 4PSXA 1XBUA 2PJ8A 4UEEA 5A28A 3RBUA 4M6IA 4UFWA 1YR0A 4P4IA 2WSAA 3EY5A 4IHMA 2AJ6A 1Z8XA 4NEXA 4HPSA 4RI1A 2AE6A 4UEFA 2ZOGA 1S7LA 2Q4VA 2PJ2A 1Q2DA 4ZY0A 1IYLA 1TKJA 1YSJA 4C2XA 4OC2A 2OZUA 4UCMA 5DS0A 4EFDA 1S7FA 1M1DA 2PJ6A 1VHOA 1XIXA 2EUIA 5EBVA 4FBEA 1S3ZA 2G9DA 4ONUA 2QECA 3R9GA 1I21A 1TKHA 2CNMA 3KZWA 3PBBA 1S7NA 2ZEHA 3BJ7A 3GUXA 2BEIA 2CXAA 2AFXA 2HUZA 1YW6A 4UEZA 2NMTA 4B11A 2QMLA 3FMCA 4KOUA 3FEEA 3S6FA 1P0HA 5D8NA 2IL4A 2F7VA 4MHNA 1YREA 4EMEA 4PSWA 1EE3P 3W6SA 2Z10A
chains in the Genus database with same CATH topology
4NXYA 3FIXA 4ZGYB 4MFLA 4CS0B 4B5PB 4KORA 2Q0YA 2ZW7A 2Q44A 3R9EA 2D4PA 2QIRA 3C26A 3R1KA 3S6KA 1CJWA 2ZPAA 2K5TA 5IV0A 2EVNA 2J8MA 4KOYA 3FNCA 4MY0A 1YK3A 4MI4A 2P6FA 4YGOA 1M4IA 4QC6A 4C7IA 2RC4A 1QSRA 4CGOA 1Y9KA 2REEA 4RS2A 3GY9A 4KSAA 1J4JA 3MGDA 1M4GA 1VHSA 1S5KA 2P0WA 2PC1A 3T9YA 2ZW6A 2OZHA 4R57A 2A4NA 1IB1E 1GHEA 2B3UA 4NCZA 2R8VA 4KS9A 4ZBGA 1BOBA 4II9A 3FRMA 4UCNA 3PP9A 4BMHA 2Z3NA 4A31A 1Q2YA 1YGHA 5HH1A 2JDDA 2YGWA 3TOBA 3EXNA 1P4NA 4JXRA 5DWMA 3TCVA 1R57A 2BL1A 2WPXA 3TO9A 4L89A 1NSLA 4CRYB 4A33A 2FXFA 1K4JA 3FBUA 4CGPA 3GYAA 3JVNA 4KZTA 2PR8A 2ATRA 4KLVA 4C68A 3D3SA 2Z3PA 1ZO0A 2PSWA 4M85A 4CGMA 4KVXA 2VZZA 5KTDA 2R98A 1KUXA 4AVBA 5J8FA 3R96A 1WWZA 5G20A 2YNDA 3P2FA 5HMNA 2VQYA 2CNTA 2D4OA 1MJBA 1Z4EA 3LODA 1Y7RA 1WK4A 2OB0A 4KOVA 2OH1A 1I1DA 1CM0A 5JQ4A 2YNCC 3K9UA 1MK4A 5CNPA 2DPTA 3H5ZA 4MY3A 5G21A 4MJ8A 3FYNA 4NSQA 1YVKA 4UWIA 4MFPA 3A9LA 3G3SA 4CYOA 2OZGA 4YRHA 3JTKA 4XNHB 2FIWA 2P6EA 4HNWB 2GIVA 2ZW4A 4E8OA 5ISVA 5KTCA 1QSNA 4QVTA 4MFQA 3RYOA 4CRZB 1M44A 3CXQA 4KOWA 4MFJA 2JLMA 1FY7A 4U9ZA 4JLYA 4BBHA 5F46A 4FD7A 4QB9A 4HKFA 3IU1A 4HNXB 3F8KA 1TIQA 5GCNA 2FT0A 4R3KA 2B4DB 3JUWA 4K30A 4Y49C 2DPSA 2ZW5A 1XE4A 4NF1A 2ARHA 4B13A 2PDOA 1S7KA 4B5PA 5G1ZA 3IGRA 3LD2A 5H84A 2Z3MA 1UFHA 2CNSA 3BLNA 3DDDA 3D2MA 4A95A 4AVCA 3I3GA 4XPDC 3IU2A 1LRZA 3V8IA 3DSBA 3IWGA 4MFKA 3QB8A 3B8GA 2JEVA 2FCKA 4I49A 4CGNA 1N71A 1ON0A 2B4DA 5F49A 2Z3KA 4CYPA 1V0CA 2YNCA 5BWAB 2FS5A 4U5YA 4M3SA 1IIDA 2P6GA 4JWPA 5C82A 2VXKA 3NE7A 3SXOA 5EC4A 4Y49B 1KZFA 4KLWA 1Z9UA 4UA3A 4OAEA 2J8RA 4C7HA 4XNHC 3S6GA 4FD5A 4MHDA 4CAWA 4E2AA 1B87A 4KSFA 2Q7BA 4JD6A 1U6MA 4UFVA 4MFZA 2FSRA 4E0AA 2H5MA 3DNSA 4LUAA 5AG6A 5JPHA 5H86A 4XPDB 5FVJA 2B5GB 4YFJA 4ONUA 2VEZA 2BUEA 2Z3OA 3PGPA 1PU9A 4Q36A 2HQYA 4J3GA 2I79A 4R9MA 2R7HA 3CXSA 3TOAA 5IB0A 2BSWA 3DR6A 2G0BA 1KUVA 4AB7A 4KUBA 3KKWA 2C27A 3FXTA 4AG7A 4CAFA 5J8CA 4GS4A 4QBJA 3ZZIA 2Z11A 2O28A 1XEBA 4CGLA 3EO4A 1B6BA 4UCPA 2Z0ZA 4FD4A 4R3LA 4OADA 2FL4A 1S60A 4LX9A 1KUYA 2OU2A 2B5GA 3H4QA 3W91A 2GANA 3EFAA 2PR1A 4DNCA 2F5IA 3EC4A 4AG9A 4Q38A 5C88A 1L0CA 1MJAA 2WPWA 1VKCA 4HNYB 4JJXA 4X5KA 4CAXA 3T90A 4UWJA 4A30A 5AG5A 4XPKA 4A32A 4KOTA 2B3VA 1Z4RA 4F0YA 2WUUA 1SQHA 3P2HA 2VZYA 4AVAA 2YNEA 3TT2A 2FE7A 4B14A 4FD6A 3F0AA 4C2YA 4JXQA 3G8WA 4KVOE 4H6UA 4H89A 2B58A 5IX3A 2X7BA 1QSMA 2Y0MA 4ORFA 2I00A 3F5BA 4MBUA 1XMTA 4B5OA 5AGEA 3VWDA 1Y9WA 3SXNA 1NMTA 4U9YA 1MJ9A 3SHPA 3S6HA 3FB3A 3BJ8A 4H6ZA 3D2PA 3R95A 3ZJ0A 2J8NA 1QSTA 2FIAA 1IICA 4KOXA 4UFXA 4A2ZA 4IF5A 4C2ZA 5G22A 4CAVA 1QSOA 2HV2A 4B12A 1RO5A 5DWNA 4B10A 3CXPA 3R9FA 2PQ8A 2G3AA 4XPLA 2CY2A 4F6AA 4KUAA 3TO6A 1OZPA 2JDCA 5F48A 5A27A 2ZXVA 2Q04A 4EVYA 5AG4A 1XF8A 3DR8A 4OLLA 1IYKA 4CYNA 1I12A 2Q4YA 3IWEA 3I9SA 2Z3LA 1YVOA 1NE9A 1YLEA 4CAEA 5E96A 5AG7A 4KOSA 1BO4A 3WR7A 4CYQA 1PUAA 4PK3A 3W6XA 2VBQA 2REFA 3TFYA 1M4DA 4QUSA 3TE4A 3N7ZA 2PRBA 4L8AA 3GKRA 4PV6A 4KVME 3TTHA 3D8PA 3VWEA 2R1IA 5I0CA 5KTAA 4R87A 2B4BA 5F47A 2G3TA 1RXTA 3QAHA 4UBRA 3PZJA 1Q2CA 3UY5A 2DXQA 2VI7A 2GE3A 3OWCA 3E0KA 4IUSA 2KCWA 4F0XA 4PK2A 1YX0A 3TO7A 4PSXA 5A28A 4UFWA 1YR0A 2WSAA 3EY5A 2AJ6A 4NEXA 4RI1A 2AE6A 1S7LA 2Q4VA 1Q2DA 1IYLA 4C2XA 4UCMA 2OZUA 1S7FA 1M1DA 1XIXA 2EUIA 5EBVA 1S3ZA 2QECA 3R9GA 1I21A 2CNMA 1S7NA 3BJ7A 2BEIA 2CXAA 2HUZA 2NMTA 4B11A 2QMLA 4KOUA 3S6FA 1P0HA 2IL4A 1YREA 4PSWA 3W6SA 2Z10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGY B;  1ZO0 A;  5BWA B; 
#chains in the Genus database with same CATH topology
 5CBM A;  4NXY A;  3FIX A;  3V7Z A;  4ZGY B;  2FVG A;  1BPM A;  1LFW A;  1RTQ A;  4MFL A;  2PJB A;  1LCP A;  4CS0 B;  2PVW A;  4B5P B;  4KOR A;  2OOT A;  1VIX A;  3RAM A;  4R76 A;  2Q0Y A;  2ZW7 A;  3PFE A;  2ZEF A;  2Q44 A;  3GLJ A;  4Q36 A;  2D4P A;  2QIR A;  3C26 A;  2ODF A;  3R1K A;  4Q7A A;  3R9E A;  2GFQ A;  2VL1 A;  3S6K A;  4MCQ A;  8CPA A;  1CJW A;  5I4M A;  1LOK A;  3KL9 A;  2ZPA A;  2K5T A;  3D7H A;  5IV0 A;  4MCS A;  3TC8 A;  4DJL A;  3FF3 A;  3FH4 A;  4NGS A;  3I1U A;  2PJ3 A;  3K9T A;  1QQ9 A;  4OID A;  4NGM A;  2EVN A;  4DUK A;  2J8M A;  2ZEN A;  4KOY A;  2V8D A;  4R6T A;  3FNC A;  2ZOF A;  4MY0 A;  3WC6 A;  1YK3 A;  4P4D A;  5K8N A;  5JM6 A;  3FJU A;  4OME A;  2AFS A;  2ZEG A;  4MI4 A;  2P6F A;  2I3C A;  2EBJ A;  1CX8 A;  1M4I A;  1A2Z A;  1ZG8 A;  4YGO A;  4QC6 A;  4C7I A;  2RC4 A;  1F2P A;  1AUG A;  1QSR A;  4CPA A;  3S9N A;  2GLF A;  2EO8 A;  4CGO A;  5HVG A;  3RNZ A;  5K8O A;  1Y9K A;  5JGF A;  2PJ0 A;  2REE A;  2WZN A;  5LRK A;  1ZLH A;  2WYR A;  4RS2 A;  2EK8 A;  3CPA A;  3GY9 A;  2POK A;  5F09 A;  3S9M A;  4KSA A;  5LYL A;  1J4J A;  3MGD A;  3IEH A;  5LYD A;  1M4G A;  1VHS A;  1S5K A;  3B7I A;  2P0W A;  2PC1 A;  3DGV A;  2OR4 A;  2ZW6 A;  3T9Y A;  2OZH A;  4R57 A;  2A4N A;  1IB1 E;  1GHE A;  1XMB A;  2B3U A;  4NCZ A;  2R8V A;  4NGP A;  4KS9 A;  1IU8 A;  4P6Y A;  4ZBG A;  3VAR A;  3N5F A;  1VHE A;  2PJ9 A;  1BOB A;  4YU9 A;  2ZEM A;  1PCA A;  3CT9 A;  4II9 A;  3FRM A;  4NFR A;  4NGT A;  4UCN A;  3PP9 A;  4BMH A;  2ZED A;  2Z3N A;  4A31 A;  4G1P A;  1Q2Y A;  1YGH A;  5HH1 A;  2JDD A;  4JYW A;  3T8W A;  4RN7 A;  2YGW A;  3CPX A;  3TOB A;  3EXN A;  1P4N A;  4JXR A;  4M6G A;  5DWM A;  3TCV A;  3B3W A;  1R57 A;  1ZG9 A;  4YFJ A;  3K2K A;  5HXD A;  1TF8 A;  2BL1 A;  2WPX A;  1BAV A;  5CPA A;  3TO9 A;  4L89 A;  1NSL A;  4CRY B;  4ZI6 A;  4OIW A;  4A33 A;  2FXF A;  1K4J A;  3FBU A;  2O4H A;  2XEF A;  4UF4 A;  4CGP A;  3GYA A;  3JVN A;  4KZT A;  2PR8 A;  1KWM A;  2ATR A;  4KLV A;  4MHP A;  4R8F A;  5EMI A;  4C68 A;  3D3S A;  3RZA A;  3VAT A;  2Z3P A;  1VGY A;  1ZO0 A;  3TX8 A;  5HVH A;  2PSW A;  4M85 A;  1TF9 A;  1XJO A;  4MMO A;  4CGM A;  3IJ3 A;  4KVX A;  2VZZ A;  1CP7 A;  5KTD A;  2IQ6 A;  3NH4 A;  2R98 A;  1KUX A;  4AVB A;  5J8F A;  2J9A A;  2JBJ A;  3R96 A;  5LRJ A;  1WWZ A;  3IWW A;  5G20 A;  2YND A;  3P2F A;  5HMN A;  2VQY A;  2CNT A;  2D4O A;  1MJB A;  4H2K A;  1Y7R A;  1Z4E A;  3LOD A;  1WK4 A;  3WAB A;  1BPN A;  1HDU A;  2OB0 A;  4A38 A;  5FVJ A;  4KOV A;  2OH1 A;  1I1D A;  1CM0 A;  5JQ4 A;  2RFH A;  5LRG A;  2YNC C;  3K9U A;  1MK4 A;  5CNP A;  2DPT A;  3H5Z A;  4MY3 A;  5G21 A;  4MJ8 A;  2HC9 A;  3FYN A;  3PEI A;  4NSQ A;  1YVK A;  4UWI A;  4NJQ A;  2CTB A;  4MFP A;  3NE8 A;  3A9L A;  3MRU A;  2GLJ A;  3G3S A;  4CYO A;  4P10 A;  2OZG A;  3FVL A;  4YRH A;  3CZX A;  3JTK A;  4XNH B;  2FIW A;  3PB7 X;  2P6E A;  2XEJ A;  4HNW B;  2GIV A;  2ZW4 A;  1HDQ A;  4E8O A;  5KTC A;  5ISV A;  4NGN A;  4F9U A;  4BD9 A;  5LYI A;  2IJZ A;  1M4L A;  3PFO A;  1X12 A;  1QSN A;  4QVT A;  3BXM A;  2IMO A;  1Y0Y A;  1CPS A;  4MFQ A;  1YLO A;  1ARL A;  3RYO A;  4CRZ B;  4AVC A;  1M44 A;  3CXQ A;  4O23 A;  4KOW A;  3LAC A;  4MFJ A;  4NGQ A;  2JLM A;  2JBK A;  4ZY2 A;  3SI0 A;  1FY7 A;  1LAM A;  3NA6 A;  4U9Z A;  5JH9 A;  4JLY A;  3FX6 A;  3BHX A;  4GM5 A;  4BBH A;  5F46 A;  2AFW A;  3CDX A;  4P45 A;  1F57 A;  4FD7 A;  2PJ7 A;  4AXV A;  3L2N A;  1Q7L A;  4QB9 A;  4HKF A;  3IU1 A;  2JEW A;  4HNX B;  3B3V A;  3F8K A;  1TIQ A;  3WT4 A;  5GCN A;  6CPA A;  2FT0 A;  4R3K A;  2AFO A;  2B4D B;  3WC5 A;  4ZYQ A;  2BOA A;  1LAN A;  3JUW A;  1IOF A;  4K30 A;  4Y49 C;  1HEE A;  1Z8W A;  2DPS A;  2NSM A;  2ZW5 A;  2GRE A;  4NGR A;  1XE4 A;  2PJA A;  1PYT B;  4NF1 A;  2ARH A;  4B13 A;  4ZX9 A;  2PDO A;  4P4J A;  1S7K A;  5ELY A;  4A39 A;  4B5P A;  4MXU A;  2EK9 A;  4P4B A;  2C6G A;  3IGR A;  2BCO A;  5G1Z A;  3LD2 A;  5H84 A;  3SJF A;  2Z3M A;  1UFH A;  2CNS A;  3BLN A;  1FT7 A;  3DDD A;  3D2M A;  4A95 A;  1ELL P;  3D7G A;  3PBE A;  3D7D A;  3I3G A;  4FWU A;  4XPD C;  3IU2 A;  4ZY1 A;  1R3N A;  4OKO A;  1LRZ A;  3V8I A;  7CPA A;  3DSB A;  3FEC A;  3IWG A;  4MFK A;  3QB8 A;  3LMS A;  4LQ6 A;  3B8G A;  2JEV A;  2FCK A;  4I49 A;  1DTD A;  4CGN A;  1N71 A;  1ON0 A;  3KI9 A;  2B4D A;  5F49 A;  2Z3K A;  4CYP A;  3SI1 A;  3D68 A;  3PB4 X;  1V0C A;  2PJC A;  3H8G A;  2YNC A;  2F8H A;  5BWA B;  1XRY A;  2C1C A;  2FS5 A;  4M3S A;  4U5Y A;  4WJB A;  3KQX A;  1IID A;  2AFM A;  2P6G A;  2AFU A;  3B3S A;  4JWP A;  5HVF A;  2PJ5 A;  2DEA A;  5C82 A;  2VXK A;  5LYF A;  3NE7 A;  3SXO A;  5EC4 A;  4Y49 B;  1KZF A;  3HUV A;  4KLW A;  1Z2L A;  1Z9U A;  4UA3 A;  4OAE A;  1BLL E;  1IGB A;  2RB7 A;  3SJG A;  2J8R A;  3H8E A;  4WWV A;  4XNH C;  4C7H A;  3S6G A;  4FD5 A;  1JQG A;  4MHD A;  4CAW A;  1B87 A;  4KSF A;  2Q7B A;  4JD6 A;  4E2A A;  1U6M A;  4UFV A;  4MFZ A;  2FSR A;  5D29 A;  3QNV A;  5K8M A;  4E0A A;  2H5M A;  3DNS A;  4LUA A;  1GYT A;  2V8H A;  1FNO A;  4GXH A;  5AG6 A;  2ZEL A;  5JPH A;  4TWE A;  4OP4 A;  1LAP A;  5H86 A;  4X8I A;  4XPD B;  2B5G B;  2PVV A;  3B3C A;  3JRU A;  2VEZ A;  1XFO A;  2BUE A;  2Z3O A;  1PU9 A;  1QMU A;  3PGP A;  2HQY A;  4J3G A;  3MN8 A;  2I79 A;  4R9M A;  2R7H A;  3CXS A;  3TOA A;  3B3T A;  5IB0 A;  2BSW A;  3DR6 A;  4P4E A;  2G0B A;  1KUV A;  4AB7 A;  4KUB A;  1DE4 C;  2Q51 A;  3KKW A;  2C27 A;  1ARM A;  3VH9 A;  3FXT A;  4A37 A;  4AG7 A;  3NFZ A;  4CAF A;  5J8C A;  4GS4 A;  4QBJ A;  3ZZI A;  2Z11 A;  2O28 A;  4OC3 A;  5IB9 A;  3SI2 A;  1XEB A;  4TNU A;  2BO9 A;  3V38 A;  4CGL A;  3EO4 A;  1R43 A;  1B6B A;  2Q4Z A;  4UCP A;  1IY7 A;  3LWU A;  2Z0Z A;  4FD4 A;  4UIB A;  4R3L A;  4OAD A;  2GU2 A;  3D4U A;  4IAV A;  2FL4 A;  4NJR A;  2V8V A;  4KSI A;  1S60 A;  4X2T A;  3WC7 A;  4LX9 A;  1KUY A;  4FUU A;  4PPZ A;  1XOV A;  2OU2 A;  2B5G A;  3H4Q A;  3W91 A;  2GAN A;  2XEG A;  4LQG A;  3EFA A;  4A94 A;  2PR1 A;  3HLP A;  2NYQ A;  4DNC A;  2F5I A;  2ZEP A;  2CF4 A;  3EC4 A;  4OC5 A;  3FED A;  4AG9 A;  4ZX8 A;  4MCR A;  1ZLI A;  4Q38 A;  3S9L A;  5C88 A;  1H8L A;  1L0C A;  1MJA A;  2XEI A;  2HB6 A;  2WPW A;  1VKC A;  2QYV A;  4HNY B;  4JJX A;  4X5K A;  4CAX A;  3T90 A;  4UWJ A;  4W9Y A;  4PXB A;  3NH5 A;  5AG5 A;  4XPK A;  4A30 A;  3B2Y A;  3D66 A;  4A32 A;  4KOT A;  4EWT A;  5THW A;  2O53 A;  2B3V A;  1Z4R A;  4F0Y A;  2WUU A;  4F9V A;  1SQH A;  3P2H A;  3PB6 X;  1Y7E A;  3DLJ A;  2CIJ A;  2VZY A;  4AVA A;  2YNE A;  3KQZ A;  3TT2 A;  2EWB A;  2PRQ A;  1UWY A;  2FE7 A;  3BI1 A;  4FD6 A;  3F0A A;  4B14 A;  2ZEE A;  4C2Y A;  1YME A;  4JXQ A;  4R7M A;  4YWY A;  3G8W A;  3ISX A;  4X3R A;  4KVO E;  2ANP A;  4H6U A;  1IOI A;  4H89 A;  2B58 A;  4K3N A;  2X7B A;  5IX3 A;  1QSM A;  1TXR A;  2Y0M A;  2DF5 A;  1JWQ A;  4PQA A;  1X10 A;  4ORF A;  2I00 A;  3F5B A;  4MBU A;  4OC0 A;  1Z8L A;  2PIY A;  3SJX A;  1XMT A;  2QJ8 A;  1Z5R A;  4Z65 A;  4PXC A;  4B5O A;  2Q7S A;  3NH8 A;  3KR5 A;  5AGE A;  3VWD A;  1Y9W A;  3SJE A;  3SXN A;  1NMT A;  1Y0R A;  4U9Y A;  1AYE A;  2C6P A;  1MJ9 A;  4ONW A;  3SHP A;  3S6H A;  5J1Q A;  3D2P A;  3BJ8 A;  3FB3 A;  4H6Z A;  3R95 A;  3ZJ0 A;  2J8N A;  3B35 A;  1QST A;  2FIA A;  1NSA A;  1IIC A;  2Q43 A;  4KOX A;  3PB9 X;  1ZG7 A;  4UFX A;  4A2Z A;  1CBX A;  4IF5 A;  3BI0 A;  4C2Z A;  5G22 A;  3IFE A;  4CAV A;  1QSO A;  2HV2 A;  4MRI A;  1RO5 A;  2CTC A;  4B12 A;  2PJ1 A;  5DWN A;  4B10 A;  3H8F A;  2PE3 A;  3CXP A;  3R9F A;  2PQ8 A;  2G3A A;  4XPL A;  4FAI A;  2CY2 A;  1TKF A;  4F6A A;  2ABZ A;  4KUA A;  3ISZ A;  4MHZ A;  1OZP A;  2JDC A;  5F48 A;  3RO0 A;  3TO6 A;  5A27 A;  2ZXV A;  2Q04 A;  2QVP A;  4EVY A;  5AG4 A;  2PJ4 A;  1XF8 A;  3GB0 A;  4IK2 A;  1CPX A;  3DR8 A;  4OLL A;  1IYK A;  4CYN A;  3IIB A;  4OC1 A;  2AFZ A;  1I12 A;  2PIZ A;  4DYO A;  3IC1 A;  2Q4Y A;  4B6Z A;  3IWE A;  1Z8T A;  3I9S A;  3QAY A;  4MCP A;  3KHZ A;  1ELM P;  4BIN A;  4RUH A;  2Z3L A;  4P44 A;  4OC4 A;  1YVO A;  1NE9 A;  1YLE A;  3KAS A;  1F2O A;  3D7F A;  4CAE A;  4JZ0 A;  5E96 A;  5AG7 A;  1YQE A;  4M6H A;  4KOS A;  1BO4 A;  3WR7 A;  4CYQ A;  1PUA A;  4PK3 A;  3KHX A;  3PB8 X;  2VBQ A;  2REF A;  3W6X A;  3TFY A;  3GIU A;  3KGQ A;  1M4D A;  4QUS A;  3TE4 A;  3N7Z A;  1CG2 A;  2PRB A;  4UIA A;  4L8A A;  3GKR A;  4PV6 A;  4KVM E;  3TTH A;  1OBR A;  3D8P A;  2PCU A;  3VWE A;  2R1I A;  2C6C A;  2V8G A;  5I0C A;  1CP6 A;  3D67 A;  3KR4 A;  4R87 A;  1AMP A;  5KTA A;  2B4B A;  5F47 A;  2G3T A;  1RXT A;  2ZEO A;  1YW4 A;  3PZJ A;  3QAH A;  4PXD A;  4UBR A;  4PXE A;  4F8Z A;  1Q2C A;  2V77 A;  3UY5 A;  2DXQ A;  3IO1 A;  2VI7 A;  2GE3 A;  3OWC A;  3E0K A;  4IUS A;  2KCW A;  3PRT A;  4F0X A;  4MHY A;  5K8P A;  4PK2 A;  4P4F A;  1YX0 A;  3TO7 A;  4PSX A;  1XBU A;  2PJ8 A;  4UEE A;  5A28 A;  3RBU A;  4M6I A;  4UFW A;  1YR0 A;  4P4I A;  2WSA A;  3EY5 A;  4IHM A;  2AJ6 A;  1Z8X A;  4NEX A;  4HPS A;  4RI1 A;  2AE6 A;  4UEF A;  2ZOG A;  1S7L A;  2Q4V A;  2PJ2 A;  1Q2D A;  4ZY0 A;  1IYL A;  1TKJ A;  1YSJ A;  4C2X A;  4OC2 A;  2OZU A;  4UCM A;  5DS0 A;  4EFD A;  1S7F A;  1M1D A;  2PJ6 A;  1VHO A;  1XIX A;  2EUI A;  5EBV A;  4FBE A;  1S3Z A;  2G9D A;  4ONU A;  2QEC A;  3R9G A;  1I21 A;  1TKH A;  2CNM A;  3KZW A;  3PBB A;  1S7N A;  2ZEH A;  3BJ7 A;  3GUX A;  2BEI A;  2CXA A;  2AFX A;  2HUZ A;  1YW6 A;  4UEZ A;  2NMT A;  4B11 A;  2QML A;  3FMC A;  4KOU A;  3FEE A;  3S6F A;  1P0H A;  5D8N A;  2IL4 A;  2F7V A;  4MHN A;  1YRE A;  4EME A;  4PSW A;  1EE3 P;  3W6S A;  2Z10 A; 
#chains in the Genus database with same CATH homology
 4NXY A;  3FIX A;  4ZGY B;  4MFL A;  4CS0 B;  4B5P B;  4KOR A;  2Q0Y A;  2ZW7 A;  2Q44 A;  3R9E A;  2D4P A;  2QIR A;  3C26 A;  3R1K A;  3S6K A;  1CJW A;  2ZPA A;  2K5T A;  5IV0 A;  2EVN A;  2J8M A;  4KOY A;  3FNC A;  4MY0 A;  1YK3 A;  4MI4 A;  2P6F A;  4YGO A;  1M4I A;  4QC6 A;  4C7I A;  2RC4 A;  1QSR A;  4CGO A;  1Y9K A;  2REE A;  4RS2 A;  3GY9 A;  4KSA A;  1J4J A;  3MGD A;  1M4G A;  1VHS A;  1S5K A;  2P0W A;  2PC1 A;  3T9Y A;  2ZW6 A;  2OZH A;  4R57 A;  2A4N A;  1IB1 E;  1GHE A;  2B3U A;  4NCZ A;  2R8V A;  4KS9 A;  4ZBG A;  1BOB A;  4II9 A;  3FRM A;  4UCN A;  3PP9 A;  4BMH A;  2Z3N A;  4A31 A;  1Q2Y A;  1YGH A;  5HH1 A;  2JDD A;  2YGW A;  3TOB A;  3EXN A;  1P4N A;  4JXR A;  5DWM A;  3TCV A;  1R57 A;  2BL1 A;  2WPX A;  3TO9 A;  4L89 A;  1NSL A;  4CRY B;  4A33 A;  2FXF A;  1K4J A;  3FBU A;  4CGP A;  3GYA A;  3JVN A;  4KZT A;  2PR8 A;  2ATR A;  4KLV A;  4C68 A;  3D3S A;  2Z3P A;  1ZO0 A;  2PSW A;  4M85 A;  4CGM A;  4KVX A;  2VZZ A;  5KTD A;  2R98 A;  1KUX A;  4AVB A;  5J8F A;  3R96 A;  1WWZ A;  5G20 A;  2YND A;  3P2F A;  5HMN A;  2VQY A;  2CNT A;  2D4O A;  1MJB A;  1Z4E A;  3LOD A;  1Y7R A;  1WK4 A;  2OB0 A;  4KOV A;  2OH1 A;  1I1D A;  1CM0 A;  5JQ4 A;  2YNC C;  3K9U A;  1MK4 A;  5CNP A;  2DPT A;  3H5Z A;  4MY3 A;  5G21 A;  4MJ8 A;  3FYN A;  4NSQ A;  1YVK A;  4UWI A;  4MFP A;  3A9L A;  3G3S A;  4CYO A;  2OZG A;  4YRH A;  3JTK A;  4XNH B;  2FIW A;  2P6E A;  4HNW B;  2GIV A;  2ZW4 A;  4E8O A;  5ISV A;  5KTC A;  1QSN A;  4QVT A;  4MFQ A;  3RYO A;  4CRZ B;  1M44 A;  3CXQ A;  4KOW A;  4MFJ A;  2JLM A;  1FY7 A;  4U9Z A;  4JLY A;  4BBH A;  5F46 A;  4FD7 A;  4QB9 A;  4HKF A;  3IU1 A;  4HNX B;  3F8K A;  1TIQ A;  5GCN A;  2FT0 A;  4R3K A;  2B4D B;  3JUW A;  4K30 A;  4Y49 C;  2DPS A;  2ZW5 A;  1XE4 A;  4NF1 A;  2ARH A;  4B13 A;  2PDO A;  1S7K A;  4B5P A;  5G1Z A;  3IGR A;  3LD2 A;  5H84 A;  2Z3M A;  1UFH A;  2CNS A;  3BLN A;  3DDD A;  3D2M A;  4A95 A;  4AVC A;  3I3G A;  4XPD C;  3IU2 A;  1LRZ A;  3V8I A;  3DSB A;  3IWG A;  4MFK A;  3QB8 A;  3B8G A;  2JEV A;  2FCK A;  4I49 A;  4CGN A;  1N71 A;  1ON0 A;  2B4D A;  5F49 A;  2Z3K A;  4CYP A;  1V0C A;  2YNC A;  5BWA B;  2FS5 A;  4U5Y A;  4M3S A;  1IID A;  2P6G A;  4JWP A;  5C82 A;  2VXK A;  3NE7 A;  3SXO A;  5EC4 A;  4Y49 B;  1KZF A;  4KLW A;  1Z9U A;  4UA3 A;  4OAE A;  2J8R A;  4C7H A;  4XNH C;  3S6G A;  4FD5 A;  4MHD A;  4CAW A;  4E2A A;  1B87 A;  4KSF A;  2Q7B A;  4JD6 A;  1U6M A;  4UFV A;  4MFZ A;  2FSR A;  4E0A A;  2H5M A;  3DNS A;  4LUA A;  5AG6 A;  5JPH A;  5H86 A;  4XPD B;  5FVJ A;  2B5G B;  4YFJ A;  4ONU A;  2VEZ A;  2BUE A;  2Z3O A;  3PGP A;  1PU9 A;  4Q36 A;  2HQY A;  4J3G A;  2I79 A;  4R9M A;  2R7H A;  3CXS A;  3TOA A;  5IB0 A;  2BSW A;  3DR6 A;  2G0B A;  1KUV A;  4AB7 A;  4KUB A;  3KKW A;  2C27 A;  3FXT A;  4AG7 A;  4CAF A;  5J8C A;  4GS4 A;  4QBJ A;  3ZZI A;  2Z11 A;  2O28 A;  1XEB A;  4CGL A;  3EO4 A;  1B6B A;  4UCP A;  2Z0Z A;  4FD4 A;  4R3L A;  4OAD A;  2FL4 A;  1S60 A;  4LX9 A;  1KUY A;  2OU2 A;  2B5G A;  3H4Q A;  3W91 A;  2GAN A;  3EFA A;  2PR1 A;  4DNC A;  2F5I A;  3EC4 A;  4AG9 A;  4Q38 A;  5C88 A;  1L0C A;  1MJA A;  2WPW A;  1VKC A;  4HNY B;  4JJX A;  4X5K A;  4CAX A;  3T90 A;  4UWJ A;  4A30 A;  5AG5 A;  4XPK A;  4A32 A;  4KOT A;  2B3V A;  1Z4R A;  4F0Y A;  2WUU A;  1SQH A;  3P2H A;  2VZY A;  4AVA A;  2YNE A;  3TT2 A;  2FE7 A;  4B14 A;  4FD6 A;  3F0A A;  4C2Y A;  4JXQ A;  3G8W A;  4KVO E;  4H6U A;  4H89 A;  2B58 A;  5IX3 A;  2X7B A;  1QSM A;  2Y0M A;  4ORF A;  2I00 A;  3F5B A;  4MBU A;  1XMT A;  4B5O A;  5AGE A;  3VWD A;  1Y9W A;  3SXN A;  1NMT A;  4U9Y A;  1MJ9 A;  3SHP A;  3S6H A;  3FB3 A;  3BJ8 A;  4H6Z A;  3D2P A;  3R95 A;  3ZJ0 A;  2J8N A;  1QST A;  2FIA A;  1IIC A;  4KOX A;  4UFX A;  4A2Z A;  4IF5 A;  4C2Z A;  5G22 A;  4CAV A;  1QSO A;  2HV2 A;  4B12 A;  1RO5 A;  5DWN A;  4B10 A;  3CXP A;  3R9F A;  2PQ8 A;  2G3A A;  4XPL A;  2CY2 A;  4F6A A;  4KUA A;  3TO6 A;  1OZP A;  2JDC A;  5F48 A;  5A27 A;  2ZXV A;  2Q04 A;  4EVY A;  5AG4 A;  1XF8 A;  3DR8 A;  4OLL A;  1IYK A;  4CYN A;  1I12 A;  2Q4Y A;  3IWE A;  3I9S A;  2Z3L A;  1YVO A;  1NE9 A;  1YLE A;  4CAE A;  5E96 A;  5AG7 A;  4KOS A;  1BO4 A;  3WR7 A;  4CYQ A;  1PUA A;  4PK3 A;  3W6X A;  2VBQ A;  2REF A;  3TFY A;  1M4D A;  4QUS A;  3TE4 A;  3N7Z A;  2PRB A;  4L8A A;  3GKR A;  4PV6 A;  4KVM E;  3TTH A;  3D8P A;  3VWE A;  2R1I A;  5I0C A;  5KTA A;  4R87 A;  2B4B A;  5F47 A;  2G3T A;  1RXT A;  3QAH A;  4UBR A;  3PZJ A;  1Q2C A;  3UY5 A;  2DXQ A;  2VI7 A;  2GE3 A;  3OWC A;  3E0K A;  4IUS A;  2KCW A;  4F0X A;  4PK2 A;  1YX0 A;  3TO7 A;  4PSX A;  5A28 A;  4UFW A;  1YR0 A;  2WSA A;  3EY5 A;  2AJ6 A;  4NEX A;  4RI1 A;  2AE6 A;  1S7L A;  2Q4V A;  1Q2D A;  1IYL A;  4C2X A;  4UCM A;  2OZU A;  1S7F A;  1M1D A;  1XIX A;  2EUI A;  5EBV A;  1S3Z A;  2QEC A;  3R9G A;  1I21 A;  2CNM A;  1S7N A;  3BJ7 A;  2BEI A;  2CXA A;  2HUZ A;  2NMT A;  4B11 A;  2QML A;  4KOU A;  3S6F A;  1P0H A;  2IL4 A;  1YRE A;  4PSW A;  3W6S A;  2Z10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...