3FJUA

Ascaris suum carboxypeptidase inhibitor in complex with human carboxypeptidase a1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
RSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase A1
publication title Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 307
sequence length 307
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fjuA00
4YWYA 2ZEEA 1F2PA 2PJ2A 2I3CA 1UWYA 3PB8X 4OC3A 1Z5RA 4EMEA 4FAIA 4F9UA 1PYTB 2PRQA 3K9TA 1TF8A 4R7MA 4UF4A 2ZENA 4P6YA 3NH8A 1OBRA 2CTCA 3TC8A 2GU2A 4P4IA 3JRUA 4NGQA 1XJOA 2V8GA 4KSIA 4NGPA 1ZG8A 1CP6A 3VATA 1Z8LA 2PJ3A 5K8MA 4NGMA 4R8FA 4NJQA 1F2OA 2HC9A 4DUKA 3KGQA 4OC2A 2CF4A 3H8EA 2ZEGA 2PJ8A 4GM5A 3IEHA 2O53A 2C6CA 3H8GA 1HDUA 2OOTA 5HXDA 2EK9A 3WC5A 2Q4ZA 2PJ1A 4MHPA 4MXUA 3B2YA 3WC6A 1Q7LA 4MCQA 1PCAA 1TKJA 4MCRA 2ABZA 1TKHA 3KI9A 2IQ6A 1YLOA 1CG2A 3SI0A 5HVHA 4PXBA 3D7FA 3FVLA 1BPMA 1YW4A 2RFHA 2PIZA 1R3NA 4UIBA 2CIJA 2BOAA 3IIBA 2V77A 4MHZA 1XFOA 4JYWA 2XEIA 2AFZA 5CPAA 4ZX9A 2C6GA 3QNVA 4UEZA 1LAMA 4OIWA 2BCOA 2IMOA 4IHMA 2AFOA 6CPAA 3B3CA 5D29A 4PQAA 4ZY2A 3B7IA 5J1QA 2ZELA 2PJ4A 4CPAA 4OC5A 2ZEOA 1FT7A 4OC0A 3IJ3A 4X3RA 1XBUA 4NGSA 4WWVA 5LRGA 2PCUA 4OMEA 1ELMP 3FEEA 3NA6A 1GYTA 4RUHA 2F7VA 1F57A 3GB0A 1QMUA 1EE3P 1VHOA 5HVFA 1CBXA 4FWUA 2PJ7A 2AFXA 3D4UA 4AXVA 1XRYA 4K3NA 3VARA 1ZG7A 5LYLA 3IWWA 1ELLP 3NFZA 3SJEA 2NYQA 5LYIA 3MN8A 2PVWA 3S9NA 3KHZA 3KZWA 3FJUA 2O4HA 4OC4A 4PXDA 1VHEA 3CPAA 4H2KA 3PEIA 5I4MA 4BD9A 1TXRA 3BI0A 2GLFA 1CP7A 3SJGA 1CPXA 4P4JA 2G9DA 3NH5A 4B6ZA 2Q51A 3CT9A 3DLJA 4PXEA 1Y7EA 3D67A 3LWUA 4PPZA 1M4LA 2GREA 1KWMA 3K2KA 2V8HA 1YW6A 4ZX8A 1Y0RA 3B3WA 5D8NA 3NH4A 2PJ9A 1BAVA 3D66A 3B35A 2ANPA 2ZOFA 3T8WA 1QQ9A 3PFOA 1CX8A 3N5FA 4P4FA 2ZEFA 4O23A 3I1UA 2DEAA 1Y0YA 3KQXA 2ZEMA 2JBJA 3S9MA 1R43A 2PIYA 5IB9A 2PJ5A 5LYFA 4NJRA 3TX8A 2ZEPA 3V7ZA 4NGTA 1AMPA 3RZAA 5JH9A 4NFRA 5K8PA 1CPSA 3SI1A 4IK2A 1VGYA 2RB7A 3DGVA 2ZEHA 5THWA 2ZOGA 2PVVA 3V38A 4TWEA 4R76A 3D68A 4Z65A 1IGBA 5LRKA 3D7GA 4TNUA 1LOKA 5LRJA 4YU9A 3B3SA 2C1CA 2NSMA 3VH9A 3PBBA 3H8FA 3PFEA 3FH4A 4P44A 4R6TA 4DJLA 4PXCA 3IFEA 3KHXA 1LAPA 2PJ0A 3ISXA 1LANA 2POKA 4ZY0A 4MRIA 2ZEDA 2HB6A 4P4EA 3GLJA 1IY7A 4JZ0A 1VIXA 4ZI6A 1ZLHA 2BO9A 4EWTA 3HLPA 4P10A 1YMEA 3WC7A 3WT4A 1FNOA 2C6PA 3B3VA 5ELYA 5F09A 2GLJA 3RBUA 2F8HA 2V8DA 3KASA 4MCSA 3SJFA 4G1PA 1JQGA 4UEEA 3CDXA 3GUXA 2WZNA 4WJBA 3KR5A 5HVGA 2XEGA 4MHNA 5CBMA 4F9VA 2QVPA 4OC1A 3FF3A 3FECA 3RAMA 2PJAA 4X2TA 1ZLIA 4IAVA 1LFWA 1YSJA 3IC1A 5K8NA 3D7DA 3D7HA 4P4BA 1HDQA 2XEFA 8CPAA 4ZY1A 1HEEA 3SJXA 4A94A 4NGNA 3PB6X 4OKOA 2VL1A 3PB4X 5K8OA 3CPXA 3BI1A 3FMCA 3KQZA 5JM6A 2V8VA 3ISZA 3PRTA 7CPAA 2AFUA 2XEJA 1DE4C 1RTQA 4MHYA 5LYDA 1AYEA 4NGRA 2PJBA 5DS0A 2IJZA 3KR4A 5JGFA 4MCPA 3B3TA 2JEWA 2PJ6A 1XMBA 3PB7X 4LQGA 4DYOA 3FX6A 3HUVA 3KL9A 4A37A 3WABA 4FBEA 2FVGA 4P45A 1ZG9A 3BHXA 2AFWA 3IO1A 4EFDA 1TF9A 4FUUA 1TKFA 4UEFA 1H8LA 4F8ZA 2CTBA 2Q43A 4OP4A 2PJCA 1BLLE 4ZYQA 3L2NA 4Q7AA 1DTDA 1ARLA 4A38A 2OR4A 4MMOA 2EWBA 2PE3A 4ONWA 1LCPA 4OIDA 2AFMA 1NSAA 2EK8A 4P4DA 1BPNA 3PBEA 3S9LA 2QJ8A 2AFSA 3LMSA 2WYRA 1ARMA 3BXMA 2JBKA 4X8IA 4A39A 2QYVA 3SI2A 3PB9X 2J9AA 3FEDA 4W9YA 1Z2LA 3MRUA 4UIAA
chains in the Genus database with same CATH superfamily
1Q2CA 4MFKA 1IOFA 4YWYA 2ZEEA 1YK3A 3T9YA 3FIXA 2HQYA 1F2PA 2CY2A 3EC4A 5DWMA 3TT2A 4KOVA 5C82A 2PJ2A 2I3CA 1UWYA 2HUZA 3PB8X 4KOTA 2FL4A 2H5MA 1IYLA 4OC3A 2YNDA 1Z5RA 4EMEA 4GXHA 4FAIA 4A95A 4F9UA 1PYTB 4MFPA 3LACA 4KVOE 1FY7A 2PRQA 3K9TA 4CRYB 4NCZA 1TF8A 4ONUA 4R7MA 4KLVA 5KTAA 4UF4A 3B8GA 1XOVA 1YGHA 2ZENA 2WPWA 4P6YA 3NH8A 1OBRA 2CTCA 4F6AA 1IOIA 3TC8A 3DDDA 3V8IA 2GU2A 4MI4A 4P4IA 5EC4A 3JRUA 4LQ6A 3TFYA 2EBJA 4NGQA 1ON0A 1XJOA 3NE7A 2Y0MA 3K9UA 4FD5A 2V8GA 4KSIA 4NGPA 3F0AA 1ZG8A 1CP6A 3I9SA 3VATA 1Z8LA 2REEA 3IU2A 4FD4A 1LRZA 2B3UA 2P6EA 2PJ3A 2YNCA 3RNZA 2YGWA 4NGMA 4R8FA 5K8MA 4NJQA 4YGOA 1F2OA 2HC9A 4DUKA 3KGQA 2G3AA 4OC2A 2CF4A 3H8EA 2ZEGA 4NEXA 2YNEA 5ISVA 5J8CA 3GIUA 2PJ8A 4RN7A 3R9EA 4GM5A 3IEHA 2O53A 3IWGA 2C6CA 4L89A 2VBQA 3H8GA 3JUWA 1HDUA 1P4NA 2PQ8A 3D8PA 3FYNA 1L0CA 2EK9A 2ZW4A 2OOTA 2Q4ZA 3R9FA 3WC5A 5HXDA 1U6MA 2PJ1A 4MHPA 2ZW7A 4MXUA 3B2YA 3S6GA 1M44A 3FXTA 1MJAA 4LUAA 3WC6A 4HNWB 3H5ZA 1Q7LA 2CNTA 4MCQA 1PCAA 3CZXA 1QSRA 4L8AA 2WUUA 1ZO0A 1TKJA 4JJXA 4MCRA 2ABZA 2FT0A 1TKHA 4A33A 3KI9A 3PZJA 2F5IA 2IQ6A 2Z3LA 1CG2A 1YLOA 5IX3A 3TO6A 1MJBA 4H6UA 3SI0A 5HVHA 3T90A 1IU8A 5CNPA 4PXBA 3D7FA 3FVLA 1M1DA 4CYQA 1BPMA 1YW4A 2ATRA 3BLNA 4JXQA 2RFHA 2Z3KA 2PIZA 2FCKA 1R3NA 3A9LA 4E2AA 3H4QA 2HV2A 2CIJA 2GIVA 4UIBA 5F48A 5A27A 3FRMA 5EBVA 2Q04A 3OWCA 2BOAA 2REFA 4U5YA 5G21A 4F0XA 2BEIA 5FVJA 3IIBA 1S7KA 2V77A 1YVKA 4MHZA 4CYOA 5F49A 1XFOA 4JYWA 3SHPA 4CS0B 2Z0ZA 2ODFA 2XEIA 4I49A 2AFZA 4J3GA 5CPAA 4ZX9A 2C6GA 4U9YA 1MJ9A 4UCPA 3ZJ0A 3PP9A 3S6HA 3QNVA 2BSWA 4M6IA 4LX9A 4MFQA 1LAMA 4OIWA 4UEZA 4IUSA 2BCOA 2B58A 2IMOA 3IGRA 3SXNA 2FE7A 4IHMA 1B6BA 4MY0A 4R3KA 1S7NA 2AFOA 2PR1A 6CPAA 3B3CA 4H6ZA 4PK3A 5D29A 2B5GB 3FBUA 4PQAA 4ZY2A 3B7IA 5J1QA 1I1DA 2ZELA 2PJ4A 4KOSA 4CPAA 4BINA 4OC5A 3RYOA 2Q4YA 2ZEOA 1FT7A 4OC0A 4JXRA 4CGOA 3S6KA 2QIRA 2VZZA 3IJ3A 4BMHA 4X3RA 1XBUA 4NGSA 4WWVA 5LRGA 4A32A 4M85A 2IL4A 2PCUA 4OMEA 2JEVA 1ELMP 1A2ZA 3FEEA 2VQYA 2FIAA 4QVTA 2OZHA 3NA6A 4OAEA 2RC4A 2ZPAA 1GYTA 4RUHA 2ZW6A 5JQ4A 4AG7A 4KOYA 2F7VA 1F57A 2R98A 4UA3A 1XF8A 4R3LA 3GB0A 1QMUA 1EE3P 4MFLA 4AB7A 2D4PA 4XPLA 1XEBA 3R9GA 1VHOA 2C27A 1UFHA 2OH1A 2R8VA 5EMIA 1CBXA 4FWUA 2Q0YA 2PJ7A 3P2HA 5HVFA 2AFXA 3R96A 2EUIA 4A30A 3D4UA 4AXVA 2EVNA 1XRYA 1Q2DA 4K3NA 3VARA 1ZG7A 2PDOA 5LYLA 2Q7SA 3IWWA 1ELLP 3EXNA 3JVNA 5J8FA 4C2ZA 3NFZA 3SJEA 2NYQA 2Q7BA 5LYIA 1NSLA 1Y9WA 1OZPA 2AE6A 1WK4A 3NE8A 1KUYA 2QECA 2GFQA 1NMTA 3MN8A 3TO9A 2PVWA 2J8RA 3S9NA 3KHZA 3KZWA 3FJUA 2O4HA 4MFJA 4MY3A 4OC4A 1VHEA 4PXDA 4A2ZA 3CPAA 4JD6A 4UFVA 4H2KA 2CNMA 1AUGA 3PEIA 4UCNA 4ZGYB 1KZFA 5I4MA 4BD9A 1TXRA 1Y7RA 5G20A 4AVCA 3BI0A 3DR6A 4FD6A 4YFJA 2GLFA 1CP7A 4RI1A 3SJGA 2PR8A 1CPXA 4P4JA 2G9DA 3NH5A 4B6ZA 5C88A 1Z4EA 2Q51A 3CT9A 4KVME 2D4OA 1S5KA 4K30A 1YX0A 3DLJA 4PXEA 3EY5A 2Z3OA 3VWDA 2J8MA 4C7HA 2I79A 4C7IA 4NF1A 4PK2A 1Y7EA 3D67A 2WPXA 2CXAA 3CXQA 3LWUA 3D2MA 4PPZA 2OZUA 1M4LA 3S6FA 3TCVA 4II9A 2GREA 1KWMA 4R87A 2WSAA 3K2KA 2EO8A 1YW6A 2V8HA 4KOXA 4ZX8A 1Y0RA 3B3WA 5D8NA 2OZGA 4QUSA 5F46A 1M4GA 1RXTA 3NH4A 4KLWA 2PJ9A 1BAVA 3CXPA 3D66A 3R1KA 3B35A 2ANPA 3LD2A 1N71A 2JDDA 2ZOFA 1CJWA 3T8WA 4C2XA 1QQ9A 1GHEA 2A4NA 1YLEA 3PFOA 1CX8A 1PU9A 4B10A 1SQHA 5GCNA 3N5FA 3MGDA 4P4FA 3TO7A 1PUAA 2G3TA 2ZEFA 4O23A 3I1UA 2DEAA 4CGLA 1Y0YA 3KQXA 2ZEMA 2JBJA 4C2YA 3BJ7A 5I0CA 1BOBA 3D3SA 4UBRA 1S60A 1XE4A 2BUEA 3S9MA 1R43A 3W6XA 2PIYA 5IB9A 2PJ5A 5LYFA 4UFXA 5IV0A 1IICA 4KUAA 1JWQA 4NJRA 4Y49C 1Z4RA 3FNCA 3TX8A 2ZEPA 4C68A 3V7ZA 2QMLA 4CGPA 4NGTA 1AMPA 3RZAA 2B5GA 5JH9A 2DPSA 4NFRA 5K8PA 1I21A 4R9MA 1CPSA 3SI1A 4CAXA 4CYPA 3ZZIA 1K4JA 4U9ZA 4IK2A 1VGYA 4CAFA 5F47A 4MHDA 1IB1E 2RB7A 3DGVA 1Q2YA 1KUVA 2I00A 2ZEHA 5THWA 2ZOGA 2PVVA 3V38A 4TWEA 4ZBGA 3W91A 3EFAA 1M4DA 1IYKA 1XIXA 2FXFA 4R76A 4OLLA 3D68A 4Z65A 3C26A 4FD7A 2FSRA 1IGBA 5HMNA 2OB0A 4HPSA 5LRKA 2Q4VA 3D7GA 4TNUA 4XNHC 4Y49B 1LOKA 1J4JA 3TTHA 5LRJA 2DF5A 4YU9A 1V0CA 1Z8XA 4CRZB 3B3SA 2C1CA 2NSMA 3VH9A 5JPHA 5HH1A 3PBBA 3H8FA 4M6GA 1QSTA 2ARHA 3G3SA 3PFEA 3FH4A 1X10A 4P44A 4R6TA 3W6SA 4CGNA 4F0YA 3VWEA 1RO5A 4DJLA 5H86A 1B87A 4PXCA 3GKRA 3IFEA 3KKWA 3KHXA 4KUBA 3FB3A 5AGEA 1LAPA 2PJ0A 3ISXA 1LANA 1M4IA 2POKA 4ORFA 2FIWA 4B12A 1IIDA 2J8NA 4MRIA 4NSQA 4ZY0A 4HKFA 2ZEDA 4B14A 4KZTA 3CXSA 2PC1A 1QSMA 2HB6A 4P4EA 3GLJA 1IY7A 4JZ0A 1VIXA 4UCMA 5AG5A 4CGMA 4ZI6A 1ZLHA 2BO9A 4NXYA 4EWTA 3HLPA 4P10A 1YMEA 3WC7A 3WT4A 4AG9A 1FNOA 3TOAA 1I12A 2C6PA 3B3VA 3D2PA 4XNHB 4B11A 1TIQA 4HNYB 5ELYA 2GANA 5F09A 1WWZA 2GLJA 3RBUA 2NMTA 2F8HA 2V8DA 3KASA 4MCSA 4RS2A 5H84A 3SJFA 4G1PA 1JQGA 3F8KA 4UEEA 4CAVA 4B5PA 4DNCA 3CDXA 1R57A 1S7LA 3GUXA 2WZNA 3EO4A 4CAEA 2B3VA 4WJBA 3KR5A 3R95A 5HVGA 2XEGA 1S7FA 2X7BA 4MHNA 5CBMA 4CAWA 2QVPA 4F9VA 5AG7A 3G8WA 1YVOA 2YNCC 4KSAA 4OC1A 4QB9A 3FF3A 3DR8A 3WR7A 5G22A 3FECA 3RAMA 1QSOA 5KTCA 2PJAA 4X2TA 1ZLIA 2PRBA 2P0WA 1LFWA 4IAVA 1YSJA 3IC1A 4B5PB 5K8NA 2KCWA 4PV6A 3D7DA 3D7HA 4QBJA 2OU2A 4P4BA 1VKCA 3RO0A 3E0KA 3F5BA 1HDQA 2XEFA 8CPAA 4ZY1A 2PSWA 2B4BA 1HEEA 5AG6A 1CM0A 3SJXA 2P6GA 4A94A 3JTKA 4NGNA 2DPTA 3PB6X 4OKOA 4R57A 4YRHA 4E0AA 2VL1A 3IWEA 1NE9A 1Z8TA 2ZW5A 2B4DA 1VHSA 4KORA 2Q44A 3PB4X 4CYNA 4Q36A 5K8OA 2DXQA 3BJ8A 3CPXA 4PSXA 2R1IA 3BI1A 3FMCA 3KQZA 2VEZA 3LODA 4GS4A 5JM6A 2V8VA 3ISZA 4KVXA 2Z3MA 3DNSA 2O28A 3PRTA 7CPAA 2AFUA 2XEJA 1DE4C 4EVYA 1RTQA 4MHYA 3TE4A 3DSBA 2K5TA 2G0BA 5LYDA 5BWAB 3I3GA 1AYEA 2B4DB 4NGRA 4XPKA 3P2FA 2Z3PA 4HNXB 2PJBA 5DS0A 2IJZA 2AJ6A 3KR4A 4OADA 4B13A 4KOUA 4MCPA 3B3TA 2Z11A 5JGFA 2Z3NA 2FS5A 1Y9KA 2JEWA 3GYAA 1Z8WA 2PJ6A 4Q38A 1XMBA 1XMTA 4XPDC 3PB7X 3PGPA 4KS9A 4LQGA 4DYOA 1X12A 3FX6A 3HUVA 3KL9A 2Z10A 1Z9UA 4A37A 3WABA 2CNSA 2JLMA 4FBEA 4KOWA 2FVGA 1BO4A 4P45A 4UWIA 1ZG9A 5E96A 1P0HA 3BHXA 1YQEA 2AFWA 4UWJA 3IO1A 4EFDA 3TOBA 1TF9A 4FUUA 1TKFA 4KSFA 1H8LA 2GE3A 4PSWA 4UEFA 4QC6A 2CTBA 2Q43A 3UY5A 4OP4A 4F8ZA 2PJCA 2VXKA 1BLLE 4IF5A 4ZYQA 3L2NA 4Q7AA 1DTDA 4X5KA 1ARLA 3SXOA 2OR4A 4A38A 4MMOA 3QB8A 2EWBA 2PE3A 2VI7A 4ONWA 2VZYA 4E8OA 1LCPA 1QSNA 4OIDA 5DWNA 2AFMA 4M3SA 1NSAA 1S3ZA 2BL1A 2EK8A 4XPDB 4P4DA 4MFZA 1BPNA 3PBEA 3GY9A 5AG4A 2R7HA 3S9LA 1YR0A 2P6FA 4B5OA 2QJ8A 2AFSA 5IB0A 3QAHA 3LMSA 1MK4A 2WYRA 1ARMA 3BXMA 4JLYA 5G1ZA 4UFWA 4BBHA 2JBKA 4MJ8A 4X8IA 4AVAA 1YREA 5KTDA 4A39A 3N7ZA 2ZXVA 2QYVA 3SI2A 3PB9X 4M6HA 2J9AA 4A31A 3FEDA 3IU1A 1KUXA 4W9YA 1Z2LA 4H89A 3MRUA 4UIAA 4JWPA 4MBUA 3QAYA 2JDCA 4AVBA 5A28A
chains in the Genus database with same CATH topology
4YWYA 2ZEEA 1F2PA 2PJ2A 2I3CA 1UWYA 3PB8X 4OC3A 1Z5RA 4EMEA 4FAIA 4F9UA 1PYTB 2PRQA 3K9TA 1TF8A 4R7MA 4UF4A 2ZENA 4P6YA 3NH8A 1OBRA 2CTCA 3TC8A 2GU2A 4P4IA 3JRUA 4NGQA 1XJOA 2V8GA 4KSIA 4NGPA 1ZG8A 1CP6A 3VATA 1Z8LA 2PJ3A 5K8MA 4NGMA 4R8FA 4NJQA 1F2OA 2HC9A 4DUKA 3KGQA 4OC2A 2CF4A 3H8EA 2ZEGA 2PJ8A 4GM5A 3IEHA 2O53A 2C6CA 3H8GA 1HDUA 2OOTA 5HXDA 2EK9A 3WC5A 2Q4ZA 2PJ1A 4MHPA 4MXUA 3B2YA 3WC6A 1Q7LA 4MCQA 1PCAA 1TKJA 4MCRA 2ABZA 1TKHA 3KI9A 2IQ6A 1YLOA 1CG2A 3SI0A 5HVHA 4PXBA 3D7FA 3FVLA 1BPMA 1YW4A 2RFHA 2PIZA 1R3NA 4UIBA 2CIJA 2BOAA 3IIBA 2V77A 4MHZA 1XFOA 4JYWA 2XEIA 2AFZA 5CPAA 4ZX9A 2C6GA 3QNVA 4UEZA 1LAMA 4OIWA 2BCOA 2IMOA 4IHMA 2AFOA 6CPAA 3B3CA 5D29A 4PQAA 4ZY2A 3B7IA 5J1QA 2ZELA 2PJ4A 4CPAA 4OC5A 2ZEOA 1FT7A 4OC0A 3IJ3A 4X3RA 1XBUA 4NGSA 4WWVA 5LRGA 2PCUA 4OMEA 1ELMP 3FEEA 3NA6A 1GYTA 4RUHA 2F7VA 1F57A 3GB0A 1QMUA 1EE3P 1VHOA 5HVFA 1CBXA 4FWUA 2PJ7A 2AFXA 3D4UA 4AXVA 1XRYA 4K3NA 3VARA 1ZG7A 5LYLA 3IWWA 1ELLP 3NFZA 3SJEA 2NYQA 5LYIA 3MN8A 2PVWA 3S9NA 3KHZA 3KZWA 3FJUA 2O4HA 4OC4A 4PXDA 1VHEA 3CPAA 4H2KA 3PEIA 5I4MA 4BD9A 1TXRA 3BI0A 2GLFA 1CP7A 3SJGA 1CPXA 4P4JA 2G9DA 3NH5A 4B6ZA 2Q51A 3CT9A 3DLJA 4PXEA 1Y7EA 3D67A 3LWUA 4PPZA 1M4LA 2GREA 1KWMA 3K2KA 2V8HA 1YW6A 4ZX8A 1Y0RA 3B3WA 5D8NA 3NH4A 2PJ9A 1BAVA 3D66A 3B35A 2ANPA 2ZOFA 3T8WA 1QQ9A 3PFOA 1CX8A 3N5FA 4P4FA 2ZEFA 4O23A 3I1UA 2DEAA 1Y0YA 3KQXA 2ZEMA 2JBJA 3S9MA 1R43A 2PIYA 5IB9A 2PJ5A 5LYFA 4NJRA 3TX8A 2ZEPA 3V7ZA 4NGTA 1AMPA 3RZAA 5JH9A 4NFRA 5K8PA 1CPSA 3SI1A 4IK2A 1VGYA 2RB7A 3DGVA 2ZEHA 5THWA 2ZOGA 2PVVA 3V38A 4TWEA 4R76A 3D68A 4Z65A 1IGBA 5LRKA 3D7GA 4TNUA 1LOKA 5LRJA 4YU9A 3B3SA 2C1CA 2NSMA 3VH9A 3PBBA 3H8FA 3PFEA 3FH4A 4P44A 4R6TA 4DJLA 4PXCA 3IFEA 3KHXA 1LAPA 2PJ0A 3ISXA 1LANA 2POKA 4ZY0A 4MRIA 2ZEDA 2HB6A 4P4EA 3GLJA 1IY7A 4JZ0A 1VIXA 4ZI6A 1ZLHA 2BO9A 4EWTA 3HLPA 4P10A 1YMEA 3WC7A 3WT4A 1FNOA 2C6PA 3B3VA 5ELYA 5F09A 2GLJA 3RBUA 2F8HA 2V8DA 3KASA 4MCSA 3SJFA 4G1PA 1JQGA 4UEEA 3CDXA 3GUXA 2WZNA 4WJBA 3KR5A 5HVGA 2XEGA 4MHNA 5CBMA 4F9VA 2QVPA 4OC1A 3FF3A 3FECA 3RAMA 2PJAA 4X2TA 1ZLIA 4IAVA 1LFWA 1YSJA 3IC1A 5K8NA 3D7DA 3D7HA 4P4BA 1HDQA 2XEFA 8CPAA 4ZY1A 1HEEA 3SJXA 4A94A 4NGNA 3PB6X 4OKOA 2VL1A 3PB4X 5K8OA 3CPXA 3BI1A 3FMCA 3KQZA 5JM6A 2V8VA 3ISZA 3PRTA 7CPAA 2AFUA 2XEJA 1DE4C 1RTQA 4MHYA 5LYDA 1AYEA 4NGRA 2PJBA 5DS0A 2IJZA 3KR4A 5JGFA 4MCPA 3B3TA 2JEWA 2PJ6A 1XMBA 3PB7X 4LQGA 4DYOA 3FX6A 3HUVA 3KL9A 4A37A 3WABA 4FBEA 2FVGA 4P45A 1ZG9A 3BHXA 2AFWA 3IO1A 4EFDA 1TF9A 4FUUA 1TKFA 4UEFA 1H8LA 4F8ZA 2CTBA 2Q43A 4OP4A 2PJCA 1BLLE 4ZYQA 3L2NA 4Q7AA 1DTDA 1ARLA 4A38A 2OR4A 4MMOA 2EWBA 2PE3A 4ONWA 1LCPA 4OIDA 2AFMA 1NSAA 2EK8A 4P4DA 1BPNA 3PBEA 3S9LA 2QJ8A 2AFSA 3LMSA 2WYRA 1ARMA 3BXMA 2JBKA 4X8IA 4A39A 2QYVA 3SI2A 3PB9X 2J9AA 3FEDA 4W9YA 1Z2LA 3MRUA 4UIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWY A;  2ZEE A;  1F2P A;  2PJ2 A;  2I3C A;  1UWY A;  3PB8 X;  4OC3 A;  1Z5R A;  4EME A;  4FAI A;  4F9U A;  1PYT B;  2PRQ A;  3K9T A;  1TF8 A;  4R7M A;  4UF4 A;  2ZEN A;  4P6Y A;  3NH8 A;  1OBR A;  2CTC A;  3TC8 A;  2GU2 A;  4P4I A;  3JRU A;  4NGQ A;  1XJO A;  2V8G A;  4KSI A;  4NGP A;  1ZG8 A;  1CP6 A;  3VAT A;  1Z8L A;  2PJ3 A;  5K8M A;  4NGM A;  4R8F A;  4NJQ A;  1F2O A;  2HC9 A;  4DUK A;  3KGQ A;  4OC2 A;  2CF4 A;  3H8E A;  2ZEG A;  2PJ8 A;  4GM5 A;  3IEH A;  2O53 A;  2C6C A;  3H8G A;  1HDU A;  2OOT A;  5HXD A;  2EK9 A;  3WC5 A;  2Q4Z A;  2PJ1 A;  4MHP A;  4MXU A;  3B2Y A;  3WC6 A;  1Q7L A;  4MCQ A;  1PCA A;  1TKJ A;  4MCR A;  2ABZ A;  1TKH A;  3KI9 A;  2IQ6 A;  1YLO A;  1CG2 A;  3SI0 A;  5HVH A;  4PXB A;  3D7F A;  3FVL A;  1BPM A;  1YW4 A;  2RFH A;  2PIZ A;  1R3N A;  4UIB A;  2CIJ A;  2BOA A;  3IIB A;  2V77 A;  4MHZ A;  1XFO A;  4JYW A;  2XEI A;  2AFZ A;  5CPA A;  4ZX9 A;  2C6G A;  3QNV A;  4UEZ A;  1LAM A;  4OIW A;  2BCO A;  2IMO A;  4IHM A;  2AFO A;  6CPA A;  3B3C A;  5D29 A;  4PQA A;  4ZY2 A;  3B7I A;  5J1Q A;  2ZEL A;  2PJ4 A;  4CPA A;  4OC5 A;  2ZEO A;  1FT7 A;  4OC0 A;  3IJ3 A;  4X3R A;  1XBU A;  4NGS A;  4WWV A;  5LRG A;  2PCU A;  4OME A;  1ELM P;  3FEE A;  3NA6 A;  1GYT A;  4RUH A;  2F7V A;  1F57 A;  3GB0 A;  1QMU A;  1EE3 P;  1VHO A;  5HVF A;  1CBX A;  4FWU A;  2PJ7 A;  2AFX A;  3D4U A;  4AXV A;  1XRY A;  4K3N A;  3VAR A;  1ZG7 A;  5LYL A;  3IWW A;  1ELL P;  3NFZ A;  3SJE A;  2NYQ A;  5LYI A;  3MN8 A;  2PVW A;  3S9N A;  3KHZ A;  3KZW A;  3FJU A;  2O4H A;  4OC4 A;  4PXD A;  1VHE A;  3CPA A;  4H2K A;  3PEI A;  5I4M A;  4BD9 A;  1TXR A;  3BI0 A;  2GLF A;  1CP7 A;  3SJG A;  1CPX A;  4P4J A;  2G9D A;  3NH5 A;  4B6Z A;  2Q51 A;  3CT9 A;  3DLJ A;  4PXE A;  1Y7E A;  3D67 A;  3LWU A;  4PPZ A;  1M4L A;  2GRE A;  1KWM A;  3K2K A;  2V8H A;  1YW6 A;  4ZX8 A;  1Y0R A;  3B3W A;  5D8N A;  3NH4 A;  2PJ9 A;  1BAV A;  3D66 A;  3B35 A;  2ANP A;  2ZOF A;  3T8W A;  1QQ9 A;  3PFO A;  1CX8 A;  3N5F A;  4P4F A;  2ZEF A;  4O23 A;  3I1U A;  2DEA A;  1Y0Y A;  3KQX A;  2ZEM A;  2JBJ A;  3S9M A;  1R43 A;  2PIY A;  5IB9 A;  2PJ5 A;  5LYF A;  4NJR A;  3TX8 A;  2ZEP A;  3V7Z A;  4NGT A;  1AMP A;  3RZA A;  5JH9 A;  4NFR A;  5K8P A;  1CPS A;  3SI1 A;  4IK2 A;  1VGY A;  2RB7 A;  3DGV A;  2ZEH A;  5THW A;  2ZOG A;  2PVV A;  3V38 A;  4TWE A;  4R76 A;  3D68 A;  4Z65 A;  1IGB A;  5LRK A;  3D7G A;  4TNU A;  1LOK A;  5LRJ A;  4YU9 A;  3B3S A;  2C1C A;  2NSM A;  3VH9 A;  3PBB A;  3H8F A;  3PFE A;  3FH4 A;  4P44 A;  4R6T A;  4DJL A;  4PXC A;  3IFE A;  3KHX A;  1LAP A;  2PJ0 A;  3ISX A;  1LAN A;  2POK A;  4ZY0 A;  4MRI A;  2ZED A;  2HB6 A;  4P4E A;  3GLJ A;  1IY7 A;  4JZ0 A;  1VIX A;  4ZI6 A;  1ZLH A;  2BO9 A;  4EWT A;  3HLP A;  4P10 A;  1YME A;  3WC7 A;  3WT4 A;  1FNO A;  2C6P A;  3B3V A;  5ELY A;  5F09 A;  2GLJ A;  3RBU A;  2F8H A;  2V8D A;  3KAS A;  4MCS A;  3SJF A;  4G1P A;  1JQG A;  4UEE A;  3CDX A;  3GUX A;  2WZN A;  4WJB A;  3KR5 A;  5HVG A;  2XEG A;  4MHN A;  5CBM A;  4F9V A;  2QVP A;  4OC1 A;  3FF3 A;  3FEC A;  3RAM A;  2PJA A;  4X2T A;  1ZLI A;  4IAV A;  1LFW A;  1YSJ A;  3IC1 A;  5K8N A;  3D7D A;  3D7H A;  4P4B A;  1HDQ A;  2XEF A;  8CPA A;  4ZY1 A;  1HEE A;  3SJX A;  4A94 A;  4NGN A;  3PB6 X;  4OKO A;  2VL1 A;  3PB4 X;  5K8O A;  3CPX A;  3BI1 A;  3FMC A;  3KQZ A;  5JM6 A;  2V8V A;  3ISZ A;  3PRT A;  7CPA A;  2AFU A;  2XEJ A;  1DE4 C;  1RTQ A;  4MHY A;  5LYD A;  1AYE A;  4NGR A;  2PJB A;  5DS0 A;  2IJZ A;  3KR4 A;  5JGF A;  4MCP A;  3B3T A;  2JEW A;  2PJ6 A;  1XMB A;  3PB7 X;  4LQG A;  4DYO A;  3FX6 A;  3HUV A;  3KL9 A;  4A37 A;  3WAB A;  4FBE A;  2FVG A;  4P45 A;  1ZG9 A;  3BHX A;  2AFW A;  3IO1 A;  4EFD A;  1TF9 A;  4FUU A;  1TKF A;  4UEF A;  1H8L A;  4F8Z A;  2CTB A;  2Q43 A;  4OP4 A;  2PJC A;  1BLL E;  4ZYQ A;  3L2N A;  4Q7A A;  1DTD A;  1ARL A;  4A38 A;  2OR4 A;  4MMO A;  2EWB A;  2PE3 A;  4ONW A;  1LCP A;  4OID A;  2AFM A;  1NSA A;  2EK8 A;  4P4D A;  1BPN A;  3PBE A;  3S9L A;  2QJ8 A;  2AFS A;  3LMS A;  2WYR A;  1ARM A;  3BXM A;  2JBK A;  4X8I A;  4A39 A;  2QYV A;  3SI2 A;  3PB9 X;  2J9A A;  3FED A;  4W9Y A;  1Z2L A;  3MRU A;  4UIA A; 
#chains in the Genus database with same CATH topology
 1Q2C A;  4MFK A;  1IOF A;  4YWY A;  2ZEE A;  1YK3 A;  3T9Y A;  3FIX A;  2HQY A;  1F2P A;  2CY2 A;  3EC4 A;  5DWM A;  3TT2 A;  4KOV A;  5C82 A;  2PJ2 A;  2I3C A;  1UWY A;  2HUZ A;  3PB8 X;  4KOT A;  2FL4 A;  2H5M A;  1IYL A;  4OC3 A;  2YND A;  1Z5R A;  4EME A;  4GXH A;  4FAI A;  4A95 A;  4F9U A;  1PYT B;  4MFP A;  3LAC A;  4KVO E;  1FY7 A;  2PRQ A;  3K9T A;  4CRY B;  4NCZ A;  1TF8 A;  4ONU A;  4R7M A;  4KLV A;  5KTA A;  4UF4 A;  3B8G A;  1XOV A;  1YGH A;  2ZEN A;  2WPW A;  4P6Y A;  3NH8 A;  1OBR A;  2CTC A;  4F6A A;  1IOI A;  3TC8 A;  3DDD A;  3V8I A;  2GU2 A;  4MI4 A;  4P4I A;  5EC4 A;  3JRU A;  4LQ6 A;  3TFY A;  2EBJ A;  4NGQ A;  1ON0 A;  1XJO A;  3NE7 A;  2Y0M A;  3K9U A;  4FD5 A;  2V8G A;  4KSI A;  4NGP A;  3F0A A;  1ZG8 A;  1CP6 A;  3I9S A;  3VAT A;  1Z8L A;  2REE A;  3IU2 A;  4FD4 A;  1LRZ A;  2B3U A;  2P6E A;  2PJ3 A;  2YNC A;  3RNZ A;  2YGW A;  4NGM A;  4R8F A;  5K8M A;  4NJQ A;  4YGO A;  1F2O A;  2HC9 A;  4DUK A;  3KGQ A;  2G3A A;  4OC2 A;  2CF4 A;  3H8E A;  2ZEG A;  4NEX A;  2YNE A;  5ISV A;  5J8C A;  3GIU A;  2PJ8 A;  4RN7 A;  3R9E A;  4GM5 A;  3IEH A;  2O53 A;  3IWG A;  2C6C A;  4L89 A;  2VBQ A;  3H8G A;  3JUW A;  1HDU A;  1P4N A;  2PQ8 A;  3D8P A;  3FYN A;  1L0C A;  2EK9 A;  2ZW4 A;  2OOT A;  2Q4Z A;  3R9F A;  3WC5 A;  5HXD A;  1U6M A;  2PJ1 A;  4MHP A;  2ZW7 A;  4MXU A;  3B2Y A;  3S6G A;  1M44 A;  3FXT A;  1MJA A;  4LUA A;  3WC6 A;  4HNW B;  3H5Z A;  1Q7L A;  2CNT A;  4MCQ A;  1PCA A;  3CZX A;  1QSR A;  4L8A A;  2WUU A;  1ZO0 A;  1TKJ A;  4JJX A;  4MCR A;  2ABZ A;  2FT0 A;  1TKH A;  4A33 A;  3KI9 A;  3PZJ A;  2F5I A;  2IQ6 A;  2Z3L A;  1CG2 A;  1YLO A;  5IX3 A;  3TO6 A;  1MJB A;  4H6U A;  3SI0 A;  5HVH A;  3T90 A;  1IU8 A;  5CNP A;  4PXB A;  3D7F A;  3FVL A;  1M1D A;  4CYQ A;  1BPM A;  1YW4 A;  2ATR A;  3BLN A;  4JXQ A;  2RFH A;  2Z3K A;  2PIZ A;  2FCK A;  1R3N A;  3A9L A;  4E2A A;  3H4Q A;  2HV2 A;  2CIJ A;  2GIV A;  4UIB A;  5F48 A;  5A27 A;  3FRM A;  5EBV A;  2Q04 A;  3OWC A;  2BOA A;  2REF A;  4U5Y A;  5G21 A;  4F0X A;  2BEI A;  5FVJ A;  3IIB A;  1S7K A;  2V77 A;  1YVK A;  4MHZ A;  4CYO A;  5F49 A;  1XFO A;  4JYW A;  3SHP A;  4CS0 B;  2Z0Z A;  2ODF A;  2XEI A;  4I49 A;  2AFZ A;  4J3G A;  5CPA A;  4ZX9 A;  2C6G A;  4U9Y A;  1MJ9 A;  4UCP A;  3ZJ0 A;  3PP9 A;  3S6H A;  3QNV A;  2BSW A;  4M6I A;  4LX9 A;  4MFQ A;  1LAM A;  4OIW A;  4UEZ A;  4IUS A;  2BCO A;  2B58 A;  2IMO A;  3IGR A;  3SXN A;  2FE7 A;  4IHM A;  1B6B A;  4MY0 A;  4R3K A;  1S7N A;  2AFO A;  2PR1 A;  6CPA A;  3B3C A;  4H6Z A;  4PK3 A;  5D29 A;  2B5G B;  3FBU A;  4PQA A;  4ZY2 A;  3B7I A;  5J1Q A;  1I1D A;  2ZEL A;  2PJ4 A;  4KOS A;  4CPA A;  4BIN A;  4OC5 A;  3RYO A;  2Q4Y A;  2ZEO A;  1FT7 A;  4OC0 A;  4JXR A;  4CGO A;  3S6K A;  2QIR A;  2VZZ A;  3IJ3 A;  4BMH A;  4X3R A;  1XBU A;  4NGS A;  4WWV A;  5LRG A;  4A32 A;  4M85 A;  2IL4 A;  2PCU A;  4OME A;  2JEV A;  1ELM P;  1A2Z A;  3FEE A;  2VQY A;  2FIA A;  4QVT A;  2OZH A;  3NA6 A;  4OAE A;  2RC4 A;  2ZPA A;  1GYT A;  4RUH A;  2ZW6 A;  5JQ4 A;  4AG7 A;  4KOY A;  2F7V A;  1F57 A;  2R98 A;  4UA3 A;  1XF8 A;  4R3L A;  3GB0 A;  1QMU A;  1EE3 P;  4MFL A;  4AB7 A;  2D4P A;  4XPL A;  1XEB A;  3R9G A;  1VHO A;  2C27 A;  1UFH A;  2OH1 A;  2R8V A;  5EMI A;  1CBX A;  4FWU A;  2Q0Y A;  2PJ7 A;  3P2H A;  5HVF A;  2AFX A;  3R96 A;  2EUI A;  4A30 A;  3D4U A;  4AXV A;  2EVN A;  1XRY A;  1Q2D A;  4K3N A;  3VAR A;  1ZG7 A;  2PDO A;  5LYL A;  2Q7S A;  3IWW A;  1ELL P;  3EXN A;  3JVN A;  5J8F A;  4C2Z A;  3NFZ A;  3SJE A;  2NYQ A;  2Q7B A;  5LYI A;  1NSL A;  1Y9W A;  1OZP A;  2AE6 A;  1WK4 A;  3NE8 A;  1KUY A;  2QEC A;  2GFQ A;  1NMT A;  3MN8 A;  3TO9 A;  2PVW A;  2J8R A;  3S9N A;  3KHZ A;  3KZW A;  3FJU A;  2O4H A;  4MFJ A;  4MY3 A;  4OC4 A;  1VHE A;  4PXD A;  4A2Z A;  3CPA A;  4JD6 A;  4UFV A;  4H2K A;  2CNM A;  1AUG A;  3PEI A;  4UCN A;  4ZGY B;  1KZF A;  5I4M A;  4BD9 A;  1TXR A;  1Y7R A;  5G20 A;  4AVC A;  3BI0 A;  3DR6 A;  4FD6 A;  4YFJ A;  2GLF A;  1CP7 A;  4RI1 A;  3SJG A;  2PR8 A;  1CPX A;  4P4J A;  2G9D A;  3NH5 A;  4B6Z A;  5C88 A;  1Z4E A;  2Q51 A;  3CT9 A;  4KVM E;  2D4O A;  1S5K A;  4K30 A;  1YX0 A;  3DLJ A;  4PXE A;  3EY5 A;  2Z3O A;  3VWD A;  2J8M A;  4C7H A;  2I79 A;  4C7I A;  4NF1 A;  4PK2 A;  1Y7E A;  3D67 A;  2WPX A;  2CXA A;  3CXQ A;  3LWU A;  3D2M A;  4PPZ A;  2OZU A;  1M4L A;  3S6F A;  3TCV A;  4II9 A;  2GRE A;  1KWM A;  4R87 A;  2WSA A;  3K2K A;  2EO8 A;  1YW6 A;  2V8H A;  4KOX A;  4ZX8 A;  1Y0R A;  3B3W A;  5D8N A;  2OZG A;  4QUS A;  5F46 A;  1M4G A;  1RXT A;  3NH4 A;  4KLW A;  2PJ9 A;  1BAV A;  3CXP A;  3D66 A;  3R1K A;  3B35 A;  2ANP A;  3LD2 A;  1N71 A;  2JDD A;  2ZOF A;  1CJW A;  3T8W A;  4C2X A;  1QQ9 A;  1GHE A;  2A4N A;  1YLE A;  3PFO A;  1CX8 A;  1PU9 A;  4B10 A;  1SQH A;  5GCN A;  3N5F A;  3MGD A;  4P4F A;  3TO7 A;  1PUA A;  2G3T A;  2ZEF A;  4O23 A;  3I1U A;  2DEA A;  4CGL A;  1Y0Y A;  3KQX A;  2ZEM A;  2JBJ A;  4C2Y A;  3BJ7 A;  5I0C A;  1BOB A;  3D3S A;  4UBR A;  1S60 A;  1XE4 A;  2BUE A;  3S9M A;  1R43 A;  3W6X A;  2PIY A;  5IB9 A;  2PJ5 A;  5LYF A;  4UFX A;  5IV0 A;  1IIC A;  4KUA A;  1JWQ A;  4NJR A;  4Y49 C;  1Z4R A;  3FNC A;  3TX8 A;  2ZEP A;  4C68 A;  3V7Z A;  2QML A;  4CGP A;  4NGT A;  1AMP A;  3RZA A;  2B5G A;  5JH9 A;  2DPS A;  4NFR A;  5K8P A;  1I21 A;  4R9M A;  1CPS A;  3SI1 A;  4CAX A;  4CYP A;  3ZZI A;  1K4J A;  4U9Z A;  4IK2 A;  1VGY A;  4CAF A;  5F47 A;  4MHD A;  1IB1 E;  2RB7 A;  3DGV A;  1Q2Y A;  1KUV A;  2I00 A;  2ZEH A;  5THW A;  2ZOG A;  2PVV A;  3V38 A;  4TWE A;  4ZBG A;  3W91 A;  3EFA A;  1M4D A;  1IYK A;  1XIX A;  2FXF A;  4R76 A;  4OLL A;  3D68 A;  4Z65 A;  3C26 A;  4FD7 A;  2FSR A;  1IGB A;  5HMN A;  2OB0 A;  4HPS A;  5LRK A;  2Q4V A;  3D7G A;  4TNU A;  4XNH C;  4Y49 B;  1LOK A;  1J4J A;  3TTH A;  5LRJ A;  2DF5 A;  4YU9 A;  1V0C A;  1Z8X A;  4CRZ B;  3B3S A;  2C1C A;  2NSM A;  3VH9 A;  5JPH A;  5HH1 A;  3PBB A;  3H8F A;  4M6G A;  1QST A;  2ARH A;  3G3S A;  3PFE A;  3FH4 A;  1X10 A;  4P44 A;  4R6T A;  3W6S A;  4CGN A;  4F0Y A;  3VWE A;  1RO5 A;  4DJL A;  5H86 A;  1B87 A;  4PXC A;  3GKR A;  3IFE A;  3KKW A;  3KHX A;  4KUB A;  3FB3 A;  5AGE A;  1LAP A;  2PJ0 A;  3ISX A;  1LAN A;  1M4I A;  2POK A;  4ORF A;  2FIW A;  4B12 A;  1IID A;  2J8N A;  4MRI A;  4NSQ A;  4ZY0 A;  4HKF A;  2ZED A;  4B14 A;  4KZT A;  3CXS A;  2PC1 A;  1QSM A;  2HB6 A;  4P4E A;  3GLJ A;  1IY7 A;  4JZ0 A;  1VIX A;  4UCM A;  5AG5 A;  4CGM A;  4ZI6 A;  1ZLH A;  2BO9 A;  4NXY A;  4EWT A;  3HLP A;  4P10 A;  1YME A;  3WC7 A;  3WT4 A;  4AG9 A;  1FNO A;  3TOA A;  1I12 A;  2C6P A;  3B3V A;  3D2P A;  4XNH B;  4B11 A;  1TIQ A;  4HNY B;  5ELY A;  2GAN A;  5F09 A;  1WWZ A;  2GLJ A;  3RBU A;  2NMT A;  2F8H A;  2V8D A;  3KAS A;  4MCS A;  4RS2 A;  5H84 A;  3SJF A;  4G1P A;  1JQG A;  3F8K A;  4UEE A;  4CAV A;  4B5P A;  4DNC A;  3CDX A;  1R57 A;  1S7L A;  3GUX A;  2WZN A;  3EO4 A;  4CAE A;  2B3V A;  4WJB A;  3KR5 A;  3R95 A;  5HVG A;  2XEG A;  1S7F A;  2X7B A;  4MHN A;  5CBM A;  4CAW A;  2QVP A;  4F9V A;  5AG7 A;  3G8W A;  1YVO A;  2YNC C;  4KSA A;  4OC1 A;  4QB9 A;  3FF3 A;  3DR8 A;  3WR7 A;  5G22 A;  3FEC A;  3RAM A;  1QSO A;  5KTC A;  2PJA A;  4X2T A;  1ZLI A;  2PRB A;  2P0W A;  1LFW A;  4IAV A;  1YSJ A;  3IC1 A;  4B5P B;  5K8N A;  2KCW A;  4PV6 A;  3D7D A;  3D7H A;  4QBJ A;  2OU2 A;  4P4B A;  1VKC A;  3RO0 A;  3E0K A;  3F5B A;  1HDQ A;  2XEF A;  8CPA A;  4ZY1 A;  2PSW A;  2B4B A;  1HEE A;  5AG6 A;  1CM0 A;  3SJX A;  2P6G A;  4A94 A;  3JTK A;  4NGN A;  2DPT A;  3PB6 X;  4OKO A;  4R57 A;  4YRH A;  4E0A A;  2VL1 A;  3IWE A;  1NE9 A;  1Z8T A;  2ZW5 A;  2B4D A;  1VHS A;  4KOR A;  2Q44 A;  3PB4 X;  4CYN A;  4Q36 A;  5K8O A;  2DXQ A;  3BJ8 A;  3CPX A;  4PSX A;  2R1I A;  3BI1 A;  3FMC A;  3KQZ A;  2VEZ A;  3LOD A;  4GS4 A;  5JM6 A;  2V8V A;  3ISZ A;  4KVX A;  2Z3M A;  3DNS A;  2O28 A;  3PRT A;  7CPA A;  2AFU A;  2XEJ A;  1DE4 C;  4EVY A;  1RTQ A;  4MHY A;  3TE4 A;  3DSB A;  2K5T A;  2G0B A;  5LYD A;  5BWA B;  3I3G A;  1AYE A;  2B4D B;  4NGR A;  4XPK A;  3P2F A;  2Z3P A;  4HNX B;  2PJB A;  5DS0 A;  2IJZ A;  2AJ6 A;  3KR4 A;  4OAD A;  4B13 A;  4KOU A;  4MCP A;  3B3T A;  2Z11 A;  5JGF A;  2Z3N A;  2FS5 A;  1Y9K A;  2JEW A;  3GYA A;  1Z8W A;  2PJ6 A;  4Q38 A;  1XMB A;  1XMT A;  4XPD C;  3PB7 X;  3PGP A;  4KS9 A;  4LQG A;  4DYO A;  1X12 A;  3FX6 A;  3HUV A;  3KL9 A;  2Z10 A;  1Z9U A;  4A37 A;  3WAB A;  2CNS A;  2JLM A;  4FBE A;  4KOW A;  2FVG A;  1BO4 A;  4P45 A;  4UWI A;  1ZG9 A;  5E96 A;  1P0H A;  3BHX A;  1YQE A;  2AFW A;  4UWJ A;  3IO1 A;  4EFD A;  3TOB A;  1TF9 A;  4FUU A;  1TKF A;  4KSF A;  1H8L A;  2GE3 A;  4PSW A;  4UEF A;  4QC6 A;  2CTB A;  2Q43 A;  3UY5 A;  4OP4 A;  4F8Z A;  2PJC A;  2VXK A;  1BLL E;  4IF5 A;  4ZYQ A;  3L2N A;  4Q7A A;  1DTD A;  4X5K A;  1ARL A;  3SXO A;  2OR4 A;  4A38 A;  4MMO A;  3QB8 A;  2EWB A;  2PE3 A;  2VI7 A;  4ONW A;  2VZY A;  4E8O A;  1LCP A;  1QSN A;  4OID A;  5DWN A;  2AFM A;  4M3S A;  1NSA A;  1S3Z A;  2BL1 A;  2EK8 A;  4XPD B;  4P4D A;  4MFZ A;  1BPN A;  3PBE A;  3GY9 A;  5AG4 A;  2R7H A;  3S9L A;  1YR0 A;  2P6F A;  4B5O A;  2QJ8 A;  2AFS A;  5IB0 A;  3QAH A;  3LMS A;  1MK4 A;  2WYR A;  1ARM A;  3BXM A;  4JLY A;  5G1Z A;  4UFW A;  4BBH A;  2JBK A;  4MJ8 A;  4X8I A;  4AVA A;  1YRE A;  5KTD A;  4A39 A;  3N7Z A;  2ZXV A;  2QYV A;  3SI2 A;  3PB9 X;  4M6H A;  2J9A A;  4A31 A;  3FED A;  3IU1 A;  1KUX A;  4W9Y A;  1Z2L A;  4H89 A;  3MRU A;  4UIA A;  4JWP A;  4MBU A;  3QAY A;  2JDC A;  4AVB A;  5A28 A; 
#chains in the Genus database with same CATH homology
 4YWY A;  2ZEE A;  1F2P A;  2PJ2 A;  2I3C A;  1UWY A;  3PB8 X;  4OC3 A;  1Z5R A;  4EME A;  4FAI A;  4F9U A;  1PYT B;  2PRQ A;  3K9T A;  1TF8 A;  4R7M A;  4UF4 A;  2ZEN A;  4P6Y A;  3NH8 A;  1OBR A;  2CTC A;  3TC8 A;  2GU2 A;  4P4I A;  3JRU A;  4NGQ A;  1XJO A;  2V8G A;  4KSI A;  4NGP A;  1ZG8 A;  1CP6 A;  3VAT A;  1Z8L A;  2PJ3 A;  5K8M A;  4NGM A;  4R8F A;  4NJQ A;  1F2O A;  2HC9 A;  4DUK A;  3KGQ A;  4OC2 A;  2CF4 A;  3H8E A;  2ZEG A;  2PJ8 A;  4GM5 A;  3IEH A;  2O53 A;  2C6C A;  3H8G A;  1HDU A;  2OOT A;  5HXD A;  2EK9 A;  3WC5 A;  2Q4Z A;  2PJ1 A;  4MHP A;  4MXU A;  3B2Y A;  3WC6 A;  1Q7L A;  4MCQ A;  1PCA A;  1TKJ A;  4MCR A;  2ABZ A;  1TKH A;  3KI9 A;  2IQ6 A;  1YLO A;  1CG2 A;  3SI0 A;  5HVH A;  4PXB A;  3D7F A;  3FVL A;  1BPM A;  1YW4 A;  2RFH A;  2PIZ A;  1R3N A;  4UIB A;  2CIJ A;  2BOA A;  3IIB A;  2V77 A;  4MHZ A;  1XFO A;  4JYW A;  2XEI A;  2AFZ A;  5CPA A;  4ZX9 A;  2C6G A;  3QNV A;  4UEZ A;  1LAM A;  4OIW A;  2BCO A;  2IMO A;  4IHM A;  2AFO A;  6CPA A;  3B3C A;  5D29 A;  4PQA A;  4ZY2 A;  3B7I A;  5J1Q A;  2ZEL A;  2PJ4 A;  4CPA A;  4OC5 A;  2ZEO A;  1FT7 A;  4OC0 A;  3IJ3 A;  4X3R A;  1XBU A;  4NGS A;  4WWV A;  5LRG A;  2PCU A;  4OME A;  1ELM P;  3FEE A;  3NA6 A;  1GYT A;  4RUH A;  2F7V A;  1F57 A;  3GB0 A;  1QMU A;  1EE3 P;  1VHO A;  5HVF A;  1CBX A;  4FWU A;  2PJ7 A;  2AFX A;  3D4U A;  4AXV A;  1XRY A;  4K3N A;  3VAR A;  1ZG7 A;  5LYL A;  3IWW A;  1ELL P;  3NFZ A;  3SJE A;  2NYQ A;  5LYI A;  3MN8 A;  2PVW A;  3S9N A;  3KHZ A;  3KZW A;  3FJU A;  2O4H A;  4OC4 A;  4PXD A;  1VHE A;  3CPA A;  4H2K A;  3PEI A;  5I4M A;  4BD9 A;  1TXR A;  3BI0 A;  2GLF A;  1CP7 A;  3SJG A;  1CPX A;  4P4J A;  2G9D A;  3NH5 A;  4B6Z A;  2Q51 A;  3CT9 A;  3DLJ A;  4PXE A;  1Y7E A;  3D67 A;  3LWU A;  4PPZ A;  1M4L A;  2GRE A;  1KWM A;  3K2K A;  2V8H A;  1YW6 A;  4ZX8 A;  1Y0R A;  3B3W A;  5D8N A;  3NH4 A;  2PJ9 A;  1BAV A;  3D66 A;  3B35 A;  2ANP A;  2ZOF A;  3T8W A;  1QQ9 A;  3PFO A;  1CX8 A;  3N5F A;  4P4F A;  2ZEF A;  4O23 A;  3I1U A;  2DEA A;  1Y0Y A;  3KQX A;  2ZEM A;  2JBJ A;  3S9M A;  1R43 A;  2PIY A;  5IB9 A;  2PJ5 A;  5LYF A;  4NJR A;  3TX8 A;  2ZEP A;  3V7Z A;  4NGT A;  1AMP A;  3RZA A;  5JH9 A;  4NFR A;  5K8P A;  1CPS A;  3SI1 A;  4IK2 A;  1VGY A;  2RB7 A;  3DGV A;  2ZEH A;  5THW A;  2ZOG A;  2PVV A;  3V38 A;  4TWE A;  4R76 A;  3D68 A;  4Z65 A;  1IGB A;  5LRK A;  3D7G A;  4TNU A;  1LOK A;  5LRJ A;  4YU9 A;  3B3S A;  2C1C A;  2NSM A;  3VH9 A;  3PBB A;  3H8F A;  3PFE A;  3FH4 A;  4P44 A;  4R6T A;  4DJL A;  4PXC A;  3IFE A;  3KHX A;  1LAP A;  2PJ0 A;  3ISX A;  1LAN A;  2POK A;  4ZY0 A;  4MRI A;  2ZED A;  2HB6 A;  4P4E A;  3GLJ A;  1IY7 A;  4JZ0 A;  1VIX A;  4ZI6 A;  1ZLH A;  2BO9 A;  4EWT A;  3HLP A;  4P10 A;  1YME A;  3WC7 A;  3WT4 A;  1FNO A;  2C6P A;  3B3V A;  5ELY A;  5F09 A;  2GLJ A;  3RBU A;  2F8H A;  2V8D A;  3KAS A;  4MCS A;  3SJF A;  4G1P A;  1JQG A;  4UEE A;  3CDX A;  3GUX A;  2WZN A;  4WJB A;  3KR5 A;  5HVG A;  2XEG A;  4MHN A;  5CBM A;  4F9V A;  2QVP A;  4OC1 A;  3FF3 A;  3FEC A;  3RAM A;  2PJA A;  4X2T A;  1ZLI A;  4IAV A;  1LFW A;  1YSJ A;  3IC1 A;  5K8N A;  3D7D A;  3D7H A;  4P4B A;  1HDQ A;  2XEF A;  8CPA A;  4ZY1 A;  1HEE A;  3SJX A;  4A94 A;  4NGN A;  3PB6 X;  4OKO A;  2VL1 A;  3PB4 X;  5K8O A;  3CPX A;  3BI1 A;  3FMC A;  3KQZ A;  5JM6 A;  2V8V A;  3ISZ A;  3PRT A;  7CPA A;  2AFU A;  2XEJ A;  1DE4 C;  1RTQ A;  4MHY A;  5LYD A;  1AYE A;  4NGR A;  2PJB A;  5DS0 A;  2IJZ A;  3KR4 A;  5JGF A;  4MCP A;  3B3T A;  2JEW A;  2PJ6 A;  1XMB A;  3PB7 X;  4LQG A;  4DYO A;  3FX6 A;  3HUV A;  3KL9 A;  4A37 A;  3WAB A;  4FBE A;  2FVG A;  4P45 A;  1ZG9 A;  3BHX A;  2AFW A;  3IO1 A;  4EFD A;  1TF9 A;  4FUU A;  1TKF A;  4UEF A;  1H8L A;  4F8Z A;  2CTB A;  2Q43 A;  4OP4 A;  2PJC A;  1BLL E;  4ZYQ A;  3L2N A;  4Q7A A;  1DTD A;  1ARL A;  4A38 A;  2OR4 A;  4MMO A;  2EWB A;  2PE3 A;  4ONW A;  1LCP A;  4OID A;  2AFM A;  1NSA A;  2EK8 A;  4P4D A;  1BPN A;  3PBE A;  3S9L A;  2QJ8 A;  2AFS A;  3LMS A;  2WYR A;  1ARM A;  3BXM A;  2JBK A;  4X8I A;  4A39 A;  2QYV A;  3SI2 A;  3PB9 X;  2J9A A;  3FED A;  4W9Y A;  1Z2L A;  3MRU A;  4UIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...