3FJUA

Ascaris suum carboxypeptidase inhibitor in complex with human carboxypeptidase a1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
RSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carboxypeptidase A1
publication title Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 307
sequence length 307
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fjuA00
2XEJA 5K8MA 2CF4A 1AYEA 1IY7A 1Z5RA 2PVWA 4X8IA 5HVFA 2OR4A 3IEHA 1ZG8A 2JBKA 4OKOA 1TXRA 2QVPA 3B3VA 7CPAA 1BPNA 5DS0A 2EK9A 4OC5A 1OBRA 4A37A 3KR4A 3D4UA 4UEEA 3N5FA 2V8GA 1YW4A 2GLFA 4UIBA 1Y0YA 4AXVA 3B3CA 3B35A 3DLJA 2NSMA 5IB9A 5J1QA 1BLLE 5CPAA 4NGTA 3FECA 3WABA 2PE3A 4YWYA 3PB8X 2ZELA 4ZX9A 2ZEGA 2F8HA 3MRUA 2OOTA 2I3CA 2RB7A 3NA6A 3FEEA 5LYLA 2XEGA 4OC1A 2ZENA 3RZAA 4TWEA 3NH4A 1FT7A 4OC0A 5I4MA 2AFMA 3PBBA 4NGRA 2IJZA 4MCQA 2PCUA 5THWA 2O4HA 4ZYQA 3PFOA 2PJ7A 2DEAA 1F2OA 4R6TA 3GUXA 3KASA 1H8LA 4MHNA 2PJ5A 3K2KA 1Z8LA 3B2YA 4P10A 3WT4A 3SJFA 4IAVA 3IIBA 1NSAA 3BXMA 4FUUA 4R8FA 5LYFA 2EWBA 3IO1A 2AFUA 2IMOA 3KHZA 2EK8A 3FJUA 4FBEA 4MXUA 3MN8A 4P4JA 4WJBA 3WC7A 4OIWA 5K8PA 2BO9A 2ZEDA 2C6PA 1ZLHA 4LQGA 2JBJA 3H8FA 3S9NA 4PXCA 4OC4A 3IJ3A 4EWTA 4NGPA 3SI2A 5F09A 1ZG9A 1ARMA 2PJCA 5JH9A 2VL1A 1TKJA 4ZY1A 4CPAA 3SI1A 3LMSA 3SI0A 2ZEPA 2IQ6A 3JRUA 4UF4A 2PJ8A 1XBUA 1DE4C 4NGNA 3B7IA 2GLJA 1EE3P 2BCOA 2ZOFA 3BI1A 3PB6X 4X2TA 2XEIA 3S9LA 2V8DA 4OMEA 2Q4ZA 2V8VA 3FH4A 3HUVA 4MRIA 1ZLIA 1Y7EA 3CPAA 4UIAA 4KSIA 3WC6A 4MMOA 3PRTA 4DUKA 3BHXA 3D67A 4BD9A 3B3WA 4P45A 1TF9A 3PFEA 4P4DA 3I1UA 1R3NA 3CDXA 2ZEFA 2AFWA 1CPXA 1QMUA 3KQXA 3PB4X 4IK2A 1CPSA 1JQGA 2C6GA 1M4LA 5HXDA 3K9TA 2BOAA 3D68A 3L2NA 4Z65A 5D29A 5CBMA 1XMBA 1GYTA 2PJ6A 3FVLA 3KZWA 3H8EA 3QNVA 4P44A 1F57A 1BPMA 4NGMA 5K8NA 1FNOA 1HDQA 4R76A 4ZY0A 4OP4A 8CPAA 5D8NA 2V8HA 3NH5A 1LANA 4PPZA 4JZ0A 2PJ9A 4MCSA 1KWMA 4P4BA 1VHEA 1CG2A 4WWVA 3RBUA 1VGYA 4UEZA 3PBEA 2ZEHA 5JM6A 4MHPA 3D7HA 3SJGA 1CX8A 4P4IA 3ISXA 1VIXA 3H8GA 1BAVA 1ZG7A 2WZNA 2PIZA 2AFXA 2F7VA 3PEIA 5HVGA 4F8ZA 4H2KA 4DYOA 4OIDA 3KHXA 1LAMA 3RAMA 2CTBA 4MCPA 2Q43A 4OC3A 2V77A 4TNUA 4YU9A 3HLPA 4PXBA 5HVHA 1CP6A 1CP7A 4P4EA 3D7DA 3B3SA 1LCPA 3KGQA 2ZOGA 2J9AA 1AMPA 4ZI6A 4PXDA 3S9MA 4Q7AA 2GU2A 3D7GA 1HEEA 2O53A 4IHMA 2POKA 4NFRA 3KL9A 3VARA 3KI9A 2AFZA 3GB0A 4A39A 1Q7LA 4O23A 5LRGA 3FEDA 2ZEOA 4P6YA 3D7FA 2FVGA 4F9UA 5LRJA 1Y0RA 1YSJA 4B6ZA 3IC1A 3FMCA 4GM5A 3WC5A 4F9VA 2PVVA 5JGFA 3CPXA 3PB7X 4NGQA 4X3RA 1TF8A 5K8OA 4NJRA 4ONWA 1QQ9A 6CPAA 3VH9A 4G1PA 5ELYA 3FX6A 4NJQA 5LYDA 2PJ1A 2CIJA 3IWWA 2C1CA 4ZX8A 1YMEA 2NYQA 2CTCA 2AFOA 3SJXA 2AFSA 4P4FA 3ISZA 2PJBA 2PJ2A 2RFHA 3FF3A 3TX8A 2PJ0A 4R7MA 1YLOA 4UEFA 1RTQA 4EFDA 3LWUA 2ABZA 3NH8A 1DTDA 1F2PA 2PJ3A 2GREA 3KR5A 3BI0A 3TC8A 1TKHA 3B3TA 3NFZA 1LAPA 4FAIA 2XEFA 4JYWA 4NGSA 1R43A 1CBXA 4A38A 2QJ8A 4K3NA 4PQAA 2PRQA 3DGVA 3D66A 1LFWA 1VHOA 3VATA 1PYTB 3SJEA 1PCAA 4OC2A 2JEWA 2QYVA 4MCRA 1YW6A 4PXEA 2PJAA 3CT9A 2PIYA 3V38A 1IGBA 2ANPA 4MHZA 2PJ4A 4ZY2A 1ARLA 4W9YA 2G9DA 4MHYA 4A94A 1ELMP 1XFOA 1HDUA 3T8WA 2HC9A 5LYIA 1ELLP 4FWUA 4EMEA 1XRYA 1LOKA 2C6CA 5LRKA 3IFEA 4RUHA 1TKFA 1UWYA 2WYRA 3PB9X 2ZEEA 2Q51A 3KQZA 1XJOA 1Z2LA 3V7ZA 4DJLA 3GLJA 2ZEMA 2HB6A
chains in the Genus database with same CATH superfamily
2XEJA 5K8MA 2CF4A 2FCKA 5IV0A 2YNCA 4KOSA 5A27A 1AYEA 1IY7A 1Z5RA 2PVWA 4X8IA 4CS0B 5HVFA 1U6MA 2CXAA 2OR4A 2OB0A 3DSBA 3IEHA 3PZJA 4M3SA 3NE7A 1ZG8A 2JBKA 4OKOA 4R87A 1TXRA 3IGRA 2QVPA 2Z3MA 4Q36A 3B3VA 3LACA 3TO6A 1M4GA 7CPAA 1M1DA 1BPNA 3D3SA 5DS0A 3WR7A 2EK9A 4OC5A 1OBRA 3JUWA 1X10A 4A37A 3KR4A 2ATRA 3D4UA 4UEEA 2PC1A 3N5FA 2GANA 4J3GA 4MFQA 4ZBGA 2V8GA 1YW4A 1OZPA 2GLFA 4UIBA 4Q38A 2Q7BA 1Y0YA 4AXVA 1R57A 3B3CA 3BLNA 3B35A 3DLJA 4KZTA 4R9MA 2VI7A 2HV2A 2NSMA 3FRMA 4KVXA 4L89A 5IB9A 1YVKA 5J1QA 1BLLE 4JD6A 5CPAA 3TOBA 5AG6A 4NGTA 3FECA 3WABA 5IB0A 4QB9A 2PE3A 4FD4A 5G1ZA 2VXKA 4YWYA 4C2YA 3PB8X 2ZELA 1M4IA 4ZX9A 2ZEGA 2F8HA 3MRUA 4CYQA 2OOTA 2R8VA 3JVNA 4AVAA 4C2XA 2I3CA 1RXTA 4HNWB 2RB7A 4H89A 2JLMA 3NA6A 1KZFA 2X7BA 5G22A 2VQYA 4M6IA 4CGLA 3KKWA 3D8PA 2PSWA 3FEEA 5LYLA 2XEGA 4X5KA 4OC1A 2ZENA 3RZAA 4TWEA 3NH4A 1FT7A 1ON0A 4OC0A 5I4MA 2AFMA 4B13A 3PBBA 2OZHA 2G3TA 2OU2A 4NGRA 2IJZA 2CNMA 4MCQA 1K4JA 2PCUA 5G20A 5THWA 2O4HA 4EVYA 3TE4A 4ZYQA 3PFOA 2PJ7A 4II9A 2DEAA 1F2OA 3I9SA 3GUXA 3KASA 1H8LA 4R6TA 1FY7A 3R1KA 4MHNA 2PJ5A 5E96A 3K2KA 1XE4A 1Z8LA 4IUSA 3B2YA 2Q44A 3PP9A 4P10A 1VHSA 3WT4A 4XPKA 3BJ7A 3SJFA 3FB3A 4IAVA 3IIBA 1NSAA 5HH1A 2PRBA 4CAXA 1RO5A 1V0CA 3BXMA 4UCMA 1JWQA 4NF1A 5DWMA 4FUUA 4R8FA 5F48A 5LYFA 2EWBA 4UWIA 4QVTA 3IO1A 3VWEA 1YLEA 2AFUA 4KSFA 2IMOA 3KHZA 3R9FA 2P0WA 1Z8XA 1Q2YA 2EK8A 3FJUA 4FBEA 5IX3A 3UY5A 2CNSA 2PQ8A 1P4NA 4F0XA 4MBUA 2J8NA 3MN8A 4MXUA 4P4JA 4WJBA 3WC7A 4AB7A 4OIWA 3R9EA 5K8PA 1MK4A 4QBJA 4ZGYB 3S6KA 4KVME 1GHEA 2BO9A 2ZEDA 2C6PA 2JDCA 3D2MA 4U9YA 1IB1E 3TOAA 3QAYA 4FD7A 1AUGA 1ZLHA 4LQGA 2JBJA 2RC4A 3H8FA 3S9NA 4PXCA 5J8FA 5DWNA 2OZUA 5AG4A 2GFQA 1YR0A 2Q4YA 3LODA 4NEXA 4UBRA 1WWZA 4C2ZA 4OC4A 2ZW4A 3IJ3A 4QUSA 4HNXB 3ZZIA 4A33A 4EWTA 4NGPA 3SI2A 5F09A 3DR8A 2FE7A 1Z8WA 1ZG9A 2GE3A 4UFXA 1ARMA 3P2FA 4MFPA 3CZXA 2Q7SA 5A28A 1IYLA 2PJCA 5JH9A 5EC4A 2VL1A 3DNSA 1TKJA 4UCPA 2FIWA 2FSRA 5KTCA 3DR6A 3VWDA 4ZY1A 4B5PA 4YFJA 4CPAA 3SI1A 2EBJA 3LMSA 3SI0A 2CNTA 2ZEPA 1KUVA 2IQ6A 4B14A 4Y49C 3JRUA 3S6FA 1PU9A 4KLWA 1Z9UA 4UF4A 2FS5A 2PJ8A 2YGWA 3FXTA 1XBUA 1J4JA 2NMTA 3T90A 4A2ZA 4B11A 1DE4C 4NGNA 3D2PA 4CGOA 2BSWA 3ZJ0A 2WPXA 4MFJA 1LRZA 4ORFA 2K5TA 1SQHA 1B6BA 3B7IA 2GLJA 2REFA 1EE3P 2BCOA 1YK3A 2ZOFA 3BI1A 3P2HA 3PB6X 4HNYB 2G3AA 3G8WA 4X2TA 2XEIA 3S9LA 2V8DA 4OMEA 2Q4ZA 3PGPA 2V8VA 3FH4A 3HUVA 4MRIA 1ZLIA 2QIRA 3QB8A 1Y7EA 2JEVA 3CPAA 5AGEA 4UIAA 4KSIA 3WC6A 1L0CA 2B3VA 4UCNA 3EO4A 4MMOA 4UA3A 4HKFA 4YRHA 5EBVA 3PRTA 4A95A 3BHXA 1S3ZA 4PK2A 3D67A 3EY5A 4AG7A 4BD9A 3B3WA 4DUKA 1B87A 4P45A 1TF9A 3PFEA 4P4DA 3I1UA 4B5PB 4CGMA 1R3NA 2VBQA 3CDXA 1ZO0A 2B4DA 2ZEFA 3W91A 1Y9KA 2AFWA 1CPXA 1QMUA 1Z4RA 3KQXA 3PB4X 4IK2A 1CPSA 1JQGA 2C6GA 1M4LA 3GKRA 4OLLA 5HXDA 3K9TA 2P6GA 2BOAA 4BBHA 3D68A 3CXPA 3L2NA 4Z65A 5D29A 5CBMA 1QSNA 1XMBA 1GYTA 2PJ6A 2PR8A 3FVLA 3H8EA 2Z0ZA 3KZWA 3QNVA 4KOXA 4P44A 1A2ZA 1F57A 3F5BA 1M44A 5GCNA 1BPMA 1S5KA 2B5GA 2P6FA 3C26A 4NGMA 1NSLA 1PUAA 5AG7A 3R96A 1YGHA 4U9ZA 5K8NA 4NXYA 1FNOA 1HDQA 4R76A 4YGOA 4Y49B 4ZY0A 2A4NA 4JXQA 4OP4A 8CPAA 5D8NA 2KCWA 4M6GA 1KUXA 2V8HA 3NH5A 1LANA 4JJXA 2HUZA 4PPZA 4JZ0A 2PJ9A 4MCSA 1S7FA 1KWMA 3EXNA 4P4BA 5F46A 1VHEA 1CG2A 4WWVA 3RBUA 3IWGA 4A32A 1Z4EA 1VGYA 2B4DB 2Z3KA 5BWAB 4UEZA 1X12A 2JDDA 3PBEA 4M6HA 1TIQA 2ZEHA 4MFZA 4MHPA 3SXNA 4C7IA 5JM6A 3D7HA 3SJGA 2GIVA 1CX8A 2O28A 2Q4VA 4P4IA 5AG5A 3ISXA 1QSRA 1VIXA 2F5IA 3H8GA 3NE8A 1BAVA 1ZG7A 2WZNA 2Y0MA 4OADA 4E2AA 2PIZA 2AFXA 3IU1A 2Z3LA 2F7VA 2YNDA 2B5GB 2YNEA 3GYAA 3PEIA 2ZW5A 4PV6A 4F6AA 5HVGA 4FD5A 4F8ZA 4CYPA 3LD2A 4DNCA 4H2KA 4CAEA 2Z10A 4KVOE 3IWEA 3G3SA 5H86A 1M4DA 4R3KA 4DYOA 4IF5A 3N7ZA 4OIDA 4UFVA 3DDDA 3KHXA 4KLVA 1LAMA 3RAMA 3OWCA 2CTBA 4MCPA 4I49A 2Q43A 3SXOA 4E8OA 4XNHC 4JWPA 4RI1A 4OC3A 3R95A 2ZXVA 5KTDA 2V77A 3CXSA 4MJ8A 2FIAA 3EC4A 4TNUA 4YU9A 3H5ZA 2P6EA 4PSWA 3HLPA 5F49A 4B10A 2C27A 1Q2CA 4PXBA 2Q04A 5HVHA 4A30A 1NE9A 4CAVA 3EFAA 4CAWA 1CP6A 2Z3OA 1YX0A 3GIUA 3FBUA 2VZYA 1CP7A 4P4EA 3QAHA 2EUIA 3D7DA 3B3SA 1LCPA 1VKCA 3KGQA 2ZOGA 2J9AA 3W6XA 1AMPA 1IOIA 3RYOA 4ZI6A 4PXDA 3S9MA 2OH1A 4KORA 4Q7AA 2GU2A 4XPLA 4LQ6A 3D7GA 4PK3A 2VEZA 1HEEA 4FD6A 1YQEA 1Z8TA 4R57A 4XPDC 2BUEA 2O53A 2DF5A 4CGNA 5I0CA 2WPWA 5CNPA 3CXQA 2BEIA 4IHMA 4LX9A 1IOFA 2POKA 4K30A 2J8MA 1N71A 4NFRA 3KL9A 3VARA 3KI9A 2AE6A 2AFZA 2EVNA 2J8RA 4KUAA 4NSQA 1YREA 3BJ8A 3GB0A 1CM0A 4JXRA 4UFWA 3TO9A 4A39A 1Q7LA 4QC6A 4B5OA 3TFYA 1XIXA 4O23A 4MI4A 3IU2A 5LRGA 4KS9A 3FEDA 2ZEOA 3F8KA 4MHDA 4P6YA 2IL4A 2FVGA 3D7FA 4F9UA 3F0AA 3S6GA 1Y9WA 4AVBA 4GS4A 5LRJA 1QSMA 1Y0RA 1YSJA 2WSAA 3FYNA 3IC1A 4B6ZA 3FIXA 3FMCA 4MY0A 4GM5A 4CAFA 4XNHB 4M85A 3WC5A 2PVVA 4F9VA 4H6ZA 5JGFA 3CPXA 3PB7X 4NGQA 3FNCA 4X3RA 1TF8A 5K8OA 3RO0A 1XEBA 2R98A 4NJRA 4ONWA 1QQ9A 6CPAA 3VH9A 4G1PA 5ELYA 2B4BA 3FX6A 5HMNA 5JQ4A 4NJQA 4L8AA 5LYDA 4E0AA 3TT2A 2PJ1A 2CIJA 3K9UA 1XF8A 3IWWA 4AVCA 5H84A 2C1CA 2Z11A 4ZX8A 1YMEA 2NYQA 1BOBA 2CTCA 1KUYA 2AFOA 3TTHA 3SJXA 2ODFA 4RS2A 4B12A 2AFSA 5C88A 4LUAA 4P4FA 3ISZA 1Q2DA 1S7NA 2FXFA 2PJ2A 2PJBA 2Q0YA 2RFHA 3FF3A 2Z3PA 2PJ0A 5F47A 3RNZA 3TX8A 4R7MA 3TO7A 4XPDB 1YLOA 4UEFA 1RTQA 4EFDA 4MFKA 4U5YA 3LWUA 5KTAA 1I21A 3A9LA 2ABZA 4PSXA 1YVOA 3NH8A 1DTDA 4KUBA 3E0KA 1F2PA 4RN7A 3SHPA 2PJ3A 2GREA 4KOYA 1BO4A 5EMIA 1I1DA 4HPSA 3KR5A 1MJ9A 3BI0A 3TC8A 1TKHA 1XMTA 4C7HA 3MGDA 2ARHA 3B3TA 4CRZB 4GXHA 3H4QA 1LAPA 2OZGA 3NFZA 2DXQA 1MJBA 1CJWA 3R9GA 4F0YA 4FAIA 2ZW6A 1IIDA 2XEFA 4JYWA 4BINA 4NGSA 5FVJA 3GY9A 1R43A 1CBXA 1S60A 3TCVA 4A38A 2QJ8A 4K3NA 4PQAA 2PRQA 3DGVA 2D4OA 3D66A 1LFWA 3S6HA 1VHOA 2H5MA 3VATA 1QSOA 1IYKA 1PYTB 1IICA 4UWJA 4MY3A 4A31A 3I3GA 3SJEA 1PCAA 4OC2A 2JEWA 1NMTA 2ZW7A 2HQYA 5JPHA 2QYVA 2B3UA 4MCRA 3B8GA 2DPTA 2VZZA 4C68A 1YW6A 4KSAA 4PXEA 2PJAA 4MFLA 3CT9A 2PIYA 3V38A 1IGBA 4H6UA 2ANPA 4MHZA 2PJ4A 1S7LA 2WUUA 2I79A 2DPSA 1ARLA 4W9YA 2G9DA 4ZY2A 2QECA 4ONUA 2PR1A 4OAEA 4MHYA 2EO8A 4CRYB 4A94A 1ELMP 2PDOA 2R7HA 1P0HA 1XFOA 1HDUA 1IU8A 2REEA 1XOVA 4R3LA 2HC9A 5LYIA 3T9YA 3T8WA 1S7KA 3JTKA 2FL4A 1ELLP 4CYOA 3W6SA 4FWUA 5C82A 3V8IA 4EMEA 1XRYA 1Y7RA 1LOKA 2FT0A 2B58A 2G0BA 2YNCC 2C6CA 5G21A 5LRKA 1UFHA 4BMHA 2AJ6A 3IFEA 4KOVA 4RUHA 2I00A 2R1IA 2Z3NA 2BL1A 1TKFA 1UWYA 4AG9A 4NCZA 1QSTA 2WYRA 3PB9X 1WK4A 5J8CA 1MJAA 1I12A 2QMLA 2ZEEA 2CY2A 4KOTA 2Q51A 4CGPA 3KQZA 1XJOA 5ISVA 2D4PA 1Z2LA 4KOUA 3V7ZA 4CYNA 4JLYA 4DJLA 2ZPAA 3GLJA 4KOWA 2ZEMA 2HB6A
chains in the Genus database with same CATH topology
2XEJA 5K8MA 2CF4A 1AYEA 1IY7A 1Z5RA 2PVWA 4X8IA 5HVFA 2OR4A 3IEHA 1ZG8A 2JBKA 4OKOA 1TXRA 2QVPA 3B3VA 7CPAA 1BPNA 5DS0A 2EK9A 4OC5A 1OBRA 4A37A 3KR4A 3D4UA 4UEEA 3N5FA 2V8GA 1YW4A 2GLFA 4UIBA 1Y0YA 4AXVA 3B3CA 3B35A 3DLJA 2NSMA 5IB9A 5J1QA 1BLLE 5CPAA 4NGTA 3FECA 3WABA 2PE3A 4YWYA 3PB8X 2ZELA 4ZX9A 2ZEGA 2F8HA 3MRUA 2OOTA 2I3CA 2RB7A 3NA6A 3FEEA 5LYLA 2XEGA 4OC1A 2ZENA 3RZAA 4TWEA 3NH4A 1FT7A 4OC0A 5I4MA 2AFMA 3PBBA 4NGRA 2IJZA 4MCQA 2PCUA 5THWA 2O4HA 4ZYQA 3PFOA 2PJ7A 2DEAA 1F2OA 4R6TA 3GUXA 3KASA 1H8LA 4MHNA 2PJ5A 3K2KA 1Z8LA 3B2YA 4P10A 3WT4A 3SJFA 4IAVA 3IIBA 1NSAA 3BXMA 4FUUA 4R8FA 5LYFA 2EWBA 3IO1A 2AFUA 2IMOA 3KHZA 2EK8A 3FJUA 4FBEA 4MXUA 3MN8A 4P4JA 4WJBA 3WC7A 4OIWA 5K8PA 2BO9A 2ZEDA 2C6PA 1ZLHA 4LQGA 2JBJA 3H8FA 3S9NA 4PXCA 4OC4A 3IJ3A 4EWTA 4NGPA 3SI2A 5F09A 1ZG9A 1ARMA 2PJCA 5JH9A 2VL1A 1TKJA 4ZY1A 4CPAA 3SI1A 3LMSA 3SI0A 2ZEPA 2IQ6A 3JRUA 4UF4A 2PJ8A 1XBUA 1DE4C 4NGNA 3B7IA 2GLJA 1EE3P 2BCOA 2ZOFA 3BI1A 3PB6X 4X2TA 2XEIA 3S9LA 2V8DA 4OMEA 2Q4ZA 2V8VA 3FH4A 3HUVA 4MRIA 1ZLIA 1Y7EA 3CPAA 4UIAA 4KSIA 3WC6A 4MMOA 3PRTA 4DUKA 3BHXA 3D67A 4BD9A 3B3WA 4P45A 1TF9A 3PFEA 4P4DA 3I1UA 1R3NA 3CDXA 2ZEFA 2AFWA 1CPXA 1QMUA 3KQXA 3PB4X 4IK2A 1CPSA 1JQGA 2C6GA 1M4LA 5HXDA 3K9TA 2BOAA 3D68A 3L2NA 4Z65A 5D29A 5CBMA 1XMBA 1GYTA 2PJ6A 3FVLA 3KZWA 3H8EA 3QNVA 4P44A 1F57A 1BPMA 4NGMA 5K8NA 1FNOA 1HDQA 4R76A 4ZY0A 4OP4A 8CPAA 5D8NA 2V8HA 3NH5A 1LANA 4PPZA 4JZ0A 2PJ9A 4MCSA 1KWMA 4P4BA 1VHEA 1CG2A 4WWVA 3RBUA 1VGYA 4UEZA 3PBEA 2ZEHA 5JM6A 4MHPA 3D7HA 3SJGA 1CX8A 4P4IA 3ISXA 1VIXA 3H8GA 1BAVA 1ZG7A 2WZNA 2PIZA 2AFXA 2F7VA 3PEIA 5HVGA 4F8ZA 4H2KA 4DYOA 4OIDA 3KHXA 1LAMA 3RAMA 2CTBA 4MCPA 2Q43A 4OC3A 2V77A 4TNUA 4YU9A 3HLPA 4PXBA 5HVHA 1CP6A 1CP7A 4P4EA 3D7DA 3B3SA 1LCPA 3KGQA 2ZOGA 2J9AA 1AMPA 4ZI6A 4PXDA 3S9MA 4Q7AA 2GU2A 3D7GA 1HEEA 2O53A 4IHMA 2POKA 4NFRA 3KL9A 3VARA 3KI9A 2AFZA 3GB0A 4A39A 1Q7LA 4O23A 5LRGA 3FEDA 2ZEOA 4P6YA 3D7FA 2FVGA 4F9UA 5LRJA 1Y0RA 1YSJA 4B6ZA 3IC1A 3FMCA 4GM5A 3WC5A 4F9VA 2PVVA 5JGFA 3CPXA 3PB7X 4NGQA 4X3RA 1TF8A 5K8OA 4NJRA 4ONWA 1QQ9A 6CPAA 3VH9A 4G1PA 5ELYA 3FX6A 4NJQA 5LYDA 2PJ1A 2CIJA 3IWWA 2C1CA 4ZX8A 1YMEA 2NYQA 2CTCA 2AFOA 3SJXA 2AFSA 4P4FA 3ISZA 2PJBA 2PJ2A 2RFHA 3FF3A 3TX8A 2PJ0A 4R7MA 1YLOA 4UEFA 1RTQA 4EFDA 3LWUA 2ABZA 3NH8A 1DTDA 1F2PA 2PJ3A 2GREA 3KR5A 3BI0A 3TC8A 1TKHA 3B3TA 3NFZA 1LAPA 4FAIA 2XEFA 4JYWA 4NGSA 1R43A 1CBXA 4A38A 2QJ8A 4K3NA 4PQAA 2PRQA 3DGVA 3D66A 1LFWA 1VHOA 3VATA 1PYTB 3SJEA 1PCAA 4OC2A 2JEWA 2QYVA 4MCRA 1YW6A 4PXEA 2PJAA 3CT9A 2PIYA 3V38A 1IGBA 2ANPA 4MHZA 2PJ4A 4ZY2A 1ARLA 4W9YA 2G9DA 4MHYA 4A94A 1ELMP 1XFOA 1HDUA 3T8WA 2HC9A 5LYIA 1ELLP 4FWUA 4EMEA 1XRYA 1LOKA 2C6CA 5LRKA 3IFEA 4RUHA 1TKFA 1UWYA 2WYRA 3PB9X 2ZEEA 2Q51A 3KQZA 1XJOA 1Z2LA 3V7ZA 4DJLA 3GLJA 2ZEMA 2HB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEJ A;  5K8M A;  2CF4 A;  1AYE A;  1IY7 A;  1Z5R A;  2PVW A;  4X8I A;  5HVF A;  2OR4 A;  3IEH A;  1ZG8 A;  2JBK A;  4OKO A;  1TXR A;  2QVP A;  3B3V A;  7CPA A;  1BPN A;  5DS0 A;  2EK9 A;  4OC5 A;  1OBR A;  4A37 A;  3KR4 A;  3D4U A;  4UEE A;  3N5F A;  2V8G A;  1YW4 A;  2GLF A;  4UIB A;  1Y0Y A;  4AXV A;  3B3C A;  3B35 A;  3DLJ A;  2NSM A;  5IB9 A;  5J1Q A;  1BLL E;  5CPA A;  4NGT A;  3FEC A;  3WAB A;  2PE3 A;  4YWY A;  3PB8 X;  2ZEL A;  4ZX9 A;  2ZEG A;  2F8H A;  3MRU A;  2OOT A;  2I3C A;  2RB7 A;  3NA6 A;  3FEE A;  5LYL A;  2XEG A;  4OC1 A;  2ZEN A;  3RZA A;  4TWE A;  3NH4 A;  1FT7 A;  4OC0 A;  5I4M A;  2AFM A;  3PBB A;  4NGR A;  2IJZ A;  4MCQ A;  2PCU A;  5THW A;  2O4H A;  4ZYQ A;  3PFO A;  2PJ7 A;  2DEA A;  1F2O A;  4R6T A;  3GUX A;  3KAS A;  1H8L A;  4MHN A;  2PJ5 A;  3K2K A;  1Z8L A;  3B2Y A;  4P10 A;  3WT4 A;  3SJF A;  4IAV A;  3IIB A;  1NSA A;  3BXM A;  4FUU A;  4R8F A;  5LYF A;  2EWB A;  3IO1 A;  2AFU A;  2IMO A;  3KHZ A;  2EK8 A;  3FJU A;  4FBE A;  4MXU A;  3MN8 A;  4P4J A;  4WJB A;  3WC7 A;  4OIW A;  5K8P A;  2BO9 A;  2ZED A;  2C6P A;  1ZLH A;  4LQG A;  2JBJ A;  3H8F A;  3S9N A;  4PXC A;  4OC4 A;  3IJ3 A;  4EWT A;  4NGP A;  3SI2 A;  5F09 A;  1ZG9 A;  1ARM A;  2PJC A;  5JH9 A;  2VL1 A;  1TKJ A;  4ZY1 A;  4CPA A;  3SI1 A;  3LMS A;  3SI0 A;  2ZEP A;  2IQ6 A;  3JRU A;  4UF4 A;  2PJ8 A;  1XBU A;  1DE4 C;  4NGN A;  3B7I A;  2GLJ A;  1EE3 P;  2BCO A;  2ZOF A;  3BI1 A;  3PB6 X;  4X2T A;  2XEI A;  3S9L A;  2V8D A;  4OME A;  2Q4Z A;  2V8V A;  3FH4 A;  3HUV A;  4MRI A;  1ZLI A;  1Y7E A;  3CPA A;  4UIA A;  4KSI A;  3WC6 A;  4MMO A;  3PRT A;  4DUK A;  3BHX A;  3D67 A;  4BD9 A;  3B3W A;  4P45 A;  1TF9 A;  3PFE A;  4P4D A;  3I1U A;  1R3N A;  3CDX A;  2ZEF A;  2AFW A;  1CPX A;  1QMU A;  3KQX A;  3PB4 X;  4IK2 A;  1CPS A;  1JQG A;  2C6G A;  1M4L A;  5HXD A;  3K9T A;  2BOA A;  3D68 A;  3L2N A;  4Z65 A;  5D29 A;  5CBM A;  1XMB A;  1GYT A;  2PJ6 A;  3FVL A;  3KZW A;  3H8E A;  3QNV A;  4P44 A;  1F57 A;  1BPM A;  4NGM A;  5K8N A;  1FNO A;  1HDQ A;  4R76 A;  4ZY0 A;  4OP4 A;  8CPA A;  5D8N A;  2V8H A;  3NH5 A;  1LAN A;  4PPZ A;  4JZ0 A;  2PJ9 A;  4MCS A;  1KWM A;  4P4B A;  1VHE A;  1CG2 A;  4WWV A;  3RBU A;  1VGY A;  4UEZ A;  3PBE A;  2ZEH A;  5JM6 A;  4MHP A;  3D7H A;  3SJG A;  1CX8 A;  4P4I A;  3ISX A;  1VIX A;  3H8G A;  1BAV A;  1ZG7 A;  2WZN A;  2PIZ A;  2AFX A;  2F7V A;  3PEI A;  5HVG A;  4F8Z A;  4H2K A;  4DYO A;  4OID A;  3KHX A;  1LAM A;  3RAM A;  2CTB A;  4MCP A;  2Q43 A;  4OC3 A;  2V77 A;  4TNU A;  4YU9 A;  3HLP A;  4PXB A;  5HVH A;  1CP6 A;  1CP7 A;  4P4E A;  3D7D A;  3B3S A;  1LCP A;  3KGQ A;  2ZOG A;  2J9A A;  1AMP A;  4ZI6 A;  4PXD A;  3S9M A;  4Q7A A;  2GU2 A;  3D7G A;  1HEE A;  2O53 A;  4IHM A;  2POK A;  4NFR A;  3KL9 A;  3VAR A;  3KI9 A;  2AFZ A;  3GB0 A;  4A39 A;  1Q7L A;  4O23 A;  5LRG A;  3FED A;  2ZEO A;  4P6Y A;  3D7F A;  2FVG A;  4F9U A;  5LRJ A;  1Y0R A;  1YSJ A;  4B6Z A;  3IC1 A;  3FMC A;  4GM5 A;  3WC5 A;  4F9V A;  2PVV A;  5JGF A;  3CPX A;  3PB7 X;  4NGQ A;  4X3R A;  1TF8 A;  5K8O A;  4NJR A;  4ONW A;  1QQ9 A;  6CPA A;  3VH9 A;  4G1P A;  5ELY A;  3FX6 A;  4NJQ A;  5LYD A;  2PJ1 A;  2CIJ A;  3IWW A;  2C1C A;  4ZX8 A;  1YME A;  2NYQ A;  2CTC A;  2AFO A;  3SJX A;  2AFS A;  4P4F A;  3ISZ A;  2PJB A;  2PJ2 A;  2RFH A;  3FF3 A;  3TX8 A;  2PJ0 A;  4R7M A;  1YLO A;  4UEF A;  1RTQ A;  4EFD A;  3LWU A;  2ABZ A;  3NH8 A;  1DTD A;  1F2P A;  2PJ3 A;  2GRE A;  3KR5 A;  3BI0 A;  3TC8 A;  1TKH A;  3B3T A;  3NFZ A;  1LAP A;  4FAI A;  2XEF A;  4JYW A;  4NGS A;  1R43 A;  1CBX A;  4A38 A;  2QJ8 A;  4K3N A;  4PQA A;  2PRQ A;  3DGV A;  3D66 A;  1LFW A;  1VHO A;  3VAT A;  1PYT B;  3SJE A;  1PCA A;  4OC2 A;  2JEW A;  2QYV A;  4MCR A;  1YW6 A;  4PXE A;  2PJA A;  3CT9 A;  2PIY A;  3V38 A;  1IGB A;  2ANP A;  4MHZ A;  2PJ4 A;  4ZY2 A;  1ARL A;  4W9Y A;  2G9D A;  4MHY A;  4A94 A;  1ELM P;  1XFO A;  1HDU A;  3T8W A;  2HC9 A;  5LYI A;  1ELL P;  4FWU A;  4EME A;  1XRY A;  1LOK A;  2C6C A;  5LRK A;  3IFE A;  4RUH A;  1TKF A;  1UWY A;  2WYR A;  3PB9 X;  2ZEE A;  2Q51 A;  3KQZ A;  1XJO A;  1Z2L A;  3V7Z A;  4DJL A;  3GLJ A;  2ZEM A;  2HB6 A; 
#chains in the Genus database with same CATH topology
 2XEJ A;  5K8M A;  2CF4 A;  2FCK A;  5IV0 A;  2YNC A;  4KOS A;  5A27 A;  1AYE A;  1IY7 A;  1Z5R A;  2PVW A;  4X8I A;  4CS0 B;  5HVF A;  1U6M A;  2CXA A;  2OR4 A;  2OB0 A;  3DSB A;  3IEH A;  3PZJ A;  4M3S A;  3NE7 A;  1ZG8 A;  2JBK A;  4OKO A;  4R87 A;  1TXR A;  3IGR A;  2QVP A;  2Z3M A;  4Q36 A;  3B3V A;  3LAC A;  3TO6 A;  1M4G A;  7CPA A;  1M1D A;  1BPN A;  3D3S A;  5DS0 A;  3WR7 A;  2EK9 A;  4OC5 A;  1OBR A;  3JUW A;  1X10 A;  4A37 A;  3KR4 A;  2ATR A;  3D4U A;  4UEE A;  2PC1 A;  3N5F A;  2GAN A;  4J3G A;  4MFQ A;  4ZBG A;  2V8G A;  1YW4 A;  1OZP A;  2GLF A;  4UIB A;  4Q38 A;  2Q7B A;  1Y0Y A;  4AXV A;  1R57 A;  3B3C A;  3BLN A;  3B35 A;  3DLJ A;  4KZT A;  4R9M A;  2VI7 A;  2HV2 A;  2NSM A;  3FRM A;  4KVX A;  4L89 A;  5IB9 A;  1YVK A;  5J1Q A;  1BLL E;  4JD6 A;  5CPA A;  3TOB A;  5AG6 A;  4NGT A;  3FEC A;  3WAB A;  5IB0 A;  4QB9 A;  2PE3 A;  4FD4 A;  5G1Z A;  2VXK A;  4YWY A;  4C2Y A;  3PB8 X;  2ZEL A;  1M4I A;  4ZX9 A;  2ZEG A;  2F8H A;  3MRU A;  4CYQ A;  2OOT A;  2R8V A;  3JVN A;  4AVA A;  4C2X A;  2I3C A;  1RXT A;  4HNW B;  2RB7 A;  4H89 A;  2JLM A;  3NA6 A;  1KZF A;  2X7B A;  5G22 A;  2VQY A;  4M6I A;  4CGL A;  3KKW A;  3D8P A;  2PSW A;  3FEE A;  5LYL A;  2XEG A;  4X5K A;  4OC1 A;  2ZEN A;  3RZA A;  4TWE A;  3NH4 A;  1FT7 A;  1ON0 A;  4OC0 A;  5I4M A;  2AFM A;  4B13 A;  3PBB A;  2OZH A;  2G3T A;  2OU2 A;  4NGR A;  2IJZ A;  2CNM A;  4MCQ A;  1K4J A;  2PCU A;  5G20 A;  5THW A;  2O4H A;  4EVY A;  3TE4 A;  4ZYQ A;  3PFO A;  2PJ7 A;  4II9 A;  2DEA A;  1F2O A;  3I9S A;  3GUX A;  3KAS A;  1H8L A;  4R6T A;  1FY7 A;  3R1K A;  4MHN A;  2PJ5 A;  5E96 A;  3K2K A;  1XE4 A;  1Z8L A;  4IUS A;  3B2Y A;  2Q44 A;  3PP9 A;  4P10 A;  1VHS A;  3WT4 A;  4XPK A;  3BJ7 A;  3SJF A;  3FB3 A;  4IAV A;  3IIB A;  1NSA A;  5HH1 A;  2PRB A;  4CAX A;  1RO5 A;  1V0C A;  3BXM A;  4UCM A;  1JWQ A;  4NF1 A;  5DWM A;  4FUU A;  4R8F A;  5F48 A;  5LYF A;  2EWB A;  4UWI A;  4QVT A;  3IO1 A;  3VWE A;  1YLE A;  2AFU A;  4KSF A;  2IMO A;  3KHZ A;  3R9F A;  2P0W A;  1Z8X A;  1Q2Y A;  2EK8 A;  3FJU A;  4FBE A;  5IX3 A;  3UY5 A;  2CNS A;  2PQ8 A;  1P4N A;  4F0X A;  4MBU A;  2J8N A;  3MN8 A;  4MXU A;  4P4J A;  4WJB A;  3WC7 A;  4AB7 A;  4OIW A;  3R9E A;  5K8P A;  1MK4 A;  4QBJ A;  4ZGY B;  3S6K A;  4KVM E;  1GHE A;  2BO9 A;  2ZED A;  2C6P A;  2JDC A;  3D2M A;  4U9Y A;  1IB1 E;  3TOA A;  3QAY A;  4FD7 A;  1AUG A;  1ZLH A;  4LQG A;  2JBJ A;  2RC4 A;  3H8F A;  3S9N A;  4PXC A;  5J8F A;  5DWN A;  2OZU A;  5AG4 A;  2GFQ A;  1YR0 A;  2Q4Y A;  3LOD A;  4NEX A;  4UBR A;  1WWZ A;  4C2Z A;  4OC4 A;  2ZW4 A;  3IJ3 A;  4QUS A;  4HNX B;  3ZZI A;  4A33 A;  4EWT A;  4NGP A;  3SI2 A;  5F09 A;  3DR8 A;  2FE7 A;  1Z8W A;  1ZG9 A;  2GE3 A;  4UFX A;  1ARM A;  3P2F A;  4MFP A;  3CZX A;  2Q7S A;  5A28 A;  1IYL A;  2PJC A;  5JH9 A;  5EC4 A;  2VL1 A;  3DNS A;  1TKJ A;  4UCP A;  2FIW A;  2FSR A;  5KTC A;  3DR6 A;  3VWD A;  4ZY1 A;  4B5P A;  4YFJ A;  4CPA A;  3SI1 A;  2EBJ A;  3LMS A;  3SI0 A;  2CNT A;  2ZEP A;  1KUV A;  2IQ6 A;  4B14 A;  4Y49 C;  3JRU A;  3S6F A;  1PU9 A;  4KLW A;  1Z9U A;  4UF4 A;  2FS5 A;  2PJ8 A;  2YGW A;  3FXT A;  1XBU A;  1J4J A;  2NMT A;  3T90 A;  4A2Z A;  4B11 A;  1DE4 C;  4NGN A;  3D2P A;  4CGO A;  2BSW A;  3ZJ0 A;  2WPX A;  4MFJ A;  1LRZ A;  4ORF A;  2K5T A;  1SQH A;  1B6B A;  3B7I A;  2GLJ A;  2REF A;  1EE3 P;  2BCO A;  1YK3 A;  2ZOF A;  3BI1 A;  3P2H A;  3PB6 X;  4HNY B;  2G3A A;  3G8W A;  4X2T A;  2XEI A;  3S9L A;  2V8D A;  4OME A;  2Q4Z A;  3PGP A;  2V8V A;  3FH4 A;  3HUV A;  4MRI A;  1ZLI A;  2QIR A;  3QB8 A;  1Y7E A;  2JEV A;  3CPA A;  5AGE A;  4UIA A;  4KSI A;  3WC6 A;  1L0C A;  2B3V A;  4UCN A;  3EO4 A;  4MMO A;  4UA3 A;  4HKF A;  4YRH A;  5EBV A;  3PRT A;  4A95 A;  3BHX A;  1S3Z A;  4PK2 A;  3D67 A;  3EY5 A;  4AG7 A;  4BD9 A;  3B3W A;  4DUK A;  1B87 A;  4P45 A;  1TF9 A;  3PFE A;  4P4D A;  3I1U A;  4B5P B;  4CGM A;  1R3N A;  2VBQ A;  3CDX A;  1ZO0 A;  2B4D A;  2ZEF A;  3W91 A;  1Y9K A;  2AFW A;  1CPX A;  1QMU A;  1Z4R A;  3KQX A;  3PB4 X;  4IK2 A;  1CPS A;  1JQG A;  2C6G A;  1M4L A;  3GKR A;  4OLL A;  5HXD A;  3K9T A;  2P6G A;  2BOA A;  4BBH A;  3D68 A;  3CXP A;  3L2N A;  4Z65 A;  5D29 A;  5CBM A;  1QSN A;  1XMB A;  1GYT A;  2PJ6 A;  2PR8 A;  3FVL A;  3H8E A;  2Z0Z A;  3KZW A;  3QNV A;  4KOX A;  4P44 A;  1A2Z A;  1F57 A;  3F5B A;  1M44 A;  5GCN A;  1BPM A;  1S5K A;  2B5G A;  2P6F A;  3C26 A;  4NGM A;  1NSL A;  1PUA A;  5AG7 A;  3R96 A;  1YGH A;  4U9Z A;  5K8N A;  4NXY A;  1FNO A;  1HDQ A;  4R76 A;  4YGO A;  4Y49 B;  4ZY0 A;  2A4N A;  4JXQ A;  4OP4 A;  8CPA A;  5D8N A;  2KCW A;  4M6G A;  1KUX A;  2V8H A;  3NH5 A;  1LAN A;  4JJX A;  2HUZ A;  4PPZ A;  4JZ0 A;  2PJ9 A;  4MCS A;  1S7F A;  1KWM A;  3EXN A;  4P4B A;  5F46 A;  1VHE A;  1CG2 A;  4WWV A;  3RBU A;  3IWG A;  4A32 A;  1Z4E A;  1VGY A;  2B4D B;  2Z3K A;  5BWA B;  4UEZ A;  1X12 A;  2JDD A;  3PBE A;  4M6H A;  1TIQ A;  2ZEH A;  4MFZ A;  4MHP A;  3SXN A;  4C7I A;  5JM6 A;  3D7H A;  3SJG A;  2GIV A;  1CX8 A;  2O28 A;  2Q4V A;  4P4I A;  5AG5 A;  3ISX A;  1QSR A;  1VIX A;  2F5I A;  3H8G A;  3NE8 A;  1BAV A;  1ZG7 A;  2WZN A;  2Y0M A;  4OAD A;  4E2A A;  2PIZ A;  2AFX A;  3IU1 A;  2Z3L A;  2F7V A;  2YND A;  2B5G B;  2YNE A;  3GYA A;  3PEI A;  2ZW5 A;  4PV6 A;  4F6A A;  5HVG A;  4FD5 A;  4F8Z A;  4CYP A;  3LD2 A;  4DNC A;  4H2K A;  4CAE A;  2Z10 A;  4KVO E;  3IWE A;  3G3S A;  5H86 A;  1M4D A;  4R3K A;  4DYO A;  4IF5 A;  3N7Z A;  4OID A;  4UFV A;  3DDD A;  3KHX A;  4KLV A;  1LAM A;  3RAM A;  3OWC A;  2CTB A;  4MCP A;  4I49 A;  2Q43 A;  3SXO A;  4E8O A;  4XNH C;  4JWP A;  4RI1 A;  4OC3 A;  3R95 A;  2ZXV A;  5KTD A;  2V77 A;  3CXS A;  4MJ8 A;  2FIA A;  3EC4 A;  4TNU A;  4YU9 A;  3H5Z A;  2P6E A;  4PSW A;  3HLP A;  5F49 A;  4B10 A;  2C27 A;  1Q2C A;  4PXB A;  2Q04 A;  5HVH A;  4A30 A;  1NE9 A;  4CAV A;  3EFA A;  4CAW A;  1CP6 A;  2Z3O A;  1YX0 A;  3GIU A;  3FBU A;  2VZY A;  1CP7 A;  4P4E A;  3QAH A;  2EUI A;  3D7D A;  3B3S A;  1LCP A;  1VKC A;  3KGQ A;  2ZOG A;  2J9A A;  3W6X A;  1AMP A;  1IOI A;  3RYO A;  4ZI6 A;  4PXD A;  3S9M A;  2OH1 A;  4KOR A;  4Q7A A;  2GU2 A;  4XPL A;  4LQ6 A;  3D7G A;  4PK3 A;  2VEZ A;  1HEE A;  4FD6 A;  1YQE A;  1Z8T A;  4R57 A;  4XPD C;  2BUE A;  2O53 A;  2DF5 A;  4CGN A;  5I0C A;  2WPW A;  5CNP A;  3CXQ A;  2BEI A;  4IHM A;  4LX9 A;  1IOF A;  2POK A;  4K30 A;  2J8M A;  1N71 A;  4NFR A;  3KL9 A;  3VAR A;  3KI9 A;  2AE6 A;  2AFZ A;  2EVN A;  2J8R A;  4KUA A;  4NSQ A;  1YRE A;  3BJ8 A;  3GB0 A;  1CM0 A;  4JXR A;  4UFW A;  3TO9 A;  4A39 A;  1Q7L A;  4QC6 A;  4B5O A;  3TFY A;  1XIX A;  4O23 A;  4MI4 A;  3IU2 A;  5LRG A;  4KS9 A;  3FED A;  2ZEO A;  3F8K A;  4MHD A;  4P6Y A;  2IL4 A;  2FVG A;  3D7F A;  4F9U A;  3F0A A;  3S6G A;  1Y9W A;  4AVB A;  4GS4 A;  5LRJ A;  1QSM A;  1Y0R A;  1YSJ A;  2WSA A;  3FYN A;  3IC1 A;  4B6Z A;  3FIX A;  3FMC A;  4MY0 A;  4GM5 A;  4CAF A;  4XNH B;  4M85 A;  3WC5 A;  2PVV A;  4F9V A;  4H6Z A;  5JGF A;  3CPX A;  3PB7 X;  4NGQ A;  3FNC A;  4X3R A;  1TF8 A;  5K8O A;  3RO0 A;  1XEB A;  2R98 A;  4NJR A;  4ONW A;  1QQ9 A;  6CPA A;  3VH9 A;  4G1P A;  5ELY A;  2B4B A;  3FX6 A;  5HMN A;  5JQ4 A;  4NJQ A;  4L8A A;  5LYD A;  4E0A A;  3TT2 A;  2PJ1 A;  2CIJ A;  3K9U A;  1XF8 A;  3IWW A;  4AVC A;  5H84 A;  2C1C A;  2Z11 A;  4ZX8 A;  1YME A;  2NYQ A;  1BOB A;  2CTC A;  1KUY A;  2AFO A;  3TTH A;  3SJX A;  2ODF A;  4RS2 A;  4B12 A;  2AFS A;  5C88 A;  4LUA A;  4P4F A;  3ISZ A;  1Q2D A;  1S7N A;  2FXF A;  2PJ2 A;  2PJB A;  2Q0Y A;  2RFH A;  3FF3 A;  2Z3P A;  2PJ0 A;  5F47 A;  3RNZ A;  3TX8 A;  4R7M A;  3TO7 A;  4XPD B;  1YLO A;  4UEF A;  1RTQ A;  4EFD A;  4MFK A;  4U5Y A;  3LWU A;  5KTA A;  1I21 A;  3A9L A;  2ABZ A;  4PSX A;  1YVO A;  3NH8 A;  1DTD A;  4KUB A;  3E0K A;  1F2P A;  4RN7 A;  3SHP A;  2PJ3 A;  2GRE A;  4KOY A;  1BO4 A;  5EMI A;  1I1D A;  4HPS A;  3KR5 A;  1MJ9 A;  3BI0 A;  3TC8 A;  1TKH A;  1XMT A;  4C7H A;  3MGD A;  2ARH A;  3B3T A;  4CRZ B;  4GXH A;  3H4Q A;  1LAP A;  2OZG A;  3NFZ A;  2DXQ A;  1MJB A;  1CJW A;  3R9G A;  4F0Y A;  4FAI A;  2ZW6 A;  1IID A;  2XEF A;  4JYW A;  4BIN A;  4NGS A;  5FVJ A;  3GY9 A;  1R43 A;  1CBX A;  1S60 A;  3TCV A;  4A38 A;  2QJ8 A;  4K3N A;  4PQA A;  2PRQ A;  3DGV A;  2D4O A;  3D66 A;  1LFW A;  3S6H A;  1VHO A;  2H5M A;  3VAT A;  1QSO A;  1IYK A;  1PYT B;  1IIC A;  4UWJ A;  4MY3 A;  4A31 A;  3I3G A;  3SJE A;  1PCA A;  4OC2 A;  2JEW A;  1NMT A;  2ZW7 A;  2HQY A;  5JPH A;  2QYV A;  2B3U A;  4MCR A;  3B8G A;  2DPT A;  2VZZ A;  4C68 A;  1YW6 A;  4KSA A;  4PXE A;  2PJA A;  4MFL A;  3CT9 A;  2PIY A;  3V38 A;  1IGB A;  4H6U A;  2ANP A;  4MHZ A;  2PJ4 A;  1S7L A;  2WUU A;  2I79 A;  2DPS A;  1ARL A;  4W9Y A;  2G9D A;  4ZY2 A;  2QEC A;  4ONU A;  2PR1 A;  4OAE A;  4MHY A;  2EO8 A;  4CRY B;  4A94 A;  1ELM P;  2PDO A;  2R7H A;  1P0H A;  1XFO A;  1HDU A;  1IU8 A;  2REE A;  1XOV A;  4R3L A;  2HC9 A;  5LYI A;  3T9Y A;  3T8W A;  1S7K A;  3JTK A;  2FL4 A;  1ELL P;  4CYO A;  3W6S A;  4FWU A;  5C82 A;  3V8I A;  4EME A;  1XRY A;  1Y7R A;  1LOK A;  2FT0 A;  2B58 A;  2G0B A;  2YNC C;  2C6C A;  5G21 A;  5LRK A;  1UFH A;  4BMH A;  2AJ6 A;  3IFE A;  4KOV A;  4RUH A;  2I00 A;  2R1I A;  2Z3N A;  2BL1 A;  1TKF A;  1UWY A;  4AG9 A;  4NCZ A;  1QST A;  2WYR A;  3PB9 X;  1WK4 A;  5J8C A;  1MJA A;  1I12 A;  2QML A;  2ZEE A;  2CY2 A;  4KOT A;  2Q51 A;  4CGP A;  3KQZ A;  1XJO A;  5ISV A;  2D4P A;  1Z2L A;  4KOU A;  3V7Z A;  4CYN A;  4JLY A;  4DJL A;  2ZPA A;  3GLJ A;  4KOW A;  2ZEM A;  2HB6 A; 
#chains in the Genus database with same CATH homology
 2XEJ A;  5K8M A;  2CF4 A;  1AYE A;  1IY7 A;  1Z5R A;  2PVW A;  4X8I A;  5HVF A;  2OR4 A;  3IEH A;  1ZG8 A;  2JBK A;  4OKO A;  1TXR A;  2QVP A;  3B3V A;  7CPA A;  1BPN A;  5DS0 A;  2EK9 A;  4OC5 A;  1OBR A;  4A37 A;  3KR4 A;  3D4U A;  4UEE A;  3N5F A;  2V8G A;  1YW4 A;  2GLF A;  4UIB A;  1Y0Y A;  4AXV A;  3B3C A;  3B35 A;  3DLJ A;  2NSM A;  5IB9 A;  5J1Q A;  1BLL E;  5CPA A;  4NGT A;  3FEC A;  3WAB A;  2PE3 A;  4YWY A;  3PB8 X;  2ZEL A;  4ZX9 A;  2ZEG A;  2F8H A;  3MRU A;  2OOT A;  2I3C A;  2RB7 A;  3NA6 A;  3FEE A;  5LYL A;  2XEG A;  4OC1 A;  2ZEN A;  3RZA A;  4TWE A;  3NH4 A;  1FT7 A;  4OC0 A;  5I4M A;  2AFM A;  3PBB A;  4NGR A;  2IJZ A;  4MCQ A;  2PCU A;  5THW A;  2O4H A;  4ZYQ A;  3PFO A;  2PJ7 A;  2DEA A;  1F2O A;  4R6T A;  3GUX A;  3KAS A;  1H8L A;  4MHN A;  2PJ5 A;  3K2K A;  1Z8L A;  3B2Y A;  4P10 A;  3WT4 A;  3SJF A;  4IAV A;  3IIB A;  1NSA A;  3BXM A;  4FUU A;  4R8F A;  5LYF A;  2EWB A;  3IO1 A;  2AFU A;  2IMO A;  3KHZ A;  2EK8 A;  3FJU A;  4FBE A;  4MXU A;  3MN8 A;  4P4J A;  4WJB A;  3WC7 A;  4OIW A;  5K8P A;  2BO9 A;  2ZED A;  2C6P A;  1ZLH A;  4LQG A;  2JBJ A;  3H8F A;  3S9N A;  4PXC A;  4OC4 A;  3IJ3 A;  4EWT A;  4NGP A;  3SI2 A;  5F09 A;  1ZG9 A;  1ARM A;  2PJC A;  5JH9 A;  2VL1 A;  1TKJ A;  4ZY1 A;  4CPA A;  3SI1 A;  3LMS A;  3SI0 A;  2ZEP A;  2IQ6 A;  3JRU A;  4UF4 A;  2PJ8 A;  1XBU A;  1DE4 C;  4NGN A;  3B7I A;  2GLJ A;  1EE3 P;  2BCO A;  2ZOF A;  3BI1 A;  3PB6 X;  4X2T A;  2XEI A;  3S9L A;  2V8D A;  4OME A;  2Q4Z A;  2V8V A;  3FH4 A;  3HUV A;  4MRI A;  1ZLI A;  1Y7E A;  3CPA A;  4UIA A;  4KSI A;  3WC6 A;  4MMO A;  3PRT A;  4DUK A;  3BHX A;  3D67 A;  4BD9 A;  3B3W A;  4P45 A;  1TF9 A;  3PFE A;  4P4D A;  3I1U A;  1R3N A;  3CDX A;  2ZEF A;  2AFW A;  1CPX A;  1QMU A;  3KQX A;  3PB4 X;  4IK2 A;  1CPS A;  1JQG A;  2C6G A;  1M4L A;  5HXD A;  3K9T A;  2BOA A;  3D68 A;  3L2N A;  4Z65 A;  5D29 A;  5CBM A;  1XMB A;  1GYT A;  2PJ6 A;  3FVL A;  3KZW A;  3H8E A;  3QNV A;  4P44 A;  1F57 A;  1BPM A;  4NGM A;  5K8N A;  1FNO A;  1HDQ A;  4R76 A;  4ZY0 A;  4OP4 A;  8CPA A;  5D8N A;  2V8H A;  3NH5 A;  1LAN A;  4PPZ A;  4JZ0 A;  2PJ9 A;  4MCS A;  1KWM A;  4P4B A;  1VHE A;  1CG2 A;  4WWV A;  3RBU A;  1VGY A;  4UEZ A;  3PBE A;  2ZEH A;  5JM6 A;  4MHP A;  3D7H A;  3SJG A;  1CX8 A;  4P4I A;  3ISX A;  1VIX A;  3H8G A;  1BAV A;  1ZG7 A;  2WZN A;  2PIZ A;  2AFX A;  2F7V A;  3PEI A;  5HVG A;  4F8Z A;  4H2K A;  4DYO A;  4OID A;  3KHX A;  1LAM A;  3RAM A;  2CTB A;  4MCP A;  2Q43 A;  4OC3 A;  2V77 A;  4TNU A;  4YU9 A;  3HLP A;  4PXB A;  5HVH A;  1CP6 A;  1CP7 A;  4P4E A;  3D7D A;  3B3S A;  1LCP A;  3KGQ A;  2ZOG A;  2J9A A;  1AMP A;  4ZI6 A;  4PXD A;  3S9M A;  4Q7A A;  2GU2 A;  3D7G A;  1HEE A;  2O53 A;  4IHM A;  2POK A;  4NFR A;  3KL9 A;  3VAR A;  3KI9 A;  2AFZ A;  3GB0 A;  4A39 A;  1Q7L A;  4O23 A;  5LRG A;  3FED A;  2ZEO A;  4P6Y A;  3D7F A;  2FVG A;  4F9U A;  5LRJ A;  1Y0R A;  1YSJ A;  4B6Z A;  3IC1 A;  3FMC A;  4GM5 A;  3WC5 A;  4F9V A;  2PVV A;  5JGF A;  3CPX A;  3PB7 X;  4NGQ A;  4X3R A;  1TF8 A;  5K8O A;  4NJR A;  4ONW A;  1QQ9 A;  6CPA A;  3VH9 A;  4G1P A;  5ELY A;  3FX6 A;  4NJQ A;  5LYD A;  2PJ1 A;  2CIJ A;  3IWW A;  2C1C A;  4ZX8 A;  1YME A;  2NYQ A;  2CTC A;  2AFO A;  3SJX A;  2AFS A;  4P4F A;  3ISZ A;  2PJB A;  2PJ2 A;  2RFH A;  3FF3 A;  3TX8 A;  2PJ0 A;  4R7M A;  1YLO A;  4UEF A;  1RTQ A;  4EFD A;  3LWU A;  2ABZ A;  3NH8 A;  1DTD A;  1F2P A;  2PJ3 A;  2GRE A;  3KR5 A;  3BI0 A;  3TC8 A;  1TKH A;  3B3T A;  3NFZ A;  1LAP A;  4FAI A;  2XEF A;  4JYW A;  4NGS A;  1R43 A;  1CBX A;  4A38 A;  2QJ8 A;  4K3N A;  4PQA A;  2PRQ A;  3DGV A;  3D66 A;  1LFW A;  1VHO A;  3VAT A;  1PYT B;  3SJE A;  1PCA A;  4OC2 A;  2JEW A;  2QYV A;  4MCR A;  1YW6 A;  4PXE A;  2PJA A;  3CT9 A;  2PIY A;  3V38 A;  1IGB A;  2ANP A;  4MHZ A;  2PJ4 A;  4ZY2 A;  1ARL A;  4W9Y A;  2G9D A;  4MHY A;  4A94 A;  1ELM P;  1XFO A;  1HDU A;  3T8W A;  2HC9 A;  5LYI A;  1ELL P;  4FWU A;  4EME A;  1XRY A;  1LOK A;  2C6C A;  5LRK A;  3IFE A;  4RUH A;  1TKF A;  1UWY A;  2WYR A;  3PB9 X;  2ZEE A;  2Q51 A;  3KQZ A;  1XJO A;  1Z2L A;  3V7Z A;  4DJL A;  3GLJ A;  2ZEM A;  2HB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...