3FJUA

Ascaris suum carboxypeptidase inhibitor in complex with human carboxypeptidase a1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
307
structure length
307
Chain Sequence
RSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase A1
publication title Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 307
sequence length 307
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fjuA00
2ZEGA 3LMSA 4CPAA 4H2KA 4MHPA 1HDUA 1XMBA 4MCSA 2C1CA 3JRUA 2ZELA 2ZOGA 1RTQA 3QNVA 1QMUA 1VIXA 1Y7EA 5DS0A 2PJ6A 3WABA 1IGBA 2BO9A 3BI0A 4X2TA 3H8GA 1PYTB 2C6CA 4F9UA 1PCAA 3CT9A 5D8NA 2V8DA 1ZG8A 1OBRA 1YLOA 3NFZA 1ZLHA 1TKHA 1TF9A 3B2YA 3SJXA 2O53A 4TWEA 5K8MA 3CPAA 2ZEDA 1JQGA 2JBKA 2ZEHA 1VGYA 5ELYA 4P4JA 3FECA 4O23A 5K8NA 5HVGA 2ZEOA 4Z65A 4MHNA 2PCUA 2PJBA 2PJ4A 1FT7A 3KR4A 5JGFA 3NH8A 2V8VA 4DYOA 2GREA 4K3NA 4P4BA 1H8LA 3KZWA 4NGPA 1KWMA 1HDQA 3S9MA 3DGVA 2BCOA 3PB6X 4UEEA 4MCPA 4ZY2A 2AFWA 2PJAA 4RUHA 2QVPA 2EK8A 2PRQA 2IQ6A 2CIJA 4AXVA 4IK2A 4MHYA 1GYTA 4GM5A 2G9DA 3S9NA 3HUVA 4UEFA 3D68A 1TXRA 3B3VA 3TX8A 1ARMA 1CP7A 5LYFA 2NSMA 2QJ8A 1ZG7A 5IB9A 3B35A 2AFZA 3BI1A 3SI1A 2PJ2A 3BXMA 3N5FA 3VARA 4ZY0A 3IWWA 1LFWA 2XEIA 2AFUA 2OR4A 3FEDA 1BLLE 1BAVA 3H8EA 4IHMA 3PB4X 1R43A 3RAMA 4WJBA 2XEGA 2NYQA 3PFEA 1ELLP 3FJUA 2ZEEA 4FUUA 4TNUA 4WWVA 4LQGA 3D67A 1VHEA 2PJCA 4F9VA 3PFOA 1YSJA 4NGQA 5LRKA 4UF4A 2ABZA 2AFMA 3KHXA 3IJ3A 3D7FA 3NH4A 4W9YA 4R6TA 1IY7A 3PBEA 3PB9X 1ZLIA 1YMEA 1ELMP 4OC2A 3D7DA 3KR5A 4R76A 4FBEA 4P45A 1EE3P 1FNOA 2AFOA 1BPNA 2XEFA 4A37A 3D4UA 2PJ7A 2OOTA 2C6GA 4MRIA 3PEIA 5JH9A 2Q51A 3SI0A 3H8FA 3IEHA 2F7VA 3WT4A 4DUKA 1CX8A 4MMOA 1Y0RA 1LAPA 1LAMA 3FH4A 1M4LA 4PPZA 3BHXA 3HLPA 3WC7A 2QYVA 3V38A 3V7ZA 4PXEA 2J9AA 3B7IA 5CPAA 4NGMA 4OIDA 4UIAA 3FX6A 2V8HA 3IC1A 2C6PA 2I3CA 2DEAA 3PRTA 3KI9A 4IAVA 1XRYA 4R8FA 6CPAA 3D7HA 5HXDA 2HC9A 4NGTA 2Q4ZA 1CG2A 3SJGA 3K9TA 7CPAA 5J1QA 4OP4A 5LYIA 1AMPA 1ARLA 1CBXA 2RFHA 4PQAA 3GB0A 3GLJA 3KGQA 3PB7X 4NGNA 4ONWA 4A39A 4ZY1A 3MRUA 3FMCA 4P44A 1CPXA 3IO1A 2Q43A 3FEEA 2ZENA 4MCRA 3S9LA 2RB7A 4ZYQA 4BD9A 8CPAA 2BOAA 2ANPA 2CTCA 2FVGA 3VH9A 1HEEA 4EFDA 5HVFA 3VATA 2PJ9A 3KQZA 1DE4C 2ZEMA 2XEJA 3T8WA 3WC6A 1LOKA 2AFSA 3LWUA 4MCQA 2GU2A 4EWTA 1CP6A 4NGRA 1AYEA 5I4MA 1UWYA 2POKA 3D7GA 4DJLA 3L2NA 1TF8A 2PIZA 1XBUA 5LRJA 1TKJA 4P6YA 2HB6A 4B6ZA 2GLFA 3GUXA 3KQXA 2IJZA 4NGSA 5THWA 3SJEA 4R7MA 2ZOFA 1BPMA 2O4HA 1F2PA 3NA6A 3WC5A 1XJOA 2GLJA 4G1PA 3TC8A 2AFXA 3B3CA 4OC4A 2PJ8A 4A94A 2PJ3A 3ISXA 2V77A 1VHOA 1F57A 3KL9A 1YW4A 3PBBA 2PE3A 3CPXA 4UEZA 1LCPA 2ZEFA 1YW6A 3CDXA 5JM6A 2F8HA 1CPSA 1Z8LA 2IMOA 4KSIA 4FAIA 1Y0YA 3IFEA 2JEWA 4P4DA 5F09A 4NJQA 5K8PA 4X3RA 4ZX9A 1Z5RA 1F2OA 2PVWA 5CBMA 3D66A 2V8GA 1ZG9A 1NSAA 4JZ0A 3DLJA 3MN8A 2ZEPA 2PJ5A 1TKFA 1R3NA 4PXCA 3SI2A 3SJFA 4OC3A 4NFRA 3RZAA 4F8ZA 4OC1A 4UIBA 4JYWA 4YWYA 4OMEA 3IIBA 4OC0A 2CF4A 4PXBA 3NH5A 4NJRA 5K8OA 4OIWA 4X8IA 4MHZA 3KASA 3K2KA 2WYRA 2EWBA 4FWUA 3ISZA 1QQ9A 2PVVA 4P10A 4ZX8A 1Z2LA 2VL1A 5HVHA 1Q7LA 4OKOA 2JBJA 3I1UA 4MXUA 4P4FA 4Q7AA 3KHZA 4PXDA 5LYLA 2PJ0A 3B3WA 3FVLA 1DTDA 2CTBA 1LANA 4ZI6A 4YU9A 4A38A 2PJ1A 3RBUA 5D29A 5LYDA 4P4IA 4OC5A 4P4EA 4EMEA 5LRGA 2EK9A 2PIYA 2WZNA 3B3TA 3FF3A 3B3SA 1XFOA 3PB8X
chains in the Genus database with same CATH superfamily
4R57A 5J8CA 2D4PA 1XEBA 5KTAA 4R9MA 2ZEGA 3LMSA 4CPAA 2Y0MA 1KUVA 4H2KA 4OAEA 4MHPA 1HDUA 4H6ZA 1XMBA 3D8PA 4OADA 2PSWA 4M85A 4CGNA 4MCSA 2C1CA 3JRUA 2ZELA 2A4NA 2ZOGA 1RTQA 2ATRA 1ON0A 3QNVA 4UFXA 4ONUA 4PSWA 1QMUA 1VIXA 1Y9KA 1Y7EA 2O28A 3BJ7A 2YGWA 5DS0A 4NCZA 2AE6A 2PJ6A 3WABA 1IGBA 2BO9A 3BI0A 4X2TA 2Q4YA 3CXSA 4MJ8A 4A31A 3H8GA 1PYTB 2C6CA 4F9UA 1PCAA 3CT9A 4MI4A 5AG7A 4A33A 4H6UA 1Z8XA 2B4DB 3FIXA 5D8NA 2CXAA 2FIWA 2V8DA 1ZG8A 1YLEA 2JDCA 1OBRA 2K5TA 5DWMA 4B10A 1B6BA 1YLOA 2VEZA 5A28A 4XNHB 3NFZA 1ZLHA 4L8AA 1TKHA 4C2XA 1TF9A 1M44A 3B2YA 3F5BA 3SJXA 4F0XA 2O53A 4TWEA 4JWPA 3CPAA 2ZEDA 3TT2A 5K8MA 4L89A 1JQGA 1NE9A 4OLLA 2JBKA 2ZEHA 4XPKA 1VGYA 2PRBA 4MFLA 5ELYA 1N71A 3GY9A 4P4JA 2QMLA 4XPLA 4JXQA 2PDOA 4CGLA 1YVKA 4KLWA 4NEXA 3FECA 1M1DA 4O23A 5HVGA 5K8NA 2ZEOA 4KVOE 2HV2A 1UFHA 4Z65A 4MHNA 2PCUA 2PJBA 1S7KA 2PJ4A 1FT7A 3KR4A 1QSMA 2C27A 5JGFA 3S6HA 3NH8A 1IOIA 2V8VA 4U9YA 2GREA 4B14A 1WK4A 1ZO0A 4K3NA 4DYOA 4P4BA 1BO4A 2PR1A 3MGDA 2FS5A 3H4QA 1H8LA 2VZZA 3KZWA 4KOYA 4MY3A 4NGPA 1KWMA 5H84A 1HDQA 1RO5A 2JEVA 3S9MA 4AG7A 1S3ZA 3DGVA 4CYOA 2BCOA 4LX9A 3PB6X 2B5GB 4PK2A 3R1KA 4UEEA 4MCPA 4C7IA 4ZY2A 2AFWA 2PJAA 4RUHA 2QVPA 2EK8A 2PRQA 1MJAA 2IQ6A 2CIJA 4AXVA 2Z3PA 4IK2A 4MHYA 1GYTA 2Z3KA 4GM5A 2G9DA 4X5KA 3S9NA 4PSXA 5G20A 3HUVA 4KORA 4UEFA 3D68A 1TXRA 2Q4VA 3B3VA 3TX8A 2FE7A 3GKRA 1ARMA 2Q04A 1CP7A 5LYFA 2NSMA 1MK4A 4MFKA 5AGEA 3OWCA 3QAHA 2QJ8A 2ARHA 1ZG7A 4YGOA 5IB9A 3B35A 2FCKA 3NE7A 2AFZA 1P0HA 4KOXA 3BI1A 4XPDB 3GIUA 2PJ2A 3SI1A 5HMNA 3BXMA 1M4IA 4HNXB 3EFAA 3N5FA 1I21A 3H5ZA 5JQ4A 3VARA 5DWNA 2OZGA 4AG9A 4DNCA 4ZY0A 3IWWA 1IICA 2HQYA 4CYQA 1YREA 2FIAA 3FNCA 2BSWA 4KSFA 3ZJ0A 1LFWA 2XEIA 2AFUA 3QAYA 5EBVA 4C7HA 1RXTA 1B87A 2OR4A 3FEDA 4QB9A 1BLLE 2OZUA 1BAVA 1M4DA 3H8EA 3PB4X 4IHMA 4KLVA 4CAFA 4BBHA 4Y49B 3R9EA 4F6AA 3TE4A 4CS0B 4KSAA 1R43A 3RAMA 4WJBA 4AVBA 1K4JA 4NF1A 4IUSA 2XEGA 2NYQA 4UWJA 3PFEA 4KUAA 1NMTA 2B4BA 1ELLP 2IL4A 1WWZA 2ZEEA 2ZPAA 3FJUA 4FUUA 4MFQA 1I12A 3SXOA 4TNUA 4FD7A 4WWVA 4LQGA 3D67A 1VHEA 2PJCA 4MHDA 4F9VA 3PFOA 1YSJA 2DPSA 1VKCA 4NGQA 4JLYA 5LRKA 3DSBA 2BEIA 4UF4A 2I00A 2ABZA 2AFMA 2PR8A 3IJ3A 3KHXA 2VQYA 5G21A 4B13A 5C88A 3TFYA 4FD6A 2VZYA 3D7FA 3NH4A 4W9YA 2P0WA 1XMTA 2X7BA 2G3AA 4R6TA 5EMIA 1IY7A 2WSAA 4B5PA 2DF5A 2Z3OA 3PBEA 4UCMA 3PB9X 1ZLIA 4FD5A 1YMEA 1ELMP 3B8GA 4OC2A 3R95A 3D7DA 3TO6A 1YVOA 3KR5A 4R76A 3T9YA 4FBEA 4P45A 2BL1A 4UWIA 3DR8A 4IF5A 1EE3P 1R57A 1FNOA 4CAWA 2AFOA 1BPNA 1Z8WA 4J3GA 2REFA 2XEFA 3PGPA 2B58A 1LRZA 4A37A 5IB0A 2CNTA 3D4UA 2PJ7A 2OOTA 5IX3A 4M6HA 2C6GA 2R8VA 4MRIA 4CAEA 4EVYA 2R1IA 3SHPA 4I49A 4M6GA 3DR6A 4BINA 3PEIA 5JH9A 1QSTA 2Q51A 3SI0A 1IOFA 3H8FA 3IEHA 2F7VA 4QVTA 3WT4A 1KZFA 2FXFA 4DUKA 1CX8A 4MMOA 5I0CA 1Y0RA 1LAPA 1LAMA 2Z3LA 2Z3MA 1M4LA 3FH4A 3IU2A 4U5YA 2KCWA 4PPZA 3TO9A 3BHXA 3HLPA 3RNZA 3UY5A 3WC7A 4RI1A 2QYVA 3V38A 4UCNA 2PQ8A 4C2YA 2P6GA 3V7ZA 2ODFA 4PXEA 2J9AA 3TCVA 3B7IA 2YNCA 5CPAA 3JVNA 4NGMA 4OIDA 2ZW7A 2CNMA 2GFQA 1Q2YA 5H86A 4UIAA 1NSLA 1YX0A 5C82A 3FX6A 3LD2A 5JPHA 2V8HA 3IC1A 2C6PA 2I3CA 2DEAA 4CAVA 1M4GA 3PRTA 4MFJA 3KI9A 4IAVA 1VHSA 1XRYA 3D2PA 4R8FA 1IYLA 1YR0A 6CPAA 4XNHC 2DXQA 3D7HA 4CRZB 1XIXA 3RO0A 4JD6A 5HXDA 2HC9A 4NGTA 4E8OA 1AUGA 2Q4ZA 2B3UA 1CG2A 2YNCC 3SJGA 2YNDA 3S6KA 1CJWA 4KUBA 3K9TA 2ZW4A 3EY5A 7CPAA 5J1QA 4HPSA 4OP4A 5LYIA 1S60A 1AMPA 1ARLA 1CBXA 3G3SA 4CAXA 3FYNA 2B5GA 4M3SA 3D2MA 2RFHA 4ORFA 4PQAA 5GCNA 1IU8A 2WPXA 2F5IA 3GB0A 4F0YA 3GLJA 3KGQA 3PB7X 4GXHA 4NGNA 4ONWA 4A39A 1Q2CA 4NXYA 4B11A 4ZY1A 1Y7RA 3MRUA 3FMCA 4P44A 1CPXA 2ZXVA 3IO1A 4R87A 3S6FA 3IWEA 1TIQA 2Q43A 3FEEA 3NE8A 2GIVA 1L0CA 1IYKA 1U6MA 2ZENA 4MCRA 2RB7A 3S9LA 2FT0A 4YRHA 4ZYQA 2OH1A 5F49A 4BD9A 8CPAA 1XE4A 2ANPA 2BOAA 2CTCA 2FVGA 3G8WA 3R9GA 3VH9A 1HEEA 4EFDA 4C68A 3N7ZA 5G1ZA 5HVFA 3K9UA 3P2HA 4KOTA 3VATA 3DDDA 2PJ9A 3KQZA 1DE4C 2ZEMA 2XEJA 3WR7A 4KOWA 1S7NA 3T8WA 4BMHA 3WC6A 3E0KA 4MFZA 3SXNA 1LOKA 4KOSA 2AFSA 4C2ZA 3LWUA 4YFJA 4MCQA 2GU2A 3TO7A 4EWTA 1CP6A 4NGRA 1AYEA 3R9FA 4CGOA 4ZGYB 4R3LA 5F48A 1PU9A 5I4MA 3FXTA 2DPTA 1UWYA 2POKA 3D7GA 1BOBA 3FBUA 5IV0A 3IU1A 5HH1A 3L2NA 4DJLA 1TF8A 2PIZA 1XBUA 2AJ6A 4A32A 4U9ZA 5LRJA 1TKJA 3F0AA 4P6YA 4RN7A 3TTHA 2R7HA 2HB6A 4KS9A 4B6ZA 2GLFA 3IGRA 2G0BA 3GUXA 1V0CA 3KQXA 3FRMA 2IJZA 4NGSA 2Q7SA 4QUSA 2EUIA 5F47A 1YGHA 5THWA 2CNSA 4B5PB 4Y49C 1QSRA 3SJEA 4R7MA 2WPWA 2ZOFA 2EBJA 3A9LA 1BPMA 4PV6A 2VXKA 2R98A 3CZXA 4HNWB 2O4HA 3TOBA 2RC4A 4CGMA 2Z11A 3D3SA 4QC6A 1F2PA 5ISVA 3NA6A 3WC5A 1XJOA 2GLJA 3W91A 4G1PA 2H5MA 3TC8A 2AFXA 5F46A 1Z4EA 2OZHA 3B3CA 4OC4A 4UCPA 2PJ8A 4HKFA 5EC4A 4A94A 1FY7A 1X10A 5BWAB 1IIDA 2PJ3A 3ISXA 4UFWA 2V77A 1VHOA 5KTDA 2QECA 1F57A 4FD4A 3KL9A 1YW4A 3PBBA 4KOUA 4PK3A 1KUXA 2PE3A 4NSQA 3CPXA 2B4DA 3BLNA 4UEZA 2QIRA 1LCPA 4LUAA 2I79A 3T90A 4A95A 2ZEFA 5AG6A 1YW6A 2EO8A 2VI7A 3CDXA 5KTCA 2YNEA 3F8KA 3JUWA 2JDDA 5JM6A 2F8HA 4KVXA 1CPSA 5A27A 2B3VA 3W6SA 2Q44A 3C26A 1XF8A 4E2AA 4LQ6A 1Z8LA 2IMOA 2ZW5A 4CRYB 2Z0ZA 4KSIA 1XOVA 4FAIA 4A2ZA 1Y0YA 1Z8TA 3IFEA 1OZPA 2REEA 3RYOA 3V8IA 2P6FA 2JEWA 4P4DA 4ZBGA 4M6IA 3VWEA 2VBQA 5F09A 4NJQA 2Q7BA 5K8PA 4X3RA 4ZX9A 1I1DA 4AVAA 4R3KA 1Z5RA 2OB0A 1KUYA 1F2OA 4A30A 2PVWA 2J8NA 3S6GA 5CBMA 2OU2A 4MY0A 5CNPA 3D66A 2V8GA 1ZG9A 1NSAA 4JZ0A 3DLJA 3EXNA 3KKWA 3MN8A 4JXRA 3W6XA 5J8FA 2ZEPA 2PJ5A 3PP9A 4GS4A 1TKFA 1R3NA 4JJXA 4PXCA 3SI2A 2G3TA 5G22A 3SJFA 4OC3A 4NFRA 5FVJA 3RZAA 4F8ZA 1YQEA 3CXQA 1S7LA 4OC1A 2NMTA 1GHEA 4UIBA 4JYWA 3CXPA 4OMEA 3IIBA 4OC0A 4YWYA 2CF4A 4KZTA 2CY2A 4PXBA 4UBRA 4E0AA 3NH5A 4NJRA 4KVME 4AVCA 2J8RA 5K8OA 4AB7A 2BUEA 4MBUA 2FSRA 4OIWA 4X8IA 2Z3NA 3TOAA 2PC1A 4II9A 3LODA 4CYPA 1P4NA 4CGPA 1QSOA 3I3GA 1CM0A 4MHZA 4QBJA 3JTKA 3KASA 5E96A 1Q2DA 3VWDA 2Q0YA 3K2KA 2WUUA 2WYRA 2GE3A 3BJ8A 2GANA 2EWBA 1J4JA 3R96A 3FB3A 1Z9UA 4FWUA 3ISZA 2P6EA 1MJBA 1QQ9A 2PVVA 3ZZIA 5AG4A 4P10A 2ZW6A 1Z2LA 4ZX8A 1S5KA 3IWGA 1Y9WA 3QB8A 2EVNA 2VL1A 5HVHA 1Q7LA 3I9SA 4OKOA 2HUZA 2JBJA 3I1UA 4K30A 4MXUA 3EC4A 3KHZA 4P4FA 4PXDA 4Q7AA 4B5OA 1SQHA 4RS2A 4UA3A 1PUAA 2PJ0A 2J8MA 1QSNA 3EO4A 1A2ZA 3B3WA 5AG5A 4Q36A 5LYLA 1Z4RA 2D4OA 3FVLA 1DTDA 2CTBA 3LACA 2FL4A 1LANA 4H89A 4XPDC 4ZI6A 2Z10A 1JWQA 4Q38A 4KOVA 3DNSA 4YU9A 1YK3A 4A38A 2PJ1A 3RBUA 3PZJA 4UFVA 1MJ9A 5D29A 1IB1E 1S7FA 5LYDA 4P4IA 4B12A 4HNYB 4OC5A 3GYAA 4P4EA 4EMEA 1X12A 2JLMA 5LRGA 4CYNA 4MFPA 2EK9A 2PIYA 2WZNA 3B3TA 3P2FA 3FF3A 3B3SA 1XFOA 3PB8X
chains in the Genus database with same CATH topology
2ZEGA 3LMSA 4CPAA 4H2KA 4MHPA 1HDUA 1XMBA 4MCSA 2C1CA 3JRUA 2ZELA 2ZOGA 1RTQA 3QNVA 1QMUA 1VIXA 1Y7EA 5DS0A 2PJ6A 3WABA 1IGBA 2BO9A 3BI0A 4X2TA 3H8GA 1PYTB 2C6CA 4F9UA 1PCAA 3CT9A 5D8NA 2V8DA 1ZG8A 1OBRA 1YLOA 3NFZA 1ZLHA 1TKHA 1TF9A 3B2YA 3SJXA 2O53A 4TWEA 5K8MA 3CPAA 2ZEDA 1JQGA 2JBKA 2ZEHA 1VGYA 5ELYA 4P4JA 3FECA 4O23A 5K8NA 5HVGA 2ZEOA 4Z65A 4MHNA 2PCUA 2PJBA 2PJ4A 1FT7A 3KR4A 5JGFA 3NH8A 2V8VA 4DYOA 2GREA 4K3NA 4P4BA 1H8LA 3KZWA 4NGPA 1KWMA 1HDQA 3S9MA 3DGVA 2BCOA 3PB6X 4UEEA 4MCPA 4ZY2A 2AFWA 2PJAA 4RUHA 2QVPA 2EK8A 2PRQA 2IQ6A 2CIJA 4AXVA 4IK2A 4MHYA 1GYTA 4GM5A 2G9DA 3S9NA 3HUVA 4UEFA 3D68A 1TXRA 3B3VA 3TX8A 1ARMA 1CP7A 5LYFA 2NSMA 2QJ8A 1ZG7A 5IB9A 3B35A 2AFZA 3BI1A 3SI1A 2PJ2A 3BXMA 3N5FA 3VARA 4ZY0A 3IWWA 1LFWA 2XEIA 2AFUA 2OR4A 3FEDA 1BLLE 1BAVA 3H8EA 4IHMA 3PB4X 1R43A 3RAMA 4WJBA 2XEGA 2NYQA 3PFEA 1ELLP 3FJUA 2ZEEA 4FUUA 4TNUA 4WWVA 4LQGA 3D67A 1VHEA 2PJCA 4F9VA 3PFOA 1YSJA 4NGQA 5LRKA 4UF4A 2ABZA 2AFMA 3KHXA 3IJ3A 3D7FA 3NH4A 4W9YA 4R6TA 1IY7A 3PBEA 3PB9X 1ZLIA 1YMEA 1ELMP 4OC2A 3D7DA 3KR5A 4R76A 4FBEA 4P45A 1EE3P 1FNOA 2AFOA 1BPNA 2XEFA 4A37A 3D4UA 2PJ7A 2OOTA 2C6GA 4MRIA 3PEIA 5JH9A 2Q51A 3SI0A 3H8FA 3IEHA 2F7VA 3WT4A 4DUKA 1CX8A 4MMOA 1Y0RA 1LAPA 1LAMA 3FH4A 1M4LA 4PPZA 3BHXA 3HLPA 3WC7A 2QYVA 3V38A 3V7ZA 4PXEA 2J9AA 3B7IA 5CPAA 4NGMA 4OIDA 4UIAA 3FX6A 2V8HA 3IC1A 2C6PA 2I3CA 2DEAA 3PRTA 3KI9A 4IAVA 1XRYA 4R8FA 6CPAA 3D7HA 5HXDA 2HC9A 4NGTA 2Q4ZA 1CG2A 3SJGA 3K9TA 7CPAA 5J1QA 4OP4A 5LYIA 1AMPA 1ARLA 1CBXA 2RFHA 4PQAA 3GB0A 3GLJA 3KGQA 3PB7X 4NGNA 4ONWA 4A39A 4ZY1A 3MRUA 3FMCA 4P44A 1CPXA 3IO1A 2Q43A 3FEEA 2ZENA 4MCRA 3S9LA 2RB7A 4ZYQA 4BD9A 8CPAA 2BOAA 2ANPA 2CTCA 2FVGA 3VH9A 1HEEA 4EFDA 5HVFA 3VATA 2PJ9A 3KQZA 1DE4C 2ZEMA 2XEJA 3T8WA 3WC6A 1LOKA 2AFSA 3LWUA 4MCQA 2GU2A 4EWTA 1CP6A 4NGRA 1AYEA 5I4MA 1UWYA 2POKA 3D7GA 4DJLA 3L2NA 1TF8A 2PIZA 1XBUA 5LRJA 1TKJA 4P6YA 2HB6A 4B6ZA 2GLFA 3GUXA 3KQXA 2IJZA 4NGSA 5THWA 3SJEA 4R7MA 2ZOFA 1BPMA 2O4HA 1F2PA 3NA6A 3WC5A 1XJOA 2GLJA 4G1PA 3TC8A 2AFXA 3B3CA 4OC4A 2PJ8A 4A94A 2PJ3A 3ISXA 2V77A 1VHOA 1F57A 3KL9A 1YW4A 3PBBA 2PE3A 3CPXA 4UEZA 1LCPA 2ZEFA 1YW6A 3CDXA 5JM6A 2F8HA 1CPSA 1Z8LA 2IMOA 4KSIA 4FAIA 1Y0YA 3IFEA 2JEWA 4P4DA 5F09A 4NJQA 5K8PA 4X3RA 4ZX9A 1Z5RA 1F2OA 2PVWA 5CBMA 3D66A 2V8GA 1ZG9A 1NSAA 4JZ0A 3DLJA 3MN8A 2ZEPA 2PJ5A 1TKFA 1R3NA 4PXCA 3SI2A 3SJFA 4OC3A 4NFRA 3RZAA 4F8ZA 4OC1A 4UIBA 4JYWA 4YWYA 4OMEA 3IIBA 4OC0A 2CF4A 4PXBA 3NH5A 4NJRA 5K8OA 4OIWA 4X8IA 4MHZA 3KASA 3K2KA 2WYRA 2EWBA 4FWUA 3ISZA 1QQ9A 2PVVA 4P10A 4ZX8A 1Z2LA 2VL1A 5HVHA 1Q7LA 4OKOA 2JBJA 3I1UA 4MXUA 4P4FA 4Q7AA 3KHZA 4PXDA 5LYLA 2PJ0A 3B3WA 3FVLA 1DTDA 2CTBA 1LANA 4ZI6A 4YU9A 4A38A 2PJ1A 3RBUA 5D29A 5LYDA 4P4IA 4OC5A 4P4EA 4EMEA 5LRGA 2EK9A 2PIYA 2WZNA 3B3TA 3FF3A 3B3SA 1XFOA 3PB8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEG A;  3LMS A;  4CPA A;  4H2K A;  4MHP A;  1HDU A;  1XMB A;  4MCS A;  2C1C A;  3JRU A;  2ZEL A;  2ZOG A;  1RTQ A;  3QNV A;  1QMU A;  1VIX A;  1Y7E A;  5DS0 A;  2PJ6 A;  3WAB A;  1IGB A;  2BO9 A;  3BI0 A;  4X2T A;  3H8G A;  1PYT B;  2C6C A;  4F9U A;  1PCA A;  3CT9 A;  5D8N A;  2V8D A;  1ZG8 A;  1OBR A;  1YLO A;  3NFZ A;  1ZLH A;  1TKH A;  1TF9 A;  3B2Y A;  3SJX A;  2O53 A;  4TWE A;  5K8M A;  3CPA A;  2ZED A;  1JQG A;  2JBK A;  2ZEH A;  1VGY A;  5ELY A;  4P4J A;  3FEC A;  4O23 A;  5K8N A;  5HVG A;  2ZEO A;  4Z65 A;  4MHN A;  2PCU A;  2PJB A;  2PJ4 A;  1FT7 A;  3KR4 A;  5JGF A;  3NH8 A;  2V8V A;  4DYO A;  2GRE A;  4K3N A;  4P4B A;  1H8L A;  3KZW A;  4NGP A;  1KWM A;  1HDQ A;  3S9M A;  3DGV A;  2BCO A;  3PB6 X;  4UEE A;  4MCP A;  4ZY2 A;  2AFW A;  2PJA A;  4RUH A;  2QVP A;  2EK8 A;  2PRQ A;  2IQ6 A;  2CIJ A;  4AXV A;  4IK2 A;  4MHY A;  1GYT A;  4GM5 A;  2G9D A;  3S9N A;  3HUV A;  4UEF A;  3D68 A;  1TXR A;  3B3V A;  3TX8 A;  1ARM A;  1CP7 A;  5LYF A;  2NSM A;  2QJ8 A;  1ZG7 A;  5IB9 A;  3B35 A;  2AFZ A;  3BI1 A;  3SI1 A;  2PJ2 A;  3BXM A;  3N5F A;  3VAR A;  4ZY0 A;  3IWW A;  1LFW A;  2XEI A;  2AFU A;  2OR4 A;  3FED A;  1BLL E;  1BAV A;  3H8E A;  4IHM A;  3PB4 X;  1R43 A;  3RAM A;  4WJB A;  2XEG A;  2NYQ A;  3PFE A;  1ELL P;  3FJU A;  2ZEE A;  4FUU A;  4TNU A;  4WWV A;  4LQG A;  3D67 A;  1VHE A;  2PJC A;  4F9V A;  3PFO A;  1YSJ A;  4NGQ A;  5LRK A;  4UF4 A;  2ABZ A;  2AFM A;  3KHX A;  3IJ3 A;  3D7F A;  3NH4 A;  4W9Y A;  4R6T A;  1IY7 A;  3PBE A;  3PB9 X;  1ZLI A;  1YME A;  1ELM P;  4OC2 A;  3D7D A;  3KR5 A;  4R76 A;  4FBE A;  4P45 A;  1EE3 P;  1FNO A;  2AFO A;  1BPN A;  2XEF A;  4A37 A;  3D4U A;  2PJ7 A;  2OOT A;  2C6G A;  4MRI A;  3PEI A;  5JH9 A;  2Q51 A;  3SI0 A;  3H8F A;  3IEH A;  2F7V A;  3WT4 A;  4DUK A;  1CX8 A;  4MMO A;  1Y0R A;  1LAP A;  1LAM A;  3FH4 A;  1M4L A;  4PPZ A;  3BHX A;  3HLP A;  3WC7 A;  2QYV A;  3V38 A;  3V7Z A;  4PXE A;  2J9A A;  3B7I A;  5CPA A;  4NGM A;  4OID A;  4UIA A;  3FX6 A;  2V8H A;  3IC1 A;  2C6P A;  2I3C A;  2DEA A;  3PRT A;  3KI9 A;  4IAV A;  1XRY A;  4R8F A;  6CPA A;  3D7H A;  5HXD A;  2HC9 A;  4NGT A;  2Q4Z A;  1CG2 A;  3SJG A;  3K9T A;  7CPA A;  5J1Q A;  4OP4 A;  5LYI A;  1AMP A;  1ARL A;  1CBX A;  2RFH A;  4PQA A;  3GB0 A;  3GLJ A;  3KGQ A;  3PB7 X;  4NGN A;  4ONW A;  4A39 A;  4ZY1 A;  3MRU A;  3FMC A;  4P44 A;  1CPX A;  3IO1 A;  2Q43 A;  3FEE A;  2ZEN A;  4MCR A;  3S9L A;  2RB7 A;  4ZYQ A;  4BD9 A;  8CPA A;  2BOA A;  2ANP A;  2CTC A;  2FVG A;  3VH9 A;  1HEE A;  4EFD A;  5HVF A;  3VAT A;  2PJ9 A;  3KQZ A;  1DE4 C;  2ZEM A;  2XEJ A;  3T8W A;  3WC6 A;  1LOK A;  2AFS A;  3LWU A;  4MCQ A;  2GU2 A;  4EWT A;  1CP6 A;  4NGR A;  1AYE A;  5I4M A;  1UWY A;  2POK A;  3D7G A;  4DJL A;  3L2N A;  1TF8 A;  2PIZ A;  1XBU A;  5LRJ A;  1TKJ A;  4P6Y A;  2HB6 A;  4B6Z A;  2GLF A;  3GUX A;  3KQX A;  2IJZ A;  4NGS A;  5THW A;  3SJE A;  4R7M A;  2ZOF A;  1BPM A;  2O4H A;  1F2P A;  3NA6 A;  3WC5 A;  1XJO A;  2GLJ A;  4G1P A;  3TC8 A;  2AFX A;  3B3C A;  4OC4 A;  2PJ8 A;  4A94 A;  2PJ3 A;  3ISX A;  2V77 A;  1VHO A;  1F57 A;  3KL9 A;  1YW4 A;  3PBB A;  2PE3 A;  3CPX A;  4UEZ A;  1LCP A;  2ZEF A;  1YW6 A;  3CDX A;  5JM6 A;  2F8H A;  1CPS A;  1Z8L A;  2IMO A;  4KSI A;  4FAI A;  1Y0Y A;  3IFE A;  2JEW A;  4P4D A;  5F09 A;  4NJQ A;  5K8P A;  4X3R A;  4ZX9 A;  1Z5R A;  1F2O A;  2PVW A;  5CBM A;  3D66 A;  2V8G A;  1ZG9 A;  1NSA A;  4JZ0 A;  3DLJ A;  3MN8 A;  2ZEP A;  2PJ5 A;  1TKF A;  1R3N A;  4PXC A;  3SI2 A;  3SJF A;  4OC3 A;  4NFR A;  3RZA A;  4F8Z A;  4OC1 A;  4UIB A;  4JYW A;  4YWY A;  4OME A;  3IIB A;  4OC0 A;  2CF4 A;  4PXB A;  3NH5 A;  4NJR A;  5K8O A;  4OIW A;  4X8I A;  4MHZ A;  3KAS A;  3K2K A;  2WYR A;  2EWB A;  4FWU A;  3ISZ A;  1QQ9 A;  2PVV A;  4P10 A;  4ZX8 A;  1Z2L A;  2VL1 A;  5HVH A;  1Q7L A;  4OKO A;  2JBJ A;  3I1U A;  4MXU A;  4P4F A;  4Q7A A;  3KHZ A;  4PXD A;  5LYL A;  2PJ0 A;  3B3W A;  3FVL A;  1DTD A;  2CTB A;  1LAN A;  4ZI6 A;  4YU9 A;  4A38 A;  2PJ1 A;  3RBU A;  5D29 A;  5LYD A;  4P4I A;  4OC5 A;  4P4E A;  4EME A;  5LRG A;  2EK9 A;  2PIY A;  2WZN A;  3B3T A;  3FF3 A;  3B3S A;  1XFO A;  3PB8 X; 
#chains in the Genus database with same CATH topology
 4R57 A;  5J8C A;  2D4P A;  1XEB A;  5KTA A;  4R9M A;  2ZEG A;  3LMS A;  4CPA A;  2Y0M A;  1KUV A;  4H2K A;  4OAE A;  4MHP A;  1HDU A;  4H6Z A;  1XMB A;  3D8P A;  4OAD A;  2PSW A;  4M85 A;  4CGN A;  4MCS A;  2C1C A;  3JRU A;  2ZEL A;  2A4N A;  2ZOG A;  1RTQ A;  2ATR A;  1ON0 A;  3QNV A;  4UFX A;  4ONU A;  4PSW A;  1QMU A;  1VIX A;  1Y9K A;  1Y7E A;  2O28 A;  3BJ7 A;  2YGW A;  5DS0 A;  4NCZ A;  2AE6 A;  2PJ6 A;  3WAB A;  1IGB A;  2BO9 A;  3BI0 A;  4X2T A;  2Q4Y A;  3CXS A;  4MJ8 A;  4A31 A;  3H8G A;  1PYT B;  2C6C A;  4F9U A;  1PCA A;  3CT9 A;  4MI4 A;  5AG7 A;  4A33 A;  4H6U A;  1Z8X A;  2B4D B;  3FIX A;  5D8N A;  2CXA A;  2FIW A;  2V8D A;  1ZG8 A;  1YLE A;  2JDC A;  1OBR A;  2K5T A;  5DWM A;  4B10 A;  1B6B A;  1YLO A;  2VEZ A;  5A28 A;  4XNH B;  3NFZ A;  1ZLH A;  4L8A A;  1TKH A;  4C2X A;  1TF9 A;  1M44 A;  3B2Y A;  3F5B A;  3SJX A;  4F0X A;  2O53 A;  4TWE A;  4JWP A;  3CPA A;  2ZED A;  3TT2 A;  5K8M A;  4L89 A;  1JQG A;  1NE9 A;  4OLL A;  2JBK A;  2ZEH A;  4XPK A;  1VGY A;  2PRB A;  4MFL A;  5ELY A;  1N71 A;  3GY9 A;  4P4J A;  2QML A;  4XPL A;  4JXQ A;  2PDO A;  4CGL A;  1YVK A;  4KLW A;  4NEX A;  3FEC A;  1M1D A;  4O23 A;  5HVG A;  5K8N A;  2ZEO A;  4KVO E;  2HV2 A;  1UFH A;  4Z65 A;  4MHN A;  2PCU A;  2PJB A;  1S7K A;  2PJ4 A;  1FT7 A;  3KR4 A;  1QSM A;  2C27 A;  5JGF A;  3S6H A;  3NH8 A;  1IOI A;  2V8V A;  4U9Y A;  2GRE A;  4B14 A;  1WK4 A;  1ZO0 A;  4K3N A;  4DYO A;  4P4B A;  1BO4 A;  2PR1 A;  3MGD A;  2FS5 A;  3H4Q A;  1H8L A;  2VZZ A;  3KZW A;  4KOY A;  4MY3 A;  4NGP A;  1KWM A;  5H84 A;  1HDQ A;  1RO5 A;  2JEV A;  3S9M A;  4AG7 A;  1S3Z A;  3DGV A;  4CYO A;  2BCO A;  4LX9 A;  3PB6 X;  2B5G B;  4PK2 A;  3R1K A;  4UEE A;  4MCP A;  4C7I A;  4ZY2 A;  2AFW A;  2PJA A;  4RUH A;  2QVP A;  2EK8 A;  2PRQ A;  1MJA A;  2IQ6 A;  2CIJ A;  4AXV A;  2Z3P A;  4IK2 A;  4MHY A;  1GYT A;  2Z3K A;  4GM5 A;  2G9D A;  4X5K A;  3S9N A;  4PSX A;  5G20 A;  3HUV A;  4KOR A;  4UEF A;  3D68 A;  1TXR A;  2Q4V A;  3B3V A;  3TX8 A;  2FE7 A;  3GKR A;  1ARM A;  2Q04 A;  1CP7 A;  5LYF A;  2NSM A;  1MK4 A;  4MFK A;  5AGE A;  3OWC A;  3QAH A;  2QJ8 A;  2ARH A;  1ZG7 A;  4YGO A;  5IB9 A;  3B35 A;  2FCK A;  3NE7 A;  2AFZ A;  1P0H A;  4KOX A;  3BI1 A;  4XPD B;  3GIU A;  2PJ2 A;  3SI1 A;  5HMN A;  3BXM A;  1M4I A;  4HNX B;  3EFA A;  3N5F A;  1I21 A;  3H5Z A;  5JQ4 A;  3VAR A;  5DWN A;  2OZG A;  4AG9 A;  4DNC A;  4ZY0 A;  3IWW A;  1IIC A;  2HQY A;  4CYQ A;  1YRE A;  2FIA A;  3FNC A;  2BSW A;  4KSF A;  3ZJ0 A;  1LFW A;  2XEI A;  2AFU A;  3QAY A;  5EBV A;  4C7H A;  1RXT A;  1B87 A;  2OR4 A;  3FED A;  4QB9 A;  1BLL E;  2OZU A;  1BAV A;  1M4D A;  3H8E A;  3PB4 X;  4IHM A;  4KLV A;  4CAF A;  4BBH A;  4Y49 B;  3R9E A;  4F6A A;  3TE4 A;  4CS0 B;  4KSA A;  1R43 A;  3RAM A;  4WJB A;  4AVB A;  1K4J A;  4NF1 A;  4IUS A;  2XEG A;  2NYQ A;  4UWJ A;  3PFE A;  4KUA A;  1NMT A;  2B4B A;  1ELL P;  2IL4 A;  1WWZ A;  2ZEE A;  2ZPA A;  3FJU A;  4FUU A;  4MFQ A;  1I12 A;  3SXO A;  4TNU A;  4FD7 A;  4WWV A;  4LQG A;  3D67 A;  1VHE A;  2PJC A;  4MHD A;  4F9V A;  3PFO A;  1YSJ A;  2DPS A;  1VKC A;  4NGQ A;  4JLY A;  5LRK A;  3DSB A;  2BEI A;  4UF4 A;  2I00 A;  2ABZ A;  2AFM A;  2PR8 A;  3IJ3 A;  3KHX A;  2VQY A;  5G21 A;  4B13 A;  5C88 A;  3TFY A;  4FD6 A;  2VZY A;  3D7F A;  3NH4 A;  4W9Y A;  2P0W A;  1XMT A;  2X7B A;  2G3A A;  4R6T A;  5EMI A;  1IY7 A;  2WSA A;  4B5P A;  2DF5 A;  2Z3O A;  3PBE A;  4UCM A;  3PB9 X;  1ZLI A;  4FD5 A;  1YME A;  1ELM P;  3B8G A;  4OC2 A;  3R95 A;  3D7D A;  3TO6 A;  1YVO A;  3KR5 A;  4R76 A;  3T9Y A;  4FBE A;  4P45 A;  2BL1 A;  4UWI A;  3DR8 A;  4IF5 A;  1EE3 P;  1R57 A;  1FNO A;  4CAW A;  2AFO A;  1BPN A;  1Z8W A;  4J3G A;  2REF A;  2XEF A;  3PGP A;  2B58 A;  1LRZ A;  4A37 A;  5IB0 A;  2CNT A;  3D4U A;  2PJ7 A;  2OOT A;  5IX3 A;  4M6H A;  2C6G A;  2R8V A;  4MRI A;  4CAE A;  4EVY A;  2R1I A;  3SHP A;  4I49 A;  4M6G A;  3DR6 A;  4BIN A;  3PEI A;  5JH9 A;  1QST A;  2Q51 A;  3SI0 A;  1IOF A;  3H8F A;  3IEH A;  2F7V A;  4QVT A;  3WT4 A;  1KZF A;  2FXF A;  4DUK A;  1CX8 A;  4MMO A;  5I0C A;  1Y0R A;  1LAP A;  1LAM A;  2Z3L A;  2Z3M A;  1M4L A;  3FH4 A;  3IU2 A;  4U5Y A;  2KCW A;  4PPZ A;  3TO9 A;  3BHX A;  3HLP A;  3RNZ A;  3UY5 A;  3WC7 A;  4RI1 A;  2QYV A;  3V38 A;  4UCN A;  2PQ8 A;  4C2Y A;  2P6G A;  3V7Z A;  2ODF A;  4PXE A;  2J9A A;  3TCV A;  3B7I A;  2YNC A;  5CPA A;  3JVN A;  4NGM A;  4OID A;  2ZW7 A;  2CNM A;  2GFQ A;  1Q2Y A;  5H86 A;  4UIA A;  1NSL A;  1YX0 A;  5C82 A;  3FX6 A;  3LD2 A;  5JPH A;  2V8H A;  3IC1 A;  2C6P A;  2I3C A;  2DEA A;  4CAV A;  1M4G A;  3PRT A;  4MFJ A;  3KI9 A;  4IAV A;  1VHS A;  1XRY A;  3D2P A;  4R8F A;  1IYL A;  1YR0 A;  6CPA A;  4XNH C;  2DXQ A;  3D7H A;  4CRZ B;  1XIX A;  3RO0 A;  4JD6 A;  5HXD A;  2HC9 A;  4NGT A;  4E8O A;  1AUG A;  2Q4Z A;  2B3U A;  1CG2 A;  2YNC C;  3SJG A;  2YND A;  3S6K A;  1CJW A;  4KUB A;  3K9T A;  2ZW4 A;  3EY5 A;  7CPA A;  5J1Q A;  4HPS A;  4OP4 A;  5LYI A;  1S60 A;  1AMP A;  1ARL A;  1CBX A;  3G3S A;  4CAX A;  3FYN A;  2B5G A;  4M3S A;  3D2M A;  2RFH A;  4ORF A;  4PQA A;  5GCN A;  1IU8 A;  2WPX A;  2F5I A;  3GB0 A;  4F0Y A;  3GLJ A;  3KGQ A;  3PB7 X;  4GXH A;  4NGN A;  4ONW A;  4A39 A;  1Q2C A;  4NXY A;  4B11 A;  4ZY1 A;  1Y7R A;  3MRU A;  3FMC A;  4P44 A;  1CPX A;  2ZXV A;  3IO1 A;  4R87 A;  3S6F A;  3IWE A;  1TIQ A;  2Q43 A;  3FEE A;  3NE8 A;  2GIV A;  1L0C A;  1IYK A;  1U6M A;  2ZEN A;  4MCR A;  2RB7 A;  3S9L A;  2FT0 A;  4YRH A;  4ZYQ A;  2OH1 A;  5F49 A;  4BD9 A;  8CPA A;  1XE4 A;  2ANP A;  2BOA A;  2CTC A;  2FVG A;  3G8W A;  3R9G A;  3VH9 A;  1HEE A;  4EFD A;  4C68 A;  3N7Z A;  5G1Z A;  5HVF A;  3K9U A;  3P2H A;  4KOT A;  3VAT A;  3DDD A;  2PJ9 A;  3KQZ A;  1DE4 C;  2ZEM A;  2XEJ A;  3WR7 A;  4KOW A;  1S7N A;  3T8W A;  4BMH A;  3WC6 A;  3E0K A;  4MFZ A;  3SXN A;  1LOK A;  4KOS A;  2AFS A;  4C2Z A;  3LWU A;  4YFJ A;  4MCQ A;  2GU2 A;  3TO7 A;  4EWT A;  1CP6 A;  4NGR A;  1AYE A;  3R9F A;  4CGO A;  4ZGY B;  4R3L A;  5F48 A;  1PU9 A;  5I4M A;  3FXT A;  2DPT A;  1UWY A;  2POK A;  3D7G A;  1BOB A;  3FBU A;  5IV0 A;  3IU1 A;  5HH1 A;  3L2N A;  4DJL A;  1TF8 A;  2PIZ A;  1XBU A;  2AJ6 A;  4A32 A;  4U9Z A;  5LRJ A;  1TKJ A;  3F0A A;  4P6Y A;  4RN7 A;  3TTH A;  2R7H A;  2HB6 A;  4KS9 A;  4B6Z A;  2GLF A;  3IGR A;  2G0B A;  3GUX A;  1V0C A;  3KQX A;  3FRM A;  2IJZ A;  4NGS A;  2Q7S A;  4QUS A;  2EUI A;  5F47 A;  1YGH A;  5THW A;  2CNS A;  4B5P B;  4Y49 C;  1QSR A;  3SJE A;  4R7M A;  2WPW A;  2ZOF A;  2EBJ A;  3A9L A;  1BPM A;  4PV6 A;  2VXK A;  2R98 A;  3CZX A;  4HNW B;  2O4H A;  3TOB A;  2RC4 A;  4CGM A;  2Z11 A;  3D3S A;  4QC6 A;  1F2P A;  5ISV A;  3NA6 A;  3WC5 A;  1XJO A;  2GLJ A;  3W91 A;  4G1P A;  2H5M A;  3TC8 A;  2AFX A;  5F46 A;  1Z4E A;  2OZH A;  3B3C A;  4OC4 A;  4UCP A;  2PJ8 A;  4HKF A;  5EC4 A;  4A94 A;  1FY7 A;  1X10 A;  5BWA B;  1IID A;  2PJ3 A;  3ISX A;  4UFW A;  2V77 A;  1VHO A;  5KTD A;  2QEC A;  1F57 A;  4FD4 A;  3KL9 A;  1YW4 A;  3PBB A;  4KOU A;  4PK3 A;  1KUX A;  2PE3 A;  4NSQ A;  3CPX A;  2B4D A;  3BLN A;  4UEZ A;  2QIR A;  1LCP A;  4LUA A;  2I79 A;  3T90 A;  4A95 A;  2ZEF A;  5AG6 A;  1YW6 A;  2EO8 A;  2VI7 A;  3CDX A;  5KTC A;  2YNE A;  3F8K A;  3JUW A;  2JDD A;  5JM6 A;  2F8H A;  4KVX A;  1CPS A;  5A27 A;  2B3V A;  3W6S A;  2Q44 A;  3C26 A;  1XF8 A;  4E2A A;  4LQ6 A;  1Z8L A;  2IMO A;  2ZW5 A;  4CRY B;  2Z0Z A;  4KSI A;  1XOV A;  4FAI A;  4A2Z A;  1Y0Y A;  1Z8T A;  3IFE A;  1OZP A;  2REE A;  3RYO A;  3V8I A;  2P6F A;  2JEW A;  4P4D A;  4ZBG A;  4M6I A;  3VWE A;  2VBQ A;  5F09 A;  4NJQ A;  2Q7B A;  5K8P A;  4X3R A;  4ZX9 A;  1I1D A;  4AVA A;  4R3K A;  1Z5R A;  2OB0 A;  1KUY A;  1F2O A;  4A30 A;  2PVW A;  2J8N A;  3S6G A;  5CBM A;  2OU2 A;  4MY0 A;  5CNP A;  3D66 A;  2V8G A;  1ZG9 A;  1NSA A;  4JZ0 A;  3DLJ A;  3EXN A;  3KKW A;  3MN8 A;  4JXR A;  3W6X A;  5J8F A;  2ZEP A;  2PJ5 A;  3PP9 A;  4GS4 A;  1TKF A;  1R3N A;  4JJX A;  4PXC A;  3SI2 A;  2G3T A;  5G22 A;  3SJF A;  4OC3 A;  4NFR A;  5FVJ A;  3RZA A;  4F8Z A;  1YQE A;  3CXQ A;  1S7L A;  4OC1 A;  2NMT A;  1GHE A;  4UIB A;  4JYW A;  3CXP A;  4OME A;  3IIB A;  4OC0 A;  4YWY A;  2CF4 A;  4KZT A;  2CY2 A;  4PXB A;  4UBR A;  4E0A A;  3NH5 A;  4NJR A;  4KVM E;  4AVC A;  2J8R A;  5K8O A;  4AB7 A;  2BUE A;  4MBU A;  2FSR A;  4OIW A;  4X8I A;  2Z3N A;  3TOA A;  2PC1 A;  4II9 A;  3LOD A;  4CYP A;  1P4N A;  4CGP A;  1QSO A;  3I3G A;  1CM0 A;  4MHZ A;  4QBJ A;  3JTK A;  3KAS A;  5E96 A;  1Q2D A;  3VWD A;  2Q0Y A;  3K2K A;  2WUU A;  2WYR A;  2GE3 A;  3BJ8 A;  2GAN A;  2EWB A;  1J4J A;  3R96 A;  3FB3 A;  1Z9U A;  4FWU A;  3ISZ A;  2P6E A;  1MJB A;  1QQ9 A;  2PVV A;  3ZZI A;  5AG4 A;  4P10 A;  2ZW6 A;  1Z2L A;  4ZX8 A;  1S5K A;  3IWG A;  1Y9W A;  3QB8 A;  2EVN A;  2VL1 A;  5HVH A;  1Q7L A;  3I9S A;  4OKO A;  2HUZ A;  2JBJ A;  3I1U A;  4K30 A;  4MXU A;  3EC4 A;  3KHZ A;  4P4F A;  4PXD A;  4Q7A A;  4B5O A;  1SQH A;  4RS2 A;  4UA3 A;  1PUA A;  2PJ0 A;  2J8M A;  1QSN A;  3EO4 A;  1A2Z A;  3B3W A;  5AG5 A;  4Q36 A;  5LYL A;  1Z4R A;  2D4O A;  3FVL A;  1DTD A;  2CTB A;  3LAC A;  2FL4 A;  1LAN A;  4H89 A;  4XPD C;  4ZI6 A;  2Z10 A;  1JWQ A;  4Q38 A;  4KOV A;  3DNS A;  4YU9 A;  1YK3 A;  4A38 A;  2PJ1 A;  3RBU A;  3PZJ A;  4UFV A;  1MJ9 A;  5D29 A;  1IB1 E;  1S7F A;  5LYD A;  4P4I A;  4B12 A;  4HNY B;  4OC5 A;  3GYA A;  4P4E A;  4EME A;  1X12 A;  2JLM A;  5LRG A;  4CYN A;  4MFP A;  2EK9 A;  2PIY A;  2WZN A;  3B3T A;  3P2F A;  3FF3 A;  3B3S A;  1XFO A;  3PB8 X; 
#chains in the Genus database with same CATH homology
 2ZEG A;  3LMS A;  4CPA A;  4H2K A;  4MHP A;  1HDU A;  1XMB A;  4MCS A;  2C1C A;  3JRU A;  2ZEL A;  2ZOG A;  1RTQ A;  3QNV A;  1QMU A;  1VIX A;  1Y7E A;  5DS0 A;  2PJ6 A;  3WAB A;  1IGB A;  2BO9 A;  3BI0 A;  4X2T A;  3H8G A;  1PYT B;  2C6C A;  4F9U A;  1PCA A;  3CT9 A;  5D8N A;  2V8D A;  1ZG8 A;  1OBR A;  1YLO A;  3NFZ A;  1ZLH A;  1TKH A;  1TF9 A;  3B2Y A;  3SJX A;  2O53 A;  4TWE A;  5K8M A;  3CPA A;  2ZED A;  1JQG A;  2JBK A;  2ZEH A;  1VGY A;  5ELY A;  4P4J A;  3FEC A;  4O23 A;  5K8N A;  5HVG A;  2ZEO A;  4Z65 A;  4MHN A;  2PCU A;  2PJB A;  2PJ4 A;  1FT7 A;  3KR4 A;  5JGF A;  3NH8 A;  2V8V A;  4DYO A;  2GRE A;  4K3N A;  4P4B A;  1H8L A;  3KZW A;  4NGP A;  1KWM A;  1HDQ A;  3S9M A;  3DGV A;  2BCO A;  3PB6 X;  4UEE A;  4MCP A;  4ZY2 A;  2AFW A;  2PJA A;  4RUH A;  2QVP A;  2EK8 A;  2PRQ A;  2IQ6 A;  2CIJ A;  4AXV A;  4IK2 A;  4MHY A;  1GYT A;  4GM5 A;  2G9D A;  3S9N A;  3HUV A;  4UEF A;  3D68 A;  1TXR A;  3B3V A;  3TX8 A;  1ARM A;  1CP7 A;  5LYF A;  2NSM A;  2QJ8 A;  1ZG7 A;  5IB9 A;  3B35 A;  2AFZ A;  3BI1 A;  3SI1 A;  2PJ2 A;  3BXM A;  3N5F A;  3VAR A;  4ZY0 A;  3IWW A;  1LFW A;  2XEI A;  2AFU A;  2OR4 A;  3FED A;  1BLL E;  1BAV A;  3H8E A;  4IHM A;  3PB4 X;  1R43 A;  3RAM A;  4WJB A;  2XEG A;  2NYQ A;  3PFE A;  1ELL P;  3FJU A;  2ZEE A;  4FUU A;  4TNU A;  4WWV A;  4LQG A;  3D67 A;  1VHE A;  2PJC A;  4F9V A;  3PFO A;  1YSJ A;  4NGQ A;  5LRK A;  4UF4 A;  2ABZ A;  2AFM A;  3KHX A;  3IJ3 A;  3D7F A;  3NH4 A;  4W9Y A;  4R6T A;  1IY7 A;  3PBE A;  3PB9 X;  1ZLI A;  1YME A;  1ELM P;  4OC2 A;  3D7D A;  3KR5 A;  4R76 A;  4FBE A;  4P45 A;  1EE3 P;  1FNO A;  2AFO A;  1BPN A;  2XEF A;  4A37 A;  3D4U A;  2PJ7 A;  2OOT A;  2C6G A;  4MRI A;  3PEI A;  5JH9 A;  2Q51 A;  3SI0 A;  3H8F A;  3IEH A;  2F7V A;  3WT4 A;  4DUK A;  1CX8 A;  4MMO A;  1Y0R A;  1LAP A;  1LAM A;  3FH4 A;  1M4L A;  4PPZ A;  3BHX A;  3HLP A;  3WC7 A;  2QYV A;  3V38 A;  3V7Z A;  4PXE A;  2J9A A;  3B7I A;  5CPA A;  4NGM A;  4OID A;  4UIA A;  3FX6 A;  2V8H A;  3IC1 A;  2C6P A;  2I3C A;  2DEA A;  3PRT A;  3KI9 A;  4IAV A;  1XRY A;  4R8F A;  6CPA A;  3D7H A;  5HXD A;  2HC9 A;  4NGT A;  2Q4Z A;  1CG2 A;  3SJG A;  3K9T A;  7CPA A;  5J1Q A;  4OP4 A;  5LYI A;  1AMP A;  1ARL A;  1CBX A;  2RFH A;  4PQA A;  3GB0 A;  3GLJ A;  3KGQ A;  3PB7 X;  4NGN A;  4ONW A;  4A39 A;  4ZY1 A;  3MRU A;  3FMC A;  4P44 A;  1CPX A;  3IO1 A;  2Q43 A;  3FEE A;  2ZEN A;  4MCR A;  3S9L A;  2RB7 A;  4ZYQ A;  4BD9 A;  8CPA A;  2BOA A;  2ANP A;  2CTC A;  2FVG A;  3VH9 A;  1HEE A;  4EFD A;  5HVF A;  3VAT A;  2PJ9 A;  3KQZ A;  1DE4 C;  2ZEM A;  2XEJ A;  3T8W A;  3WC6 A;  1LOK A;  2AFS A;  3LWU A;  4MCQ A;  2GU2 A;  4EWT A;  1CP6 A;  4NGR A;  1AYE A;  5I4M A;  1UWY A;  2POK A;  3D7G A;  4DJL A;  3L2N A;  1TF8 A;  2PIZ A;  1XBU A;  5LRJ A;  1TKJ A;  4P6Y A;  2HB6 A;  4B6Z A;  2GLF A;  3GUX A;  3KQX A;  2IJZ A;  4NGS A;  5THW A;  3SJE A;  4R7M A;  2ZOF A;  1BPM A;  2O4H A;  1F2P A;  3NA6 A;  3WC5 A;  1XJO A;  2GLJ A;  4G1P A;  3TC8 A;  2AFX A;  3B3C A;  4OC4 A;  2PJ8 A;  4A94 A;  2PJ3 A;  3ISX A;  2V77 A;  1VHO A;  1F57 A;  3KL9 A;  1YW4 A;  3PBB A;  2PE3 A;  3CPX A;  4UEZ A;  1LCP A;  2ZEF A;  1YW6 A;  3CDX A;  5JM6 A;  2F8H A;  1CPS A;  1Z8L A;  2IMO A;  4KSI A;  4FAI A;  1Y0Y A;  3IFE A;  2JEW A;  4P4D A;  5F09 A;  4NJQ A;  5K8P A;  4X3R A;  4ZX9 A;  1Z5R A;  1F2O A;  2PVW A;  5CBM A;  3D66 A;  2V8G A;  1ZG9 A;  1NSA A;  4JZ0 A;  3DLJ A;  3MN8 A;  2ZEP A;  2PJ5 A;  1TKF A;  1R3N A;  4PXC A;  3SI2 A;  3SJF A;  4OC3 A;  4NFR A;  3RZA A;  4F8Z A;  4OC1 A;  4UIB A;  4JYW A;  4YWY A;  4OME A;  3IIB A;  4OC0 A;  2CF4 A;  4PXB A;  3NH5 A;  4NJR A;  5K8O A;  4OIW A;  4X8I A;  4MHZ A;  3KAS A;  3K2K A;  2WYR A;  2EWB A;  4FWU A;  3ISZ A;  1QQ9 A;  2PVV A;  4P10 A;  4ZX8 A;  1Z2L A;  2VL1 A;  5HVH A;  1Q7L A;  4OKO A;  2JBJ A;  3I1U A;  4MXU A;  4P4F A;  4Q7A A;  3KHZ A;  4PXD A;  5LYL A;  2PJ0 A;  3B3W A;  3FVL A;  1DTD A;  2CTB A;  1LAN A;  4ZI6 A;  4YU9 A;  4A38 A;  2PJ1 A;  3RBU A;  5D29 A;  5LYD A;  4P4I A;  4OC5 A;  4P4E A;  4EME A;  5LRG A;  2EK9 A;  2PIY A;  2WZN A;  3B3T A;  3FF3 A;  3B3S A;  1XFO A;  3PB8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...