1GHEA

Crystal structure of tabtoxin resistance protein complexed with an acyl coenzyme a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
170
structure length
170
Chain Sequence
b'AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE
publication title Crystal Structure of Tabtoxin Resistance Protein Complexed with Acetyl Coenzyme A Reveals the Mechanism for beta-Lactam Acetylation
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
molecule tags Transferase
total genus 49
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1gheA00
4DNCA 2Q44A 2ZXVA 2PSWA 4MI4A 3KKWA 5C82A 3JUWA 3R9GA 4BMHA 4KOWA 4LUAA 4KUAA 4PK2A 5F47A 2F5IA 4KLVA 4CAXA 1Q2CA 5F46A 5EBVA 1QSNA 1M1DA 1OZPA 2CNTA 3CXQA 2FL4A 1I1DA 3S6GA 4XPKA 4II9A 2A4NA 1YK3A 4PSXA 2PDOA 4NXYA 5JPHA 3TFYA 3W91A 3SXNA 1P0HA 2Q0YA 1Y9KA 4U9YA 4M85A 2JDDA 4OLLA 2P6GA 2JLMA 2CNSA 3NE7A 4KZTA 4QVTA 3CXSA 4AVCA 4KOTA 1U6MA 4PV6A 2FS5A 2WPWA 3PZJA 2VZZA 1IIDA 5IX3A 4XPLA 2AJ6A 3R95A 2D4OA 4YFJA 5F49A 2Y0MA 3P2HA 1VKCA 4U5YA 5C88A 3FBUA 2PC1A 2P6FA 1B6BA 5GCNA 1YR0A 4B5PA 1IYLA 1CM0A 1MJBA 1GHEA 1WK4A 3R9EA 1ON0A 4UBRA 2VBQA 5H86A 5KTCA 4J3GA 2R98A 3T90A 2G3AA 1NMTA 1S7KA 3RYOA 4E0AA 4IF5A 4AVAA 2HV2A 1Y7RA 2QMLA 1QSMA 4R9MA 3EXNA 2VXKA 1YGHA 1Q2DA 4NF1A 2WPXA 3FIXA 3S6FA 1S5KA 3BJ8A 1V0CA 3DDDA 1PUAA 2IL4A 1B87A 5KTAA 2RC4A 3C26A 4NEXA 1IYKA 1QSTA 4AG7A 4CS0B 2PRBA 1NSLA 5IV0A 4ONUA 3FB3A 1NE9A 4QC6A 4CAVA 2PR8A 3G3SA 3EC4A 3JVNA 4HNWB 3TO6A 2J8NA 4ZBGA 1S3ZA 3W6XA 1S7FA 3DR6A 1Z9UA 2K5TA 1BOBA 4MJ8A 4KOSA 3FRMA 3EY5A 1BO4A 3I3GA 3VWDA 2D4PA 2PR1A 4JLYA 2REFA 2VZYA 2B3UA 4QUSA 2VI7A 5H84A 3TT2A 1S60A 4UA3A 2B4BA 2CY2A 3TTHA 2BEIA 4XNHB 3B8GA 2P6EA 1KZFA 1FY7A 4KVOE 3G8WA 4OAEA 1QSRA 4QB9A 3N7ZA 4KVME 3S6HA 3FYNA 2AE6A 1P4NA 4B5OA 4FD4A 4PK3A 2I00A 2ZW6A 3WR7A 2GE3A 4KVXA 5CNPA 4UWIA 5KTDA 2X7BA 1M44A 4F0YA 2R7HA 3D2MA 2FT0A 4R57A 2J8RA 4FD5A 4UWJA 2VQYA 1WWZA 4H6UA 4KORA 3GY9A 4Y49B 4MBUA 5HH1A 4KOXA 5ISVA 4XNHC 3PP9A 3S6KA 4NSQA 3CXPA 3FNCA 2BSWA 2OU2A 3R1KA 4KUBA 1VHSA 4LX9A 1L0CA 3W6SA 3F8KA 4JD6A 2Q4YA 2B3VA 3TO7A 2JEVA 4KOVA 2FCKA 2FXFA 3DR8A 2QIRA 4RS2A 2ARHA 2OZGA 2B5GB 1XEBA 5DWNA 4AG9A 2J8MA 1MK4A 2Q7BA 3DSBA 4FD6A 3D2PA 2ATRA 1MJAA 4FD7A 4R3LA 2FSRA 4I49A 1RO5A 3SHPA 2Q04A 2JDCA 2Z11A 3K9UA 1S7NA 4Y49C 4M3SA 1YVKA 2HUZA 4RI1A 3UY5A 3IGRA 1R57A 1IB1E 1M4IA 4HNYB 3TCVA 2Q4VA 4QBJA 1UFHA 2B4DB 3BJ7A 4GS4A 3I9SA 1MJ9A 5FVJA 1M4GA 3F0AA 1KUXA 3R9FA 2EUIA 4L89A 4CRYB 3V8IA 1YREA 3D3SA 4ORFA 5I0CA 1XE4A 4F6AA 4H6ZA 3PGPA 1K4JA 1J4JA 1Z4EA 4U9ZA 4L8AA 4R3KA 3FXTA 4AB7A 3QAHA 1S7LA 5EC4A 3EFAA 3P2FA 2OZUA 2ZW7A 4KLWA 4PSWA 5J8FA 4HNXB 4CRZB 5J8CA 4MY3A 4CAWA 1IICA 4NCZA 3ZJ0A 3H4QA 3TOAA 1XIXA 2ZW5A 2CNMA 5F48A 1YLEA 3GYAA 2GIVA 2FIWA 4KOYA 4JJXA 1CJWA 2R1IA 1N71A 2H5MA 4JXRA 4JXQA 2OH1A 2KCWA 5DWMA 3QB8A 4X5KA 2NMTA 1PU9A 2GANA 1KUVA 1XMTA 1M4DA 5IB0A 4IUSA 2O28A 2R8VA 3E0KA 1Q2YA 2ZPAA 2I79A 1QSOA 4KOUA 4AVBA 3GKRA 2DXQA 4R87A 4XPDB 2HQYA 2EVNA 2FE7A 1RXTA 4B5PB 2OZHA 4E2AA 2B5GA 4YGOA 3MGDA 2OB0A 1Z4RA 2PQ8A 2B58A 5JQ4A 4MHDA 1YVOA 1Y9WA 2Z10A 4OADA 3BLNA 4MY0A 2QECA 3DNSA 3ZZIA 2C27A 3LODA 2Z0ZA 3R96A 4JWPA 2FIAA 1I12A 3D8PA 4EVYA 2REEA 2G3TA 3TOBA 3LD2A 2BL1A 3IWGA 5HMNA 1TIQA 2BUEA 3TE4A 1I21A 4HKFA 3VWEA 5E96A 1KUYA 2B4DA 2G0BA 2P0WA 3F5BA 1XF8A 2ZW4A 3SXOA 4YRHA 3TO9A 3EO4A 4XPDC 4K30A 4H89A 1SQHA 2VEZA 3OWCA 4E8OA 1YX0A 3T9YA 1LRZA
chains in the Genus database with same CATH superfamily
1TKHA 4DNCA 2V8VA 4B14A 4OC4A 2AFWA 2C6CA 2Q44A 2ODFA 2ZXVA 4MHZA 2PSWA 2DPSA 4MFPA 4MI4A 3KKWA 1LANA 1LAMA 4A32A 5C82A 3JUWA 3R9GA 4R6TA 4BMHA 4KOWA 1TF9A 4LUAA 4KUAA 4PK2A 2DF5A 5F47A 2F5IA 4KLVA 4CAXA 2PJ5A 4KSIA 1Q2CA 1Y0YA 1X12A 3IU2A 1XMBA 4UEZA 5ELYA 5F46A 1KWMA 2C6GA 1Q7LA 1QSNA 5EBVA 4B12A 1M1DA 1CPXA 2PCUA 1OZPA 2CNTA 3CXQA 3D66A 2FL4A 4NGQA 1I1DA 4KS9A 4UCPA 4NFRA 4XPKA 3S6GA 4II9A 2A4NA 1YK3A 3PB4X 2PJ4A 4PSXA 4Q38A 2PDOA 4NXYA 5JPHA 3V7ZA 5HVGA 3GIUA 4UFWA 2AFZA 3W91A 4A38A 3SXNA 4CGOA 3TFYA 1HDQA 5THWA 4ONWA 1P0HA 2CTCA 4X8IA 2Q0YA 1Y9KA 4A39A 4OC3A 4U9YA 4M85A 1YQEA 2JDDA 4OLLA 1IU8A 5BWAB 2P6GA 1VGYA 2JLMA 2Q43A 5G20A 2CNSA 3NE7A 4KZTA 2PJ2A 2RFHA 4QVTA 3CXSA 4A33A 4AVCA 4B6ZA 5LYDA 4KOTA 1EE3P 1U6MA 3QAYA 3IU1A 2POKA 4OIWA 4LQGA 4OKOA 4PV6A 2FS5A 2WPWA 4A31A 5A27A 5G21A 3QNVA 3PZJA 4EMEA 3PEIA 4FBEA 2VZZA 1IIDA 4A37A 5IX3A 4IHMA 4XPLA 2AJ6A 3R95A 1YSJA 3WC6A 2D4OA 2EK8A 4YFJA 2RB7A 5F49A 5LRJA 5LYLA 3PFOA 2Y0MA 3P2HA 2ZEFA 4OC0A 1VKCA 4U5YA 5C88A 4H2KA 1PCAA 1UWYA 3FBUA 2PC1A 2P6FA 2YNCC 4B11A 1TKFA 4NGRA 1B6BA 4KSAA 5GCNA 1YR0A 4C2ZA 5CBMA 1XOVA 3D7FA 4A2ZA 4W9YA 4B5PA 1R3NA 2PJ3A 5J1QA 2BO9A 1IYLA 4DJLA 3D68A 1CM0A 5JGFA 3IEHA 3CPXA 2C1CA 5AG5A 1MJBA 2CF4A 4P4BA 1GHEA 2AFMA 1WK4A 5CPAA 2YGWA 2ZEPA 3HLPA 3R9EA 5G1ZA 4CGPA 4PXCA 1ON0A 2EBJA 3FECA 4UBRA 2VBQA 5H86A 1YMEA 3MN8A 3KHXA 2WSAA 1ZLHA 4MFLA 5KTCA 4Q7AA 2XEFA 4J3GA 2R98A 4JZ0A 3T90A 2G3AA 3FJUA 1NMTA 1VHEA 3PB6X 4MHPA 3PB9X 3D7DA 2YNDA 1S7KA 3RYOA 2DEAA 4E0AA 4IF5A 4R8FA 4RN7A 2V8DA 4AVAA 1CPSA 1LOKA 1Y7RA 2HV2A 4UEEA 4BBHA 4PPZA 3PB8X 2QMLA 4P4FA 1QSMA 4ZX9A 4R9MA 4R76A 3IO1A 3EXNA 3SI0A 1CP7A 3WABA 2VXKA 3SJEA 1YGHA 1ELLP 4OIDA 1Q2DA 3KL9A 4P4EA 3KR5A 2V8HA 2PIZA 4UEFA 4NF1A 2WPXA 1VIXA 3FIXA 4OC5A 3S6FA 4IAVA 1S5KA 3BJ8A 3H8EA 4F0XA 4UCMA 2DPTA 1V0CA 4CGNA 7CPAA 1VHOA 3RAMA 3DDDA 3S9LA 1Z8LA 4MHYA 1PUAA 2IL4A 2GLJA 2ZEGA 4OMEA 5K8MA 1B87A 5KTAA 2RC4A 3L2NA 3C26A 5LYFA 4NEXA 3A9LA 1IYKA 1ZLIA 3S9NA 2O4HA 1QSTA 4MFQA 4MFZA 2AFSA 4TNUA 4AG7A 4CS0B 3NH5A 2PRBA 1NSLA 4A94A 2YNCA 2GFQA 5G22A 5IV0A 4ONUA 3FB3A 1HDUA 1XFOA 4MCPA 1NE9A 4QC6A 4CAVA 2NYQA 2PR8A 3KQZA 4ZGYB 5JH9A 3G3SA 3EC4A 3JVNA 4HNWB 1ZG7A 4PXBA 3TO6A 2J8NA 4ZBGA 1LAPA 1S3ZA 3W6XA 1IOFA 5K8OA 1S7FA 2XEIA 3DR6A 4RUHA 1Z9UA 4OP4A 4PQAA 4BD9A 1ARLA 2K5TA 1BOBA 4MJ8A 6CPAA 4KOSA 1X10A 2ZEOA 3BXMA 3FRMA 3EY5A 5A28A 1BO4A 2BCOA 2IMOA 1DTDA 3I3GA 3VWDA 2CXAA 4MMOA 2D4PA 2Z3OA 2NSMA 2PR1A 3RZAA 4UIBA 2PVVA 2ZEDA 2REFA 4JLYA 2VZYA 3MRUA 2J9AA 1CBXA 3FVLA 2B3UA 4QUSA 2VI7A 5H84A 4B10A 3TT2A 1ARMA 1S60A 2BOAA 4UA3A 2B4BA 2CY2A 1TXRA 2BEIA 2QJ8A 4XNHB 3TTHA 2PRQA 3B8GA 3IFEA 4OC1A 2P6EA 3PBBA 1TF8A 3DGVA 2ANPA 1KZFA 1FY7A 4MHNA 2JEWA 2V8GA 1ZG9A 2AFUA 3G8WA 4KVOE 4OAEA 4HPSA 4ZYQA 1QSRA 5AG6A 3B7IA 4QB9A 3N7ZA 3IWEA 4P4IA 2Q7SA 4KVME 3KGQA 5IB9A 2JBJA 4CGLA 4WWVA 4BINA 4P44A 3FF3A 4GXHA 4LQ6A 3S6HA 4CPAA 3FYNA 2AE6A 1CP6A 1P4NA 5AGEA 5LRKA 4B5OA 4FD4A 4PK3A 3WT4A 4Z65A 2I00A 4CYQA 1OBRA 5HVFA 2ZW6A 3WR7A 2C6PA 2EWBA 2GE3A 4KVXA 5CNPA 2PJ0A 4UWIA 5KTDA 2X7BA 1M44A 1F2PA 3KZWA 4F0YA 2R7HA 3CT9A 3KI9A 3D2MA 2FT0A 4TWEA 4R57A 4AXVA 4CYPA 2J8RA 1A2ZA 4A30A 4FD5A 4UWJA 1M4LA 2VQYA 1WWZA 4H6UA 3RBUA 5AG7A 3I1UA 4NJRA 4KORA 3GY9A 4Y49B 4MBUA 2WUUA 2XEGA 5HH1A 3LWUA 4KOXA 4UIAA 3NH8A 3FX6A 5ISVA 4XNHC 2ZEHA 4C7IA 3PP9A 5I4MA 3S6KA 4NSQA 3CXPA 2EK9A 4X3RA 1AUGA 3FNCA 2BSWA 5LRGA 3B3WA 2OU2A 4GM5A 3GUXA 3R1KA 4KUBA 1VHSA 2GLFA 4LX9A 4DUKA 1L0CA 5D29A 3W6SA 3F8KA 4JD6A 2Q4YA 3T8WA 4OC2A 4EFDA 1JWQA 3PRTA 2B3VA 4K3NA 3TO7A 4F8ZA 2JEVA 3DLJA 4KOVA 4C7HA 2FCKA 1BPMA 2FXFA 3DR8A 3IJ3A 4CGMA 1NSAA 2QIRA 5DS0A 4RS2A 4F9UA 2ARHA 3TX8A 2OZGA 4JYWA 4UCNA 1IGBA 2FVGA 4NGMA 2B5GB 1XEBA 4P45A 4ZY1A 4B13A 5DWNA 4AG9A 2J8MA 1F57A 4P6YA 8CPAA 1F2OA 1MK4A 2Q7BA 3DSBA 1CX8A 4FD6A 3D2PA 2ATRA 1MJAA 2Q51A 4FD7A 4R3LA 2Z3PA 3JTKA 2FSRA 2VL1A 3D7GA 4I49A 2ZEMA 1RO5A 3SHPA 4P4DA 4G1PA 2Q04A 4UFVA 1Y7EA 2JDCA 3PB7X 2Z11A 2Z3KA 3K9UA 1S7NA 4Y49C 4M3SA 1YVKA 3KASA 1H8LA 5K8PA 2HUZA 4RI1A 2ZENA 1XBUA 2PJAA 3B2YA 3K2KA 3BI0A 3UY5A 3IGRA 3BHXA 4YWYA 1R57A 1Z8TA 1IB1E 1M4IA 5D8NA 3FEDA 4HNYB 4NGNA 3TCVA 2Q4VA 4QBJA 1UFHA 2B4DB 3B35A 2Q4ZA 2G9DA 3BJ7A 1MJ9A 3CZXA 3I9SA 4GS4A 1M4GA 4UFXA 5FVJA 3TC8A 3F0AA 4YU9A 1KUXA 3R9FA 2OOTA 4MRIA 2EUIA 3D7HA 4L89A 2PJ9A 3GB0A 3PFEA 4M6IA 2AFOA 4CRYB 3N5FA 2Z3MA 3V8IA 1YREA 1XRYA 3D3SA 4ORFA 5I0CA 1ELMP 4UF4A 1XE4A 2ZOGA 2OR4A 3CPAA 2PE3A 4M6HA 4F6AA 4ZY0A 1JQGA 4H6ZA 2F8HA 3IWWA 4P10A 3PGPA 1K4JA 1J4JA 1Z4EA 4NGPA 3BI1A 2PJCA 4F9VA 2ZOFA 3V38A 1Y0RA 2PJBA 2GU2A 4L8AA 4U9ZA 4R3KA 3H5ZA 3FXTA 4AB7A 3QAHA 5F09A 3B3SA 1AYEA 1S7LA 5EC4A 3EFAA 3P2FA 3B3VA 1XJOA 4X2TA 1YW4A 2OZUA 2ZW7A 3VH9A 4KLWA 1RTQA 4PSWA 5J8FA 4HNXB 4CRZB 1LCPA 3H8FA 5J8CA 4CAFA 4MY3A 4FWUA 5EMIA 4CAWA 2PJ6A 3RNZA 1IICA 4NCZA 3ZJ0A 3H4QA 4WJBA 3TOAA 1XIXA 2ZW5A 2PIYA 2CNMA 5F48A 1YLEA 4PXDA 1TKJA 4MFKA 3GYAA 3SJXA 2GIVA 2PJ8A 2FIWA 4KOYA 4JJXA 1CJWA 2R1IA 1N71A 1ZO0A 2H5MA 3B3TA 4MCRA 4ZX8A 5JM6A 3KQXA 3FEEA 3PBEA 4MCSA 4JXRA 3ISZA 4JXQA 2OH1A 4P4JA 2KCWA 4A95A 5DWMA 2HC9A 3QB8A 4X5KA 4ZI6A 2HB6A 2CIJA 2NMTA 1PU9A 2PJ1A 2GANA 1Z2LA 1KUVA 3NH4A 4CAEA 1XMTA 1M4DA 1QMUA 1DE4C 2I3CA 5IB0A 2GREA 1IOIA 3VARA 4IUSA 2O28A 4C68A 2R8VA 3E0KA 1Z8XA 1Q2YA 2QVPA 2ZPAA 4ZY2A 4CYNA 3IC1A 2I79A 1QSOA 4KOUA 2IJZA 1QQ9A 4AVBA 3GKRA 2DXQA 4R87A 4XPDB 2HQYA 2EVNA 4NGSA 2FE7A 3ISXA 1RXTA 2AFXA 4C2YA 3LMSA 4R7MA 1HEEA 1LFWA 3IIBA 4MCQA 1Z8WA 2PJ7A 2WYRA 3D67A 1FNOA 3D4UA 2OZHA 4B5PB 3SI1A 4E2AA 2B5GA 4NGTA 1R43A 4M6GA 4YGOA 3MGDA 4O23A 2OB0A 2ZELA 5LYIA 3H8GA 1FT7A 3K9TA 1Z4RA 2PQ8A 3JRUA 3WC5A 2YNEA 5HVHA 2B58A 5JQ4A 4MHDA 1YVOA 1Y9WA 2Z10A 4OADA 3BLNA 1BPNA 4MY0A 3RO0A 2O53A 2QECA 4PXEA 3VATA 2F7VA 2Z3LA 3DNSA 2C27A 3ZZIA 4CYOA 4DYOA 4KSFA 3SI2A 5HXDA 3LODA 3SJFA 5AG4A 4IK2A 1ZG8A 2Z0ZA 3R96A 1BLLE 4JWPA 2FIAA 3SJGA 4EWTA 1I12A 2IQ6A 2XEJA 2ZEEA 3D8PA 2REEA 4NJQA 4EVYA 4C2XA 2G3TA 5K8NA 4Q36A 3TOBA 3LD2A 2BL1A 3IWGA 2Z3NA 5HMNA 2EO8A 1GYTA 1TIQA 2BUEA 1BAVA 2QYVA 3NA6A 3LACA 2V77A 3FH4A 1Z5RA 4MFJA 1I21A 3TE4A 3NFZA 4HKFA 4FUUA 3KHZA 3VWEA 5E96A 3CDXA 1KUYA 2CTBA 2B4DA 2G0BA 2P0WA 3B3CA 3KR4A 3F5BA 4FAIA 1XF8A 2ZW4A 3SXOA 2PVWA 3HUVA 4YRHA 3TO9A 2WZNA 3EO4A 1CG2A 3GLJA 1AMPA 4K30A 4XPDC 4H89A 1SQHA 2VEZA 3NE8A 3OWCA 2ABZA 3WC7A 4E8OA 4MXUA 1YW6A 1YX0A 2JBKA 1IY7A 3FMCA 1PYTB 3T9YA 1YLOA 1LRZA 3S9MA
chains in the Genus database with same CATH topology
4DNCA 4B14A 2Q44A 2ZXVA 2PSWA 2DPSA 4MFPA 4MI4A 3KKWA 4A32A 5C82A 3JUWA 3R9GA 4BMHA 4KOWA 4LUAA 4KUAA 4PK2A 5F47A 2F5IA 4KLVA 4CAXA 1Q2CA 3IU2A 5F46A 5EBVA 1QSNA 4B12A 1M1DA 1OZPA 2CNTA 3CXQA 2FL4A 1I1DA 4KS9A 4UCPA 3S6GA 4XPKA 4II9A 2A4NA 1YK3A 4Q38A 4PSXA 2PDOA 4NXYA 5JPHA 4UFWA 3TFYA 3W91A 3SXNA 4CGOA 1P0HA 2Q0YA 1Y9KA 4U9YA 4M85A 2JDDA 4OLLA 5BWAB 2P6GA 2JLMA 5G20A 2CNSA 3NE7A 4KZTA 4QVTA 3CXSA 4A33A 4AVCA 4KOTA 1U6MA 3IU1A 4PV6A 2FS5A 2WPWA 4A31A 5A27A 5G21A 3PZJA 2VZZA 1IIDA 5IX3A 4XPLA 2AJ6A 3R95A 2D4OA 4YFJA 5F49A 2Y0MA 3P2HA 1VKCA 4U5YA 5C88A 3FBUA 2PC1A 2P6FA 2YNCC 4B11A 1B6BA 4KSAA 5GCNA 1YR0A 4C2ZA 4A2ZA 4B5PA 1IYLA 1CM0A 5AG5A 1MJBA 1GHEA 1WK4A 2YGWA 3R9EA 5G1ZA 4CGPA 1ON0A 4UBRA 2VBQA 5H86A 4MFLA 5KTCA 4J3GA 2R98A 3T90A 2G3AA 1NMTA 2YNDA 1S7KA 3RYOA 4E0AA 4IF5A 4AVAA 2HV2A 1Y7RA 4BBHA 2QMLA 1QSMA 4R9MA 3EXNA 2VXKA 1YGHA 1Q2DA 4NF1A 2WPXA 3FIXA 3S6FA 1S5KA 3BJ8A 4F0XA 4UCMA 2DPTA 1V0CA 4CGNA 3DDDA 1PUAA 2IL4A 1B87A 5KTAA 2RC4A 3C26A 4NEXA 3A9LA 1IYKA 1QSTA 4MFQA 4MFZA 4AG7A 4CS0B 2PRBA 1NSLA 2YNCA 5G22A 5IV0A 4ONUA 3FB3A 1NE9A 4QC6A 4CAVA 2PR8A 4ZGYB 3G3SA 3EC4A 3JVNA 4HNWB 3TO6A 2J8NA 4ZBGA 1S3ZA 3W6XA 1S7FA 3DR6A 1Z9UA 2K5TA 1BOBA 4MJ8A 4KOSA 3FRMA 3EY5A 5A28A 1BO4A 3I3GA 3VWDA 2CXAA 2D4PA 2Z3OA 2PR1A 4JLYA 2REFA 2VZYA 2B3UA 4QUSA 2VI7A 5H84A 4B10A 3TT2A 1S60A 4UA3A 2B4BA 2CY2A 3TTHA 2BEIA 4XNHB 3B8GA 2P6EA 1KZFA 1FY7A 4KVOE 3G8WA 4OAEA 1QSRA 5AG6A 4QB9A 3N7ZA 3IWEA 4KVME 4CGLA 3S6HA 3FYNA 2AE6A 1P4NA 5AGEA 4B5OA 4FD4A 4PK3A 2I00A 4CYQA 2ZW6A 3WR7A 2GE3A 4KVXA 5CNPA 4UWIA 5KTDA 2X7BA 1M44A 4F0YA 2R7HA 3D2MA 2FT0A 4R57A 4CYPA 2J8RA 4A30A 4FD5A 4UWJA 2VQYA 1WWZA 4H6UA 5AG7A 4KORA 3GY9A 4Y49B 4MBUA 2WUUA 5HH1A 4KOXA 5ISVA 4XNHC 4C7IA 3PP9A 3S6KA 4NSQA 3CXPA 3FNCA 2BSWA 2OU2A 3R1KA 4KUBA 1VHSA 4LX9A 1L0CA 3W6SA 3F8KA 4JD6A 2Q4YA 2B3VA 3TO7A 2JEVA 4KOVA 4C7HA 2FCKA 2FXFA 4CGMA 3DR8A 2QIRA 4RS2A 2ARHA 2OZGA 4UCNA 2B5GB 1XEBA 4B13A 5DWNA 4AG9A 2J8MA 1MK4A 2Q7BA 3DSBA 4FD6A 3D2PA 2ATRA 1MJAA 4FD7A 4R3LA 2Z3PA 3JTKA 2FSRA 4I49A 1RO5A 3SHPA 2Q04A 4UFVA 2JDCA 2Z11A 2Z3KA 3K9UA 1S7NA 4Y49C 4M3SA 1YVKA 2HUZA 4RI1A 3UY5A 3IGRA 1R57A 1IB1E 1M4IA 4HNYB 3TCVA 2Q4VA 4QBJA 1UFHA 2B4DB 3BJ7A 4GS4A 3I9SA 1MJ9A 5FVJA 1M4GA 4UFXA 3F0AA 1KUXA 3R9FA 2EUIA 4L89A 4CRYB 2Z3MA 3V8IA 1YREA 3D3SA 4ORFA 5I0CA 1XE4A 4F6AA 4H6ZA 3PGPA 1K4JA 1J4JA 1Z4EA 4U9ZA 4L8AA 4R3KA 3H5ZA 3FXTA 1LRZA 4AB7A 3QAHA 1S7LA 5EC4A 3EFAA 3P2FA 2OZUA 2ZW7A 4KLWA 4PSWA 5J8FA 4HNXB 4CRZB 5J8CA 4CAFA 4MY3A 4CAWA 1IICA 4NCZA 3ZJ0A 3H4QA 3TOAA 1XIXA 2ZW5A 2CNMA 5F48A 1YLEA 4MFKA 3GYAA 2GIVA 2FIWA 4KOYA 4JJXA 1CJWA 2R1IA 1N71A 1ZO0A 2H5MA 4JXRA 4JXQA 2OH1A 2KCWA 4A95A 5DWMA 3QB8A 4X5KA 2NMTA 1PU9A 2GANA 1KUVA 4CAEA 1XMTA 1M4DA 5IB0A 4IUSA 2O28A 4C68A 2R8VA 3E0KA 1Q2YA 2ZPAA 4CYNA 2I79A 1QSOA 4KOUA 4AVBA 3GKRA 2DXQA 4R87A 4XPDB 2HQYA 2EVNA 2FE7A 1RXTA 4C2YA 4B5PB 2OZHA 4E2AA 2B5GA 4YGOA 3MGDA 2OB0A 1Z4RA 2PQ8A 2YNEA 2B58A 5JQ4A 4MHDA 1YVOA 1Y9WA 2Z10A 4OADA 3BLNA 4MY0A 2QECA 4CYOA 2Z3LA 3DNSA 2C27A 3ZZIA 4KSFA 3LODA 5AG4A 2Z0ZA 3R96A 4JWPA 2FIAA 1I12A 3D8PA 4EVYA 2REEA 4C2XA 2G3TA 4Q36A 3TOBA 3LD2A 2BL1A 3IWGA 2Z3NA 5HMNA 1TIQA 2BUEA 4MFJA 3TE4A 1I21A 4HKFA 3VWEA 5E96A 1KUYA 2B4DA 2G0BA 2P0WA 3F5BA 1XF8A 2ZW4A 3SXOA 4YRHA 3TO9A 3EO4A 4XPDC 4K30A 4H89A 1SQHA 2VEZA 3OWCA 4E8OA 1YX0A 3T9YA 2WSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNC A;  2Q44 A;  2ZXV A;  2PSW A;  4MI4 A;  3KKW A;  5C82 A;  3JUW A;  3R9G A;  4BMH A;  4KOW A;  4LUA A;  4KUA A;  4PK2 A;  5F47 A;  2F5I A;  4KLV A;  4CAX A;  1Q2C A;  5F46 A;  5EBV A;  1QSN A;  1M1D A;  1OZP A;  2CNT A;  3CXQ A;  2FL4 A;  1I1D A;  3S6G A;  4XPK A;  4II9 A;  2A4N A;  1YK3 A;  4PSX A;  2PDO A;  4NXY A;  5JPH A;  3TFY A;  3W91 A;  3SXN A;  1P0H A;  2Q0Y A;  1Y9K A;  4U9Y A;  4M85 A;  2JDD A;  4OLL A;  2P6G A;  2JLM A;  2CNS A;  3NE7 A;  4KZT A;  4QVT A;  3CXS A;  4AVC A;  4KOT A;  1U6M A;  4PV6 A;  2FS5 A;  2WPW A;  3PZJ A;  2VZZ A;  1IID A;  5IX3 A;  4XPL A;  2AJ6 A;  3R95 A;  2D4O A;  4YFJ A;  5F49 A;  2Y0M A;  3P2H A;  1VKC A;  4U5Y A;  5C88 A;  3FBU A;  2PC1 A;  2P6F A;  1B6B A;  5GCN A;  1YR0 A;  4B5P A;  1IYL A;  1CM0 A;  1MJB A;  1GHE A;  1WK4 A;  3R9E A;  1ON0 A;  4UBR A;  2VBQ A;  5H86 A;  5KTC A;  4J3G A;  2R98 A;  3T90 A;  2G3A A;  1NMT A;  1S7K A;  3RYO A;  4E0A A;  4IF5 A;  4AVA A;  2HV2 A;  1Y7R A;  2QML A;  1QSM A;  4R9M A;  3EXN A;  2VXK A;  1YGH A;  1Q2D A;  4NF1 A;  2WPX A;  3FIX A;  3S6F A;  1S5K A;  3BJ8 A;  1V0C A;  3DDD A;  1PUA A;  2IL4 A;  1B87 A;  5KTA A;  2RC4 A;  3C26 A;  4NEX A;  1IYK A;  1QST A;  4AG7 A;  4CS0 B;  2PRB A;  1NSL A;  5IV0 A;  4ONU A;  3FB3 A;  1NE9 A;  4QC6 A;  4CAV A;  2PR8 A;  3G3S A;  3EC4 A;  3JVN A;  4HNW B;  3TO6 A;  2J8N A;  4ZBG A;  1S3Z A;  3W6X A;  1S7F A;  3DR6 A;  1Z9U A;  2K5T A;  1BOB A;  4MJ8 A;  4KOS A;  3FRM A;  3EY5 A;  1BO4 A;  3I3G A;  3VWD A;  2D4P A;  2PR1 A;  4JLY A;  2REF A;  2VZY A;  2B3U A;  4QUS A;  2VI7 A;  5H84 A;  3TT2 A;  1S60 A;  4UA3 A;  2B4B A;  2CY2 A;  3TTH A;  2BEI A;  4XNH B;  3B8G A;  2P6E A;  1KZF A;  1FY7 A;  4KVO E;  3G8W A;  4OAE A;  1QSR A;  4QB9 A;  3N7Z A;  4KVM E;  3S6H A;  3FYN A;  2AE6 A;  1P4N A;  4B5O A;  4FD4 A;  4PK3 A;  2I00 A;  2ZW6 A;  3WR7 A;  2GE3 A;  4KVX A;  5CNP A;  4UWI A;  5KTD A;  2X7B A;  1M44 A;  4F0Y A;  2R7H A;  3D2M A;  2FT0 A;  4R57 A;  2J8R A;  4FD5 A;  4UWJ A;  2VQY A;  1WWZ A;  4H6U A;  4KOR A;  3GY9 A;  4Y49 B;  4MBU A;  5HH1 A;  4KOX A;  5ISV A;  4XNH C;  3PP9 A;  3S6K A;  4NSQ A;  3CXP A;  3FNC A;  2BSW A;  2OU2 A;  3R1K A;  4KUB A;  1VHS A;  4LX9 A;  1L0C A;  3W6S A;  3F8K A;  4JD6 A;  2Q4Y A;  2B3V A;  3TO7 A;  2JEV A;  4KOV A;  2FCK A;  2FXF A;  3DR8 A;  2QIR A;  4RS2 A;  2ARH A;  2OZG A;  2B5G B;  1XEB A;  5DWN A;  4AG9 A;  2J8M A;  1MK4 A;  2Q7B A;  3DSB A;  4FD6 A;  3D2P A;  2ATR A;  1MJA A;  4FD7 A;  4R3L A;  2FSR A;  4I49 A;  1RO5 A;  3SHP A;  2Q04 A;  2JDC A;  2Z11 A;  3K9U A;  1S7N A;  4Y49 C;  4M3S A;  1YVK A;  2HUZ A;  4RI1 A;  3UY5 A;  3IGR A;  1R57 A;  1IB1 E;  1M4I A;  4HNY B;  3TCV A;  2Q4V A;  4QBJ A;  1UFH A;  2B4D B;  3BJ7 A;  4GS4 A;  3I9S A;  1MJ9 A;  5FVJ A;  1M4G A;  3F0A A;  1KUX A;  3R9F A;  2EUI A;  4L89 A;  4CRY B;  3V8I A;  1YRE A;  3D3S A;  4ORF A;  5I0C A;  1XE4 A;  4F6A A;  4H6Z A;  3PGP A;  1K4J A;  1J4J A;  1Z4E A;  4U9Z A;  4L8A A;  4R3K A;  3FXT A;  4AB7 A;  3QAH A;  1S7L A;  5EC4 A;  3EFA A;  3P2F A;  2OZU A;  2ZW7 A;  4KLW A;  4PSW A;  5J8F A;  4HNX B;  4CRZ B;  5J8C A;  4MY3 A;  4CAW A;  1IIC A;  4NCZ A;  3ZJ0 A;  3H4Q A;  3TOA A;  1XIX A;  2ZW5 A;  2CNM A;  5F48 A;  1YLE A;  3GYA A;  2GIV A;  2FIW A;  4KOY A;  4JJX A;  1CJW A;  2R1I A;  1N71 A;  2H5M A;  4JXR A;  4JXQ A;  2OH1 A;  2KCW A;  5DWM A;  3QB8 A;  4X5K A;  2NMT A;  1PU9 A;  2GAN A;  1KUV A;  1XMT A;  1M4D A;  5IB0 A;  4IUS A;  2O28 A;  2R8V A;  3E0K A;  1Q2Y A;  2ZPA A;  2I79 A;  1QSO A;  4KOU A;  4AVB A;  3GKR A;  2DXQ A;  4R87 A;  4XPD B;  2HQY A;  2EVN A;  2FE7 A;  1RXT A;  4B5P B;  2OZH A;  4E2A A;  2B5G A;  4YGO A;  3MGD A;  2OB0 A;  1Z4R A;  2PQ8 A;  2B58 A;  5JQ4 A;  4MHD A;  1YVO A;  1Y9W A;  2Z10 A;  4OAD A;  3BLN A;  4MY0 A;  2QEC A;  3DNS A;  3ZZI A;  2C27 A;  3LOD A;  2Z0Z A;  3R96 A;  4JWP A;  2FIA A;  1I12 A;  3D8P A;  4EVY A;  2REE A;  2G3T A;  3TOB A;  3LD2 A;  2BL1 A;  3IWG A;  5HMN A;  1TIQ A;  2BUE A;  3TE4 A;  1I21 A;  4HKF A;  3VWE A;  5E96 A;  1KUY A;  2B4D A;  2G0B A;  2P0W A;  3F5B A;  1XF8 A;  2ZW4 A;  3SXO A;  4YRH A;  3TO9 A;  3EO4 A;  4XPD C;  4K30 A;  4H89 A;  1SQH A;  2VEZ A;  3OWC A;  4E8O A;  1YX0 A;  3T9Y A;  1LRZ A; 
#chains in the Genus database with same CATH topology
 1TKH A;  4DNC A;  2V8V A;  4B14 A;  4OC4 A;  2AFW A;  2C6C A;  2Q44 A;  2ODF A;  2ZXV A;  4MHZ A;  2PSW A;  2DPS A;  4MFP A;  4MI4 A;  3KKW A;  1LAN A;  1LAM A;  4A32 A;  5C82 A;  3JUW A;  3R9G A;  4R6T A;  4BMH A;  4KOW A;  1TF9 A;  4LUA A;  4KUA A;  4PK2 A;  2DF5 A;  5F47 A;  2F5I A;  4KLV A;  4CAX A;  2PJ5 A;  4KSI A;  1Q2C A;  1Y0Y A;  1X12 A;  3IU2 A;  1XMB A;  4UEZ A;  5ELY A;  5F46 A;  1KWM A;  2C6G A;  1Q7L A;  1QSN A;  5EBV A;  4B12 A;  1M1D A;  1CPX A;  2PCU A;  1OZP A;  2CNT A;  3CXQ A;  3D66 A;  2FL4 A;  4NGQ A;  1I1D A;  4KS9 A;  4UCP A;  4NFR A;  4XPK A;  3S6G A;  4II9 A;  2A4N A;  1YK3 A;  3PB4 X;  2PJ4 A;  4PSX A;  4Q38 A;  2PDO A;  4NXY A;  5JPH A;  3V7Z A;  5HVG A;  3GIU A;  4UFW A;  2AFZ A;  3W91 A;  4A38 A;  3SXN A;  4CGO A;  3TFY A;  1HDQ A;  5THW A;  4ONW A;  1P0H A;  2CTC A;  4X8I A;  2Q0Y A;  1Y9K A;  4A39 A;  4OC3 A;  4U9Y A;  4M85 A;  1YQE A;  2JDD A;  4OLL A;  1IU8 A;  5BWA B;  2P6G A;  1VGY A;  2JLM A;  2Q43 A;  5G20 A;  2CNS A;  3NE7 A;  4KZT A;  2PJ2 A;  2RFH A;  4QVT A;  3CXS A;  4A33 A;  4AVC A;  4B6Z A;  5LYD A;  4KOT A;  1EE3 P;  1U6M A;  3QAY A;  3IU1 A;  2POK A;  4OIW A;  4LQG A;  4OKO A;  4PV6 A;  2FS5 A;  2WPW A;  4A31 A;  5A27 A;  5G21 A;  3QNV A;  3PZJ A;  4EME A;  3PEI A;  4FBE A;  2VZZ A;  1IID A;  4A37 A;  5IX3 A;  4IHM A;  4XPL A;  2AJ6 A;  3R95 A;  1YSJ A;  3WC6 A;  2D4O A;  2EK8 A;  4YFJ A;  2RB7 A;  5F49 A;  5LRJ A;  5LYL A;  3PFO A;  2Y0M A;  3P2H A;  2ZEF A;  4OC0 A;  1VKC A;  4U5Y A;  5C88 A;  4H2K A;  1PCA A;  1UWY A;  3FBU A;  2PC1 A;  2P6F A;  2YNC C;  4B11 A;  1TKF A;  4NGR A;  1B6B A;  4KSA A;  5GCN A;  1YR0 A;  4C2Z A;  5CBM A;  1XOV A;  3D7F A;  4A2Z A;  4W9Y A;  4B5P A;  1R3N A;  2PJ3 A;  5J1Q A;  2BO9 A;  1IYL A;  4DJL A;  3D68 A;  1CM0 A;  5JGF A;  3IEH A;  3CPX A;  2C1C A;  5AG5 A;  1MJB A;  2CF4 A;  4P4B A;  1GHE A;  2AFM A;  1WK4 A;  5CPA A;  2YGW A;  2ZEP A;  3HLP A;  3R9E A;  5G1Z A;  4CGP A;  4PXC A;  1ON0 A;  2EBJ A;  3FEC A;  4UBR A;  2VBQ A;  5H86 A;  1YME A;  3MN8 A;  3KHX A;  2WSA A;  1ZLH A;  4MFL A;  5KTC A;  4Q7A A;  2XEF A;  4J3G A;  2R98 A;  4JZ0 A;  3T90 A;  2G3A A;  3FJU A;  1NMT A;  1VHE A;  3PB6 X;  4MHP A;  3PB9 X;  3D7D A;  2YND A;  1S7K A;  3RYO A;  2DEA A;  4E0A A;  4IF5 A;  4R8F A;  4RN7 A;  2V8D A;  4AVA A;  1CPS A;  1LOK A;  1Y7R A;  2HV2 A;  4UEE A;  4BBH A;  4PPZ A;  3PB8 X;  2QML A;  4P4F A;  1QSM A;  4ZX9 A;  4R9M A;  4R76 A;  3IO1 A;  3EXN A;  3SI0 A;  1CP7 A;  3WAB A;  2VXK A;  3SJE A;  1YGH A;  1ELL P;  4OID A;  1Q2D A;  3KL9 A;  4P4E A;  3KR5 A;  2V8H A;  2PIZ A;  4UEF A;  4NF1 A;  2WPX A;  1VIX A;  3FIX A;  4OC5 A;  3S6F A;  4IAV A;  1S5K A;  3BJ8 A;  3H8E A;  4F0X A;  4UCM A;  2DPT A;  1V0C A;  4CGN A;  7CPA A;  1VHO A;  3RAM A;  3DDD A;  3S9L A;  1Z8L A;  4MHY A;  1PUA A;  2IL4 A;  2GLJ A;  2ZEG A;  4OME A;  5K8M A;  1B87 A;  5KTA A;  2RC4 A;  3L2N A;  3C26 A;  5LYF A;  4NEX A;  3A9L A;  1IYK A;  1ZLI A;  3S9N A;  2O4H A;  1QST A;  4MFQ A;  4MFZ A;  2AFS A;  4TNU A;  4AG7 A;  4CS0 B;  3NH5 A;  2PRB A;  1NSL A;  4A94 A;  2YNC A;  2GFQ A;  5G22 A;  5IV0 A;  4ONU A;  3FB3 A;  1HDU A;  1XFO A;  4MCP A;  1NE9 A;  4QC6 A;  4CAV A;  2NYQ A;  2PR8 A;  3KQZ A;  4ZGY B;  5JH9 A;  3G3S A;  3EC4 A;  3JVN A;  4HNW B;  1ZG7 A;  4PXB A;  3TO6 A;  2J8N A;  4ZBG A;  1LAP A;  1S3Z A;  3W6X A;  1IOF A;  5K8O A;  1S7F A;  2XEI A;  3DR6 A;  4RUH A;  1Z9U A;  4OP4 A;  4PQA A;  4BD9 A;  1ARL A;  2K5T A;  1BOB A;  4MJ8 A;  6CPA A;  4KOS A;  1X10 A;  2ZEO A;  3BXM A;  3FRM A;  3EY5 A;  5A28 A;  1BO4 A;  2BCO A;  2IMO A;  1DTD A;  3I3G A;  3VWD A;  2CXA A;  4MMO A;  2D4P A;  2Z3O A;  2NSM A;  2PR1 A;  3RZA A;  4UIB A;  2PVV A;  2ZED A;  2REF A;  4JLY A;  2VZY A;  3MRU A;  2J9A A;  1CBX A;  3FVL A;  2B3U A;  4QUS A;  2VI7 A;  5H84 A;  4B10 A;  3TT2 A;  1ARM A;  1S60 A;  2BOA A;  4UA3 A;  2B4B A;  2CY2 A;  1TXR A;  2BEI A;  2QJ8 A;  4XNH B;  3TTH A;  2PRQ A;  3B8G A;  3IFE A;  4OC1 A;  2P6E A;  3PBB A;  1TF8 A;  3DGV A;  2ANP A;  1KZF A;  1FY7 A;  4MHN A;  2JEW A;  2V8G A;  1ZG9 A;  2AFU A;  3G8W A;  4KVO E;  4OAE A;  4HPS A;  4ZYQ A;  1QSR A;  5AG6 A;  3B7I A;  4QB9 A;  3N7Z A;  3IWE A;  4P4I A;  2Q7S A;  4KVM E;  3KGQ A;  5IB9 A;  2JBJ A;  4CGL A;  4WWV A;  4BIN A;  4P44 A;  3FF3 A;  4GXH A;  4LQ6 A;  3S6H A;  4CPA A;  3FYN A;  2AE6 A;  1CP6 A;  1P4N A;  5AGE A;  5LRK A;  4B5O A;  4FD4 A;  4PK3 A;  3WT4 A;  4Z65 A;  2I00 A;  4CYQ A;  1OBR A;  5HVF A;  2ZW6 A;  3WR7 A;  2C6P A;  2EWB A;  2GE3 A;  4KVX A;  5CNP A;  2PJ0 A;  4UWI A;  5KTD A;  2X7B A;  1M44 A;  1F2P A;  3KZW A;  4F0Y A;  2R7H A;  3CT9 A;  3KI9 A;  3D2M A;  2FT0 A;  4TWE A;  4R57 A;  4AXV A;  4CYP A;  2J8R A;  1A2Z A;  4A30 A;  4FD5 A;  4UWJ A;  1M4L A;  2VQY A;  1WWZ A;  4H6U A;  3RBU A;  5AG7 A;  3I1U A;  4NJR A;  4KOR A;  3GY9 A;  4Y49 B;  4MBU A;  2WUU A;  2XEG A;  5HH1 A;  3LWU A;  4KOX A;  4UIA A;  3NH8 A;  3FX6 A;  5ISV A;  4XNH C;  2ZEH A;  4C7I A;  3PP9 A;  5I4M A;  3S6K A;  4NSQ A;  3CXP A;  2EK9 A;  4X3R A;  1AUG A;  3FNC A;  2BSW A;  5LRG A;  3B3W A;  2OU2 A;  4GM5 A;  3GUX A;  3R1K A;  4KUB A;  1VHS A;  2GLF A;  4LX9 A;  4DUK A;  1L0C A;  5D29 A;  3W6S A;  3F8K A;  4JD6 A;  2Q4Y A;  3T8W A;  4OC2 A;  4EFD A;  1JWQ A;  3PRT A;  2B3V A;  4K3N A;  3TO7 A;  4F8Z A;  2JEV A;  3DLJ A;  4KOV A;  4C7H A;  2FCK A;  1BPM A;  2FXF A;  3DR8 A;  3IJ3 A;  4CGM A;  1NSA A;  2QIR A;  5DS0 A;  4RS2 A;  4F9U A;  2ARH A;  3TX8 A;  2OZG A;  4JYW A;  4UCN A;  1IGB A;  2FVG A;  4NGM A;  2B5G B;  1XEB A;  4P45 A;  4ZY1 A;  4B13 A;  5DWN A;  4AG9 A;  2J8M A;  1F57 A;  4P6Y A;  8CPA A;  1F2O A;  1MK4 A;  2Q7B A;  3DSB A;  1CX8 A;  4FD6 A;  3D2P A;  2ATR A;  1MJA A;  2Q51 A;  4FD7 A;  4R3L A;  2Z3P A;  3JTK A;  2FSR A;  2VL1 A;  3D7G A;  4I49 A;  2ZEM A;  1RO5 A;  3SHP A;  4P4D A;  4G1P A;  2Q04 A;  4UFV A;  1Y7E A;  2JDC A;  3PB7 X;  2Z11 A;  2Z3K A;  3K9U A;  1S7N A;  4Y49 C;  4M3S A;  1YVK A;  3KAS A;  1H8L A;  5K8P A;  2HUZ A;  4RI1 A;  2ZEN A;  1XBU A;  2PJA A;  3B2Y A;  3K2K A;  3BI0 A;  3UY5 A;  3IGR A;  3BHX A;  4YWY A;  1R57 A;  1Z8T A;  1IB1 E;  1M4I A;  5D8N A;  3FED A;  4HNY B;  4NGN A;  3TCV A;  2Q4V A;  4QBJ A;  1UFH A;  2B4D B;  3B35 A;  2Q4Z A;  2G9D A;  3BJ7 A;  1MJ9 A;  3CZX A;  3I9S A;  4GS4 A;  1M4G A;  4UFX A;  5FVJ A;  3TC8 A;  3F0A A;  4YU9 A;  1KUX A;  3R9F A;  2OOT A;  4MRI A;  2EUI A;  3D7H A;  4L89 A;  2PJ9 A;  3GB0 A;  3PFE A;  4M6I A;  2AFO A;  4CRY B;  3N5F A;  2Z3M A;  3V8I A;  1YRE A;  1XRY A;  3D3S A;  4ORF A;  5I0C A;  1ELM P;  4UF4 A;  1XE4 A;  2ZOG A;  2OR4 A;  3CPA A;  2PE3 A;  4M6H A;  4F6A A;  4ZY0 A;  1JQG A;  4H6Z A;  2F8H A;  3IWW A;  4P10 A;  3PGP A;  1K4J A;  1J4J A;  1Z4E A;  4NGP A;  3BI1 A;  2PJC A;  4F9V A;  2ZOF A;  3V38 A;  1Y0R A;  2PJB A;  2GU2 A;  4L8A A;  4U9Z A;  4R3K A;  3H5Z A;  3FXT A;  4AB7 A;  3QAH A;  5F09 A;  3B3S A;  1AYE A;  1S7L A;  5EC4 A;  3EFA A;  3P2F A;  3B3V A;  1XJO A;  4X2T A;  1YW4 A;  2OZU A;  2ZW7 A;  3VH9 A;  4KLW A;  1RTQ A;  4PSW A;  5J8F A;  4HNX B;  4CRZ B;  1LCP A;  3H8F A;  5J8C A;  4CAF A;  4MY3 A;  4FWU A;  5EMI A;  4CAW A;  2PJ6 A;  3RNZ A;  1IIC A;  4NCZ A;  3ZJ0 A;  3H4Q A;  4WJB A;  3TOA A;  1XIX A;  2ZW5 A;  2PIY A;  2CNM A;  5F48 A;  1YLE A;  4PXD A;  1TKJ A;  4MFK A;  3GYA A;  3SJX A;  2GIV A;  2PJ8 A;  2FIW A;  4KOY A;  4JJX A;  1CJW A;  2R1I A;  1N71 A;  1ZO0 A;  2H5M A;  3B3T A;  4MCR A;  4ZX8 A;  5JM6 A;  3KQX A;  3FEE A;  3PBE A;  4MCS A;  4JXR A;  3ISZ A;  4JXQ A;  2OH1 A;  4P4J A;  2KCW A;  4A95 A;  5DWM A;  2HC9 A;  3QB8 A;  4X5K A;  4ZI6 A;  2HB6 A;  2CIJ A;  2NMT A;  1PU9 A;  2PJ1 A;  2GAN A;  1Z2L A;  1KUV A;  3NH4 A;  4CAE A;  1XMT A;  1M4D A;  1QMU A;  1DE4 C;  2I3C A;  5IB0 A;  2GRE A;  1IOI A;  3VAR A;  4IUS A;  2O28 A;  4C68 A;  2R8V A;  3E0K A;  1Z8X A;  1Q2Y A;  2QVP A;  2ZPA A;  4ZY2 A;  4CYN A;  3IC1 A;  2I79 A;  1QSO A;  4KOU A;  2IJZ A;  1QQ9 A;  4AVB A;  3GKR A;  2DXQ A;  4R87 A;  4XPD B;  2HQY A;  2EVN A;  4NGS A;  2FE7 A;  3ISX A;  1RXT A;  2AFX A;  4C2Y A;  3LMS A;  4R7M A;  1HEE A;  1LFW A;  3IIB A;  4MCQ A;  1Z8W A;  2PJ7 A;  2WYR A;  3D67 A;  1FNO A;  3D4U A;  2OZH A;  4B5P B;  3SI1 A;  4E2A A;  2B5G A;  4NGT A;  1R43 A;  4M6G A;  4YGO A;  3MGD A;  4O23 A;  2OB0 A;  2ZEL A;  5LYI A;  3H8G A;  1FT7 A;  3K9T A;  1Z4R A;  2PQ8 A;  3JRU A;  3WC5 A;  2YNE A;  5HVH A;  2B58 A;  5JQ4 A;  4MHD A;  1YVO A;  1Y9W A;  2Z10 A;  4OAD A;  3BLN A;  1BPN A;  4MY0 A;  3RO0 A;  2O53 A;  2QEC A;  4PXE A;  3VAT A;  2F7V A;  2Z3L A;  3DNS A;  2C27 A;  3ZZI A;  4CYO A;  4DYO A;  4KSF A;  3SI2 A;  5HXD A;  3LOD A;  3SJF A;  5AG4 A;  4IK2 A;  1ZG8 A;  2Z0Z A;  3R96 A;  1BLL E;  4JWP A;  2FIA A;  3SJG A;  4EWT A;  1I12 A;  2IQ6 A;  2XEJ A;  2ZEE A;  3D8P A;  2REE A;  4NJQ A;  4EVY A;  4C2X A;  2G3T A;  5K8N A;  4Q36 A;  3TOB A;  3LD2 A;  2BL1 A;  3IWG A;  2Z3N A;  5HMN A;  2EO8 A;  1GYT A;  1TIQ A;  2BUE A;  1BAV A;  2QYV A;  3NA6 A;  3LAC A;  2V77 A;  3FH4 A;  1Z5R A;  4MFJ A;  1I21 A;  3TE4 A;  3NFZ A;  4HKF A;  4FUU A;  3KHZ A;  3VWE A;  5E96 A;  3CDX A;  1KUY A;  2CTB A;  2B4D A;  2G0B A;  2P0W A;  3B3C A;  3KR4 A;  3F5B A;  4FAI A;  1XF8 A;  2ZW4 A;  3SXO A;  2PVW A;  3HUV A;  4YRH A;  3TO9 A;  2WZN A;  3EO4 A;  1CG2 A;  3GLJ A;  1AMP A;  4K30 A;  4XPD C;  4H89 A;  1SQH A;  2VEZ A;  3NE8 A;  3OWC A;  2ABZ A;  3WC7 A;  4E8O A;  4MXU A;  1YW6 A;  1YX0 A;  2JBK A;  1IY7 A;  3FMC A;  1PYT B;  3T9Y A;  1YLO A;  1LRZ A;  3S9M A; 
#chains in the Genus database with same CATH homology
 4DNC A;  4B14 A;  2Q44 A;  2ZXV A;  2PSW A;  2DPS A;  4MFP A;  4MI4 A;  3KKW A;  4A32 A;  5C82 A;  3JUW A;  3R9G A;  4BMH A;  4KOW A;  4LUA A;  4KUA A;  4PK2 A;  5F47 A;  2F5I A;  4KLV A;  4CAX A;  1Q2C A;  3IU2 A;  5F46 A;  5EBV A;  1QSN A;  4B12 A;  1M1D A;  1OZP A;  2CNT A;  3CXQ A;  2FL4 A;  1I1D A;  4KS9 A;  4UCP A;  3S6G A;  4XPK A;  4II9 A;  2A4N A;  1YK3 A;  4Q38 A;  4PSX A;  2PDO A;  4NXY A;  5JPH A;  4UFW A;  3TFY A;  3W91 A;  3SXN A;  4CGO A;  1P0H A;  2Q0Y A;  1Y9K A;  4U9Y A;  4M85 A;  2JDD A;  4OLL A;  5BWA B;  2P6G A;  2JLM A;  5G20 A;  2CNS A;  3NE7 A;  4KZT A;  4QVT A;  3CXS A;  4A33 A;  4AVC A;  4KOT A;  1U6M A;  3IU1 A;  4PV6 A;  2FS5 A;  2WPW A;  4A31 A;  5A27 A;  5G21 A;  3PZJ A;  2VZZ A;  1IID A;  5IX3 A;  4XPL A;  2AJ6 A;  3R95 A;  2D4O A;  4YFJ A;  5F49 A;  2Y0M A;  3P2H A;  1VKC A;  4U5Y A;  5C88 A;  3FBU A;  2PC1 A;  2P6F A;  2YNC C;  4B11 A;  1B6B A;  4KSA A;  5GCN A;  1YR0 A;  4C2Z A;  4A2Z A;  4B5P A;  1IYL A;  1CM0 A;  5AG5 A;  1MJB A;  1GHE A;  1WK4 A;  2YGW A;  3R9E A;  5G1Z A;  4CGP A;  1ON0 A;  4UBR A;  2VBQ A;  5H86 A;  4MFL A;  5KTC A;  4J3G A;  2R98 A;  3T90 A;  2G3A A;  1NMT A;  2YND A;  1S7K A;  3RYO A;  4E0A A;  4IF5 A;  4AVA A;  2HV2 A;  1Y7R A;  4BBH A;  2QML A;  1QSM A;  4R9M A;  3EXN A;  2VXK A;  1YGH A;  1Q2D A;  4NF1 A;  2WPX A;  3FIX A;  3S6F A;  1S5K A;  3BJ8 A;  4F0X A;  4UCM A;  2DPT A;  1V0C A;  4CGN A;  3DDD A;  1PUA A;  2IL4 A;  1B87 A;  5KTA A;  2RC4 A;  3C26 A;  4NEX A;  3A9L A;  1IYK A;  1QST A;  4MFQ A;  4MFZ A;  4AG7 A;  4CS0 B;  2PRB A;  1NSL A;  2YNC A;  5G22 A;  5IV0 A;  4ONU A;  3FB3 A;  1NE9 A;  4QC6 A;  4CAV A;  2PR8 A;  4ZGY B;  3G3S A;  3EC4 A;  3JVN A;  4HNW B;  3TO6 A;  2J8N A;  4ZBG A;  1S3Z A;  3W6X A;  1S7F A;  3DR6 A;  1Z9U A;  2K5T A;  1BOB A;  4MJ8 A;  4KOS A;  3FRM A;  3EY5 A;  5A28 A;  1BO4 A;  3I3G A;  3VWD A;  2CXA A;  2D4P A;  2Z3O A;  2PR1 A;  4JLY A;  2REF A;  2VZY A;  2B3U A;  4QUS A;  2VI7 A;  5H84 A;  4B10 A;  3TT2 A;  1S60 A;  4UA3 A;  2B4B A;  2CY2 A;  3TTH A;  2BEI A;  4XNH B;  3B8G A;  2P6E A;  1KZF A;  1FY7 A;  4KVO E;  3G8W A;  4OAE A;  1QSR A;  5AG6 A;  4QB9 A;  3N7Z A;  3IWE A;  4KVM E;  4CGL A;  3S6H A;  3FYN A;  2AE6 A;  1P4N A;  5AGE A;  4B5O A;  4FD4 A;  4PK3 A;  2I00 A;  4CYQ A;  2ZW6 A;  3WR7 A;  2GE3 A;  4KVX A;  5CNP A;  4UWI A;  5KTD A;  2X7B A;  1M44 A;  4F0Y A;  2R7H A;  3D2M A;  2FT0 A;  4R57 A;  4CYP A;  2J8R A;  4A30 A;  4FD5 A;  4UWJ A;  2VQY A;  1WWZ A;  4H6U A;  5AG7 A;  4KOR A;  3GY9 A;  4Y49 B;  4MBU A;  2WUU A;  5HH1 A;  4KOX A;  5ISV A;  4XNH C;  4C7I A;  3PP9 A;  3S6K A;  4NSQ A;  3CXP A;  3FNC A;  2BSW A;  2OU2 A;  3R1K A;  4KUB A;  1VHS A;  4LX9 A;  1L0C A;  3W6S A;  3F8K A;  4JD6 A;  2Q4Y A;  2B3V A;  3TO7 A;  2JEV A;  4KOV A;  4C7H A;  2FCK A;  2FXF A;  4CGM A;  3DR8 A;  2QIR A;  4RS2 A;  2ARH A;  2OZG A;  4UCN A;  2B5G B;  1XEB A;  4B13 A;  5DWN A;  4AG9 A;  2J8M A;  1MK4 A;  2Q7B A;  3DSB A;  4FD6 A;  3D2P A;  2ATR A;  1MJA A;  4FD7 A;  4R3L A;  2Z3P A;  3JTK A;  2FSR A;  4I49 A;  1RO5 A;  3SHP A;  2Q04 A;  4UFV A;  2JDC A;  2Z11 A;  2Z3K A;  3K9U A;  1S7N A;  4Y49 C;  4M3S A;  1YVK A;  2HUZ A;  4RI1 A;  3UY5 A;  3IGR A;  1R57 A;  1IB1 E;  1M4I A;  4HNY B;  3TCV A;  2Q4V A;  4QBJ A;  1UFH A;  2B4D B;  3BJ7 A;  4GS4 A;  3I9S A;  1MJ9 A;  5FVJ A;  1M4G A;  4UFX A;  3F0A A;  1KUX A;  3R9F A;  2EUI A;  4L89 A;  4CRY B;  2Z3M A;  3V8I A;  1YRE A;  3D3S A;  4ORF A;  5I0C A;  1XE4 A;  4F6A A;  4H6Z A;  3PGP A;  1K4J A;  1J4J A;  1Z4E A;  4U9Z A;  4L8A A;  4R3K A;  3H5Z A;  3FXT A;  1LRZ A;  4AB7 A;  3QAH A;  1S7L A;  5EC4 A;  3EFA A;  3P2F A;  2OZU A;  2ZW7 A;  4KLW A;  4PSW A;  5J8F A;  4HNX B;  4CRZ B;  5J8C A;  4CAF A;  4MY3 A;  4CAW A;  1IIC A;  4NCZ A;  3ZJ0 A;  3H4Q A;  3TOA A;  1XIX A;  2ZW5 A;  2CNM A;  5F48 A;  1YLE A;  4MFK A;  3GYA A;  2GIV A;  2FIW A;  4KOY A;  4JJX A;  1CJW A;  2R1I A;  1N71 A;  1ZO0 A;  2H5M A;  4JXR A;  4JXQ A;  2OH1 A;  2KCW A;  4A95 A;  5DWM A;  3QB8 A;  4X5K A;  2NMT A;  1PU9 A;  2GAN A;  1KUV A;  4CAE A;  1XMT A;  1M4D A;  5IB0 A;  4IUS A;  2O28 A;  4C68 A;  2R8V A;  3E0K A;  1Q2Y A;  2ZPA A;  4CYN A;  2I79 A;  1QSO A;  4KOU A;  4AVB A;  3GKR A;  2DXQ A;  4R87 A;  4XPD B;  2HQY A;  2EVN A;  2FE7 A;  1RXT A;  4C2Y A;  4B5P B;  2OZH A;  4E2A A;  2B5G A;  4YGO A;  3MGD A;  2OB0 A;  1Z4R A;  2PQ8 A;  2YNE A;  2B58 A;  5JQ4 A;  4MHD A;  1YVO A;  1Y9W A;  2Z10 A;  4OAD A;  3BLN A;  4MY0 A;  2QEC A;  4CYO A;  2Z3L A;  3DNS A;  2C27 A;  3ZZI A;  4KSF A;  3LOD A;  5AG4 A;  2Z0Z A;  3R96 A;  4JWP A;  2FIA A;  1I12 A;  3D8P A;  4EVY A;  2REE A;  4C2X A;  2G3T A;  4Q36 A;  3TOB A;  3LD2 A;  2BL1 A;  3IWG A;  2Z3N A;  5HMN A;  1TIQ A;  2BUE A;  4MFJ A;  3TE4 A;  1I21 A;  4HKF A;  3VWE A;  5E96 A;  1KUY A;  2B4D A;  2G0B A;  2P0W A;  3F5B A;  1XF8 A;  2ZW4 A;  3SXO A;  4YRH A;  3TO9 A;  3EO4 A;  4XPD C;  4K30 A;  4H89 A;  1SQH A;  2VEZ A;  3OWC A;  4E8O A;  1YX0 A;  3T9Y A;  2WSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...