1GHEA

Crystal structure of tabtoxin resistance protein complexed with an acyl coenzyme a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
170
structure length
170
Chain Sequence
AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE
publication title Crystal Structure of Tabtoxin Resistance Protein Complexed with Acetyl Coenzyme A Reveals the Mechanism for beta-Lactam Acetylation
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
molecule tags Transferase
total genus 49
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1gheA00
1LRZA 4QBJA 4QC6A 2BEIA 4KORA 3TOBA 4KOYA 4HNWB 5EC4A 3DR8A 4XPDB 3R96A 3QAHA 2FL4A 2Z10A 4JWPA 2ATRA 5EBVA 3FNCA 2B4DA 1Z4RA 4L8AA 4CAXA 3JVNA 3SXNA 2VI7A 2FIWA 4KOSA 3S6KA 2B3VA 3V8IA 4E8OA 3TO9A 2Z0ZA 2OZUA 3IGRA 2ZW5A 2BUEA 2R8VA 5F46A 2Z11A 4ONUA 4CAVA 1KUXA 1OZPA 2I00A 1YK3A 2Q4VA 1K4JA 2ZW7A 2H5MA 2HQYA 1Y9WA 4XPDC 3F8KA 4FD5A 2HUZA 1NE9A 3P2FA 3R95A 5KTDA 1U6MA 1I21A 4II9A 1I1DA 3N7ZA 2CNSA 5KTCA 2I79A 2ZPAA 4I49A 4XNHB 2CNMA 4NSQA 2PDOA 1P0HA 3QB8A 1CM0A 1L0CA 4UBRA 5IX3A 4R3KA 3EY5A 3S6FA 4U9ZA 2P6GA 2B58A 1QSOA 1QSNA 3WR7A 4CRYB 4H6ZA 4NXYA 4JXQA 2Y0MA 2A4NA 4AG7A 5JQ4A 1M4GA 1TIQA 3PGPA 2C27A 4LX9A 3NE7A 4KUAA 5GCNA 4IF5A 5F49A 1Z4EA 3LODA 5IV0A 3R9GA 3B8GA 4L89A 3EO4A 4NEXA 3SHPA 1Y7RA 5FVJA 1XIXA 4KUBA 4PSXA 4YGOA 1Q2YA 2IL4A 3TCVA 3G8WA 3CXPA 4R9MA 4MY3A 1MJ9A 1YX0A 2J8MA 2WPXA 4GS4A 3BJ8A 2VZZA 3SXOA 5HMNA 1R57A 1IB1E 1QSTA 2B5GB 3W91A 1S7LA 4MI4A 3DR6A 4KLVA 3BJ7A 1B6BA 3W6SA 5C82A 3TFYA 2VBQA 4ORFA 1WWZA 1Q2DA 4QVTA 5JPHA 4KVXA 4HNYB 4QUSA 2RC4A 4NCZA 2FS5A 3UY5A 4BMHA 1S5KA 1VKCA 2Q4YA 4KZTA 2Q0YA 4KVME 4FD6A 2PRBA 1I12A 2QECA 3FB3A 3TO6A 4MY0A 4UA3A 4R87A 4R57A 2P0WA 2PQ8A 4JJXA 3KKWA 2JEVA 4UWJA 3G3SA 2VZYA 3R1KA 4U9YA 2J8RA 4AVCA 1B87A 4KOUA 3S6HA 1SQHA 4HNXB 3JUWA 3C26A 2OB0A 2J8NA 3PP9A 4KOXA 1YVKA 2QMLA 1IICA 2HV2A 3D3SA 4JD6A 1WK4A 3T9YA 4OADA 3W6XA 3F0AA 2K5TA 3GY9A 1RXTA 3K9UA 4M85A 4PK3A 2JDCA 2F5IA 4B5PB 3TO7A 1S7KA 5KTAA 1RO5A 2ZW4A 4RI1A 2FXFA 4PV6A 2EVNA 4HKFA 1V0CA 4LUAA 1NSLA 4XNHC 1XMTA 1KUYA 2GE3A 2R1IA 4K30A 3OWCA 1PUAA 1YLEA 4CAWA 2Q04A 1M4IA 3TT2A 1QSRA 1Q2CA 4DNCA 4KOTA 2OH1A 3CXQA 1YGHA 4QB9A 3I9SA 4YRHA 3GYAA 3FIXA 1XF8A 4B5OA 2R7HA 3VWDA 2REFA 3DNSA 5CNPA 1IIDA 2CY2A 4J3GA 1YVOA 3D8PA 5I0CA 3R9FA 4M3SA 2G3TA 3EFAA 4E2AA 1YR0A 3I3GA 3FXTA 5H86A 2FCKA 1P4NA 3BLNA 3DDDA 2OU2A 2PR8A 4X5KA 2CNTA 4CS0B 4PSWA 4RS2A 3ZZIA 3TTHA 3T90A 3D2MA 4MBUA 2OZHA 4MHDA 2BL1A 3FBUA 2WPWA 2G3AA 1ON0A 1IYLA 5F47A 2JLMA 5C88A 3EC4A 2P6FA 4IUSA 1Z9UA 2B5GA 1PU9A 1MJAA 2FE7A 1VHSA 4XPKA 3F5BA 2OZGA 4NF1A 1M1DA 2VXKA 1IYKA 1S7FA 5E96A 5H84A 3H4QA 5HH1A 2D4OA 2ZXVA 3GKRA 3TOAA 1MK4A 2ARHA 1YREA 2FT0A 3IWGA 3E0KA 3MGDA 2B4BA 1MJBA 2Q7BA 1UFHA 4U5YA 4H6UA 4MJ8A 1NMTA 2FSRA 2DXQA 4E0AA 5DWMA 2EUIA 3VWEA 4KVOE 4KOWA 4FD7A 1CJWA 3LD2A 4OAEA 2PSWA 2GIVA 2O28A 5IB0A 4Y49B 2AE6A 4OLLA 5J8CA 2B3UA 4EVYA 3TE4A 1XEBA 2P6EA 4F0YA 1KZFA 3R9EA 2Q44A 4KOVA 5ISVA 1QSMA 4AB7A 1BO4A 4AVBA 2PR1A 5J8FA 4JXRA 2VEZA 3D2PA 1S60A 2BSWA 2KCWA 4YFJA 1S3ZA 3ZJ0A 4XPLA 2X7BA 1N71A 2R98A 4ZBGA 4FD4A 2GANA 4UWIA 3PZJA 4H89A 2AJ6A 3DSBA 1BOBA 1GHEA 2ZW6A 5F48A 4R3LA 2FIAA 2B4DB 4Y49C 2NMTA 2PC1A 4B5PA 4AG9A 5DWNA 3FRMA 1M44A 4CRZB 4AVAA 3P2HA 1FY7A 2VQYA 4PK2A 1XE4A 3CXSA 3S6GA 1S7NA 2JDDA 1KUVA 2QIRA 4JLYA 2G0BA 1M4DA 2D4PA 3EXNA 1Y9KA 3RYOA 4F6AA 1J4JA 2REEA 4KLWA 3FYNA
chains in the Genus database with same CATH superfamily
1Z5RA 4BINA 1LRZA 2PRQA 5DS0A 1Z8XA 4QBJA 4QC6A 2QJ8A 3FH4A 2BEIA 4KORA 4A37A 3TOBA 2YNCC 4KOYA 3CDXA 4HNWB 4UIAA 5EC4A 4A33A 3DR8A 4XPDB 3R96A 2YNCA 5AG7A 4FAIA 3QAHA 2FL4A 2Z10A 2PJAA 4JWPA 3FVLA 2ATRA 4DYOA 5EBVA 1CP7A 2CIJA 3FNCA 3GB0A 2B4DA 1Z4RA 3FJUA 4L8AA 4CAXA 3JVNA 3SXNA 4A38A 2VI7A 2FIWA 4KOSA 3S6KA 2B3VA 3V8IA 2ZEFA 3PB4X 4FWUA 4E8OA 3DGVA 4MFJA 4MFPA 3TO9A 2Z0ZA 4CYOA 4NGPA 2OZUA 3IGRA 4P6YA 2ZW5A 4ZY2A 3PFEA 1TXRA 2BUEA 4FBEA 5K8MA 2PJ8A 2R8VA 3KHXA 3TC8A 4A2ZA 5F46A 2PJ7A 2Z11A 2PJ0A 2Q4ZA 4ONUA 4P4EA 5ELYA 2POKA 4A30A 3D66A 4CAVA 1KUXA 1OZPA 2I00A 1YK3A 1FT7A 5LRGA 2Q4VA 1K4JA 2XEJA 4TNUA 1CBXA 3ISZA 3B3TA 4MHNA 3LMSA 3D7GA 2ZW7A 1VHOA 2ZEHA 2H5MA 2HQYA 2VL1A 1Y9WA 1F57A 4X2TA 8CPAA 4XPDC 5AG4A 3F8KA 1VGYA 4YU9A 3S9LA 4ZI6A 3KQXA 2ZEGA 4A31A 2Q51A 5LYIA 4FD5A 2HUZA 1NE9A 4C2XA 1YQEA 3WT4A 1LAPA 2ZEDA 2NYQA 5G21A 4RUHA 4MHYA 2ZEEA 3P2FA 3R95A 3FX6A 1A2ZA 5A27A 5HVHA 5KTDA 1U6MA 3RBUA 1YLOA 1I21A 4P45A 4II9A 4NGQA 1I1DA 3K2KA 4LQ6A 3N7ZA 4C2YA 2CNSA 1CPSA 5KTCA 2I79A 5AG6A 2ZPAA 4I49A 4XNHB 4OC4A 2CNMA 4NSQA 2PDOA 4ZYQA 5JGFA 1BAVA 1P0HA 2YNEA 3QB8A 5A28A 1CM0A 3PB8X 5AGEA 1Y7EA 2AFOA 1L0CA 4UBRA 5IX3A 5EMIA 1AMPA 4R3KA 1NSAA 2BOAA 2V8VA 3H8FA 4OP4A 3EY5A 3S6FA 3HLPA 4UCNA 4UFXA 4DJLA 1DE4C 4U9ZA 2P6GA 3RAMA 4ZX9A 2B58A 1ELLP 1QSOA 4ONWA 1QSNA 2EWBA 3SJEA 3WR7A 3FMCA 4CRYB 2NSMA 3HUVA 4B14A 4ZY0A 2DPTA 2AFUA 1H8LA 4H6ZA 4NXYA 4A32A 4JXQA 4UIBA 2Y0MA 4MCPA 2A4NA 4UEEA 4OC5A 3RNZA 4AG7A 4P44A 1F2OA 5JQ4A 1M4GA 1TIQA 1X10A 3BI0A 2PVVA 3PGPA 2C27A 4LX9A 3NE7A 4KUAA 5GCNA 4IF5A 5F49A 5G22A 4C2ZA 1Z4EA 5BWAB 3LODA 5IV0A 3R9GA 3B8GA 4KS9A 4CGPA 5I4MA 1ARLA 1LOKA 3EO4A 3QNVA 4L89A 4NEXA 4NFRA 4P4DA 3K9TA 3SHPA 1Y7RA 5FVJA 1VIXA 1XIXA 1EE3P 4FUUA 3SJFA 4KUBA 4PSXA 4YGOA 4B11A 3KR4A 3B3CA 2WZNA 1HDQA 2BO9A 1Q2YA 2IL4A 3B3SA 3TCVA 1LANA 4CGMA 5HXDA 3G8WA 3CXPA 1LFWA 4MRIA 4R9MA 3FEEA 4MY3A 1JQGA 4B10A 1MJ9A 2G9DA 2PJ3A 1YX0A 2J8MA 2WPXA 4CAEA 5IB9A 4GS4A 3BJ8A 2VZZA 2OR4A 2WUUA 4HPSA 1Q7LA 2GFQA 3SXOA 4F0XA 2I3CA 1R57A 5HMNA 1IB1E 1QSTA 2B5GB 4PPZA 4R8FA 3IU2A 4P4IA 3D4UA 1UWYA 4UCMA 1S7LA 3W91A 2V77A 4MI4A 3DR6A 4OC0A 4ZY1A 1IGBA 4KLVA 3BJ7A 1DTDA 4KSAA 3KQZA 1B6BA 1IY7A 2XEIA 5CBMA 2AFWA 3W6SA 4CGLA 5C82A 3PFOA 4M6GA 1AYEA 4G1PA 4CAFA 4B13A 4PXCA 3TFYA 4C7HA 2VBQA 3H5ZA 1WWZA 1Q2DA 4ORFA 4P4JA 4QVTA 2JBJA 5JPHA 4KVXA 4HNYB 3H8GA 4QUSA 2RC4A 4NCZA 4OC1A 1Z8LA 4GM5A 2PJ1A 3GLJA 2DPSA 2FS5A 3UY5A 4BMHA 1S5KA 3PB7X 1GYTA 2O4HA 2FVGA 1VKCA 2Q4YA 4ZGYB 2XEFA 4KZTA 2ZENA 1IOFA 2Q0YA 2AFZA 3CPAA 4KVME 4MXUA 4FD6A 2PRBA 1I12A 2ZEMA 2RFHA 3SJGA 5J1QA 2QECA 3FB3A 3KASA 4NGNA 2V8DA 2GU2A 4PXDA 4UFVA 3TO6A 3BXMA 4BD9A 1IOIA 1RTQA 4MY0A 4Q7AA 4UA3A 4R87A 4R57A 4AXVA 2P0WA 4MFLA 3D67A 3FECA 3PRTA 2PQ8A 2CTCA 1TF8A 2PJCA 4R7MA 4JJXA 3QAYA 3KKWA 3GUXA 2JEVA 4NJQA 2PJ9A 4UWJA 3G3SA 2VZYA 3R1KA 4U9YA 2J8RA 3D7DA 4AVCA 1B87A 3I1UA 4KOUA 3S6HA 1SQHA 1FNOA 2C6PA 4HNXB 3JUWA 3C26A 2OB0A 3CT9A 2J8NA 3PP9A 4EMEA 1PYTB 4KOXA 1ZLHA 5LYDA 1YVKA 2EK9A 5JM6A 2QMLA 2Z3OA 1IICA 2HV2A 2PE3A 3D7HA 2ZOFA 3D3SA 3NE8A 4JD6A 3PB6X 3T8WA 3WC5A 2CTBA 1WK4A 4WWVA 5AG5A 3T9YA 1HEEA 4X8IA 3KZWA 1QQ9A 1IU8A 4OADA 4UFWA 2WSAA 1XMBA 1ZO0A 3W6XA 2O53A 3F0AA 3WC7A 5LYLA 3JRUA 2EBJA 2K5TA 1XOVA 1RXTA 3A9LA 3GY9A 3K9UA 4M85A 4PK3A 2OOTA 2JDCA 2JEWA 2GLFA 4MCQA 4NGMA 2F5IA 1R3NA 3NH4A 3SI1A 4B5PB 3TO7A 1CG2A 1S7KA 4MMOA 4Q38A 3V7ZA 5F09A 3N5FA 4B6ZA 4JZ0A 1TKJA 5KTAA 1RO5A 2ZW4A 4RI1A 2FXFA 4CYPA 4PV6A 2EVNA 3S9MA 4HKFA 4CYNA 1V0CA 4LUAA 1NSLA 4TWEA 1YMEA 4XNHC 2PJ6A 1XMTA 1KUYA 2AFMA 6CPAA 2PIYA 1ZLIA 5JH9A 1BPMA 5D29A 2GE3A 4R76A 2R1IA 4NGRA 4K30A 3OWCA 1PUAA 2EK8A 1YLEA 3D68A 2PJ4A 1VHEA 2C1CA 4GXHA 4CAWA 1Z8TA 2Q04A 1M4IA 3RZAA 3TT2A 3KI9A 1QSRA 1Q2CA 4DNCA 4UEFA 4KOTA 2CXAA 4WJBA 3PBBA 3LWUA 2OH1A 2Z3PA 4A39A 3CXQA 1YGHA 4QB9A 3I9SA 1CPXA 2RB7A 1XRYA 3GYAA 4YRHA 1JWQA 3FIXA 1XF8A 3PBEA 4MFKA 4CGOA 1CP6A 2R7HA 4B5OA 4CPAA 3VWDA 2REFA 3DNSA 5K8NA 5CNPA 1IIDA 2CY2A 4MCSA 4JYWA 4P4BA 3LACA 4J3GA 1YVOA 3ISXA 4EWTA 3D8PA 3KGQA 4OIDA 3VH9A 5I0CA 4C68A 3IO1A 3R9FA 4M3SA 5THWA 3S9NA 4C7IA 2G3TA 2WYRA 3EFAA 4E2AA 2BCOA 1YR0A 3I3GA 2IMOA 2ODFA 3FXTA 4F9VA 4F8ZA 3B7IA 5H86A 3NFZA 3V38A 2FCKA 1P4NA 3BLNA 3DDDA 4X3RA 2OU2A 4CGNA 3RO0A 2PR8A 1ZG9A 4X5KA 2CNTA 4CS0B 2Q43A 3IIBA 4PSWA 3KR5A 2F8HA 4RS2A 4W9YA 3ZZIA 3TTHA 2ABZA 5G1ZA 3T90A 4CYQA 1ARMA 3D2MA 4MBUA 5LRKA 2OZHA 4MHDA 2BL1A 4H2KA 3H8EA 1ZG8A 2V8HA 3FBUA 2WPWA 2G3AA 2XEGA 1ON0A 3NH5A 1IYLA 4OIWA 5F47A 1TKFA 1ELMP 2YNDA 3VARA 5LYFA 2JLMA 5C88A 1OBRA 4NGSA 3EC4A 2ZELA 1XJOA 1KWMA 3MN8A 2P6FA 4IUSA 2QYVA 1Z9UA 2B5GA 1PU9A 2DEAA 2JBKA 1MJAA 2FE7A 1VHSA 3NA6A 1QMUA 4XPKA 1Z8WA 3F5BA 3JTKA 2OZGA 2GLJA 4NF1A 1M1DA 3PEIA 4F9UA 4OKOA 1LAMA 3CPXA 1TF9A 1IYKA 2VXKA 4RN7A 1Z2LA 1S7FA 4BBHA 5E96A 5H84A 3H4QA 1TKHA 3IEHA 2YGWA 1F2PA 5HH1A 2IJZA 3BI1A 2D4OA 3VATA 2ZXVA 7CPAA 3GKRA 4YWYA 3TOAA 2PVWA 4B12A 4KSFA 4UF4A 1MK4A 2FT0A 2ARHA 1YREA 2C6CA 3IWGA 3E0KA 3MGDA 2B4BA 1MJBA 3MRUA 2PJ5A 2Q7BA 4OC3A 1UFHA 4U5YA 4H6UA 4MJ8A 2PIZA 3NH8A 1NMTA 1PCAA 2FSRA 5G20A 2DXQA 4O23A 4A95A 1YW6A 4Q36A 5DWMA 4E0AA 1LCPA 2EO8A 2EUIA 1BPNA 3VWEA 2PJ2A 1CX8A 2ANPA 3L2NA 4IHMA 4KVOE 4KOWA 4FD7A 1CJWA 4R6TA 3LD2A 4OAEA 2PSWA 3PB9X 4OC2A 5D8NA 5K8PA 3SJXA 2GIVA 1AUGA 1YSJA 2O28A 2C6GA 1BLLE 5IB0A 4Y49B 2AE6A 4OLLA 3BHXA 2B3UA 4UCPA 2ZEOA 4DUKA 4MFZA 5J8CA 4EVYA 4MHZA 3TE4A 1XEBA 2P6EA 2ZEPA 4F0YA 3WC6A 1KZFA 3FF3A 4NGTA 3SI0A 1Y0YA 3R9EA 3B35A 2Q44A 1Y0RA 4KOVA 4A94A 5ISVA 1QSMA 4M6IA 2HB6A 2AFXA 3CZXA 3KHZA 4LQGA 4PXEA 4AB7A 1BO4A 3TX8A 2PR1A 4AVBA 5J8FA 4JXRA 2VEZA 3D2PA 1S60A 2GREA 2BSWA 2J9AA 3B2YA 3IWEA 2AFSA 3KL9A 1YW4A 5LRJA 2KCWA 2F7VA 4M6HA 1S3ZA 1X12A 3ZJ0A 4XPLA 4YFJA 2Z3NA 2X7BA 4KSIA 1N71A 2R98A 4NJRA 4ZBGA 4FD4A 3IWWA 1HDUA 2DF5A 2GANA 4UEZA 3SI2A 4UWIA 4MCRA 3PZJA 4H89A 2AJ6A 3DSBA 4EFDA 1BOBA 4PXBA 1GHEA 2ZW6A 5F48A 4K3NA 4Z65A 4R3LA 2FIAA 2B4DB 4Y49C 1XFOA 2NMTA 2PC1A 2ZOGA 4MFQA 3FEDA 2Q7SA 2QVPA 5DWNA 4AG9A 4B5PA 2Z3KA 3DLJA 1M44A 2Z3LA 3FRMA 3IC1A 3IFEA 4MHPA 4ZX8A 3D7FA 1R43A 2V8GA 4CRZB 5CPAA 4AVAA 3P2HA 1FY7A 2VQYA 3IJ3A 1XE4A 4PK2A 1XBUA 2IQ6A 3CXSA 5HVFA 3S6GA 5K8OA 2Z3MA 1S7NA 2JDDA 2PCUA 1KUVA 3IU1A 4OMEA 2QIRA 4IAVA 4P4FA 4PQAA 4IK2A 4JLYA 2G0BA 5HVGA 1M4DA 2D4PA 3B3WA 3EXNA 2HC9A 4P10A 1Y9KA 3GIUA 1M4LA 3WABA 3RYOA 4F6AA 1ZG7A 2CF4A 1J4JA 2REEA 4KLWA 3B3VA 2PJBA 3FYNA
chains in the Genus database with same CATH topology
1LRZA 4QBJA 4QC6A 2BEIA 4KORA 3TOBA 2YNCC 4KOYA 4A33A 4HNWB 5EC4A 3DR8A 4XPDB 3R96A 2YNCA 5AG7A 3QAHA 2FL4A 2Z10A 4JWPA 2ATRA 5EBVA 3FNCA 2B4DA 1Z4RA 4L8AA 4CAXA 3JVNA 3SXNA 2VI7A 2FIWA 4KOSA 3S6KA 2B3VA 3V8IA 4E8OA 4MFJA 4MFPA 3TO9A 2Z0ZA 4CYOA 2OZUA 3IGRA 2ZW5A 2BUEA 2R8VA 4A2ZA 5F46A 2Z11A 4ONUA 4A30A 4CAVA 1KUXA 1OZPA 2I00A 1YK3A 2Q4VA 1K4JA 2ZW7A 2H5MA 2HQYA 1Y9WA 4XPDC 5AG4A 3F8KA 4A31A 4FD5A 2HUZA 1NE9A 4C2XA 5G21A 3P2FA 3R95A 5A27A 5KTDA 1U6MA 1I21A 4II9A 1I1DA 3N7ZA 4C2YA 2CNSA 5KTCA 2I79A 5AG6A 2ZPAA 4I49A 4XNHB 2CNMA 4NSQA 2PDOA 1P0HA 2YNEA 3QB8A 5A28A 1CM0A 5AGEA 1L0CA 4UBRA 5IX3A 4R3KA 3EY5A 3S6FA 4UCNA 4UFXA 4U9ZA 2P6GA 2B58A 1QSOA 1QSNA 3WR7A 4CRYB 4B14A 2DPTA 4H6ZA 4NXYA 4A32A 4JXQA 2Y0MA 2A4NA 4AG7A 5JQ4A 1M4GA 1TIQA 3PGPA 2C27A 4LX9A 3NE7A 4KUAA 5GCNA 4IF5A 5F49A 5G22A 4C2ZA 1Z4EA 5BWAB 3LODA 5IV0A 3R9GA 3B8GA 4KS9A 4CGPA 4L89A 3EO4A 4NEXA 3SHPA 1Y7RA 5FVJA 1XIXA 4KUBA 4PSXA 4YGOA 4B11A 1Q2YA 2IL4A 3TCVA 4CGMA 3G8WA 3CXPA 4B10A 4R9MA 4MY3A 1MJ9A 1YX0A 2J8MA 2WPXA 4CAEA 4GS4A 3BJ8A 2VZZA 2WUUA 3SXOA 5HMNA 4F0XA 1R57A 1IB1E 1QSTA 2B5GB 3IU2A 3W91A 4UCMA 1S7LA 4MI4A 3DR6A 4KLVA 3BJ7A 4KSAA 1B6BA 3W6SA 4CGLA 5C82A 4CAFA 4B13A 3TFYA 4C7HA 2VBQA 3H5ZA 1WWZA 1Q2DA 4ORFA 4QVTA 5JPHA 4KVXA 4HNYB 4QUSA 2RC4A 4NCZA 2DPSA 2FS5A 3UY5A 4BMHA 1S5KA 1VKCA 2Q4YA 4ZGYB 4KZTA 2Q0YA 4KVME 4FD6A 2PRBA 1I12A 2QECA 3FB3A 3TO6A 4UFVA 4MY0A 4UA3A 4R87A 4R57A 2P0WA 4MFLA 2PQ8A 4JJXA 3KKWA 2JEVA 4UWJA 3G3SA 2VZYA 3R1KA 4U9YA 2J8RA 4AVCA 1B87A 4KOUA 3S6HA 1SQHA 4HNXB 3JUWA 3C26A 2OB0A 2J8NA 3PP9A 4KOXA 1YVKA 2QMLA 2Z3OA 1IICA 2HV2A 3D3SA 4JD6A 1WK4A 5AG5A 3T9YA 4OADA 4UFWA 2WSAA 1ZO0A 3W6XA 3F0AA 2K5TA 3GY9A 1RXTA 3A9LA 3K9UA 4M85A 4PK3A 2JDCA 2F5IA 4B5PB 3TO7A 1S7KA 4Q38A 5KTAA 1RO5A 2ZW4A 4RI1A 2FXFA 4CYPA 4PV6A 2EVNA 4HKFA 4CYNA 1V0CA 4LUAA 1NSLA 4XNHC 1XMTA 1KUYA 2GE3A 2R1IA 4K30A 3OWCA 1PUAA 1YLEA 4CAWA 2Q04A 1M4IA 3TT2A 1QSRA 1Q2CA 4DNCA 4KOTA 2CXAA 2OH1A 2Z3PA 3CXQA 1YGHA 4QB9A 3I9SA 4YRHA 3GYAA 3FIXA 4CGOA 1XF8A 4MFKA 4B5OA 2R7HA 3VWDA 2REFA 3DNSA 5CNPA 1IIDA 2CY2A 4J3GA 1YVOA 3D8PA 5I0CA 4C68A 3R9FA 4M3SA 4C7IA 2G3TA 3EFAA 4E2AA 1YR0A 3I3GA 3FXTA 5H86A 2FCKA 1P4NA 3BLNA 3DDDA 2OU2A 4CGNA 2PR8A 4X5KA 2CNTA 4CS0B 4PSWA 4RS2A 3ZZIA 3TTHA 5G1ZA 3T90A 4CYQA 3D2MA 4MBUA 2OZHA 4MHDA 2BL1A 3FBUA 2WPWA 2G3AA 1ON0A 1IYLA 5F47A 2YNDA 2JLMA 5C88A 3EC4A 2P6FA 4IUSA 1Z9UA 2B5GA 1PU9A 1MJAA 2FE7A 1VHSA 4XPKA 3F5BA 3JTKA 2OZGA 4NF1A 1M1DA 2VXKA 1IYKA 1S7FA 4BBHA 5E96A 5H84A 3H4QA 2YGWA 5HH1A 2D4OA 2ZXVA 3GKRA 3TOAA 4B12A 4KSFA 1MK4A 2ARHA 1YREA 2FT0A 3IWGA 3E0KA 3MGDA 2B4BA 1MJBA 2Q7BA 1UFHA 4U5YA 4H6UA 4MJ8A 1NMTA 2FSRA 5G20A 2DXQA 4A95A 4Q36A 5DWMA 4E0AA 2EUIA 3VWEA 4KVOE 4KOWA 4FD7A 1CJWA 3LD2A 4OAEA 2PSWA 2GIVA 2O28A 5IB0A 4Y49B 2AE6A 4OLLA 5J8CA 2B3UA 4UCPA 4MFZA 4EVYA 3TE4A 1XEBA 2P6EA 4F0YA 1KZFA 3R9EA 2Q44A 4KOVA 5ISVA 1QSMA 4AB7A 1BO4A 4AVBA 2PR1A 5J8FA 4JXRA 2VEZA 3D2PA 1S60A 2BSWA 3IWEA 2KCWA 4YFJA 1S3ZA 3ZJ0A 4XPLA 2Z3NA 2X7BA 1N71A 2R98A 4ZBGA 4FD4A 2GANA 4UWIA 3PZJA 4H89A 2AJ6A 3DSBA 1BOBA 1GHEA 2ZW6A 5F48A 4R3LA 2FIAA 2B4DB 4Y49C 2NMTA 2PC1A 4MFQA 4B5PA 4AG9A 5DWNA 2Z3KA 3FRMA 1M44A 2Z3LA 4CRZB 4AVAA 3P2HA 1FY7A 2VQYA 4PK2A 1XE4A 3CXSA 3S6GA 2Z3MA 1S7NA 2JDDA 1KUVA 3IU1A 2QIRA 4JLYA 2G0BA 1M4DA 2D4PA 3EXNA 1Y9KA 3RYOA 4F6AA 1J4JA 2REEA 4KLWA 3FYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRZ A;  4QBJ A;  4QC6 A;  2BEI A;  4KOR A;  3TOB A;  4KOY A;  4HNW B;  5EC4 A;  3DR8 A;  4XPD B;  3R96 A;  3QAH A;  2FL4 A;  2Z10 A;  4JWP A;  2ATR A;  5EBV A;  3FNC A;  2B4D A;  1Z4R A;  4L8A A;  4CAX A;  3JVN A;  3SXN A;  2VI7 A;  2FIW A;  4KOS A;  3S6K A;  2B3V A;  3V8I A;  4E8O A;  3TO9 A;  2Z0Z A;  2OZU A;  3IGR A;  2ZW5 A;  2BUE A;  2R8V A;  5F46 A;  2Z11 A;  4ONU A;  4CAV A;  1KUX A;  1OZP A;  2I00 A;  1YK3 A;  2Q4V A;  1K4J A;  2ZW7 A;  2H5M A;  2HQY A;  1Y9W A;  4XPD C;  3F8K A;  4FD5 A;  2HUZ A;  1NE9 A;  3P2F A;  3R95 A;  5KTD A;  1U6M A;  1I21 A;  4II9 A;  1I1D A;  3N7Z A;  2CNS A;  5KTC A;  2I79 A;  2ZPA A;  4I49 A;  4XNH B;  2CNM A;  4NSQ A;  2PDO A;  1P0H A;  3QB8 A;  1CM0 A;  1L0C A;  4UBR A;  5IX3 A;  4R3K A;  3EY5 A;  3S6F A;  4U9Z A;  2P6G A;  2B58 A;  1QSO A;  1QSN A;  3WR7 A;  4CRY B;  4H6Z A;  4NXY A;  4JXQ A;  2Y0M A;  2A4N A;  4AG7 A;  5JQ4 A;  1M4G A;  1TIQ A;  3PGP A;  2C27 A;  4LX9 A;  3NE7 A;  4KUA A;  5GCN A;  4IF5 A;  5F49 A;  1Z4E A;  3LOD A;  5IV0 A;  3R9G A;  3B8G A;  4L89 A;  3EO4 A;  4NEX A;  3SHP A;  1Y7R A;  5FVJ A;  1XIX A;  4KUB A;  4PSX A;  4YGO A;  1Q2Y A;  2IL4 A;  3TCV A;  3G8W A;  3CXP A;  4R9M A;  4MY3 A;  1MJ9 A;  1YX0 A;  2J8M A;  2WPX A;  4GS4 A;  3BJ8 A;  2VZZ A;  3SXO A;  5HMN A;  1R57 A;  1IB1 E;  1QST A;  2B5G B;  3W91 A;  1S7L A;  4MI4 A;  3DR6 A;  4KLV A;  3BJ7 A;  1B6B A;  3W6S A;  5C82 A;  3TFY A;  2VBQ A;  4ORF A;  1WWZ A;  1Q2D A;  4QVT A;  5JPH A;  4KVX A;  4HNY B;  4QUS A;  2RC4 A;  4NCZ A;  2FS5 A;  3UY5 A;  4BMH A;  1S5K A;  1VKC A;  2Q4Y A;  4KZT A;  2Q0Y A;  4KVM E;  4FD6 A;  2PRB A;  1I12 A;  2QEC A;  3FB3 A;  3TO6 A;  4MY0 A;  4UA3 A;  4R87 A;  4R57 A;  2P0W A;  2PQ8 A;  4JJX A;  3KKW A;  2JEV A;  4UWJ A;  3G3S A;  2VZY A;  3R1K A;  4U9Y A;  2J8R A;  4AVC A;  1B87 A;  4KOU A;  3S6H A;  1SQH A;  4HNX B;  3JUW A;  3C26 A;  2OB0 A;  2J8N A;  3PP9 A;  4KOX A;  1YVK A;  2QML A;  1IIC A;  2HV2 A;  3D3S A;  4JD6 A;  1WK4 A;  3T9Y A;  4OAD A;  3W6X A;  3F0A A;  2K5T A;  3GY9 A;  1RXT A;  3K9U A;  4M85 A;  4PK3 A;  2JDC A;  2F5I A;  4B5P B;  3TO7 A;  1S7K A;  5KTA A;  1RO5 A;  2ZW4 A;  4RI1 A;  2FXF A;  4PV6 A;  2EVN A;  4HKF A;  1V0C A;  4LUA A;  1NSL A;  4XNH C;  1XMT A;  1KUY A;  2GE3 A;  2R1I A;  4K30 A;  3OWC A;  1PUA A;  1YLE A;  4CAW A;  2Q04 A;  1M4I A;  3TT2 A;  1QSR A;  1Q2C A;  4DNC A;  4KOT A;  2OH1 A;  3CXQ A;  1YGH A;  4QB9 A;  3I9S A;  4YRH A;  3GYA A;  3FIX A;  1XF8 A;  4B5O A;  2R7H A;  3VWD A;  2REF A;  3DNS A;  5CNP A;  1IID A;  2CY2 A;  4J3G A;  1YVO A;  3D8P A;  5I0C A;  3R9F A;  4M3S A;  2G3T A;  3EFA A;  4E2A A;  1YR0 A;  3I3G A;  3FXT A;  5H86 A;  2FCK A;  1P4N A;  3BLN A;  3DDD A;  2OU2 A;  2PR8 A;  4X5K A;  2CNT A;  4CS0 B;  4PSW A;  4RS2 A;  3ZZI A;  3TTH A;  3T90 A;  3D2M A;  4MBU A;  2OZH A;  4MHD A;  2BL1 A;  3FBU A;  2WPW A;  2G3A A;  1ON0 A;  1IYL A;  5F47 A;  2JLM A;  5C88 A;  3EC4 A;  2P6F A;  4IUS A;  1Z9U A;  2B5G A;  1PU9 A;  1MJA A;  2FE7 A;  1VHS A;  4XPK A;  3F5B A;  2OZG A;  4NF1 A;  1M1D A;  2VXK A;  1IYK A;  1S7F A;  5E96 A;  5H84 A;  3H4Q A;  5HH1 A;  2D4O A;  2ZXV A;  3GKR A;  3TOA A;  1MK4 A;  2ARH A;  1YRE A;  2FT0 A;  3IWG A;  3E0K A;  3MGD A;  2B4B A;  1MJB A;  2Q7B A;  1UFH A;  4U5Y A;  4H6U A;  4MJ8 A;  1NMT A;  2FSR A;  2DXQ A;  4E0A A;  5DWM A;  2EUI A;  3VWE A;  4KVO E;  4KOW A;  4FD7 A;  1CJW A;  3LD2 A;  4OAE A;  2PSW A;  2GIV A;  2O28 A;  5IB0 A;  4Y49 B;  2AE6 A;  4OLL A;  5J8C A;  2B3U A;  4EVY A;  3TE4 A;  1XEB A;  2P6E A;  4F0Y A;  1KZF A;  3R9E A;  2Q44 A;  4KOV A;  5ISV A;  1QSM A;  4AB7 A;  1BO4 A;  4AVB A;  2PR1 A;  5J8F A;  4JXR A;  2VEZ A;  3D2P A;  1S60 A;  2BSW A;  2KCW A;  4YFJ A;  1S3Z A;  3ZJ0 A;  4XPL A;  2X7B A;  1N71 A;  2R98 A;  4ZBG A;  4FD4 A;  2GAN A;  4UWI A;  3PZJ A;  4H89 A;  2AJ6 A;  3DSB A;  1BOB A;  1GHE A;  2ZW6 A;  5F48 A;  4R3L A;  2FIA A;  2B4D B;  4Y49 C;  2NMT A;  2PC1 A;  4B5P A;  4AG9 A;  5DWN A;  3FRM A;  1M44 A;  4CRZ B;  4AVA A;  3P2H A;  1FY7 A;  2VQY A;  4PK2 A;  1XE4 A;  3CXS A;  3S6G A;  1S7N A;  2JDD A;  1KUV A;  2QIR A;  4JLY A;  2G0B A;  1M4D A;  2D4P A;  3EXN A;  1Y9K A;  3RYO A;  4F6A A;  1J4J A;  2REE A;  4KLW A;  3FYN A; 
#chains in the Genus database with same CATH topology
 1Z5R A;  4BIN A;  1LRZ A;  2PRQ A;  5DS0 A;  1Z8X A;  4QBJ A;  4QC6 A;  2QJ8 A;  3FH4 A;  2BEI A;  4KOR A;  4A37 A;  3TOB A;  2YNC C;  4KOY A;  3CDX A;  4HNW B;  4UIA A;  5EC4 A;  4A33 A;  3DR8 A;  4XPD B;  3R96 A;  2YNC A;  5AG7 A;  4FAI A;  3QAH A;  2FL4 A;  2Z10 A;  2PJA A;  4JWP A;  3FVL A;  2ATR A;  4DYO A;  5EBV A;  1CP7 A;  2CIJ A;  3FNC A;  3GB0 A;  2B4D A;  1Z4R A;  3FJU A;  4L8A A;  4CAX A;  3JVN A;  3SXN A;  4A38 A;  2VI7 A;  2FIW A;  4KOS A;  3S6K A;  2B3V A;  3V8I A;  2ZEF A;  3PB4 X;  4FWU A;  4E8O A;  3DGV A;  4MFJ A;  4MFP A;  3TO9 A;  2Z0Z A;  4CYO A;  4NGP A;  2OZU A;  3IGR A;  4P6Y A;  2ZW5 A;  4ZY2 A;  3PFE A;  1TXR A;  2BUE A;  4FBE A;  5K8M A;  2PJ8 A;  2R8V A;  3KHX A;  3TC8 A;  4A2Z A;  5F46 A;  2PJ7 A;  2Z11 A;  2PJ0 A;  2Q4Z A;  4ONU A;  4P4E A;  5ELY A;  2POK A;  4A30 A;  3D66 A;  4CAV A;  1KUX A;  1OZP A;  2I00 A;  1YK3 A;  1FT7 A;  5LRG A;  2Q4V A;  1K4J A;  2XEJ A;  4TNU A;  1CBX A;  3ISZ A;  3B3T A;  4MHN A;  3LMS A;  3D7G A;  2ZW7 A;  1VHO A;  2ZEH A;  2H5M A;  2HQY A;  2VL1 A;  1Y9W A;  1F57 A;  4X2T A;  8CPA A;  4XPD C;  5AG4 A;  3F8K A;  1VGY A;  4YU9 A;  3S9L A;  4ZI6 A;  3KQX A;  2ZEG A;  4A31 A;  2Q51 A;  5LYI A;  4FD5 A;  2HUZ A;  1NE9 A;  4C2X A;  1YQE A;  3WT4 A;  1LAP A;  2ZED A;  2NYQ A;  5G21 A;  4RUH A;  4MHY A;  2ZEE A;  3P2F A;  3R95 A;  3FX6 A;  1A2Z A;  5A27 A;  5HVH A;  5KTD A;  1U6M A;  3RBU A;  1YLO A;  1I21 A;  4P45 A;  4II9 A;  4NGQ A;  1I1D A;  3K2K A;  4LQ6 A;  3N7Z A;  4C2Y A;  2CNS A;  1CPS A;  5KTC A;  2I79 A;  5AG6 A;  2ZPA A;  4I49 A;  4XNH B;  4OC4 A;  2CNM A;  4NSQ A;  2PDO A;  4ZYQ A;  5JGF A;  1BAV A;  1P0H A;  2YNE A;  3QB8 A;  5A28 A;  1CM0 A;  3PB8 X;  5AGE A;  1Y7E A;  2AFO A;  1L0C A;  4UBR A;  5IX3 A;  5EMI A;  1AMP A;  4R3K A;  1NSA A;  2BOA A;  2V8V A;  3H8F A;  4OP4 A;  3EY5 A;  3S6F A;  3HLP A;  4UCN A;  4UFX A;  4DJL A;  1DE4 C;  4U9Z A;  2P6G A;  3RAM A;  4ZX9 A;  2B58 A;  1ELL P;  1QSO A;  4ONW A;  1QSN A;  2EWB A;  3SJE A;  3WR7 A;  3FMC A;  4CRY B;  2NSM A;  3HUV A;  4B14 A;  4ZY0 A;  2DPT A;  2AFU A;  1H8L A;  4H6Z A;  4NXY A;  4A32 A;  4JXQ A;  4UIB A;  2Y0M A;  4MCP A;  2A4N A;  4UEE A;  4OC5 A;  3RNZ A;  4AG7 A;  4P44 A;  1F2O A;  5JQ4 A;  1M4G A;  1TIQ A;  1X10 A;  3BI0 A;  2PVV A;  3PGP A;  2C27 A;  4LX9 A;  3NE7 A;  4KUA A;  5GCN A;  4IF5 A;  5F49 A;  5G22 A;  4C2Z A;  1Z4E A;  5BWA B;  3LOD A;  5IV0 A;  3R9G A;  3B8G A;  4KS9 A;  4CGP A;  5I4M A;  1ARL A;  1LOK A;  3EO4 A;  3QNV A;  4L89 A;  4NEX A;  4NFR A;  4P4D A;  3K9T A;  3SHP A;  1Y7R A;  5FVJ A;  1VIX A;  1XIX A;  1EE3 P;  4FUU A;  3SJF A;  4KUB A;  4PSX A;  4YGO A;  4B11 A;  3KR4 A;  3B3C A;  2WZN A;  1HDQ A;  2BO9 A;  1Q2Y A;  2IL4 A;  3B3S A;  3TCV A;  1LAN A;  4CGM A;  5HXD A;  3G8W A;  3CXP A;  1LFW A;  4MRI A;  4R9M A;  3FEE A;  4MY3 A;  1JQG A;  4B10 A;  1MJ9 A;  2G9D A;  2PJ3 A;  1YX0 A;  2J8M A;  2WPX A;  4CAE A;  5IB9 A;  4GS4 A;  3BJ8 A;  2VZZ A;  2OR4 A;  2WUU A;  4HPS A;  1Q7L A;  2GFQ A;  3SXO A;  4F0X A;  2I3C A;  1R57 A;  5HMN A;  1IB1 E;  1QST A;  2B5G B;  4PPZ A;  4R8F A;  3IU2 A;  4P4I A;  3D4U A;  1UWY A;  4UCM A;  1S7L A;  3W91 A;  2V77 A;  4MI4 A;  3DR6 A;  4OC0 A;  4ZY1 A;  1IGB A;  4KLV A;  3BJ7 A;  1DTD A;  4KSA A;  3KQZ A;  1B6B A;  1IY7 A;  2XEI A;  5CBM A;  2AFW A;  3W6S A;  4CGL A;  5C82 A;  3PFO A;  4M6G A;  1AYE A;  4G1P A;  4CAF A;  4B13 A;  4PXC A;  3TFY A;  4C7H A;  2VBQ A;  3H5Z A;  1WWZ A;  1Q2D A;  4ORF A;  4P4J A;  4QVT A;  2JBJ A;  5JPH A;  4KVX A;  4HNY B;  3H8G A;  4QUS A;  2RC4 A;  4NCZ A;  4OC1 A;  1Z8L A;  4GM5 A;  2PJ1 A;  3GLJ A;  2DPS A;  2FS5 A;  3UY5 A;  4BMH A;  1S5K A;  3PB7 X;  1GYT A;  2O4H A;  2FVG A;  1VKC A;  2Q4Y A;  4ZGY B;  2XEF A;  4KZT A;  2ZEN A;  1IOF A;  2Q0Y A;  2AFZ A;  3CPA A;  4KVM E;  4MXU A;  4FD6 A;  2PRB A;  1I12 A;  2ZEM A;  2RFH A;  3SJG A;  5J1Q A;  2QEC A;  3FB3 A;  3KAS A;  4NGN A;  2V8D A;  2GU2 A;  4PXD A;  4UFV A;  3TO6 A;  3BXM A;  4BD9 A;  1IOI A;  1RTQ A;  4MY0 A;  4Q7A A;  4UA3 A;  4R87 A;  4R57 A;  4AXV A;  2P0W A;  4MFL A;  3D67 A;  3FEC A;  3PRT A;  2PQ8 A;  2CTC A;  1TF8 A;  2PJC A;  4R7M A;  4JJX A;  3QAY A;  3KKW A;  3GUX A;  2JEV A;  4NJQ A;  2PJ9 A;  4UWJ A;  3G3S A;  2VZY A;  3R1K A;  4U9Y A;  2J8R A;  3D7D A;  4AVC A;  1B87 A;  3I1U A;  4KOU A;  3S6H A;  1SQH A;  1FNO A;  2C6P A;  4HNX B;  3JUW A;  3C26 A;  2OB0 A;  3CT9 A;  2J8N A;  3PP9 A;  4EME A;  1PYT B;  4KOX A;  1ZLH A;  5LYD A;  1YVK A;  2EK9 A;  5JM6 A;  2QML A;  2Z3O A;  1IIC A;  2HV2 A;  2PE3 A;  3D7H A;  2ZOF A;  3D3S A;  3NE8 A;  4JD6 A;  3PB6 X;  3T8W A;  3WC5 A;  2CTB A;  1WK4 A;  4WWV A;  5AG5 A;  3T9Y A;  1HEE A;  4X8I A;  3KZW A;  1QQ9 A;  1IU8 A;  4OAD A;  4UFW A;  2WSA A;  1XMB A;  1ZO0 A;  3W6X A;  2O53 A;  3F0A A;  3WC7 A;  5LYL A;  3JRU A;  2EBJ A;  2K5T A;  1XOV A;  1RXT A;  3A9L A;  3GY9 A;  3K9U A;  4M85 A;  4PK3 A;  2OOT A;  2JDC A;  2JEW A;  2GLF A;  4MCQ A;  4NGM A;  2F5I A;  1R3N A;  3NH4 A;  3SI1 A;  4B5P B;  3TO7 A;  1CG2 A;  1S7K A;  4MMO A;  4Q38 A;  3V7Z A;  5F09 A;  3N5F A;  4B6Z A;  4JZ0 A;  1TKJ A;  5KTA A;  1RO5 A;  2ZW4 A;  4RI1 A;  2FXF A;  4CYP A;  4PV6 A;  2EVN A;  3S9M A;  4HKF A;  4CYN A;  1V0C A;  4LUA A;  1NSL A;  4TWE A;  1YME A;  4XNH C;  2PJ6 A;  1XMT A;  1KUY A;  2AFM A;  6CPA A;  2PIY A;  1ZLI A;  5JH9 A;  1BPM A;  5D29 A;  2GE3 A;  4R76 A;  2R1I A;  4NGR A;  4K30 A;  3OWC A;  1PUA A;  2EK8 A;  1YLE A;  3D68 A;  2PJ4 A;  1VHE A;  2C1C A;  4GXH A;  4CAW A;  1Z8T A;  2Q04 A;  1M4I A;  3RZA A;  3TT2 A;  3KI9 A;  1QSR A;  1Q2C A;  4DNC A;  4UEF A;  4KOT A;  2CXA A;  4WJB A;  3PBB A;  3LWU A;  2OH1 A;  2Z3P A;  4A39 A;  3CXQ A;  1YGH A;  4QB9 A;  3I9S A;  1CPX A;  2RB7 A;  1XRY A;  3GYA A;  4YRH A;  1JWQ A;  3FIX A;  1XF8 A;  3PBE A;  4MFK A;  4CGO A;  1CP6 A;  2R7H A;  4B5O A;  4CPA A;  3VWD A;  2REF A;  3DNS A;  5K8N A;  5CNP A;  1IID A;  2CY2 A;  4MCS A;  4JYW A;  4P4B A;  3LAC A;  4J3G A;  1YVO A;  3ISX A;  4EWT A;  3D8P A;  3KGQ A;  4OID A;  3VH9 A;  5I0C A;  4C68 A;  3IO1 A;  3R9F A;  4M3S A;  5THW A;  3S9N A;  4C7I A;  2G3T A;  2WYR A;  3EFA A;  4E2A A;  2BCO A;  1YR0 A;  3I3G A;  2IMO A;  2ODF A;  3FXT A;  4F9V A;  4F8Z A;  3B7I A;  5H86 A;  3NFZ A;  3V38 A;  2FCK A;  1P4N A;  3BLN A;  3DDD A;  4X3R A;  2OU2 A;  4CGN A;  3RO0 A;  2PR8 A;  1ZG9 A;  4X5K A;  2CNT A;  4CS0 B;  2Q43 A;  3IIB A;  4PSW A;  3KR5 A;  2F8H A;  4RS2 A;  4W9Y A;  3ZZI A;  3TTH A;  2ABZ A;  5G1Z A;  3T90 A;  4CYQ A;  1ARM A;  3D2M A;  4MBU A;  5LRK A;  2OZH A;  4MHD A;  2BL1 A;  4H2K A;  3H8E A;  1ZG8 A;  2V8H A;  3FBU A;  2WPW A;  2G3A A;  2XEG A;  1ON0 A;  3NH5 A;  1IYL A;  4OIW A;  5F47 A;  1TKF A;  1ELM P;  2YND A;  3VAR A;  5LYF A;  2JLM A;  5C88 A;  1OBR A;  4NGS A;  3EC4 A;  2ZEL A;  1XJO A;  1KWM A;  3MN8 A;  2P6F A;  4IUS A;  2QYV A;  1Z9U A;  2B5G A;  1PU9 A;  2DEA A;  2JBK A;  1MJA A;  2FE7 A;  1VHS A;  3NA6 A;  1QMU A;  4XPK A;  1Z8W A;  3F5B A;  3JTK A;  2OZG A;  2GLJ A;  4NF1 A;  1M1D A;  3PEI A;  4F9U A;  4OKO A;  1LAM A;  3CPX A;  1TF9 A;  1IYK A;  2VXK A;  4RN7 A;  1Z2L A;  1S7F A;  4BBH A;  5E96 A;  5H84 A;  3H4Q A;  1TKH A;  3IEH A;  2YGW A;  1F2P A;  5HH1 A;  2IJZ A;  3BI1 A;  2D4O A;  3VAT A;  2ZXV A;  7CPA A;  3GKR A;  4YWY A;  3TOA A;  2PVW A;  4B12 A;  4KSF A;  4UF4 A;  1MK4 A;  2FT0 A;  2ARH A;  1YRE A;  2C6C A;  3IWG A;  3E0K A;  3MGD A;  2B4B A;  1MJB A;  3MRU A;  2PJ5 A;  2Q7B A;  4OC3 A;  1UFH A;  4U5Y A;  4H6U A;  4MJ8 A;  2PIZ A;  3NH8 A;  1NMT A;  1PCA A;  2FSR A;  5G20 A;  2DXQ A;  4O23 A;  4A95 A;  1YW6 A;  4Q36 A;  5DWM A;  4E0A A;  1LCP A;  2EO8 A;  2EUI A;  1BPN A;  3VWE A;  2PJ2 A;  1CX8 A;  2ANP A;  3L2N A;  4IHM A;  4KVO E;  4KOW A;  4FD7 A;  1CJW A;  4R6T A;  3LD2 A;  4OAE A;  2PSW A;  3PB9 X;  4OC2 A;  5D8N A;  5K8P A;  3SJX A;  2GIV A;  1AUG A;  1YSJ A;  2O28 A;  2C6G A;  1BLL E;  5IB0 A;  4Y49 B;  2AE6 A;  4OLL A;  3BHX A;  2B3U A;  4UCP A;  2ZEO A;  4DUK A;  4MFZ A;  5J8C A;  4EVY A;  4MHZ A;  3TE4 A;  1XEB A;  2P6E A;  2ZEP A;  4F0Y A;  3WC6 A;  1KZF A;  3FF3 A;  4NGT A;  3SI0 A;  1Y0Y A;  3R9E A;  3B35 A;  2Q44 A;  1Y0R A;  4KOV A;  4A94 A;  5ISV A;  1QSM A;  4M6I A;  2HB6 A;  2AFX A;  3CZX A;  3KHZ A;  4LQG A;  4PXE A;  4AB7 A;  1BO4 A;  3TX8 A;  2PR1 A;  4AVB A;  5J8F A;  4JXR A;  2VEZ A;  3D2P A;  1S60 A;  2GRE A;  2BSW A;  2J9A A;  3B2Y A;  3IWE A;  2AFS A;  3KL9 A;  1YW4 A;  5LRJ A;  2KCW A;  2F7V A;  4M6H A;  1S3Z A;  1X12 A;  3ZJ0 A;  4XPL A;  4YFJ A;  2Z3N A;  2X7B A;  4KSI A;  1N71 A;  2R98 A;  4NJR A;  4ZBG A;  4FD4 A;  3IWW A;  1HDU A;  2DF5 A;  2GAN A;  4UEZ A;  3SI2 A;  4UWI A;  4MCR A;  3PZJ A;  4H89 A;  2AJ6 A;  3DSB A;  4EFD A;  1BOB A;  4PXB A;  1GHE A;  2ZW6 A;  5F48 A;  4K3N A;  4Z65 A;  4R3L A;  2FIA A;  2B4D B;  4Y49 C;  1XFO A;  2NMT A;  2PC1 A;  2ZOG A;  4MFQ A;  3FED A;  2Q7S A;  2QVP A;  5DWN A;  4AG9 A;  4B5P A;  2Z3K A;  3DLJ A;  1M44 A;  2Z3L A;  3FRM A;  3IC1 A;  3IFE A;  4MHP A;  4ZX8 A;  3D7F A;  1R43 A;  2V8G A;  4CRZ B;  5CPA A;  4AVA A;  3P2H A;  1FY7 A;  2VQY A;  3IJ3 A;  1XE4 A;  4PK2 A;  1XBU A;  2IQ6 A;  3CXS A;  5HVF A;  3S6G A;  5K8O A;  2Z3M A;  1S7N A;  2JDD A;  2PCU A;  1KUV A;  3IU1 A;  4OME A;  2QIR A;  4IAV A;  4P4F A;  4PQA A;  4IK2 A;  4JLY A;  2G0B A;  5HVG A;  1M4D A;  2D4P A;  3B3W A;  3EXN A;  2HC9 A;  4P10 A;  1Y9K A;  3GIU A;  1M4L A;  3WAB A;  3RYO A;  4F6A A;  1ZG7 A;  2CF4 A;  1J4J A;  2REE A;  4KLW A;  3B3V A;  2PJB A;  3FYN A; 
#chains in the Genus database with same CATH homology
 1LRZ A;  4QBJ A;  4QC6 A;  2BEI A;  4KOR A;  3TOB A;  2YNC C;  4KOY A;  4A33 A;  4HNW B;  5EC4 A;  3DR8 A;  4XPD B;  3R96 A;  2YNC A;  5AG7 A;  3QAH A;  2FL4 A;  2Z10 A;  4JWP A;  2ATR A;  5EBV A;  3FNC A;  2B4D A;  1Z4R A;  4L8A A;  4CAX A;  3JVN A;  3SXN A;  2VI7 A;  2FIW A;  4KOS A;  3S6K A;  2B3V A;  3V8I A;  4E8O A;  4MFJ A;  4MFP A;  3TO9 A;  2Z0Z A;  4CYO A;  2OZU A;  3IGR A;  2ZW5 A;  2BUE A;  2R8V A;  4A2Z A;  5F46 A;  2Z11 A;  4ONU A;  4A30 A;  4CAV A;  1KUX A;  1OZP A;  2I00 A;  1YK3 A;  2Q4V A;  1K4J A;  2ZW7 A;  2H5M A;  2HQY A;  1Y9W A;  4XPD C;  5AG4 A;  3F8K A;  4A31 A;  4FD5 A;  2HUZ A;  1NE9 A;  4C2X A;  5G21 A;  3P2F A;  3R95 A;  5A27 A;  5KTD A;  1U6M A;  1I21 A;  4II9 A;  1I1D A;  3N7Z A;  4C2Y A;  2CNS A;  5KTC A;  2I79 A;  5AG6 A;  2ZPA A;  4I49 A;  4XNH B;  2CNM A;  4NSQ A;  2PDO A;  1P0H A;  2YNE A;  3QB8 A;  5A28 A;  1CM0 A;  5AGE A;  1L0C A;  4UBR A;  5IX3 A;  4R3K A;  3EY5 A;  3S6F A;  4UCN A;  4UFX A;  4U9Z A;  2P6G A;  2B58 A;  1QSO A;  1QSN A;  3WR7 A;  4CRY B;  4B14 A;  2DPT A;  4H6Z A;  4NXY A;  4A32 A;  4JXQ A;  2Y0M A;  2A4N A;  4AG7 A;  5JQ4 A;  1M4G A;  1TIQ A;  3PGP A;  2C27 A;  4LX9 A;  3NE7 A;  4KUA A;  5GCN A;  4IF5 A;  5F49 A;  5G22 A;  4C2Z A;  1Z4E A;  5BWA B;  3LOD A;  5IV0 A;  3R9G A;  3B8G A;  4KS9 A;  4CGP A;  4L89 A;  3EO4 A;  4NEX A;  3SHP A;  1Y7R A;  5FVJ A;  1XIX A;  4KUB A;  4PSX A;  4YGO A;  4B11 A;  1Q2Y A;  2IL4 A;  3TCV A;  4CGM A;  3G8W A;  3CXP A;  4B10 A;  4R9M A;  4MY3 A;  1MJ9 A;  1YX0 A;  2J8M A;  2WPX A;  4CAE A;  4GS4 A;  3BJ8 A;  2VZZ A;  2WUU A;  3SXO A;  5HMN A;  4F0X A;  1R57 A;  1IB1 E;  1QST A;  2B5G B;  3IU2 A;  3W91 A;  4UCM A;  1S7L A;  4MI4 A;  3DR6 A;  4KLV A;  3BJ7 A;  4KSA A;  1B6B A;  3W6S A;  4CGL A;  5C82 A;  4CAF A;  4B13 A;  3TFY A;  4C7H A;  2VBQ A;  3H5Z A;  1WWZ A;  1Q2D A;  4ORF A;  4QVT A;  5JPH A;  4KVX A;  4HNY B;  4QUS A;  2RC4 A;  4NCZ A;  2DPS A;  2FS5 A;  3UY5 A;  4BMH A;  1S5K A;  1VKC A;  2Q4Y A;  4ZGY B;  4KZT A;  2Q0Y A;  4KVM E;  4FD6 A;  2PRB A;  1I12 A;  2QEC A;  3FB3 A;  3TO6 A;  4UFV A;  4MY0 A;  4UA3 A;  4R87 A;  4R57 A;  2P0W A;  4MFL A;  2PQ8 A;  4JJX A;  3KKW A;  2JEV A;  4UWJ A;  3G3S A;  2VZY A;  3R1K A;  4U9Y A;  2J8R A;  4AVC A;  1B87 A;  4KOU A;  3S6H A;  1SQH A;  4HNX B;  3JUW A;  3C26 A;  2OB0 A;  2J8N A;  3PP9 A;  4KOX A;  1YVK A;  2QML A;  2Z3O A;  1IIC A;  2HV2 A;  3D3S A;  4JD6 A;  1WK4 A;  5AG5 A;  3T9Y A;  4OAD A;  4UFW A;  2WSA A;  1ZO0 A;  3W6X A;  3F0A A;  2K5T A;  3GY9 A;  1RXT A;  3A9L A;  3K9U A;  4M85 A;  4PK3 A;  2JDC A;  2F5I A;  4B5P B;  3TO7 A;  1S7K A;  4Q38 A;  5KTA A;  1RO5 A;  2ZW4 A;  4RI1 A;  2FXF A;  4CYP A;  4PV6 A;  2EVN A;  4HKF A;  4CYN A;  1V0C A;  4LUA A;  1NSL A;  4XNH C;  1XMT A;  1KUY A;  2GE3 A;  2R1I A;  4K30 A;  3OWC A;  1PUA A;  1YLE A;  4CAW A;  2Q04 A;  1M4I A;  3TT2 A;  1QSR A;  1Q2C A;  4DNC A;  4KOT A;  2CXA A;  2OH1 A;  2Z3P A;  3CXQ A;  1YGH A;  4QB9 A;  3I9S A;  4YRH A;  3GYA A;  3FIX A;  4CGO A;  1XF8 A;  4MFK A;  4B5O A;  2R7H A;  3VWD A;  2REF A;  3DNS A;  5CNP A;  1IID A;  2CY2 A;  4J3G A;  1YVO A;  3D8P A;  5I0C A;  4C68 A;  3R9F A;  4M3S A;  4C7I A;  2G3T A;  3EFA A;  4E2A A;  1YR0 A;  3I3G A;  3FXT A;  5H86 A;  2FCK A;  1P4N A;  3BLN A;  3DDD A;  2OU2 A;  4CGN A;  2PR8 A;  4X5K A;  2CNT A;  4CS0 B;  4PSW A;  4RS2 A;  3ZZI A;  3TTH A;  5G1Z A;  3T90 A;  4CYQ A;  3D2M A;  4MBU A;  2OZH A;  4MHD A;  2BL1 A;  3FBU A;  2WPW A;  2G3A A;  1ON0 A;  1IYL A;  5F47 A;  2YND A;  2JLM A;  5C88 A;  3EC4 A;  2P6F A;  4IUS A;  1Z9U A;  2B5G A;  1PU9 A;  1MJA A;  2FE7 A;  1VHS A;  4XPK A;  3F5B A;  3JTK A;  2OZG A;  4NF1 A;  1M1D A;  2VXK A;  1IYK A;  1S7F A;  4BBH A;  5E96 A;  5H84 A;  3H4Q A;  2YGW A;  5HH1 A;  2D4O A;  2ZXV A;  3GKR A;  3TOA A;  4B12 A;  4KSF A;  1MK4 A;  2ARH A;  1YRE A;  2FT0 A;  3IWG A;  3E0K A;  3MGD A;  2B4B A;  1MJB A;  2Q7B A;  1UFH A;  4U5Y A;  4H6U A;  4MJ8 A;  1NMT A;  2FSR A;  5G20 A;  2DXQ A;  4A95 A;  4Q36 A;  5DWM A;  4E0A A;  2EUI A;  3VWE A;  4KVO E;  4KOW A;  4FD7 A;  1CJW A;  3LD2 A;  4OAE A;  2PSW A;  2GIV A;  2O28 A;  5IB0 A;  4Y49 B;  2AE6 A;  4OLL A;  5J8C A;  2B3U A;  4UCP A;  4MFZ A;  4EVY A;  3TE4 A;  1XEB A;  2P6E A;  4F0Y A;  1KZF A;  3R9E A;  2Q44 A;  4KOV A;  5ISV A;  1QSM A;  4AB7 A;  1BO4 A;  4AVB A;  2PR1 A;  5J8F A;  4JXR A;  2VEZ A;  3D2P A;  1S60 A;  2BSW A;  3IWE A;  2KCW A;  4YFJ A;  1S3Z A;  3ZJ0 A;  4XPL A;  2Z3N A;  2X7B A;  1N71 A;  2R98 A;  4ZBG A;  4FD4 A;  2GAN A;  4UWI A;  3PZJ A;  4H89 A;  2AJ6 A;  3DSB A;  1BOB A;  1GHE A;  2ZW6 A;  5F48 A;  4R3L A;  2FIA A;  2B4D B;  4Y49 C;  2NMT A;  2PC1 A;  4MFQ A;  4B5P A;  4AG9 A;  5DWN A;  2Z3K A;  3FRM A;  1M44 A;  2Z3L A;  4CRZ B;  4AVA A;  3P2H A;  1FY7 A;  2VQY A;  4PK2 A;  1XE4 A;  3CXS A;  3S6G A;  2Z3M A;  1S7N A;  2JDD A;  1KUV A;  3IU1 A;  2QIR A;  4JLY A;  2G0B A;  1M4D A;  2D4P A;  3EXN A;  1Y9K A;  3RYO A;  4F6A A;  1J4J A;  2REE A;  4KLW A;  3FYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...