1GHEA

Crystal structure of tabtoxin resistance protein complexed with an acyl coenzyme a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
170
structure length
170
Chain Sequence
AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE
publication title Crystal Structure of Tabtoxin Resistance Protein Complexed with Acetyl Coenzyme A Reveals the Mechanism for beta-Lactam Acetylation
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
total genus 49
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1gheA00
4R9MA 3TOAA 4JD6A 1QSTA 1LRZA 1MK4A 2O28A 2FXFA 1B6BA 5C82A 2P0WA 3BLNA 2JDCA 4I49A 2HV2A 3F0AA 4F6AA 1QSOA 3R95A 1XE4A 4X5KA 2REEA 4E8OA 1Z4EA 1P0HA 4QC6A 3ZZIA 2JLMA 4KZTA 2Z11A 2ZPAA 4XPDC 4KUBA 4FD5A 4JXQA 1YGHA 3P2FA 5I0CA 3FB3A 3JUWA 4RS2A 2ZXVA 2CY2A 2R7HA 3W6XA 4NXYA 4JJXA 4M3SA 4HNXB 2B4DA 3F5BA 2OB0A 3CXPA 1CJWA 2P6GA 2Y0MA 3SHPA 4AVAA 4L89A 2JDDA 4KLWA 3EY5A 1B87A 4BMHA 1Y9WA 4XPDB 5EC4A 4OADA 1S3ZA 2PRBA 3TT2A 2R98A 1KUVA 2B4BA 2GIVA 4KORA 3PZJA 2JEVA 4YRHA 4UWJA 4KVXA 2QIRA 3DNSA 3GYAA 1Q2YA 1WWZA 2EVNA 1YVKA 2B3VA 3TCVA 2P6FA 3TTHA 2Q4VA 1YVOA 4MBUA 4CS0B 2FIWA 3EFAA 2R1IA 1GHEA 3EO4A 1ON0A 4XPKA 3K9UA 3C26A 3TE4A 3JVNA 1P4NA 4RI1A 4F0YA 4B5OA 3GKRA 2PC1A 2REFA 3KKWA 1U6MA 2NMTA 3H4QA 5J8CA 2C27A 5EBVA 2FS5A 2OH1A 3DR6A 4H89A 1RXTA 4CAWA 5KTDA 1XF8A 5J8FA 2OZHA 3PGPA 4CAXA 4M85A 2I00A 2RC4A 4KOTA 2ZW6A 3FBUA 1YX0A 3D3SA 3R96A 5C88A 1MJ9A 3DSBA 4AVBA 4PK3A 4FD7A 4PV6A 3PP9A 3GY9A 1IICA 4XNHB 4E0AA 2ZW5A 1MJAA 5F49A 5E96A 2BUEA 2IL4A 3D2PA 4NSQA 5FVJA 1YK3A 1KZFA 4AG7A 1PU9A 1IB1E 2CNTA 4NCZA 3BJ8A 3R1KA 5KTAA 3MGDA 3IWGA 3D8PA 4II9A 1XMTA 3S6HA 3EC4A 2FE7A 2BL1A 1PUAA 3TO9A 4LX9A 3IGRA 2ZW4A 2VZYA 3TFYA 2DXQA 4UA3A 3T9YA 3WR7A 2F5IA 3FXTA 1CM0A 3V8IA 2H5MA 4QB9A 1S7KA 4HNWB 5HMNA 3VWEA 2J8MA 4R3LA 2D4OA 4U5YA 2ARHA 1Y9KA 3TOBA 4R57A 3VWDA 4AVCA 4KVME 2BEIA 2I79A 4QUSA 1I21A 2VQYA 3W6SA 5JQ4A 4U9ZA 4JWPA 4CRZB 3G8WA 4YFJA 2FL4A 5CNPA 1QSNA 3CXQA 3S6FA 4KLVA 1N71A 4NEXA 4KVOE 4KOSA 2J8NA 2K5TA 3G3SA 4J3GA 2G3TA 4FD4A 5F47A 1OZPA 4UBRA 3FRMA 1S5KA 2FCKA 2HUZA 1KUYA 3BJ7A 4PSWA 3DDDA 2QECA 4YGOA 1NMTA 5H86A 5F46A 1I1DA 3W91A 4KOVA 2EUIA 1TIQA 4KUAA 3FYNA 1S7LA 5H84A 2VZZA 4E2AA 4AB7A 4U9YA 1S7NA 2OZGA 1I12A 2Q44A 4XPLA 4CAVA 4EVYA 1YREA 3EXNA 1XIXA 2PR1A 3FNCA 2A4NA 3TO7A 2ZW7A 1M44A 3LODA 3D2MA 4MI4A 5HH1A 1Q2CA 1YLEA 3NE7A 4Y49C 3QAHA 1FY7A 2ATRA 4NF1A 2AJ6A 2J8RA 3B8GA 1SQHA 2B5GB 1UFHA 1M4DA 5KTCA 1J4JA 2KCWA 3QB8A 4MJ8A 1MJBA 4MHDA 4ORFA 1M4GA 5ISVA 3R9EA 2G0BA 2PDOA 2OZUA 1S60A 4Y49B 3R9GA 1V0CA 4LUAA 1BOBA 1IYKA 1XEBA 2VXKA 3DR8A 2Q0YA 4R87A 1Z9UA 4QVTA 4K30A 2CNMA 4JLYA 4KOWA 4H6ZA 4PK2A 3SXOA 4QBJA 1NSLA 2Q04A 2WPXA 5JPHA 2HQYA 2VBQA 2G3AA 3F8KA 4H6UA 2QMLA 3OWCA 1VHSA 4L8AA 3E0KA 1QSMA 5IB0A 1M4IA 2Q7BA 4B5PA 4KOUA 2GANA 4DNCA 3T90A 3I3GA 3CXSA 3ZJ0A 4GS4A 3S6GA 2BSWA 1R57A 2B4DB 4UWIA 1K4JA 2PQ8A 5IV0A 1VKCA 2Z10A 2GE3A 2VI7A 1S7FA 2P6EA 4B5PB 4FD6A 1BO4A 3P2HA 4MY0A 3UY5A 4HKFA 3SXNA 2CNSA 4CRYB 1IYLA 4KOYA 4AG9A 4OLLA 4MY3A 3N7ZA 5IX3A 2PSWA 4IF5A 1Y7RA 1RO5A 4IUSA 3S6KA 2OU2A 1L0CA 5DWNA 2FSRA 3TO6A 4ONUA 2AE6A 1YR0A 4PSXA 2Q4YA 1Z4RA 2Z0ZA 5GCNA 2FT0A 4KOXA 4HNYB 5DWMA 3LD2A 2PR8A 5F48A 1KUXA 1Q2DA 3FIXA 2X7BA 2B3UA 1WK4A 2D4PA 3R9FA 2WPWA 4ZBGA 3RYOA 2B5GA 1IIDA 2R8VA 4R3KA 4XNHC 3I9SA 2VEZA 2FIAA 4JXRA 2B58A 4OAEA 1M1DA 1NE9A 1QSRA
chains in the Genus database with same CATH superfamily
4FWUA 4R9MA 3TOAA 3RZAA 6CPAA 5JH9A 4C2YA 4JD6A 1QSTA 1LRZA 1MK4A 2O28A 2FXFA 2YNCC 3IC1A 3SI1A 2PJ7A 4CGNA 1B6BA 5C82A 2P0WA 3BLNA 3D67A 2JDCA 3IJ3A 4I49A 5G1ZA 3NE8A 4M6IA 2HV2A 2PJCA 1JWQA 3F0AA 1QSOA 3JTKA 3LWUA 1M4LA 4F6AA 3R95A 1ZG7A 1XE4A 4X5KA 3KR4A 2REEA 2EWBA 4E8OA 2ZEFA 2V77A 1Z4EA 1P0HA 4QC6A 3ZZIA 1X10A 1CG2A 2JLMA 4KZTA 4FUUA 2Z11A 2POKA 3FMCA 2CXAA 2ZPAA 2ZEMA 4C2ZA 4MHZA 4XPDC 4KUBA 5A27A 4FD5A 2ZELA 4JXQA 2AFWA 1YGHA 3P2FA 2ZEEA 1YMEA 5I0CA 2YNDA 3FB3A 3JUWA 4OP4A 2ZXVA 4RS2A 2CY2A 2R7HA 3NA6A 3B3TA 3W6XA 3DGVA 4NXYA 3IU1A 4JJXA 4M3SA 3RAMA 3FJUA 4CGOA 3FH4A 4HNXB 4PXCA 2B4DA 3F5BA 1IU8A 4Q36A 5LYDA 2OB0A 4NGMA 1VGYA 3CXPA 1CJWA 1Z8LA 2P6GA 2XEGA 2DPSA 1ARLA 2Y0MA 3SHPA 2Z3MA 4AVAA 4JZ0A 5G21A 4L89A 2HC9A 2JDDA 4P6YA 4KLWA 3EY5A 1BPNA 3V7ZA 4HPSA 1JQGA 2PRQA 3KQZA 2Q7SA 1B87A 4GXHA 2RFHA 3SJEA 4MCRA 4BMHA 1Y9WA 4XPDB 1PCAA 5EC4A 4YWYA 1HDQA 1CPXA 2PJ5A 2C6CA 3L2NA 4OADA 1S3ZA 2PRBA 1BLLE 4P4EA 2C6PA 3TT2A 2CIJA 1TKFA 2R98A 1KUVA 3VATA 2B4BA 2CTBA 4A31A 3PBEA 2GIVA 4KORA 3PZJA 4P4JA 5D29A 2JEVA 4YRHA 4UWJA 5HVHA 2PJ3A 4KVXA 2QIRA 1ZG8A 3DNSA 3GYAA 1Q2YA 1WWZA 2EVNA 4NFRA 1YVKA 3HUVA 4LQ6A 1Y0YA 2B3VA 2V8DA 3PFEA 3TCVA 2P6FA 3NFZA 5CBMA 5LYFA 3TTHA 2Q4VA 1YVOA 4CGPA 3NH5A 4MBUA 4CS0B 1ZLIA 2XEJA 2V8GA 2FIWA 4O23A 4B14A 2BCOA 3EFAA 2R1IA 2Z3LA 1GHEA 3FEDA 4M6GA 3EO4A 3GUXA 1ON0A 4F0XA 4XPKA 3K9UA 2ZEOA 2AFSA 3D68A 2PIYA 2Q4ZA 4CYQA 2PJ1A 2Z3KA 3C26A 3IWEA 1P4NA 3JVNA 4OMEA 4P45A 4OC5A 4RI1A 4TWEA 4B5OA 2BOAA 4F0YA 4C68A 3KHXA 3D7GA 2DPTA 2PC1A 3GKRA 5LRJA 1LANA 3WC5A 2REFA 4CAEA 2NYQA 3B3WA 3KKWA 4A95A 1YSJA 5K8OA 3I1UA 1U6MA 4ZY1A 1TF8A 1YLOA 2IMOA 2NMTA 1X12A 2Z3PA 2C27A 3H4QA 4RUHA 4R6TA 5HVGA 5J8CA 5EBVA 4F8ZA 2FS5A 2OH1A 2Q51A 3DR6A 4H89A 2HB6A 8CPAA 1RXTA 4CAWA 5KTDA 2CTCA 1KWMA 1OBRA 1XF8A 5J8FA 2OZHA 2NSMA 3PGPA 4OKOA 1F2OA 2VL1A 4CAXA 4M85A 2I00A 1CPSA 1PYTB 2RC4A 5F09A 4KOTA 2ZW6A 1GYTA 1LAPA 5LYLA 4UEEA 1UWYA 3FBUA 2Z3NA 3B3CA 3RO0A 3PB8X 4W9YA 1YX0A 3D3SA 3R96A 3A9LA 1LCPA 5C88A 4UCNA 1MJ9A 2GFQA 4M6HA 3DSBA 4AVBA 3KHZA 3WABA 5LRKA 4PK3A 1VHOA 2WSAA 2V8VA 4FD7A 5HXDA 4PXBA 4PV6A 3PP9A 3GY9A 1IICA 3NH8A 4XNHB 4E0AA 3TE4A 4G1PA 2CF4A 2F8HA 4C7IA 2ZW5A 1MJAA 5AGEA 5F49A 4CAFA 5E96A 3SI2A 2EBJA 1FNOA 2BUEA 2IL4A 3D2PA 3LMSA 4NSQA 4P4FA 5AG7A 1YK3A 1KZFA 5AG5A 5FVJA 4AG7A 2GLFA 1AMPA 1PU9A 1IB1E 2CNTA 3BI0A 4NCZA 4P4DA 3BJ8A 5AG6A 3PEIA 1NSAA 3R1KA 4UFVA 3WT4A 3PB9X 5KTAA 2EO8A 4X8IA 3MGDA 3PB6X 3IWGA 3D8PA 4A94A 3KL9A 2PJ0A 1XMTA 2ZEHA 4MFKA 4DJLA 4II9A 3S6HA 4UF4A 1CBXA 1R43A 3EC4A 3B7IA 2FE7A 2BL1A 2PIZA 1PUAA 2QJ8A 4ZI6A 4KS9A 4LX9A 3IGRA 3JRUA 4P44A 4UFWA 3T8WA 3TO9A 5A28A 1Z5RA 2AFZA 3GB0A 2ZW4A 4WWVA 5ELYA 4DUKA 4NGSA 2VZYA 1XFOA 3TFYA 1ZG9A 4K3NA 4ZX9A 2DXQA 1XBUA 1CP6A 2XEIA 4NJQA 4UA3A 3T9YA 3WC7A 3WR7A 4BD9A 2F5IA 2PJ4A 3N5FA 3FXTA 4LQGA 2C1CA 1CM0A 1HEEA 2QVPA 4MFQA 3V8IA 2PJ9A 2H5MA 4QB9A 4BBHA 1S7KA 4F9UA 4HNWB 2PCUA 3NH4A 3TX8A 5HMNA 1TF9A 3H8EA 4UEFA 2JBKA 3QAYA 3IU2A 3VWEA 2J8MA 4R3LA 2D4OA 2FVGA 2ARHA 1Y9KA 4PPZA 1XMBA 4R57A 4U5YA 4YU9A 4OC0A 4B12A 4CYPA 4AVCA 3FEEA 4KVME 1A2ZA 2BEIA 2I79A 4OAEA 4QUSA 3MRUA 1I21A 2VQYA 3B35A 4MFZA 2IQ6A 4NJRA 3W6SA 5JQ4A 2PE3A 4U9ZA 3SJXA 5I4MA 4JWPA 4CRZB 3G8WA 4B11A 4C2XA 2DF5A 4YFJA 2FL4A 1YW4A 2QYVA 4H2KA 3IIBA 3IWWA 2V8HA 5CNPA 1QSNA 3CXQA 4IHMA 4UFXA 3S6FA 1DE4C 1IOIA 4KLVA 1N71A 3B2YA 1Y7EA 3D7HA 4NEXA 4EFDA 1ELMP 4KVOE 4KOSA 4A32A 2Z3OA 3FECA 2J8NA 3D4UA 2ODFA 3S9NA 2K5TA 4A39A 3D66A 4F9VA 2GU2A 1LAMA 2EK8A 2OR4A 2G3TA 3G3SA 4FD4A 4J3GA 5K8PA 5F47A 5JGFA 1OZPA 4UBRA 4KSIA 3FRMA 3V38A 4CPAA 1S5KA 2FCKA 2HUZA 1KUYA 3BJ7A 4PSWA 2JEWA 3DDDA 2QECA 4ZGYB 4YGOA 1NMTA 4ZY0A 1F57A 1HDUA 3MN8A 1F2PA 4OC3A 4OC1A 5H86A 4TNUA 1I1DA 4A37A 5F46A 4MMOA 2ZOFA 3W91A 4KOVA 2EUIA 1TIQA 4MCQA 4KUAA 3FYNA 1QMUA 1S7LA 4OC2A 5H84A 2AFMA 1Z8WA 2VZZA 4E2AA 4AB7A 4U9YA 3RNZA 3S9MA 1S7NA 2XEFA 2OZGA 3KI9A 1I12A 1Q7LA 2Q44A 2PVWA 2PVVA 3H5ZA 4PXDA 5LRGA 5G22A 2RB7A 3KR5A 1AYEA 3KASA 4XPLA 4CAVA 4P4IA 4IAVA 1Z8XA 1IGBA 4EVYA 4MFJA 3HLPA 1CX8A 1YREA 1AUGA 3EXNA 2PJ8A 5HVFA 1XIXA 2PJBA 3FX6A 2PR1A 3FNCA 1RTQA 2AFXA 2A4NA 4CGMA 3TO7A 4FBEA 2ZW7A 1M44A 4DYOA 1BAVA 2ZENA 4R8FA 3LODA 1R3NA 2AFOA 4IK2A 3D2MA 1XRYA 3KGQA 4MI4A 2YGWA 1Q2CA 1YLEA 4PXEA 5HH1A 4P4BA 3NE7A 3IO1A 2YNCA 4KSAA 4Y49C 3TOBA 3QAHA 4FAIA 1FY7A 2ATRA 7CPAA 4NF1A 4UIBA 1YQEA 4MFPA 2AJ6A 3VARA 2J9AA 3PBBA 2J8RA 3B8GA 4OC4A 3PB4X 3D7FA 1SQHA 4NGPA 2B5GB 4UCMA 1UFHA 1M4DA 5KTCA 1J4JA 2JBJA 3VWDA 4B6ZA 2KCWA 3QB8A 4MJ8A 5CPAA 1MJBA 4X3RA 3IEHA 4MHDA 4ORFA 1M4GA 5ISVA 3CPAA 3R9EA 1CP7A 2BO9A 3BHXA 3B3SA 4EMEA 2DEAA 2G0BA 2G9DA 3PFOA 2PDOA 4MHYA 4MXUA 2ZOGA 1ZO0A 2OZUA 4BINA 2WZNA 3PRTA 3BI1A 3ISZA 1S60A 4Y49B 3R9GA 5AG4A 5JM6A 4ONWA 1V0CA 4LUAA 1H8LA 4ZYQA 1ARMA 5LYIA 1BOBA 1IYKA 1XEBA 2VXKA 3FVLA 3GIUA 3DR8A 1LOKA 5EMIA 2Q0YA 2IJZA 4CGLA 4R87A 1Z9UA 2C6GA 4QVTA 4K30A 2CNMA 4JLYA 1IY7A 4H6ZA 3K2KA 4KOWA 4PK2A 3SXOA 4X2TA 4QBJA 2GLJA 1VIXA 1NSLA 1IOFA 2Q04A 3TC8A 2WPXA 5JPHA 2HQYA 2I3CA 4UCPA 2VBQA 3CPXA 2G3AA 4B10A 3F8KA 4H6UA 2O4HA 2QMLA 4MRIA 3SI0A 1VHEA 5K8MA 3K9TA 1Y0RA 1Z2LA 3OWCA 1VHSA 4L8AA 3E0KA 1QSMA 5IB0A 3KZWA 2OOTA 1M4IA 3S9LA 1BPMA 4Q38A 4UIAA 2Q7BA 4OIDA 4B5PA 4KOUA 2GANA 4DNCA 5D8NA 4ZX8A 5BWAB 3T90A 3I3GA 3CXSA 3ZJ0A 4A2ZA 4C7HA 4GS4A 3S6GA 2BSWA 2ZEDA 5DS0A 1R57A 2B4DB 3GLJA 4UWIA 1K4JA 2PQ8A 5THWA 5IB9A 5IV0A 4A30A 4CYNA 1VKCA 3SJGA 4B13A 2Z10A 2GE3A 1XJOA 3H8FA 3RBUA 2VI7A 4A38A 1S7FA 2Q43A 3SJFA 2AFUA 2P6EA 2WYRA 3KQXA 3QNVA 4B5PB 4FD6A 1BO4A 3P2HA 4P10A 3FF3A 2PJAA 3BXMA 2WUUA 4MY0A 3UY5A 4HKFA 4ZY2A 4CYOA 4NGTA 3SXNA 4RN7A 2CNSA 4CRYB 4MCPA 1IYLA 4KOYA 4PQAA 4AG9A 4OLLA 3CT9A 3CZXA 3N7ZA 4MY3A 4OIWA 3ISXA 4Q7AA 5IX3A 2PSWA 2ZEPA 4IF5A 1Y7RA 1RO5A 4IUSA 3S6KA 2OU2A 2PJ2A 1TKHA 1L0CA 5DWNA 2FSRA 3LACA 4R76A 3TO6A 4ONUA 4MCSA 2ZEGA 2AE6A 2GREA 1YR0A 4PSXA 3H8GA 2O53A 3CDXA 2Q4YA 4MHPA 1Z4RA 2Z0ZA 4Z65A 4MHNA 4NGQA 1EE3P 5GCNA 2FT0A 4KOXA 4HNYB 4JYWA 5DWMA 3LD2A 1QQ9A 4KSFA 3D7DA 3IFEA 2PR8A 5F48A 1KUXA 4EWTA 1Q2DA 1FT7A 1DTDA 3FIXA 2X7BA 2YNEA 4A33A 1ZLHA 1WK4A 2B3UA 4UEZA 3DLJA 2D4PA 3R9FA 3WC6A 4NGNA 4MFLA 2WPWA 4ZBGA 3RYOA 2B5GA 1TXRA 1IIDA 2R8VA 2ABZA 3PB7X 4WJBA 4R3KA 4XNHC 1TKJA 5K8NA 3I9SA 4AXVA 1ELLP 3B3VA 4R7MA 5G20A 2PJ6A 1Z8TA 5J1QA 2F7VA 2FIAA 2VEZA 1YW6A 4JXRA 4GM5A 2B58A 1LFWA 1XOVA 4NGRA 2ANPA 2EK9A 3VH9A 1M1DA 1NE9A 1QSRA
chains in the Genus database with same CATH topology
4R9MA 3TOAA 4C2YA 4JD6A 1QSTA 1LRZA 1MK4A 2O28A 2FXFA 2YNCC 4CGNA 1B6BA 5C82A 2P0WA 3BLNA 2JDCA 4I49A 5G1ZA 2HV2A 3F0AA 4F6AA 1QSOA 3JTKA 3R95A 1XE4A 4X5KA 2REEA 4E8OA 1Z4EA 1P0HA 4QC6A 3ZZIA 2JLMA 4KZTA 2Z11A 2CXAA 2ZPAA 4C2ZA 4XPDC 4KUBA 5A27A 4FD5A 4JXQA 1YGHA 3P2FA 5I0CA 2YNDA 3FB3A 3JUWA 4RS2A 2ZXVA 2CY2A 2R7HA 3W6XA 4NXYA 3IU1A 4JJXA 4M3SA 4CGOA 4HNXB 2B4DA 3F5BA 4Q36A 2OB0A 3CXPA 1CJWA 2P6GA 2DPSA 2Y0MA 3SHPA 2Z3MA 4AVAA 5G21A 4L89A 2JDDA 4KLWA 3EY5A 1B87A 4BMHA 1Y9WA 4XPDB 5EC4A 4OADA 1S3ZA 2PRBA 3TT2A 2R98A 1KUVA 2B4BA 4A31A 2GIVA 4KORA 3PZJA 2JEVA 4YRHA 4UWJA 4KVXA 2QIRA 3DNSA 3GYAA 1Q2YA 1WWZA 2EVNA 1YVKA 2B3VA 3TCVA 2P6FA 3TTHA 2Q4VA 1YVOA 4CGPA 4MBUA 4CS0B 2FIWA 4B14A 3EFAA 2R1IA 2Z3LA 1GHEA 3EO4A 1ON0A 4F0XA 4XPKA 3K9UA 4CYQA 2Z3KA 3C26A 3IWEA 3JVNA 1P4NA 4RI1A 4F0YA 3TE4A 4B5OA 4C68A 3GKRA 2DPTA 2PC1A 4CAEA 2REFA 4A95A 3KKWA 1U6MA 2NMTA 3H4QA 2Z3PA 2C27A 5J8CA 5EBVA 2FS5A 2OH1A 3DR6A 4H89A 1RXTA 4CAWA 5KTDA 1XF8A 5J8FA 2OZHA 3PGPA 4CAXA 4M85A 2I00A 2RC4A 4KOTA 2ZW6A 3FBUA 2Z3NA 1YX0A 3D3SA 3R96A 3A9LA 5C88A 4UCNA 1MJ9A 3DSBA 4AVBA 4PK3A 2WSAA 4FD7A 4PV6A 3PP9A 3GY9A 1IICA 4XNHB 4E0AA 4C7IA 2ZW5A 1MJAA 5AGEA 5F49A 4CAFA 5E96A 2BUEA 2IL4A 3D2PA 4NSQA 5AG5A 5FVJA 1YK3A 1KZFA 4AG7A 1PU9A 1IB1E 2CNTA 4NCZA 3BJ8A 5AG6A 3R1KA 4UFVA 5KTAA 3MGDA 3IWGA 3D8PA 4II9A 4MFKA 1XMTA 3S6HA 3EC4A 2FE7A 2BL1A 1PUAA 4KS9A 4LX9A 3IGRA 4UFWA 3TO9A 5A28A 2ZW4A 2VZYA 3TFYA 2DXQA 4UA3A 3T9YA 3WR7A 2F5IA 3FXTA 1CM0A 4MFQA 3V8IA 2H5MA 4QB9A 4BBHA 1S7KA 4HNWB 5HMNA 3IU2A 3VWEA 2J8MA 4R3LA 2D4OA 4U5YA 2ARHA 1Y9KA 3TOBA 4R57A 3VWDA 4CYPA 4B12A 4AVCA 4KVME 2BEIA 2I79A 4QUSA 1I21A 2VQYA 4MFZA 3W6SA 5JQ4A 4U9ZA 4JWPA 4CRZB 3G8WA 4B11A 4C2XA 4YFJA 2FL4A 5CNPA 1QSNA 3CXQA 3S6FA 4UFXA 4KLVA 1N71A 4NEXA 4KVOE 4KOSA 4A32A 2Z3OA 2J8NA 2K5TA 3G3SA 4J3GA 2G3TA 4FD4A 5F47A 1OZPA 4UBRA 3FRMA 1S5KA 2FCKA 2HUZA 1KUYA 3BJ7A 4PSWA 3DDDA 2QECA 4ZGYB 4YGOA 1NMTA 5H86A 5F46A 1I1DA 3W91A 4KOVA 2EUIA 1TIQA 4KUAA 3FYNA 1S7LA 5H84A 2VZZA 4E2AA 4AB7A 4U9YA 4A2ZA 1S7NA 2OZGA 1I12A 2Q44A 3H5ZA 5G22A 4XPLA 4CAVA 4EVYA 4MFJA 1YREA 3EXNA 1XIXA 2PR1A 3FNCA 2A4NA 4CGMA 3TO7A 2ZW7A 1M44A 3LODA 3D2MA 4MI4A 2YGWA 1Q2CA 1YLEA 5HH1A 3NE7A 2YNCA 4KSAA 4Y49C 3QAHA 1FY7A 2ATRA 4NF1A 4MFPA 2AJ6A 2J8RA 3B8GA 1SQHA 2B5GB 4UCMA 1UFHA 1M4DA 5KTCA 1J4JA 2KCWA 3QB8A 4MJ8A 1MJBA 4MHDA 4ORFA 1M4GA 5ISVA 3R9EA 2G0BA 2PDOA 1ZO0A 2OZUA 1S60A 4Y49B 3R9GA 5AG4A 1V0CA 4LUAA 1BOBA 1IYKA 1XEBA 2VXKA 3DR8A 2Q0YA 4CGLA 4R87A 1Z9UA 4QVTA 4K30A 2CNMA 4JLYA 4KOWA 4H6ZA 4PK2A 3SXOA 4QBJA 1NSLA 2Q04A 2WPXA 5JPHA 2HQYA 4UCPA 2VBQA 2G3AA 4B10A 3F8KA 4H6UA 2QMLA 3OWCA 1VHSA 4L8AA 3E0KA 1QSMA 5IB0A 1M4IA 4Q38A 2Q7BA 4B5PA 4KOUA 2GANA 4DNCA 5BWAB 3T90A 3I3GA 3CXSA 3ZJ0A 4C7HA 4GS4A 3S6GA 2BSWA 1R57A 2B4DB 4UWIA 1K4JA 2PQ8A 5IV0A 4A30A 4CYNA 1VKCA 4B13A 2Z10A 2GE3A 2VI7A 1S7FA 2P6EA 4B5PB 4FD6A 1BO4A 3P2HA 2WUUA 4MY0A 3UY5A 4HKFA 4CYOA 3SXNA 2CNSA 4CRYB 1IYLA 4KOYA 4AG9A 4OLLA 4MY3A 3N7ZA 5IX3A 2PSWA 4IF5A 1Y7RA 1RO5A 4IUSA 3S6KA 2OU2A 1L0CA 5DWNA 2FSRA 3TO6A 4ONUA 2AE6A 1YR0A 4PSXA 2Q4YA 1Z4RA 2Z0ZA 5GCNA 2FT0A 4KOXA 4HNYB 5DWMA 3LD2A 4KSFA 2PR8A 5F48A 1KUXA 1Q2DA 3FIXA 2X7BA 2YNEA 4A33A 2B3UA 1WK4A 2D4PA 3R9FA 4MFLA 2WPWA 4ZBGA 3RYOA 2B5GA 1IIDA 2R8VA 4R3KA 4XNHC 3I9SA 5G20A 2VEZA 2FIAA 4JXRA 2B58A 5AG7A 4OAEA 1M1DA 1NE9A 1QSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9M A;  3TOA A;  4JD6 A;  1QST A;  1LRZ A;  1MK4 A;  2O28 A;  2FXF A;  1B6B A;  5C82 A;  2P0W A;  3BLN A;  2JDC A;  4I49 A;  2HV2 A;  3F0A A;  4F6A A;  1QSO A;  3R95 A;  1XE4 A;  4X5K A;  2REE A;  4E8O A;  1Z4E A;  1P0H A;  4QC6 A;  3ZZI A;  2JLM A;  4KZT A;  2Z11 A;  2ZPA A;  4XPD C;  4KUB A;  4FD5 A;  4JXQ A;  1YGH A;  3P2F A;  5I0C A;  3FB3 A;  3JUW A;  4RS2 A;  2ZXV A;  2CY2 A;  2R7H A;  3W6X A;  4NXY A;  4JJX A;  4M3S A;  4HNX B;  2B4D A;  3F5B A;  2OB0 A;  3CXP A;  1CJW A;  2P6G A;  2Y0M A;  3SHP A;  4AVA A;  4L89 A;  2JDD A;  4KLW A;  3EY5 A;  1B87 A;  4BMH A;  1Y9W A;  4XPD B;  5EC4 A;  4OAD A;  1S3Z A;  2PRB A;  3TT2 A;  2R98 A;  1KUV A;  2B4B A;  2GIV A;  4KOR A;  3PZJ A;  2JEV A;  4YRH A;  4UWJ A;  4KVX A;  2QIR A;  3DNS A;  3GYA A;  1Q2Y A;  1WWZ A;  2EVN A;  1YVK A;  2B3V A;  3TCV A;  2P6F A;  3TTH A;  2Q4V A;  1YVO A;  4MBU A;  4CS0 B;  2FIW A;  3EFA A;  2R1I A;  1GHE A;  3EO4 A;  1ON0 A;  4XPK A;  3K9U A;  3C26 A;  3TE4 A;  3JVN A;  1P4N A;  4RI1 A;  4F0Y A;  4B5O A;  3GKR A;  2PC1 A;  2REF A;  3KKW A;  1U6M A;  2NMT A;  3H4Q A;  5J8C A;  2C27 A;  5EBV A;  2FS5 A;  2OH1 A;  3DR6 A;  4H89 A;  1RXT A;  4CAW A;  5KTD A;  1XF8 A;  5J8F A;  2OZH A;  3PGP A;  4CAX A;  4M85 A;  2I00 A;  2RC4 A;  4KOT A;  2ZW6 A;  3FBU A;  1YX0 A;  3D3S A;  3R96 A;  5C88 A;  1MJ9 A;  3DSB A;  4AVB A;  4PK3 A;  4FD7 A;  4PV6 A;  3PP9 A;  3GY9 A;  1IIC A;  4XNH B;  4E0A A;  2ZW5 A;  1MJA A;  5F49 A;  5E96 A;  2BUE A;  2IL4 A;  3D2P A;  4NSQ A;  5FVJ A;  1YK3 A;  1KZF A;  4AG7 A;  1PU9 A;  1IB1 E;  2CNT A;  4NCZ A;  3BJ8 A;  3R1K A;  5KTA A;  3MGD A;  3IWG A;  3D8P A;  4II9 A;  1XMT A;  3S6H A;  3EC4 A;  2FE7 A;  2BL1 A;  1PUA A;  3TO9 A;  4LX9 A;  3IGR A;  2ZW4 A;  2VZY A;  3TFY A;  2DXQ A;  4UA3 A;  3T9Y A;  3WR7 A;  2F5I A;  3FXT A;  1CM0 A;  3V8I A;  2H5M A;  4QB9 A;  1S7K A;  4HNW B;  5HMN A;  3VWE A;  2J8M A;  4R3L A;  2D4O A;  4U5Y A;  2ARH A;  1Y9K A;  3TOB A;  4R57 A;  3VWD A;  4AVC A;  4KVM E;  2BEI A;  2I79 A;  4QUS A;  1I21 A;  2VQY A;  3W6S A;  5JQ4 A;  4U9Z A;  4JWP A;  4CRZ B;  3G8W A;  4YFJ A;  2FL4 A;  5CNP A;  1QSN A;  3CXQ A;  3S6F A;  4KLV A;  1N71 A;  4NEX A;  4KVO E;  4KOS A;  2J8N A;  2K5T A;  3G3S A;  4J3G A;  2G3T A;  4FD4 A;  5F47 A;  1OZP A;  4UBR A;  3FRM A;  1S5K A;  2FCK A;  2HUZ A;  1KUY A;  3BJ7 A;  4PSW A;  3DDD A;  2QEC A;  4YGO A;  1NMT A;  5H86 A;  5F46 A;  1I1D A;  3W91 A;  4KOV A;  2EUI A;  1TIQ A;  4KUA A;  3FYN A;  1S7L A;  5H84 A;  2VZZ A;  4E2A A;  4AB7 A;  4U9Y A;  1S7N A;  2OZG A;  1I12 A;  2Q44 A;  4XPL A;  4CAV A;  4EVY A;  1YRE A;  3EXN A;  1XIX A;  2PR1 A;  3FNC A;  2A4N A;  3TO7 A;  2ZW7 A;  1M44 A;  3LOD A;  3D2M A;  4MI4 A;  5HH1 A;  1Q2C A;  1YLE A;  3NE7 A;  4Y49 C;  3QAH A;  1FY7 A;  2ATR A;  4NF1 A;  2AJ6 A;  2J8R A;  3B8G A;  1SQH A;  2B5G B;  1UFH A;  1M4D A;  5KTC A;  1J4J A;  2KCW A;  3QB8 A;  4MJ8 A;  1MJB A;  4MHD A;  4ORF A;  1M4G A;  5ISV A;  3R9E A;  2G0B A;  2PDO A;  2OZU A;  1S60 A;  4Y49 B;  3R9G A;  1V0C A;  4LUA A;  1BOB A;  1IYK A;  1XEB A;  2VXK A;  3DR8 A;  2Q0Y A;  4R87 A;  1Z9U A;  4QVT A;  4K30 A;  2CNM A;  4JLY A;  4KOW A;  4H6Z A;  4PK2 A;  3SXO A;  4QBJ A;  1NSL A;  2Q04 A;  2WPX A;  5JPH A;  2HQY A;  2VBQ A;  2G3A A;  3F8K A;  4H6U A;  2QML A;  3OWC A;  1VHS A;  4L8A A;  3E0K A;  1QSM A;  5IB0 A;  1M4I A;  2Q7B A;  4B5P A;  4KOU A;  2GAN A;  4DNC A;  3T90 A;  3I3G A;  3CXS A;  3ZJ0 A;  4GS4 A;  3S6G A;  2BSW A;  1R57 A;  2B4D B;  4UWI A;  1K4J A;  2PQ8 A;  5IV0 A;  1VKC A;  2Z10 A;  2GE3 A;  2VI7 A;  1S7F A;  2P6E A;  4B5P B;  4FD6 A;  1BO4 A;  3P2H A;  4MY0 A;  3UY5 A;  4HKF A;  3SXN A;  2CNS A;  4CRY B;  1IYL A;  4KOY A;  4AG9 A;  4OLL A;  4MY3 A;  3N7Z A;  5IX3 A;  2PSW A;  4IF5 A;  1Y7R A;  1RO5 A;  4IUS A;  3S6K A;  2OU2 A;  1L0C A;  5DWN A;  2FSR A;  3TO6 A;  4ONU A;  2AE6 A;  1YR0 A;  4PSX A;  2Q4Y A;  1Z4R A;  2Z0Z A;  5GCN A;  2FT0 A;  4KOX A;  4HNY B;  5DWM A;  3LD2 A;  2PR8 A;  5F48 A;  1KUX A;  1Q2D A;  3FIX A;  2X7B A;  2B3U A;  1WK4 A;  2D4P A;  3R9F A;  2WPW A;  4ZBG A;  3RYO A;  2B5G A;  1IID A;  2R8V A;  4R3K A;  4XNH C;  3I9S A;  2VEZ A;  2FIA A;  4JXR A;  2B58 A;  4OAE A;  1M1D A;  1NE9 A;  1QSR A; 
#chains in the Genus database with same CATH topology
 4FWU A;  4R9M A;  3TOA A;  3RZA A;  6CPA A;  5JH9 A;  4C2Y A;  4JD6 A;  1QST A;  1LRZ A;  1MK4 A;  2O28 A;  2FXF A;  2YNC C;  3IC1 A;  3SI1 A;  2PJ7 A;  4CGN A;  1B6B A;  5C82 A;  2P0W A;  3BLN A;  3D67 A;  2JDC A;  3IJ3 A;  4I49 A;  5G1Z A;  3NE8 A;  4M6I A;  2HV2 A;  2PJC A;  1JWQ A;  3F0A A;  1QSO A;  3JTK A;  3LWU A;  1M4L A;  4F6A A;  3R95 A;  1ZG7 A;  1XE4 A;  4X5K A;  3KR4 A;  2REE A;  2EWB A;  4E8O A;  2ZEF A;  2V77 A;  1Z4E A;  1P0H A;  4QC6 A;  3ZZI A;  1X10 A;  1CG2 A;  2JLM A;  4KZT A;  4FUU A;  2Z11 A;  2POK A;  3FMC A;  2CXA A;  2ZPA A;  2ZEM A;  4C2Z A;  4MHZ A;  4XPD C;  4KUB A;  5A27 A;  4FD5 A;  2ZEL A;  4JXQ A;  2AFW A;  1YGH A;  3P2F A;  2ZEE A;  1YME A;  5I0C A;  2YND A;  3FB3 A;  3JUW A;  4OP4 A;  2ZXV A;  4RS2 A;  2CY2 A;  2R7H A;  3NA6 A;  3B3T A;  3W6X A;  3DGV A;  4NXY A;  3IU1 A;  4JJX A;  4M3S A;  3RAM A;  3FJU A;  4CGO A;  3FH4 A;  4HNX B;  4PXC A;  2B4D A;  3F5B A;  1IU8 A;  4Q36 A;  5LYD A;  2OB0 A;  4NGM A;  1VGY A;  3CXP A;  1CJW A;  1Z8L A;  2P6G A;  2XEG A;  2DPS A;  1ARL A;  2Y0M A;  3SHP A;  2Z3M A;  4AVA A;  4JZ0 A;  5G21 A;  4L89 A;  2HC9 A;  2JDD A;  4P6Y A;  4KLW A;  3EY5 A;  1BPN A;  3V7Z A;  4HPS A;  1JQG A;  2PRQ A;  3KQZ A;  2Q7S A;  1B87 A;  4GXH A;  2RFH A;  3SJE A;  4MCR A;  4BMH A;  1Y9W A;  4XPD B;  1PCA A;  5EC4 A;  4YWY A;  1HDQ A;  1CPX A;  2PJ5 A;  2C6C A;  3L2N A;  4OAD A;  1S3Z A;  2PRB A;  1BLL E;  4P4E A;  2C6P A;  3TT2 A;  2CIJ A;  1TKF A;  2R98 A;  1KUV A;  3VAT A;  2B4B A;  2CTB A;  4A31 A;  3PBE A;  2GIV A;  4KOR A;  3PZJ A;  4P4J A;  5D29 A;  2JEV A;  4YRH A;  4UWJ A;  5HVH A;  2PJ3 A;  4KVX A;  2QIR A;  1ZG8 A;  3DNS A;  3GYA A;  1Q2Y A;  1WWZ A;  2EVN A;  4NFR A;  1YVK A;  3HUV A;  4LQ6 A;  1Y0Y A;  2B3V A;  2V8D A;  3PFE A;  3TCV A;  2P6F A;  3NFZ A;  5CBM A;  5LYF A;  3TTH A;  2Q4V A;  1YVO A;  4CGP A;  3NH5 A;  4MBU A;  4CS0 B;  1ZLI A;  2XEJ A;  2V8G A;  2FIW A;  4O23 A;  4B14 A;  2BCO A;  3EFA A;  2R1I A;  2Z3L A;  1GHE A;  3FED A;  4M6G A;  3EO4 A;  3GUX A;  1ON0 A;  4F0X A;  4XPK A;  3K9U A;  2ZEO A;  2AFS A;  3D68 A;  2PIY A;  2Q4Z A;  4CYQ A;  2PJ1 A;  2Z3K A;  3C26 A;  3IWE A;  1P4N A;  3JVN A;  4OME A;  4P45 A;  4OC5 A;  4RI1 A;  4TWE A;  4B5O A;  2BOA A;  4F0Y A;  4C68 A;  3KHX A;  3D7G A;  2DPT A;  2PC1 A;  3GKR A;  5LRJ A;  1LAN A;  3WC5 A;  2REF A;  4CAE A;  2NYQ A;  3B3W A;  3KKW A;  4A95 A;  1YSJ A;  5K8O A;  3I1U A;  1U6M A;  4ZY1 A;  1TF8 A;  1YLO A;  2IMO A;  2NMT A;  1X12 A;  2Z3P A;  2C27 A;  3H4Q A;  4RUH A;  4R6T A;  5HVG A;  5J8C A;  5EBV A;  4F8Z A;  2FS5 A;  2OH1 A;  2Q51 A;  3DR6 A;  4H89 A;  2HB6 A;  8CPA A;  1RXT A;  4CAW A;  5KTD A;  2CTC A;  1KWM A;  1OBR A;  1XF8 A;  5J8F A;  2OZH A;  2NSM A;  3PGP A;  4OKO A;  1F2O A;  2VL1 A;  4CAX A;  4M85 A;  2I00 A;  1CPS A;  1PYT B;  2RC4 A;  5F09 A;  4KOT A;  2ZW6 A;  1GYT A;  1LAP A;  5LYL A;  4UEE A;  1UWY A;  3FBU A;  2Z3N A;  3B3C A;  3RO0 A;  3PB8 X;  4W9Y A;  1YX0 A;  3D3S A;  3R96 A;  3A9L A;  1LCP A;  5C88 A;  4UCN A;  1MJ9 A;  2GFQ A;  4M6H A;  3DSB A;  4AVB A;  3KHZ A;  3WAB A;  5LRK A;  4PK3 A;  1VHO A;  2WSA A;  2V8V A;  4FD7 A;  5HXD A;  4PXB A;  4PV6 A;  3PP9 A;  3GY9 A;  1IIC A;  3NH8 A;  4XNH B;  4E0A A;  3TE4 A;  4G1P A;  2CF4 A;  2F8H A;  4C7I A;  2ZW5 A;  1MJA A;  5AGE A;  5F49 A;  4CAF A;  5E96 A;  3SI2 A;  2EBJ A;  1FNO A;  2BUE A;  2IL4 A;  3D2P A;  3LMS A;  4NSQ A;  4P4F A;  5AG7 A;  1YK3 A;  1KZF A;  5AG5 A;  5FVJ A;  4AG7 A;  2GLF A;  1AMP A;  1PU9 A;  1IB1 E;  2CNT A;  3BI0 A;  4NCZ A;  4P4D A;  3BJ8 A;  5AG6 A;  3PEI A;  1NSA A;  3R1K A;  4UFV A;  3WT4 A;  3PB9 X;  5KTA A;  2EO8 A;  4X8I A;  3MGD A;  3PB6 X;  3IWG A;  3D8P A;  4A94 A;  3KL9 A;  2PJ0 A;  1XMT A;  2ZEH A;  4MFK A;  4DJL A;  4II9 A;  3S6H A;  4UF4 A;  1CBX A;  1R43 A;  3EC4 A;  3B7I A;  2FE7 A;  2BL1 A;  2PIZ A;  1PUA A;  2QJ8 A;  4ZI6 A;  4KS9 A;  4LX9 A;  3IGR A;  3JRU A;  4P44 A;  4UFW A;  3T8W A;  3TO9 A;  5A28 A;  1Z5R A;  2AFZ A;  3GB0 A;  2ZW4 A;  4WWV A;  5ELY A;  4DUK A;  4NGS A;  2VZY A;  1XFO A;  3TFY A;  1ZG9 A;  4K3N A;  4ZX9 A;  2DXQ A;  1XBU A;  1CP6 A;  2XEI A;  4NJQ A;  4UA3 A;  3T9Y A;  3WC7 A;  3WR7 A;  4BD9 A;  2F5I A;  2PJ4 A;  3N5F A;  3FXT A;  4LQG A;  2C1C A;  1CM0 A;  1HEE A;  2QVP A;  4MFQ A;  3V8I A;  2PJ9 A;  2H5M A;  4QB9 A;  4BBH A;  1S7K A;  4F9U A;  4HNW B;  2PCU A;  3NH4 A;  3TX8 A;  5HMN A;  1TF9 A;  3H8E A;  4UEF A;  2JBK A;  3QAY A;  3IU2 A;  3VWE A;  2J8M A;  4R3L A;  2D4O A;  2FVG A;  2ARH A;  1Y9K A;  4PPZ A;  1XMB A;  4R57 A;  4U5Y A;  4YU9 A;  4OC0 A;  4B12 A;  4CYP A;  4AVC A;  3FEE A;  4KVM E;  1A2Z A;  2BEI A;  2I79 A;  4OAE A;  4QUS A;  3MRU A;  1I21 A;  2VQY A;  3B35 A;  4MFZ A;  2IQ6 A;  4NJR A;  3W6S A;  5JQ4 A;  2PE3 A;  4U9Z A;  3SJX A;  5I4M A;  4JWP A;  4CRZ B;  3G8W A;  4B11 A;  4C2X A;  2DF5 A;  4YFJ A;  2FL4 A;  1YW4 A;  2QYV A;  4H2K A;  3IIB A;  3IWW A;  2V8H A;  5CNP A;  1QSN A;  3CXQ A;  4IHM A;  4UFX A;  3S6F A;  1DE4 C;  1IOI A;  4KLV A;  1N71 A;  3B2Y A;  1Y7E A;  3D7H A;  4NEX A;  4EFD A;  1ELM P;  4KVO E;  4KOS A;  4A32 A;  2Z3O A;  3FEC A;  2J8N A;  3D4U A;  2ODF A;  3S9N A;  2K5T A;  4A39 A;  3D66 A;  4F9V A;  2GU2 A;  1LAM A;  2EK8 A;  2OR4 A;  2G3T A;  3G3S A;  4FD4 A;  4J3G A;  5K8P A;  5F47 A;  5JGF A;  1OZP A;  4UBR A;  4KSI A;  3FRM A;  3V38 A;  4CPA A;  1S5K A;  2FCK A;  2HUZ A;  1KUY A;  3BJ7 A;  4PSW A;  2JEW A;  3DDD A;  2QEC A;  4ZGY B;  4YGO A;  1NMT A;  4ZY0 A;  1F57 A;  1HDU A;  3MN8 A;  1F2P A;  4OC3 A;  4OC1 A;  5H86 A;  4TNU A;  1I1D A;  4A37 A;  5F46 A;  4MMO A;  2ZOF A;  3W91 A;  4KOV A;  2EUI A;  1TIQ A;  4MCQ A;  4KUA A;  3FYN A;  1QMU A;  1S7L A;  4OC2 A;  5H84 A;  2AFM A;  1Z8W A;  2VZZ A;  4E2A A;  4AB7 A;  4U9Y A;  3RNZ A;  3S9M A;  1S7N A;  2XEF A;  2OZG A;  3KI9 A;  1I12 A;  1Q7L A;  2Q44 A;  2PVW A;  2PVV A;  3H5Z A;  4PXD A;  5LRG A;  5G22 A;  2RB7 A;  3KR5 A;  1AYE A;  3KAS A;  4XPL A;  4CAV A;  4P4I A;  4IAV A;  1Z8X A;  1IGB A;  4EVY A;  4MFJ A;  3HLP A;  1CX8 A;  1YRE A;  1AUG A;  3EXN A;  2PJ8 A;  5HVF A;  1XIX A;  2PJB A;  3FX6 A;  2PR1 A;  3FNC A;  1RTQ A;  2AFX A;  2A4N A;  4CGM A;  3TO7 A;  4FBE A;  2ZW7 A;  1M44 A;  4DYO A;  1BAV A;  2ZEN A;  4R8F A;  3LOD A;  1R3N A;  2AFO A;  4IK2 A;  3D2M A;  1XRY A;  3KGQ A;  4MI4 A;  2YGW A;  1Q2C A;  1YLE A;  4PXE A;  5HH1 A;  4P4B A;  3NE7 A;  3IO1 A;  2YNC A;  4KSA A;  4Y49 C;  3TOB A;  3QAH A;  4FAI A;  1FY7 A;  2ATR A;  7CPA A;  4NF1 A;  4UIB A;  1YQE A;  4MFP A;  2AJ6 A;  3VAR A;  2J9A A;  3PBB A;  2J8R A;  3B8G A;  4OC4 A;  3PB4 X;  3D7F A;  1SQH A;  4NGP A;  2B5G B;  4UCM A;  1UFH A;  1M4D A;  5KTC A;  1J4J A;  2JBJ A;  3VWD A;  4B6Z A;  2KCW A;  3QB8 A;  4MJ8 A;  5CPA A;  1MJB A;  4X3R A;  3IEH A;  4MHD A;  4ORF A;  1M4G A;  5ISV A;  3CPA A;  3R9E A;  1CP7 A;  2BO9 A;  3BHX A;  3B3S A;  4EME A;  2DEA A;  2G0B A;  2G9D A;  3PFO A;  2PDO A;  4MHY A;  4MXU A;  2ZOG A;  1ZO0 A;  2OZU A;  4BIN A;  2WZN A;  3PRT A;  3BI1 A;  3ISZ A;  1S60 A;  4Y49 B;  3R9G A;  5AG4 A;  5JM6 A;  4ONW A;  1V0C A;  4LUA A;  1H8L A;  4ZYQ A;  1ARM A;  5LYI A;  1BOB A;  1IYK A;  1XEB A;  2VXK A;  3FVL A;  3GIU A;  3DR8 A;  1LOK A;  5EMI A;  2Q0Y A;  2IJZ A;  4CGL A;  4R87 A;  1Z9U A;  2C6G A;  4QVT A;  4K30 A;  2CNM A;  4JLY A;  1IY7 A;  4H6Z A;  3K2K A;  4KOW A;  4PK2 A;  3SXO A;  4X2T A;  4QBJ A;  2GLJ A;  1VIX A;  1NSL A;  1IOF A;  2Q04 A;  3TC8 A;  2WPX A;  5JPH A;  2HQY A;  2I3C A;  4UCP A;  2VBQ A;  3CPX A;  2G3A A;  4B10 A;  3F8K A;  4H6U A;  2O4H A;  2QML A;  4MRI A;  3SI0 A;  1VHE A;  5K8M A;  3K9T A;  1Y0R A;  1Z2L A;  3OWC A;  1VHS A;  4L8A A;  3E0K A;  1QSM A;  5IB0 A;  3KZW A;  2OOT A;  1M4I A;  3S9L A;  1BPM A;  4Q38 A;  4UIA A;  2Q7B A;  4OID A;  4B5P A;  4KOU A;  2GAN A;  4DNC A;  5D8N A;  4ZX8 A;  5BWA B;  3T90 A;  3I3G A;  3CXS A;  3ZJ0 A;  4A2Z A;  4C7H A;  4GS4 A;  3S6G A;  2BSW A;  2ZED A;  5DS0 A;  1R57 A;  2B4D B;  3GLJ A;  4UWI A;  1K4J A;  2PQ8 A;  5THW A;  5IB9 A;  5IV0 A;  4A30 A;  4CYN A;  1VKC A;  3SJG A;  4B13 A;  2Z10 A;  2GE3 A;  1XJO A;  3H8F A;  3RBU A;  2VI7 A;  4A38 A;  1S7F A;  2Q43 A;  3SJF A;  2AFU A;  2P6E A;  2WYR A;  3KQX A;  3QNV A;  4B5P B;  4FD6 A;  1BO4 A;  3P2H A;  4P10 A;  3FF3 A;  2PJA A;  3BXM A;  2WUU A;  4MY0 A;  3UY5 A;  4HKF A;  4ZY2 A;  4CYO A;  4NGT A;  3SXN A;  4RN7 A;  2CNS A;  4CRY B;  4MCP A;  1IYL A;  4KOY A;  4PQA A;  4AG9 A;  4OLL A;  3CT9 A;  3CZX A;  3N7Z A;  4MY3 A;  4OIW A;  3ISX A;  4Q7A A;  5IX3 A;  2PSW A;  2ZEP A;  4IF5 A;  1Y7R A;  1RO5 A;  4IUS A;  3S6K A;  2OU2 A;  2PJ2 A;  1TKH A;  1L0C A;  5DWN A;  2FSR A;  3LAC A;  4R76 A;  3TO6 A;  4ONU A;  4MCS A;  2ZEG A;  2AE6 A;  2GRE A;  1YR0 A;  4PSX A;  3H8G A;  2O53 A;  3CDX A;  2Q4Y A;  4MHP A;  1Z4R A;  2Z0Z A;  4Z65 A;  4MHN A;  4NGQ A;  1EE3 P;  5GCN A;  2FT0 A;  4KOX A;  4HNY B;  4JYW A;  5DWM A;  3LD2 A;  1QQ9 A;  4KSF A;  3D7D A;  3IFE A;  2PR8 A;  5F48 A;  1KUX A;  4EWT A;  1Q2D A;  1FT7 A;  1DTD A;  3FIX A;  2X7B A;  2YNE A;  4A33 A;  1ZLH A;  1WK4 A;  2B3U A;  4UEZ A;  3DLJ A;  2D4P A;  3R9F A;  3WC6 A;  4NGN A;  4MFL A;  2WPW A;  4ZBG A;  3RYO A;  2B5G A;  1TXR A;  1IID A;  2R8V A;  2ABZ A;  3PB7 X;  4WJB A;  4R3K A;  4XNH C;  1TKJ A;  5K8N A;  3I9S A;  4AXV A;  1ELL P;  3B3V A;  4R7M A;  5G20 A;  2PJ6 A;  1Z8T A;  5J1Q A;  2F7V A;  2FIA A;  2VEZ A;  1YW6 A;  4JXR A;  4GM5 A;  2B58 A;  1LFW A;  1XOV A;  4NGR A;  2ANP A;  2EK9 A;  3VH9 A;  1M1D A;  1NE9 A;  1QSR A; 
#chains in the Genus database with same CATH homology
 4R9M A;  3TOA A;  4C2Y A;  4JD6 A;  1QST A;  1LRZ A;  1MK4 A;  2O28 A;  2FXF A;  2YNC C;  4CGN A;  1B6B A;  5C82 A;  2P0W A;  3BLN A;  2JDC A;  4I49 A;  5G1Z A;  2HV2 A;  3F0A A;  4F6A A;  1QSO A;  3JTK A;  3R95 A;  1XE4 A;  4X5K A;  2REE A;  4E8O A;  1Z4E A;  1P0H A;  4QC6 A;  3ZZI A;  2JLM A;  4KZT A;  2Z11 A;  2CXA A;  2ZPA A;  4C2Z A;  4XPD C;  4KUB A;  5A27 A;  4FD5 A;  4JXQ A;  1YGH A;  3P2F A;  5I0C A;  2YND A;  3FB3 A;  3JUW A;  4RS2 A;  2ZXV A;  2CY2 A;  2R7H A;  3W6X A;  4NXY A;  3IU1 A;  4JJX A;  4M3S A;  4CGO A;  4HNX B;  2B4D A;  3F5B A;  4Q36 A;  2OB0 A;  3CXP A;  1CJW A;  2P6G A;  2DPS A;  2Y0M A;  3SHP A;  2Z3M A;  4AVA A;  5G21 A;  4L89 A;  2JDD A;  4KLW A;  3EY5 A;  1B87 A;  4BMH A;  1Y9W A;  4XPD B;  5EC4 A;  4OAD A;  1S3Z A;  2PRB A;  3TT2 A;  2R98 A;  1KUV A;  2B4B A;  4A31 A;  2GIV A;  4KOR A;  3PZJ A;  2JEV A;  4YRH A;  4UWJ A;  4KVX A;  2QIR A;  3DNS A;  3GYA A;  1Q2Y A;  1WWZ A;  2EVN A;  1YVK A;  2B3V A;  3TCV A;  2P6F A;  3TTH A;  2Q4V A;  1YVO A;  4CGP A;  4MBU A;  4CS0 B;  2FIW A;  4B14 A;  3EFA A;  2R1I A;  2Z3L A;  1GHE A;  3EO4 A;  1ON0 A;  4F0X A;  4XPK A;  3K9U A;  4CYQ A;  2Z3K A;  3C26 A;  3IWE A;  3JVN A;  1P4N A;  4RI1 A;  4F0Y A;  3TE4 A;  4B5O A;  4C68 A;  3GKR A;  2DPT A;  2PC1 A;  4CAE A;  2REF A;  4A95 A;  3KKW A;  1U6M A;  2NMT A;  3H4Q A;  2Z3P A;  2C27 A;  5J8C A;  5EBV A;  2FS5 A;  2OH1 A;  3DR6 A;  4H89 A;  1RXT A;  4CAW A;  5KTD A;  1XF8 A;  5J8F A;  2OZH A;  3PGP A;  4CAX A;  4M85 A;  2I00 A;  2RC4 A;  4KOT A;  2ZW6 A;  3FBU A;  2Z3N A;  1YX0 A;  3D3S A;  3R96 A;  3A9L A;  5C88 A;  4UCN A;  1MJ9 A;  3DSB A;  4AVB A;  4PK3 A;  2WSA A;  4FD7 A;  4PV6 A;  3PP9 A;  3GY9 A;  1IIC A;  4XNH B;  4E0A A;  4C7I A;  2ZW5 A;  1MJA A;  5AGE A;  5F49 A;  4CAF A;  5E96 A;  2BUE A;  2IL4 A;  3D2P A;  4NSQ A;  5AG5 A;  5FVJ A;  1YK3 A;  1KZF A;  4AG7 A;  1PU9 A;  1IB1 E;  2CNT A;  4NCZ A;  3BJ8 A;  5AG6 A;  3R1K A;  4UFV A;  5KTA A;  3MGD A;  3IWG A;  3D8P A;  4II9 A;  4MFK A;  1XMT A;  3S6H A;  3EC4 A;  2FE7 A;  2BL1 A;  1PUA A;  4KS9 A;  4LX9 A;  3IGR A;  4UFW A;  3TO9 A;  5A28 A;  2ZW4 A;  2VZY A;  3TFY A;  2DXQ A;  4UA3 A;  3T9Y A;  3WR7 A;  2F5I A;  3FXT A;  1CM0 A;  4MFQ A;  3V8I A;  2H5M A;  4QB9 A;  4BBH A;  1S7K A;  4HNW B;  5HMN A;  3IU2 A;  3VWE A;  2J8M A;  4R3L A;  2D4O A;  4U5Y A;  2ARH A;  1Y9K A;  3TOB A;  4R57 A;  3VWD A;  4CYP A;  4B12 A;  4AVC A;  4KVM E;  2BEI A;  2I79 A;  4QUS A;  1I21 A;  2VQY A;  4MFZ A;  3W6S A;  5JQ4 A;  4U9Z A;  4JWP A;  4CRZ B;  3G8W A;  4B11 A;  4C2X A;  4YFJ A;  2FL4 A;  5CNP A;  1QSN A;  3CXQ A;  3S6F A;  4UFX A;  4KLV A;  1N71 A;  4NEX A;  4KVO E;  4KOS A;  4A32 A;  2Z3O A;  2J8N A;  2K5T A;  3G3S A;  4J3G A;  2G3T A;  4FD4 A;  5F47 A;  1OZP A;  4UBR A;  3FRM A;  1S5K A;  2FCK A;  2HUZ A;  1KUY A;  3BJ7 A;  4PSW A;  3DDD A;  2QEC A;  4ZGY B;  4YGO A;  1NMT A;  5H86 A;  5F46 A;  1I1D A;  3W91 A;  4KOV A;  2EUI A;  1TIQ A;  4KUA A;  3FYN A;  1S7L A;  5H84 A;  2VZZ A;  4E2A A;  4AB7 A;  4U9Y A;  4A2Z A;  1S7N A;  2OZG A;  1I12 A;  2Q44 A;  3H5Z A;  5G22 A;  4XPL A;  4CAV A;  4EVY A;  4MFJ A;  1YRE A;  3EXN A;  1XIX A;  2PR1 A;  3FNC A;  2A4N A;  4CGM A;  3TO7 A;  2ZW7 A;  1M44 A;  3LOD A;  3D2M A;  4MI4 A;  2YGW A;  1Q2C A;  1YLE A;  5HH1 A;  3NE7 A;  2YNC A;  4KSA A;  4Y49 C;  3QAH A;  1FY7 A;  2ATR A;  4NF1 A;  4MFP A;  2AJ6 A;  2J8R A;  3B8G A;  1SQH A;  2B5G B;  4UCM A;  1UFH A;  1M4D A;  5KTC A;  1J4J A;  2KCW A;  3QB8 A;  4MJ8 A;  1MJB A;  4MHD A;  4ORF A;  1M4G A;  5ISV A;  3R9E A;  2G0B A;  2PDO A;  1ZO0 A;  2OZU A;  1S60 A;  4Y49 B;  3R9G A;  5AG4 A;  1V0C A;  4LUA A;  1BOB A;  1IYK A;  1XEB A;  2VXK A;  3DR8 A;  2Q0Y A;  4CGL A;  4R87 A;  1Z9U A;  4QVT A;  4K30 A;  2CNM A;  4JLY A;  4KOW A;  4H6Z A;  4PK2 A;  3SXO A;  4QBJ A;  1NSL A;  2Q04 A;  2WPX A;  5JPH A;  2HQY A;  4UCP A;  2VBQ A;  2G3A A;  4B10 A;  3F8K A;  4H6U A;  2QML A;  3OWC A;  1VHS A;  4L8A A;  3E0K A;  1QSM A;  5IB0 A;  1M4I A;  4Q38 A;  2Q7B A;  4B5P A;  4KOU A;  2GAN A;  4DNC A;  5BWA B;  3T90 A;  3I3G A;  3CXS A;  3ZJ0 A;  4C7H A;  4GS4 A;  3S6G A;  2BSW A;  1R57 A;  2B4D B;  4UWI A;  1K4J A;  2PQ8 A;  5IV0 A;  4A30 A;  4CYN A;  1VKC A;  4B13 A;  2Z10 A;  2GE3 A;  2VI7 A;  1S7F A;  2P6E A;  4B5P B;  4FD6 A;  1BO4 A;  3P2H A;  2WUU A;  4MY0 A;  3UY5 A;  4HKF A;  4CYO A;  3SXN A;  2CNS A;  4CRY B;  1IYL A;  4KOY A;  4AG9 A;  4OLL A;  4MY3 A;  3N7Z A;  5IX3 A;  2PSW A;  4IF5 A;  1Y7R A;  1RO5 A;  4IUS A;  3S6K A;  2OU2 A;  1L0C A;  5DWN A;  2FSR A;  3TO6 A;  4ONU A;  2AE6 A;  1YR0 A;  4PSX A;  2Q4Y A;  1Z4R A;  2Z0Z A;  5GCN A;  2FT0 A;  4KOX A;  4HNY B;  5DWM A;  3LD2 A;  4KSF A;  2PR8 A;  5F48 A;  1KUX A;  1Q2D A;  3FIX A;  2X7B A;  2YNE A;  4A33 A;  2B3U A;  1WK4 A;  2D4P A;  3R9F A;  4MFL A;  2WPW A;  4ZBG A;  3RYO A;  2B5G A;  1IID A;  2R8V A;  4R3K A;  4XNH C;  3I9S A;  5G20 A;  2VEZ A;  2FIA A;  4JXR A;  2B58 A;  5AG7 A;  4OAE A;  1M1D A;  1NE9 A;  1QSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...