1GHEA

Crystal structure of tabtoxin resistance protein complexed with an acyl coenzyme a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
170
structure length
170
Chain Sequence
AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE
publication title Crystal Structure of Tabtoxin Resistance Protein Complexed with Acetyl Coenzyme A Reveals the Mechanism for beta-Lactam Acetylation
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
molecule tags Transferase
total genus 49
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1gheA00
1YX0A 2D4OA 5HMNA 2CNMA 1IYLA 1R57A 2QMLA 1KUVA 1PUAA 2JEVA 2FE7A 4AG9A 4QBJA 3TFYA 1QSMA 4AG7A 3V8IA 4MBUA 5JQ4A 1QSOA 4H89A 4IF5A 4UWIA 3EY5A 2ARHA 1MJ9A 4KOYA 3LODA 3R9GA 5IX3A 3SHPA 4PSWA 3JVNA 1XE4A 1CM0A 2Q44A 2PQ8A 1BOBA 3FIXA 2PDOA 2Z0ZA 2OZGA 4RS2A 4ORFA 5KTAA 1P4NA 1Y9WA 3BJ8A 5H84A 3DR6A 4R9MA 3BLNA 3F5BA 1YVKA 4OLLA 4KUBA 1YGHA 3QB8A 2KCWA 2HV2A 3D3SA 2QECA 2J8MA 4NCZA 1Q2DA 1WK4A 3FRMA 3SXOA 3C26A 3MGDA 1WWZA 4UA3A 4KOUA 3W91A 5HH1A 2JDCA 1B87A 2FCKA 1MJAA 4R87A 2Y0MA 1M4IA 4UBRA 1XF8A 3EO4A 3IGRA 4L89A 4F0YA 1XIXA 2EUIA 2VI7A 2EVNA 1L0CA 1ON0A 4E2AA 1XMTA 2O28A 4JXQA 4JD6A 5FVJA 5J8FA 1Y9KA 2FXFA 1YREA 3UY5A 3EFAA 2Q4VA 1I21A 3R1KA 5H86A 1IYKA 5EBVA 5IV0A 4U5YA 3P2FA 4YFJA 5E96A 2PC1A 4HNXB 4AB7A 1I1DA 5KTCA 2R98A 2J8NA 2Q04A 2ZW5A 2Q7BA 4XNHB 4NXYA 4PSXA 2B4BA 2B3UA 3H4QA 3E0KA 2OB0A 3TOBA 5F49A 4RI1A 2FS5A 2FIWA 2OZUA 1S3ZA 2ZXVA 4JJXA 5J8CA 2ZW6A 4XPDB 3T9YA 1V0CA 2B58A 1RXTA 2J8RA 3CXQA 4B5PB 1S7LA 4M3SA 3TE4A 2CNTA 4IUSA 3CXPA 4NSQA 5F46A 1M44A 4LX9A 4KUAA 4Y49B 3SXNA 2FT0A 5F47A 2ZPAA 4HNWB 4PK3A 3KKWA 1TIQA 2Q0YA 4MI4A 2P6EA 3K9UA 1NE9A 2G3TA 4KLWA 2D4PA 3S6HA 2BSWA 2B4DB 1S7NA 4EVYA 2R7HA 2WPXA 4E0AA 1RO5A 1S60A 4FD7A 2OZHA 4XNHC 2JLMA 4CS0B 1Q2YA 1VKCA 4KOWA 1NSLA 1K4JA 3GKRA 3TO7A 3BJ7A 2I00A 4ZBGA 4QUSA 2QIRA 4I49A 4R3LA 2R8VA 4KOVA 2FSRA 3G8WA 2G3AA 4U9YA 3PZJA 4OADA 3PGPA 4XPDC 2IL4A 1B6BA 4AVBA 3D2PA 1UFHA 4R57A 1VHSA 3D2MA 1Y7RA 2NMTA 4K30A 2F5IA 5GCNA 1KZFA 4X5KA 4NF1A 3RYOA 5CNPA 2VZZA 1N71A 2PR8A 3G3SA 3P2HA 4KVXA 3TO9A 3F0AA 3R9EA 3TOAA 4L8AA 4PK2A 3I3GA 4H6UA 4KOTA 2AE6A 5DWNA 3CXSA 1J4JA 4CAVA 4KOSA 2VBQA 2P6GA 4GS4A 4KVOE 4B5OA 2Z11A 4JLYA 4JWPA 2VXKA 1IB1E 4QB9A 3N7ZA 1PU9A 4YRHA 2CY2A 3DSBA 3WR7A 4CRYB 2OU2A 3FNCA 4R3KA 2HQYA 5KTDA 1XEBA 3EXNA 4B5PA 4FD5A 2P6FA 2JDDA 1IICA 3TO6A 2B5GA 3PP9A 3VWEA 5DWMA 3DDDA 4F6AA 3TT2A 2CNSA 1YR0A 2B5GB 4M85A 3FBUA 3B8GA 2REFA 3EC4A 2ZW4A 4QVTA 1SQHA 2VQYA 2A4NA 2X7BA 2G0BA 3S6KA 4FD6A 1QSRA 3R95A 5EC4A 5I0CA 2C27A 3QAHA 4II9A 4MJ8A 3NE7A 4QC6A 1IIDA 3LD2A 4XPKA 4CRZB 1Z9UA 2B4DA 3OWCA 2Z10A 3W6XA 1KUXA 1S7FA 1Q2CA 2B3VA 2WPWA 4H6ZA 1U6MA 1MJBA 3FXTA 2I79A 2DXQA 3IWGA 3DR8A 1BO4A 1S5KA 1Z4RA 4AVCA 4KZTA 2Q4YA 4OAEA 4JXRA 3GYAA 2BL1A 1QSTA 1M1DA 4MHDA 2BUEA 2ATRA 3FYNA 2PRBA 2ZW7A 4AVAA 2REEA 4HNYB 1YVOA 3F8KA 2R1IA 3R96A 1NMTA 2PR1A 3D8PA 5C88A 5F48A 2P0WA 4E8OA 2FIAA 5JPHA 2VZYA 4DNCA 2RC4A 4PV6A 3VWDA 3S6FA 4NEXA 4XPLA 1OZPA 3FB3A 3GY9A 4KLVA 3JUWA 4Y49C 4KVME 5C82A 4ONUA 1S7KA 2H5MA 4KORA 4J3GA 2GE3A 3W6SA 2BEIA 4BMHA 2OH1A 4MY3A 1M4GA 1YLEA 4U9ZA 4UWJA 5ISVA 1M4DA 2HUZA 3DNSA 3TTHA 1KUYA 4KOXA 2AJ6A 3ZJ0A 1CJWA 5IB0A 3R9FA 2PSWA 4MY0A 2FL4A 1MK4A 4CAWA 1LRZA 2GANA 3TCVA 1GHEA 3T90A 4FD4A 3ZZIA 2VEZA 4YGOA 2K5TA 4HKFA 2GIVA 1YK3A 1FY7A 1I12A 4LUAA 1Z4EA 3I9SA 3S6GA 1QSNA 1P0HA 4CAXA
chains in the Genus database with same CATH superfamily
2GLFA 4A33A 1YX0A 2D4OA 3SI2A 4RUHA 1ARMA 4PXBA 4TWEA 5HMNA 5AG5A 2CNMA 1IYLA 4ZX9A 1R57A 2QMLA 1KUVA 1PUAA 5AG7A 2JEVA 4MCQA 4CYOA 2FE7A 3FX6A 3VH9A 2EO8A 4UIAA 4NGSA 2PJCA 3SJXA 4AG9A 4QBJA 3B7IA 3D67A 3D7HA 3TFYA 3KHZA 2PCUA 3FJUA 3H8FA 4JZ0A 1QSMA 4AG7A 3V8IA 4MBUA 4AVBA 4NGTA 2QYVA 2F8HA 5JQ4A 5THWA 1QSOA 4FBEA 2BO9A 4H89A 4C7HA 4F0XA 2ODFA 1Z8WA 3CZXA 4PXDA 1Y0RA 4BINA 4IF5A 4UWIA 5AGEA 3EY5A 3GUXA 2ARHA 3PFEA 1MJ9A 2V8GA 2YNCA 1R3NA 4KOYA 1YLOA 3LODA 3R9GA 5IX3A 1BLLE 2PRQA 3SHPA 4PSWA 1OBRA 1XFOA 3JVNA 1XE4A 2YNEA 1CM0A 3D7GA 4MHNA 1ARLA 3BI0A 2Q44A 2PQ8A 3PBBA 1BOBA 5LYFA 3FIXA 3SJFA 3RO0A 2PDOA 2Q7SA 2Z0ZA 4MFZA 2OZGA 4RS2A 2RB7A 1YMEA 4ORFA 5KTAA 1P4NA 1Y9WA 3BJ8A 4MFJA 3DR6A 2ZEOA 5H84A 4OC4A 5G21A 2PJAA 4R9MA 4ZI6A 3KQZA 3BLNA 2WUUA 2WYRA 3F5BA 3IIBA 4CGNA 1TKHA 3GIUA 1YVKA 1H8LA 3D4UA 4KUBA 1XBUA 1YGHA 4OLLA 3QB8A 2Q51A 4R8FA 3KASA 3FEEA 2KCWA 2HV2A 3D3SA 1PCAA 2QECA 4CGLA 2J8MA 4NCZA 4DUKA 1ELLP 1YSJA 1Q2DA 1WK4A 4OC3A 4ZGYB 3FRMA 3SXOA 3C26A 2PJ4A 3MGDA 1WWZA 4UA3A 2PE3A 4KOUA 3W91A 5HH1A 2JDCA 1B87A 2FCKA 1MJAA 3NE8A 2IJZA 4R87A 3B3VA 2O53A 1TKFA 2Y0MA 1CG2A 4KS9A 3NA6A 1M4IA 1ZO0A 4UBRA 2RFHA 1XF8A 3EO4A 3IGRA 4L89A 1BAVA 3MN8A 4OC5A 1XIXA 2EUIA 2GU2A 2VI7A 4F0YA 2EVNA 1L0CA 5LRKA 3IO1A 2V8VA 1ON0A 4AXVA 1JQGA 4E2AA 1XMTA 2O28A 4A95A 4JXQA 5HVGA 4G1PA 4JD6A 2ZEDA 3IEHA 5FVJA 5J8FA 1Y9KA 4CAFA 2Z3LA 3PRTA 1A2ZA 4C68A 2FXFA 2PJ5A 1YREA 1VIXA 4UFWA 3B3SA 3UY5A 4CPAA 1F57A 3S9MA 3EFAA 3VATA 2Q4VA 3BI1A 1I21A 4K3NA 3R1KA 5H86A 1IYKA 1DE4C 2AFZA 5EBVA 5IV0A 4U5YA 4P45A 2JEWA 3P2FA 4UCPA 1VGYA 3NH5A 5E96A 4YFJA 1XRYA 4WJBA 4Q7AA 1Y7EA 2PC1A 4UIBA 4HNXB 1Z8XA 1I1DA 4AB7A 5KTCA 2R98A 2J8NA 2Q04A 4PXCA 2ZW5A 2Q7BA 4YWYA 1IY7A 4XNHB 2YNCC 4NXYA 2PJBA 4PSXA 3S9NA 4CGMA 1NSAA 1AMPA 3KZWA 5LRGA 4FUUA 1ZG7A 3D66A 2B4BA 2B3UA 1XOVA 3H4QA 5J1QA 3E0KA 5LYDA 3SI0A 2OB0A 7CPAA 2ZENA 3TOBA 5K8OA 4M6HA 2ZOFA 5F49A 1DTDA 4RI1A 4ZY2A 4NGRA 2XEIA 2FS5A 2ZEFA 1FT7A 2FIWA 2IMOA 2OZUA 1S3ZA 2ZXVA 5G22A 3BHXA 4JJXA 5IB9A 5J8CA 4C2ZA 1IOIA 2EWBA 2NYQA 2ZEPA 2ZW6A 4PPZA 4XPDB 3T9YA 1V0CA 2B58A 3CPAA 1RXTA 3LACA 3B35A 2J8RA 4LQ6A 1LOKA 3K9TA 3CXQA 5JH9A 4OC1A 5D29A 4B5PB 4A94A 1S7LA 4M3SA 2WSAA 3TE4A 2BCOA 1CX8A 3PB4X 1Z5RA 3BXMA 2CNTA 4IUSA 2PIYA 4OC2A 3CXPA 4NSQA 2CXAA 4C2YA 5F46A 1M44A 4UEEA 4A32A 4HPSA 1LANA 2AFSA 4LX9A 4PQAA 2QJ8A 4KUAA 4Y49B 4DYOA 5BWAB 2AFOA 2PJ8A 3SXNA 1JWQA 3MRUA 3N5FA 2FT0A 4NGQA 5F47A 3NH4A 3QNVA 1TXRA 4EMEA 2ZPAA 5JGFA 3B2YA 1KWMA 4HNWB 4PK3A 2PJ3A 3FH4A 1BPMA 3KKWA 2Q4ZA 2PVVA 1TIQA 4DJLA 2Q0YA 4MI4A 4MHPA 1HDQA 2P6EA 3K9UA 1NE9A 2G3TA 4KLWA 2D4PA 5G1ZA 2QVPA 3IJ3A 3K2KA 2PJ1A 5A27A 3S6HA 1R43A 2BSWA 3RAMA 4B6ZA 3NFZA 4P4EA 4NGPA 2WZNA 4OC0A 3I1UA 2B4DB 3A9LA 1S7NA 4OKOA 3PFOA 4MHZA 4BBHA 1Z8LA 2R7HA 4EVYA 5AG4A 1ZLHA 2WPXA 4LQGA 1RO5A 1S60A 3KGQA 2Z3OA 4KSAA 4E0AA 1CP6A 4FD7A 2OZHA 4IK2A 2Z3KA 1TF9A 1HEEA 4UEZA 3PB6X 4UF4A 2O4HA 2ZEEA 4C2XA 4KSFA 4XNHC 1YW6A 2JLMA 1Q2YA 1VKCA 4KOWA 4CS0B 1NSLA 1FNOA 2EK8A 1K4JA 3GLJA 3GKRA 4MXUA 3TO7A 4Z65A 2C6PA 2Z3NA 3BJ7A 4A31A 2I00A 4ZBGA 3V38A 4QUSA 3IWEA 4NFRA 1LFWA 2QIRA 3D7FA 4M6GA 4OMEA 4O23A 2F7VA 4I49A 4P4BA 1YQEA 3PB7X 4OP4A 4R3LA 2R8VA 3KL9A 4GXHA 4KOVA 4Q36A 4UCMA 2FSRA 2PIZA 4P4JA 3G8WA 2G3AA 3IU1A 3FVLA 4U9YA 2PVWA 3PZJA 4OADA 2ZEMA 3PGPA 4XPDC 2IL4A 1B6BA 2HB6A 3D2PA 3HUVA 1UFHA 2DF5A 2Z3PA 4MCPA 4R57A 3RBUA 3WABA 1VHSA 1ZG9A 1ELMP 1YW4A 3D2MA 5CPAA 1Y7RA 4MCSA 4P6YA 2NMTA 4K30A 4H2KA 4A30A 2F5IA 2ZEHA 6CPAA 5GCNA 1KZFA 2JBKA 3H8EA 1PYTB 4X5KA 4NF1A 5F09A 3RYOA 5CNPA 2VZZA 1N71A 1VHOA 2PR8A 3G3SA 3P2HA 4KVXA 4NGMA 3TO9A 3F0AA 3R9EA 3FMCA 3KQXA 3RNZA 5K8PA 2DPTA 3FF3A 3TOAA 2V8HA 2CIJA 4L8AA 4PK2A 3I3GA 5EMIA 5HVFA 4ZY1A 4H6UA 2XEFA 3FEDA 4CYNA 4KOTA 4CYQA 8CPAA 2AE6A 4W9YA 3PBEA 1CPXA 5DWNA 3RZAA 3CXSA 1HDUA 1CP7A 1J4JA 1LAMA 2CTCA 4CAVA 4MHYA 4KOSA 4Q38A 2VBQA 3IC1A 2ANPA 2P6GA 4GS4A 1LAPA 4KVOE 3SJGA 1TF8A 3FECA 4B5OA 1UWYA 2Z11A 3IWWA 4JLYA 2VXKA 3KHXA 2YNDA 4JWPA 1IB1E 4QB9A 3N7ZA 1PU9A 2HC9A 4A39A 3B3CA 2C6GA 4YRHA 4KSIA 2CY2A 3T8WA 4B13A 4C7IA 4NJRA 3DGVA 3HLPA 4F8ZA 3DSBA 3WR7A 2DPSA 4NGNA 2OR4A 4B14A 5LYIA 4CRYB 5G20A 4CGOA 2OU2A 3FNCA 4R3KA 5HXDA 2HQYA 5KTDA 1XEBA 3EXNA 4A2ZA 4B5PA 2C1CA 1EE3P 2PJ6A 1RTQA 4FD5A 2P6FA 2PJ2A 3ISXA 2ABZA 1F2OA 2JDDA 1QQ9A 2V77A 1IICA 2GREA 3DLJA 3TO6A 2B5GA 3ISZA 3PP9A 3VWEA 2V8DA 5DWMA 3DDDA 4P10A 3TT2A 4F6AA 2CNSA 3H5ZA 1YR0A 4B12A 2B5GB 4M85A 2AFWA 3JTKA 3FBUA 4FAIA 3B8GA 1XJOA 2REFA 3V7ZA 3EC4A 4A37A 2ZW4A 4IAVA 4QVTA 1SQHA 2VQYA 4RN7A 4ZX8A 2A4NA 2JBJA 2X7BA 2FVGA 2G0BA 4P44A 3S6KA 1X10A 4FD6A 1QSRA 4MFKA 3R95A 3PEIA 5EC4A 5I0CA 2C27A 4MRIA 3QAHA 3LMSA 1ZLIA 5D8NA 4II9A 4FWUA 2XEJA 4EWTA 1Z8TA 4MJ8A 3NE7A 4QC6A 1IIDA 1F2PA 2BOAA 5DS0A 3KR5A 3LD2A 5LRJA 1LCPA 4XPKA 4CRZB 1Z9UA 2B4DA 3L2NA 3VARA 3OWCA 4WWVA 2Z10A 3QAYA 4MFQA 3W6XA 1KUXA 1S7FA 2EBJA 5AG6A 1IGBA 1Q2CA 3SI1A 2B3VA 2WPWA 4A38A 4H6ZA 1U6MA 1MJBA 3FXTA 2I79A 2DXQA 5A28A 3IWGA 3DR8A 1BO4A 1S5KA 1Z4RA 4AVCA 5HVHA 4F9UA 4OIDA 4KZTA 2Q4YA 4OAEA 4JXRA 3GYAA 3PB9X 4R7MA 4UFVA 2BL1A 2POKA 1QSTA 2PJ9A 1M1DA 2CF4A 4MHDA 2BUEA 2ATRA 4F9VA 4X3RA 3FYNA 2PRBA 2AFMA 2ZW7A 4AVAA 2REEA 2ZOGA 4HNYB 2NSMA 1YVOA 3CT9A 3IFEA 3F8KA 2R1IA 2OOTA 2YGWA 3R96A 1IOFA 1NMTA 2GFQA 2PR1A 3D8PA 4CAEA 2VL1A 5C88A 5F48A 2P0WA 2ZEGA 4MFLA 4E8OA 2C6CA 2PJ0A 3WC7A 3PB8X 2FIAA 5K8MA 1IU8A 5JPHA 4OIWA 2VZYA 3WC5A 5CBMA 4UEFA 4DNCA 2RC4A 4ZYQA 4PV6A 4JYWA 3VWDA 3B3WA 3S6FA 4NEXA 4XPLA 1OZPA 3FB3A 4EFDA 1TKJA 3JRUA 3GY9A 1QMUA 4KLVA 4GM5A 4P4DA 4X8IA 3JUWA 2DEAA 4MMOA 4Y49C 5ELYA 3TX8A 4KVME 3KI9A 5C82A 2ZELA 3TC8A 4ONUA 3CDXA 4B10A 1S7KA 1AUGA 2H5MA 4IHMA 1XMBA 4KORA 4MFPA 1X12A 2I3CA 4J3GA 2G9DA 4P4FA 2GE3A 1M4LA 1Y0YA 3KR4A 3W6SA 3H8GA 2BEIA 4P4IA 3WC6A 4BMHA 1BPNA 2Z3MA 2OH1A 4MY3A 1M4GA 1YLEA 4U9ZA 4UWJA 5ISVA 1M4DA 2HUZA 2J9AA 3DNSA 3TTHA 1GYTA 5JM6A 3IU2A 4M6IA 4ZY0A 1KUYA 4CGPA 2PJ7A 4R6TA 4UFXA 4KOXA 2AJ6A 3WT4A 1ZG8A 4TNUA 3ZJ0A 5I4MA 3CPXA 2GLJA 1CJWA 4R76A 1AYEA 4X2TA 2CTBA 3R9FA 5IB0A 4YU9A 3SJEA 3B3TA 4CYPA 4NJQA 4ONWA 2PSWA 3D7DA 4MY0A 4MCRA 4UCNA 2FL4A 1MK4A 4CAWA 2IQ6A 1LRZA 2GANA 3TCVA 1CBXA 1CPSA 1GHEA 1Z2LA 3D68A 4PXEA 3T90A 4FD4A 2EK9A 3GB0A 3ZZIA 2VEZA 4YGOA 1Q7LA 2AFUA 2Q43A 4B11A 2K5TA 3LWUA 5LYLA 4HKFA 2GIVA 4BD9A 1VHEA 3NH8A 2AFXA 1YK3A 1FY7A 1I12A 2XEGA 1Z4EA 3I9SA 4LUAA 3S6GA 5K8NA 1QSNA 1P0HA 4CAXA 3S9LA
chains in the Genus database with same CATH topology
4A33A 1YX0A 2D4OA 5HMNA 5AG5A 2CNMA 1IYLA 1R57A 2QMLA 1KUVA 1PUAA 5AG7A 2JEVA 4CYOA 2FE7A 4AG9A 4QBJA 3TFYA 1QSMA 4AG7A 3V8IA 4MBUA 5JQ4A 1QSOA 4H89A 4C7HA 4F0XA 4IF5A 4UWIA 5AGEA 3EY5A 2ARHA 1MJ9A 2YNCA 4KOYA 3LODA 3R9GA 5IX3A 3SHPA 4PSWA 3JVNA 1XE4A 2YNEA 1CM0A 2Q44A 2PQ8A 1BOBA 3FIXA 2PDOA 4MFZA 2Z0ZA 2OZGA 4RS2A 4ORFA 5KTAA 1P4NA 1Y9WA 3BJ8A 4MFJA 3DR6A 5H84A 5G21A 4R9MA 3BLNA 2WUUA 3F5BA 4CGNA 1YVKA 4OLLA 4KUBA 1YGHA 3QB8A 2KCWA 2HV2A 3D3SA 2QECA 4CGLA 2J8MA 4NCZA 1Q2DA 1WK4A 4ZGYB 3FRMA 3SXOA 3C26A 3MGDA 1WWZA 4UA3A 4KOUA 3W91A 5HH1A 2JDCA 1B87A 2FCKA 1MJAA 4R87A 2Y0MA 4KS9A 1M4IA 1ZO0A 4UBRA 1XF8A 3EO4A 3IGRA 4L89A 4F0YA 1XIXA 2EUIA 2VI7A 2EVNA 1L0CA 1ON0A 4E2AA 1XMTA 2O28A 4A95A 4JXQA 4JD6A 5FVJA 5J8FA 1Y9KA 4CAFA 2Z3LA 4C68A 2FXFA 1YREA 4UFWA 3UY5A 3EFAA 2Q4VA 1I21A 3R1KA 5H86A 1IYKA 5EBVA 5IV0A 4U5YA 3P2FA 4UCPA 4YFJA 5E96A 2PC1A 4HNXB 4AB7A 1I1DA 5KTCA 2R98A 2J8NA 2Q04A 2ZW5A 2Q7BA 4XNHB 2YNCC 4NXYA 4PSXA 4CGMA 2B4BA 2B3UA 3H4QA 3E0KA 2OB0A 3TOBA 5F49A 4RI1A 2FS5A 2FIWA 2OZUA 1S3ZA 2ZXVA 5G22A 4JJXA 5J8CA 4C2ZA 2ZW6A 4XPDB 3T9YA 1V0CA 2B58A 1RXTA 2J8RA 3CXQA 4B5PB 1S7LA 4M3SA 2WSAA 3TE4A 2CNTA 4IUSA 4C2YA 3CXPA 4NSQA 2CXAA 5F46A 1M44A 4A32A 4LX9A 4KUAA 4Y49B 5BWAB 3SXNA 2FT0A 5F47A 2ZPAA 4HNWB 4PK3A 3KKWA 1TIQA 2Q0YA 4MI4A 2P6EA 3K9UA 1NE9A 2G3TA 4KLWA 2D4PA 5G1ZA 5A27A 3S6HA 2BSWA 2B4DB 3A9LA 1S7NA 4BBHA 4EVYA 2R7HA 5AG4A 2WPXA 4E0AA 1RO5A 1S60A 2Z3OA 4KSAA 4FD7A 2OZHA 2Z3KA 4C2XA 4KSFA 4XNHC 2JLMA 4CS0B 1Q2YA 1VKCA 4KOWA 1NSLA 1K4JA 3GKRA 3TO7A 2Z3NA 3BJ7A 4A31A 2I00A 4ZBGA 4QUSA 3IWEA 2QIRA 4I49A 4R3LA 2R8VA 4KOVA 4Q36A 4UCMA 2FSRA 3G8WA 2G3AA 3IU1A 4U9YA 3PZJA 4OADA 3PGPA 4XPDC 2IL4A 1B6BA 4AVBA 3D2PA 1UFHA 2Z3PA 4R57A 1VHSA 3D2MA 1Y7RA 2NMTA 4K30A 4A30A 2F5IA 5GCNA 1KZFA 4X5KA 4NF1A 3RYOA 5CNPA 2VZZA 1N71A 2PR8A 3G3SA 3P2HA 4KVXA 3TO9A 3F0AA 3R9EA 2DPTA 3TOAA 4L8AA 4PK2A 3I3GA 4H6UA 4CYNA 4KOTA 4CYQA 2AE6A 5DWNA 3CXSA 1J4JA 4CAVA 4KOSA 4Q38A 2VBQA 2P6GA 4GS4A 4KVOE 4B5OA 2Z11A 4JLYA 4JWPA 2VXKA 2YNDA 1IB1E 4QB9A 3N7ZA 1PU9A 4YRHA 4C7IA 2CY2A 4B13A 3DSBA 3WR7A 2DPSA 4B14A 4CRYB 5G20A 4CGOA 2OU2A 3FNCA 4R3KA 2HQYA 5KTDA 1XEBA 3EXNA 4A2ZA 4B5PA 4FD5A 2P6FA 2JDDA 1IICA 3TO6A 2B5GA 3PP9A 3VWEA 5DWMA 3DDDA 4F6AA 3TT2A 2CNSA 3H5ZA 1YR0A 4B12A 2B5GB 4M85A 3JTKA 3FBUA 3B8GA 2REFA 3EC4A 2ZW4A 4QVTA 1SQHA 2VQYA 2A4NA 2X7BA 2G0BA 3S6KA 4FD6A 1QSRA 4MFKA 3R95A 5EC4A 5I0CA 2C27A 3QAHA 4II9A 4MJ8A 3NE7A 4QC6A 1IIDA 3LD2A 4XPKA 4CRZB 1Z9UA 2B4DA 3OWCA 2Z10A 4MFQA 3W6XA 1KUXA 1S7FA 5AG6A 1Q2CA 2B3VA 2WPWA 4H6ZA 1U6MA 1MJBA 3FXTA 2I79A 2DXQA 5A28A 3IWGA 3DR8A 1BO4A 1S5KA 1Z4RA 4AVCA 4KZTA 2Q4YA 4OAEA 4JXRA 3GYAA 4UFVA 2BL1A 1QSTA 1M1DA 4MHDA 2BUEA 2ATRA 3FYNA 2PRBA 2ZW7A 4AVAA 2REEA 4HNYB 1YVOA 3F8KA 2R1IA 2YGWA 3R96A 1NMTA 2PR1A 4CAEA 3D8PA 5C88A 5F48A 2P0WA 4MFLA 4E8OA 2FIAA 5JPHA 2VZYA 4DNCA 2RC4A 4PV6A 3VWDA 3S6FA 4NEXA 4XPLA 1OZPA 3FB3A 3GY9A 4KLVA 3JUWA 4Y49C 4KVME 5C82A 4ONUA 4B10A 1S7KA 2H5MA 4KORA 4MFPA 4J3GA 2GE3A 3W6SA 2BEIA 4BMHA 2Z3MA 2OH1A 4MY3A 1M4GA 1YLEA 4U9ZA 4UWJA 5ISVA 1M4DA 2HUZA 3DNSA 3TTHA 3IU2A 1KUYA 4CGPA 4UFXA 4KOXA 2AJ6A 3ZJ0A 1CJWA 5IB0A 3R9FA 4CYPA 2PSWA 4MY0A 4UCNA 2FL4A 1MK4A 4CAWA 1LRZA 2GANA 3TCVA 1GHEA 3T90A 4FD4A 3ZZIA 2VEZA 4YGOA 4B11A 2K5TA 4HKFA 2GIVA 1YK3A 1FY7A 1I12A 4LUAA 1Z4EA 3I9SA 3S6GA 1QSNA 1P0HA 4CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX0 A;  2D4O A;  5HMN A;  2CNM A;  1IYL A;  1R57 A;  2QML A;  1KUV A;  1PUA A;  2JEV A;  2FE7 A;  4AG9 A;  4QBJ A;  3TFY A;  1QSM A;  4AG7 A;  3V8I A;  4MBU A;  5JQ4 A;  1QSO A;  4H89 A;  4IF5 A;  4UWI A;  3EY5 A;  2ARH A;  1MJ9 A;  4KOY A;  3LOD A;  3R9G A;  5IX3 A;  3SHP A;  4PSW A;  3JVN A;  1XE4 A;  1CM0 A;  2Q44 A;  2PQ8 A;  1BOB A;  3FIX A;  2PDO A;  2Z0Z A;  2OZG A;  4RS2 A;  4ORF A;  5KTA A;  1P4N A;  1Y9W A;  3BJ8 A;  5H84 A;  3DR6 A;  4R9M A;  3BLN A;  3F5B A;  1YVK A;  4OLL A;  4KUB A;  1YGH A;  3QB8 A;  2KCW A;  2HV2 A;  3D3S A;  2QEC A;  2J8M A;  4NCZ A;  1Q2D A;  1WK4 A;  3FRM A;  3SXO A;  3C26 A;  3MGD A;  1WWZ A;  4UA3 A;  4KOU A;  3W91 A;  5HH1 A;  2JDC A;  1B87 A;  2FCK A;  1MJA A;  4R87 A;  2Y0M A;  1M4I A;  4UBR A;  1XF8 A;  3EO4 A;  3IGR A;  4L89 A;  4F0Y A;  1XIX A;  2EUI A;  2VI7 A;  2EVN A;  1L0C A;  1ON0 A;  4E2A A;  1XMT A;  2O28 A;  4JXQ A;  4JD6 A;  5FVJ A;  5J8F A;  1Y9K A;  2FXF A;  1YRE A;  3UY5 A;  3EFA A;  2Q4V A;  1I21 A;  3R1K A;  5H86 A;  1IYK A;  5EBV A;  5IV0 A;  4U5Y A;  3P2F A;  4YFJ A;  5E96 A;  2PC1 A;  4HNX B;  4AB7 A;  1I1D A;  5KTC A;  2R98 A;  2J8N A;  2Q04 A;  2ZW5 A;  2Q7B A;  4XNH B;  4NXY A;  4PSX A;  2B4B A;  2B3U A;  3H4Q A;  3E0K A;  2OB0 A;  3TOB A;  5F49 A;  4RI1 A;  2FS5 A;  2FIW A;  2OZU A;  1S3Z A;  2ZXV A;  4JJX A;  5J8C A;  2ZW6 A;  4XPD B;  3T9Y A;  1V0C A;  2B58 A;  1RXT A;  2J8R A;  3CXQ A;  4B5P B;  1S7L A;  4M3S A;  3TE4 A;  2CNT A;  4IUS A;  3CXP A;  4NSQ A;  5F46 A;  1M44 A;  4LX9 A;  4KUA A;  4Y49 B;  3SXN A;  2FT0 A;  5F47 A;  2ZPA A;  4HNW B;  4PK3 A;  3KKW A;  1TIQ A;  2Q0Y A;  4MI4 A;  2P6E A;  3K9U A;  1NE9 A;  2G3T A;  4KLW A;  2D4P A;  3S6H A;  2BSW A;  2B4D B;  1S7N A;  4EVY A;  2R7H A;  2WPX A;  4E0A A;  1RO5 A;  1S60 A;  4FD7 A;  2OZH A;  4XNH C;  2JLM A;  4CS0 B;  1Q2Y A;  1VKC A;  4KOW A;  1NSL A;  1K4J A;  3GKR A;  3TO7 A;  3BJ7 A;  2I00 A;  4ZBG A;  4QUS A;  2QIR A;  4I49 A;  4R3L A;  2R8V A;  4KOV A;  2FSR A;  3G8W A;  2G3A A;  4U9Y A;  3PZJ A;  4OAD A;  3PGP A;  4XPD C;  2IL4 A;  1B6B A;  4AVB A;  3D2P A;  1UFH A;  4R57 A;  1VHS A;  3D2M A;  1Y7R A;  2NMT A;  4K30 A;  2F5I A;  5GCN A;  1KZF A;  4X5K A;  4NF1 A;  3RYO A;  5CNP A;  2VZZ A;  1N71 A;  2PR8 A;  3G3S A;  3P2H A;  4KVX A;  3TO9 A;  3F0A A;  3R9E A;  3TOA A;  4L8A A;  4PK2 A;  3I3G A;  4H6U A;  4KOT A;  2AE6 A;  5DWN A;  3CXS A;  1J4J A;  4CAV A;  4KOS A;  2VBQ A;  2P6G A;  4GS4 A;  4KVO E;  4B5O A;  2Z11 A;  4JLY A;  4JWP A;  2VXK A;  1IB1 E;  4QB9 A;  3N7Z A;  1PU9 A;  4YRH A;  2CY2 A;  3DSB A;  3WR7 A;  4CRY B;  2OU2 A;  3FNC A;  4R3K A;  2HQY A;  5KTD A;  1XEB A;  3EXN A;  4B5P A;  4FD5 A;  2P6F A;  2JDD A;  1IIC A;  3TO6 A;  2B5G A;  3PP9 A;  3VWE A;  5DWM A;  3DDD A;  4F6A A;  3TT2 A;  2CNS A;  1YR0 A;  2B5G B;  4M85 A;  3FBU A;  3B8G A;  2REF A;  3EC4 A;  2ZW4 A;  4QVT A;  1SQH A;  2VQY A;  2A4N A;  2X7B A;  2G0B A;  3S6K A;  4FD6 A;  1QSR A;  3R95 A;  5EC4 A;  5I0C A;  2C27 A;  3QAH A;  4II9 A;  4MJ8 A;  3NE7 A;  4QC6 A;  1IID A;  3LD2 A;  4XPK A;  4CRZ B;  1Z9U A;  2B4D A;  3OWC A;  2Z10 A;  3W6X A;  1KUX A;  1S7F A;  1Q2C A;  2B3V A;  2WPW A;  4H6Z A;  1U6M A;  1MJB A;  3FXT A;  2I79 A;  2DXQ A;  3IWG A;  3DR8 A;  1BO4 A;  1S5K A;  1Z4R A;  4AVC A;  4KZT A;  2Q4Y A;  4OAE A;  4JXR A;  3GYA A;  2BL1 A;  1QST A;  1M1D A;  4MHD A;  2BUE A;  2ATR A;  3FYN A;  2PRB A;  2ZW7 A;  4AVA A;  2REE A;  4HNY B;  1YVO A;  3F8K A;  2R1I A;  3R96 A;  1NMT A;  2PR1 A;  3D8P A;  5C88 A;  5F48 A;  2P0W A;  4E8O A;  2FIA A;  5JPH A;  2VZY A;  4DNC A;  2RC4 A;  4PV6 A;  3VWD A;  3S6F A;  4NEX A;  4XPL A;  1OZP A;  3FB3 A;  3GY9 A;  4KLV A;  3JUW A;  4Y49 C;  4KVM E;  5C82 A;  4ONU A;  1S7K A;  2H5M A;  4KOR A;  4J3G A;  2GE3 A;  3W6S A;  2BEI A;  4BMH A;  2OH1 A;  4MY3 A;  1M4G A;  1YLE A;  4U9Z A;  4UWJ A;  5ISV A;  1M4D A;  2HUZ A;  3DNS A;  3TTH A;  1KUY A;  4KOX A;  2AJ6 A;  3ZJ0 A;  1CJW A;  5IB0 A;  3R9F A;  2PSW A;  4MY0 A;  2FL4 A;  1MK4 A;  4CAW A;  1LRZ A;  2GAN A;  3TCV A;  1GHE A;  3T90 A;  4FD4 A;  3ZZI A;  2VEZ A;  4YGO A;  2K5T A;  4HKF A;  2GIV A;  1YK3 A;  1FY7 A;  1I12 A;  4LUA A;  1Z4E A;  3I9S A;  3S6G A;  1QSN A;  1P0H A;  4CAX A; 
#chains in the Genus database with same CATH topology
 2GLF A;  4A33 A;  1YX0 A;  2D4O A;  3SI2 A;  4RUH A;  1ARM A;  4PXB A;  4TWE A;  5HMN A;  5AG5 A;  2CNM A;  1IYL A;  4ZX9 A;  1R57 A;  2QML A;  1KUV A;  1PUA A;  5AG7 A;  2JEV A;  4MCQ A;  4CYO A;  2FE7 A;  3FX6 A;  3VH9 A;  2EO8 A;  4UIA A;  4NGS A;  2PJC A;  3SJX A;  4AG9 A;  4QBJ A;  3B7I A;  3D67 A;  3D7H A;  3TFY A;  3KHZ A;  2PCU A;  3FJU A;  3H8F A;  4JZ0 A;  1QSM A;  4AG7 A;  3V8I A;  4MBU A;  4AVB A;  4NGT A;  2QYV A;  2F8H A;  5JQ4 A;  5THW A;  1QSO A;  4FBE A;  2BO9 A;  4H89 A;  4C7H A;  4F0X A;  2ODF A;  1Z8W A;  3CZX A;  4PXD A;  1Y0R A;  4BIN A;  4IF5 A;  4UWI A;  5AGE A;  3EY5 A;  3GUX A;  2ARH A;  3PFE A;  1MJ9 A;  2V8G A;  2YNC A;  1R3N A;  4KOY A;  1YLO A;  3LOD A;  3R9G A;  5IX3 A;  1BLL E;  2PRQ A;  3SHP A;  4PSW A;  1OBR A;  1XFO A;  3JVN A;  1XE4 A;  2YNE A;  1CM0 A;  3D7G A;  4MHN A;  1ARL A;  3BI0 A;  2Q44 A;  2PQ8 A;  3PBB A;  1BOB A;  5LYF A;  3FIX A;  3SJF A;  3RO0 A;  2PDO A;  2Q7S A;  2Z0Z A;  4MFZ A;  2OZG A;  4RS2 A;  2RB7 A;  1YME A;  4ORF A;  5KTA A;  1P4N A;  1Y9W A;  3BJ8 A;  4MFJ A;  3DR6 A;  2ZEO A;  5H84 A;  4OC4 A;  5G21 A;  2PJA A;  4R9M A;  4ZI6 A;  3KQZ A;  3BLN A;  2WUU A;  2WYR A;  3F5B A;  3IIB A;  4CGN A;  1TKH A;  3GIU A;  1YVK A;  1H8L A;  3D4U A;  4KUB A;  1XBU A;  1YGH A;  4OLL A;  3QB8 A;  2Q51 A;  4R8F A;  3KAS A;  3FEE A;  2KCW A;  2HV2 A;  3D3S A;  1PCA A;  2QEC A;  4CGL A;  2J8M A;  4NCZ A;  4DUK A;  1ELL P;  1YSJ A;  1Q2D A;  1WK4 A;  4OC3 A;  4ZGY B;  3FRM A;  3SXO A;  3C26 A;  2PJ4 A;  3MGD A;  1WWZ A;  4UA3 A;  2PE3 A;  4KOU A;  3W91 A;  5HH1 A;  2JDC A;  1B87 A;  2FCK A;  1MJA A;  3NE8 A;  2IJZ A;  4R87 A;  3B3V A;  2O53 A;  1TKF A;  2Y0M A;  1CG2 A;  4KS9 A;  3NA6 A;  1M4I A;  1ZO0 A;  4UBR A;  2RFH A;  1XF8 A;  3EO4 A;  3IGR A;  4L89 A;  1BAV A;  3MN8 A;  4OC5 A;  1XIX A;  2EUI A;  2GU2 A;  2VI7 A;  4F0Y A;  2EVN A;  1L0C A;  5LRK A;  3IO1 A;  2V8V A;  1ON0 A;  4AXV A;  1JQG A;  4E2A A;  1XMT A;  2O28 A;  4A95 A;  4JXQ A;  5HVG A;  4G1P A;  4JD6 A;  2ZED A;  3IEH A;  5FVJ A;  5J8F A;  1Y9K A;  4CAF A;  2Z3L A;  3PRT A;  1A2Z A;  4C68 A;  2FXF A;  2PJ5 A;  1YRE A;  1VIX A;  4UFW A;  3B3S A;  3UY5 A;  4CPA A;  1F57 A;  3S9M A;  3EFA A;  3VAT A;  2Q4V A;  3BI1 A;  1I21 A;  4K3N A;  3R1K A;  5H86 A;  1IYK A;  1DE4 C;  2AFZ A;  5EBV A;  5IV0 A;  4U5Y A;  4P45 A;  2JEW A;  3P2F A;  4UCP A;  1VGY A;  3NH5 A;  5E96 A;  4YFJ A;  1XRY A;  4WJB A;  4Q7A A;  1Y7E A;  2PC1 A;  4UIB A;  4HNX B;  1Z8X A;  1I1D A;  4AB7 A;  5KTC A;  2R98 A;  2J8N A;  2Q04 A;  4PXC A;  2ZW5 A;  2Q7B A;  4YWY A;  1IY7 A;  4XNH B;  2YNC C;  4NXY A;  2PJB A;  4PSX A;  3S9N A;  4CGM A;  1NSA A;  1AMP A;  3KZW A;  5LRG A;  4FUU A;  1ZG7 A;  3D66 A;  2B4B A;  2B3U A;  1XOV A;  3H4Q A;  5J1Q A;  3E0K A;  5LYD A;  3SI0 A;  2OB0 A;  7CPA A;  2ZEN A;  3TOB A;  5K8O A;  4M6H A;  2ZOF A;  5F49 A;  1DTD A;  4RI1 A;  4ZY2 A;  4NGR A;  2XEI A;  2FS5 A;  2ZEF A;  1FT7 A;  2FIW A;  2IMO A;  2OZU A;  1S3Z A;  2ZXV A;  5G22 A;  3BHX A;  4JJX A;  5IB9 A;  5J8C A;  4C2Z A;  1IOI A;  2EWB A;  2NYQ A;  2ZEP A;  2ZW6 A;  4PPZ A;  4XPD B;  3T9Y A;  1V0C A;  2B58 A;  3CPA A;  1RXT A;  3LAC A;  3B35 A;  2J8R A;  4LQ6 A;  1LOK A;  3K9T A;  3CXQ A;  5JH9 A;  4OC1 A;  5D29 A;  4B5P B;  4A94 A;  1S7L A;  4M3S A;  2WSA A;  3TE4 A;  2BCO A;  1CX8 A;  3PB4 X;  1Z5R A;  3BXM A;  2CNT A;  4IUS A;  2PIY A;  4OC2 A;  3CXP A;  4NSQ A;  2CXA A;  4C2Y A;  5F46 A;  1M44 A;  4UEE A;  4A32 A;  4HPS A;  1LAN A;  2AFS A;  4LX9 A;  4PQA A;  2QJ8 A;  4KUA A;  4Y49 B;  4DYO A;  5BWA B;  2AFO A;  2PJ8 A;  3SXN A;  1JWQ A;  3MRU A;  3N5F A;  2FT0 A;  4NGQ A;  5F47 A;  3NH4 A;  3QNV A;  1TXR A;  4EME A;  2ZPA A;  5JGF A;  3B2Y A;  1KWM A;  4HNW B;  4PK3 A;  2PJ3 A;  3FH4 A;  1BPM A;  3KKW A;  2Q4Z A;  2PVV A;  1TIQ A;  4DJL A;  2Q0Y A;  4MI4 A;  4MHP A;  1HDQ A;  2P6E A;  3K9U A;  1NE9 A;  2G3T A;  4KLW A;  2D4P A;  5G1Z A;  2QVP A;  3IJ3 A;  3K2K A;  2PJ1 A;  5A27 A;  3S6H A;  1R43 A;  2BSW A;  3RAM A;  4B6Z A;  3NFZ A;  4P4E A;  4NGP A;  2WZN A;  4OC0 A;  3I1U A;  2B4D B;  3A9L A;  1S7N A;  4OKO A;  3PFO A;  4MHZ A;  4BBH A;  1Z8L A;  2R7H A;  4EVY A;  5AG4 A;  1ZLH A;  2WPX A;  4LQG A;  1RO5 A;  1S60 A;  3KGQ A;  2Z3O A;  4KSA A;  4E0A A;  1CP6 A;  4FD7 A;  2OZH A;  4IK2 A;  2Z3K A;  1TF9 A;  1HEE A;  4UEZ A;  3PB6 X;  4UF4 A;  2O4H A;  2ZEE A;  4C2X A;  4KSF A;  4XNH C;  1YW6 A;  2JLM A;  1Q2Y A;  1VKC A;  4KOW A;  4CS0 B;  1NSL A;  1FNO A;  2EK8 A;  1K4J A;  3GLJ A;  3GKR A;  4MXU A;  3TO7 A;  4Z65 A;  2C6P A;  2Z3N A;  3BJ7 A;  4A31 A;  2I00 A;  4ZBG A;  3V38 A;  4QUS A;  3IWE A;  4NFR A;  1LFW A;  2QIR A;  3D7F A;  4M6G A;  4OME A;  4O23 A;  2F7V A;  4I49 A;  4P4B A;  1YQE A;  3PB7 X;  4OP4 A;  4R3L A;  2R8V A;  3KL9 A;  4GXH A;  4KOV A;  4Q36 A;  4UCM A;  2FSR A;  2PIZ A;  4P4J A;  3G8W A;  2G3A A;  3IU1 A;  3FVL A;  4U9Y A;  2PVW A;  3PZJ A;  4OAD A;  2ZEM A;  3PGP A;  4XPD C;  2IL4 A;  1B6B A;  2HB6 A;  3D2P A;  3HUV A;  1UFH A;  2DF5 A;  2Z3P A;  4MCP A;  4R57 A;  3RBU A;  3WAB A;  1VHS A;  1ZG9 A;  1ELM P;  1YW4 A;  3D2M A;  5CPA A;  1Y7R A;  4MCS A;  4P6Y A;  2NMT A;  4K30 A;  4H2K A;  4A30 A;  2F5I A;  2ZEH A;  6CPA A;  5GCN A;  1KZF A;  2JBK A;  3H8E A;  1PYT B;  4X5K A;  4NF1 A;  5F09 A;  3RYO A;  5CNP A;  2VZZ A;  1N71 A;  1VHO A;  2PR8 A;  3G3S A;  3P2H A;  4KVX A;  4NGM A;  3TO9 A;  3F0A A;  3R9E A;  3FMC A;  3KQX A;  3RNZ A;  5K8P A;  2DPT A;  3FF3 A;  3TOA A;  2V8H A;  2CIJ A;  4L8A A;  4PK2 A;  3I3G A;  5EMI A;  5HVF A;  4ZY1 A;  4H6U A;  2XEF A;  3FED A;  4CYN A;  4KOT A;  4CYQ A;  8CPA A;  2AE6 A;  4W9Y A;  3PBE A;  1CPX A;  5DWN A;  3RZA A;  3CXS A;  1HDU A;  1CP7 A;  1J4J A;  1LAM A;  2CTC A;  4CAV A;  4MHY A;  4KOS A;  4Q38 A;  2VBQ A;  3IC1 A;  2ANP A;  2P6G A;  4GS4 A;  1LAP A;  4KVO E;  3SJG A;  1TF8 A;  3FEC A;  4B5O A;  1UWY A;  2Z11 A;  3IWW A;  4JLY A;  2VXK A;  3KHX A;  2YND A;  4JWP A;  1IB1 E;  4QB9 A;  3N7Z A;  1PU9 A;  2HC9 A;  4A39 A;  3B3C A;  2C6G A;  4YRH A;  4KSI A;  2CY2 A;  3T8W A;  4B13 A;  4C7I A;  4NJR A;  3DGV A;  3HLP A;  4F8Z A;  3DSB A;  3WR7 A;  2DPS A;  4NGN A;  2OR4 A;  4B14 A;  5LYI A;  4CRY B;  5G20 A;  4CGO A;  2OU2 A;  3FNC A;  4R3K A;  5HXD A;  2HQY A;  5KTD A;  1XEB A;  3EXN A;  4A2Z A;  4B5P A;  2C1C A;  1EE3 P;  2PJ6 A;  1RTQ A;  4FD5 A;  2P6F A;  2PJ2 A;  3ISX A;  2ABZ A;  1F2O A;  2JDD A;  1QQ9 A;  2V77 A;  1IIC A;  2GRE A;  3DLJ A;  3TO6 A;  2B5G A;  3ISZ A;  3PP9 A;  3VWE A;  2V8D A;  5DWM A;  3DDD A;  4P10 A;  3TT2 A;  4F6A A;  2CNS A;  3H5Z A;  1YR0 A;  4B12 A;  2B5G B;  4M85 A;  2AFW A;  3JTK A;  3FBU A;  4FAI A;  3B8G A;  1XJO A;  2REF A;  3V7Z A;  3EC4 A;  4A37 A;  2ZW4 A;  4IAV A;  4QVT A;  1SQH A;  2VQY A;  4RN7 A;  4ZX8 A;  2A4N A;  2JBJ A;  2X7B A;  2FVG A;  2G0B A;  4P44 A;  3S6K A;  1X10 A;  4FD6 A;  1QSR A;  4MFK A;  3R95 A;  3PEI A;  5EC4 A;  5I0C A;  2C27 A;  4MRI A;  3QAH A;  3LMS A;  1ZLI A;  5D8N A;  4II9 A;  4FWU A;  2XEJ A;  4EWT A;  1Z8T A;  4MJ8 A;  3NE7 A;  4QC6 A;  1IID A;  1F2P A;  2BOA A;  5DS0 A;  3KR5 A;  3LD2 A;  5LRJ A;  1LCP A;  4XPK A;  4CRZ B;  1Z9U A;  2B4D A;  3L2N A;  3VAR A;  3OWC A;  4WWV A;  2Z10 A;  3QAY A;  4MFQ A;  3W6X A;  1KUX A;  1S7F A;  2EBJ A;  5AG6 A;  1IGB A;  1Q2C A;  3SI1 A;  2B3V A;  2WPW A;  4A38 A;  4H6Z A;  1U6M A;  1MJB A;  3FXT A;  2I79 A;  2DXQ A;  5A28 A;  3IWG A;  3DR8 A;  1BO4 A;  1S5K A;  1Z4R A;  4AVC A;  5HVH A;  4F9U A;  4OID A;  4KZT A;  2Q4Y A;  4OAE A;  4JXR A;  3GYA A;  3PB9 X;  4R7M A;  4UFV A;  2BL1 A;  2POK A;  1QST A;  2PJ9 A;  1M1D A;  2CF4 A;  4MHD A;  2BUE A;  2ATR A;  4F9V A;  4X3R A;  3FYN A;  2PRB A;  2AFM A;  2ZW7 A;  4AVA A;  2REE A;  2ZOG A;  4HNY B;  2NSM A;  1YVO A;  3CT9 A;  3IFE A;  3F8K A;  2R1I A;  2OOT A;  2YGW A;  3R96 A;  1IOF A;  1NMT A;  2GFQ A;  2PR1 A;  3D8P A;  4CAE A;  2VL1 A;  5C88 A;  5F48 A;  2P0W A;  2ZEG A;  4MFL A;  4E8O A;  2C6C A;  2PJ0 A;  3WC7 A;  3PB8 X;  2FIA A;  5K8M A;  1IU8 A;  5JPH A;  4OIW A;  2VZY A;  3WC5 A;  5CBM A;  4UEF A;  4DNC A;  2RC4 A;  4ZYQ A;  4PV6 A;  4JYW A;  3VWD A;  3B3W A;  3S6F A;  4NEX A;  4XPL A;  1OZP A;  3FB3 A;  4EFD A;  1TKJ A;  3JRU A;  3GY9 A;  1QMU A;  4KLV A;  4GM5 A;  4P4D A;  4X8I A;  3JUW A;  2DEA A;  4MMO A;  4Y49 C;  5ELY A;  3TX8 A;  4KVM E;  3KI9 A;  5C82 A;  2ZEL A;  3TC8 A;  4ONU A;  3CDX A;  4B10 A;  1S7K A;  1AUG A;  2H5M A;  4IHM A;  1XMB A;  4KOR A;  4MFP A;  1X12 A;  2I3C A;  4J3G A;  2G9D A;  4P4F A;  2GE3 A;  1M4L A;  1Y0Y A;  3KR4 A;  3W6S A;  3H8G A;  2BEI A;  4P4I A;  3WC6 A;  4BMH A;  1BPN A;  2Z3M A;  2OH1 A;  4MY3 A;  1M4G A;  1YLE A;  4U9Z A;  4UWJ A;  5ISV A;  1M4D A;  2HUZ A;  2J9A A;  3DNS A;  3TTH A;  1GYT A;  5JM6 A;  3IU2 A;  4M6I A;  4ZY0 A;  1KUY A;  4CGP A;  2PJ7 A;  4R6T A;  4UFX A;  4KOX A;  2AJ6 A;  3WT4 A;  1ZG8 A;  4TNU A;  3ZJ0 A;  5I4M A;  3CPX A;  2GLJ A;  1CJW A;  4R76 A;  1AYE A;  4X2T A;  2CTB A;  3R9F A;  5IB0 A;  4YU9 A;  3SJE A;  3B3T A;  4CYP A;  4NJQ A;  4ONW A;  2PSW A;  3D7D A;  4MY0 A;  4MCR A;  4UCN A;  2FL4 A;  1MK4 A;  4CAW A;  2IQ6 A;  1LRZ A;  2GAN A;  3TCV A;  1CBX A;  1CPS A;  1GHE A;  1Z2L A;  3D68 A;  4PXE A;  3T90 A;  4FD4 A;  2EK9 A;  3GB0 A;  3ZZI A;  2VEZ A;  4YGO A;  1Q7L A;  2AFU A;  2Q43 A;  4B11 A;  2K5T A;  3LWU A;  5LYL A;  4HKF A;  2GIV A;  4BD9 A;  1VHE A;  3NH8 A;  2AFX A;  1YK3 A;  1FY7 A;  1I12 A;  2XEG A;  1Z4E A;  3I9S A;  4LUA A;  3S6G A;  5K8N A;  1QSN A;  1P0H A;  4CAX A;  3S9L A; 
#chains in the Genus database with same CATH homology
 4A33 A;  1YX0 A;  2D4O A;  5HMN A;  5AG5 A;  2CNM A;  1IYL A;  1R57 A;  2QML A;  1KUV A;  1PUA A;  5AG7 A;  2JEV A;  4CYO A;  2FE7 A;  4AG9 A;  4QBJ A;  3TFY A;  1QSM A;  4AG7 A;  3V8I A;  4MBU A;  5JQ4 A;  1QSO A;  4H89 A;  4C7H A;  4F0X A;  4IF5 A;  4UWI A;  5AGE A;  3EY5 A;  2ARH A;  1MJ9 A;  2YNC A;  4KOY A;  3LOD A;  3R9G A;  5IX3 A;  3SHP A;  4PSW A;  3JVN A;  1XE4 A;  2YNE A;  1CM0 A;  2Q44 A;  2PQ8 A;  1BOB A;  3FIX A;  2PDO A;  4MFZ A;  2Z0Z A;  2OZG A;  4RS2 A;  4ORF A;  5KTA A;  1P4N A;  1Y9W A;  3BJ8 A;  4MFJ A;  3DR6 A;  5H84 A;  5G21 A;  4R9M A;  3BLN A;  2WUU A;  3F5B A;  4CGN A;  1YVK A;  4OLL A;  4KUB A;  1YGH A;  3QB8 A;  2KCW A;  2HV2 A;  3D3S A;  2QEC A;  4CGL A;  2J8M A;  4NCZ A;  1Q2D A;  1WK4 A;  4ZGY B;  3FRM A;  3SXO A;  3C26 A;  3MGD A;  1WWZ A;  4UA3 A;  4KOU A;  3W91 A;  5HH1 A;  2JDC A;  1B87 A;  2FCK A;  1MJA A;  4R87 A;  2Y0M A;  4KS9 A;  1M4I A;  1ZO0 A;  4UBR A;  1XF8 A;  3EO4 A;  3IGR A;  4L89 A;  4F0Y A;  1XIX A;  2EUI A;  2VI7 A;  2EVN A;  1L0C A;  1ON0 A;  4E2A A;  1XMT A;  2O28 A;  4A95 A;  4JXQ A;  4JD6 A;  5FVJ A;  5J8F A;  1Y9K A;  4CAF A;  2Z3L A;  4C68 A;  2FXF A;  1YRE A;  4UFW A;  3UY5 A;  3EFA A;  2Q4V A;  1I21 A;  3R1K A;  5H86 A;  1IYK A;  5EBV A;  5IV0 A;  4U5Y A;  3P2F A;  4UCP A;  4YFJ A;  5E96 A;  2PC1 A;  4HNX B;  4AB7 A;  1I1D A;  5KTC A;  2R98 A;  2J8N A;  2Q04 A;  2ZW5 A;  2Q7B A;  4XNH B;  2YNC C;  4NXY A;  4PSX A;  4CGM A;  2B4B A;  2B3U A;  3H4Q A;  3E0K A;  2OB0 A;  3TOB A;  5F49 A;  4RI1 A;  2FS5 A;  2FIW A;  2OZU A;  1S3Z A;  2ZXV A;  5G22 A;  4JJX A;  5J8C A;  4C2Z A;  2ZW6 A;  4XPD B;  3T9Y A;  1V0C A;  2B58 A;  1RXT A;  2J8R A;  3CXQ A;  4B5P B;  1S7L A;  4M3S A;  2WSA A;  3TE4 A;  2CNT A;  4IUS A;  4C2Y A;  3CXP A;  4NSQ A;  2CXA A;  5F46 A;  1M44 A;  4A32 A;  4LX9 A;  4KUA A;  4Y49 B;  5BWA B;  3SXN A;  2FT0 A;  5F47 A;  2ZPA A;  4HNW B;  4PK3 A;  3KKW A;  1TIQ A;  2Q0Y A;  4MI4 A;  2P6E A;  3K9U A;  1NE9 A;  2G3T A;  4KLW A;  2D4P A;  5G1Z A;  5A27 A;  3S6H A;  2BSW A;  2B4D B;  3A9L A;  1S7N A;  4BBH A;  4EVY A;  2R7H A;  5AG4 A;  2WPX A;  4E0A A;  1RO5 A;  1S60 A;  2Z3O A;  4KSA A;  4FD7 A;  2OZH A;  2Z3K A;  4C2X A;  4KSF A;  4XNH C;  2JLM A;  4CS0 B;  1Q2Y A;  1VKC A;  4KOW A;  1NSL A;  1K4J A;  3GKR A;  3TO7 A;  2Z3N A;  3BJ7 A;  4A31 A;  2I00 A;  4ZBG A;  4QUS A;  3IWE A;  2QIR A;  4I49 A;  4R3L A;  2R8V A;  4KOV A;  4Q36 A;  4UCM A;  2FSR A;  3G8W A;  2G3A A;  3IU1 A;  4U9Y A;  3PZJ A;  4OAD A;  3PGP A;  4XPD C;  2IL4 A;  1B6B A;  4AVB A;  3D2P A;  1UFH A;  2Z3P A;  4R57 A;  1VHS A;  3D2M A;  1Y7R A;  2NMT A;  4K30 A;  4A30 A;  2F5I A;  5GCN A;  1KZF A;  4X5K A;  4NF1 A;  3RYO A;  5CNP A;  2VZZ A;  1N71 A;  2PR8 A;  3G3S A;  3P2H A;  4KVX A;  3TO9 A;  3F0A A;  3R9E A;  2DPT A;  3TOA A;  4L8A A;  4PK2 A;  3I3G A;  4H6U A;  4CYN A;  4KOT A;  4CYQ A;  2AE6 A;  5DWN A;  3CXS A;  1J4J A;  4CAV A;  4KOS A;  4Q38 A;  2VBQ A;  2P6G A;  4GS4 A;  4KVO E;  4B5O A;  2Z11 A;  4JLY A;  4JWP A;  2VXK A;  2YND A;  1IB1 E;  4QB9 A;  3N7Z A;  1PU9 A;  4YRH A;  4C7I A;  2CY2 A;  4B13 A;  3DSB A;  3WR7 A;  2DPS A;  4B14 A;  4CRY B;  5G20 A;  4CGO A;  2OU2 A;  3FNC A;  4R3K A;  2HQY A;  5KTD A;  1XEB A;  3EXN A;  4A2Z A;  4B5P A;  4FD5 A;  2P6F A;  2JDD A;  1IIC A;  3TO6 A;  2B5G A;  3PP9 A;  3VWE A;  5DWM A;  3DDD A;  4F6A A;  3TT2 A;  2CNS A;  3H5Z A;  1YR0 A;  4B12 A;  2B5G B;  4M85 A;  3JTK A;  3FBU A;  3B8G A;  2REF A;  3EC4 A;  2ZW4 A;  4QVT A;  1SQH A;  2VQY A;  2A4N A;  2X7B A;  2G0B A;  3S6K A;  4FD6 A;  1QSR A;  4MFK A;  3R95 A;  5EC4 A;  5I0C A;  2C27 A;  3QAH A;  4II9 A;  4MJ8 A;  3NE7 A;  4QC6 A;  1IID A;  3LD2 A;  4XPK A;  4CRZ B;  1Z9U A;  2B4D A;  3OWC A;  2Z10 A;  4MFQ A;  3W6X A;  1KUX A;  1S7F A;  5AG6 A;  1Q2C A;  2B3V A;  2WPW A;  4H6Z A;  1U6M A;  1MJB A;  3FXT A;  2I79 A;  2DXQ A;  5A28 A;  3IWG A;  3DR8 A;  1BO4 A;  1S5K A;  1Z4R A;  4AVC A;  4KZT A;  2Q4Y A;  4OAE A;  4JXR A;  3GYA A;  4UFV A;  2BL1 A;  1QST A;  1M1D A;  4MHD A;  2BUE A;  2ATR A;  3FYN A;  2PRB A;  2ZW7 A;  4AVA A;  2REE A;  4HNY B;  1YVO A;  3F8K A;  2R1I A;  2YGW A;  3R96 A;  1NMT A;  2PR1 A;  4CAE A;  3D8P A;  5C88 A;  5F48 A;  2P0W A;  4MFL A;  4E8O A;  2FIA A;  5JPH A;  2VZY A;  4DNC A;  2RC4 A;  4PV6 A;  3VWD A;  3S6F A;  4NEX A;  4XPL A;  1OZP A;  3FB3 A;  3GY9 A;  4KLV A;  3JUW A;  4Y49 C;  4KVM E;  5C82 A;  4ONU A;  4B10 A;  1S7K A;  2H5M A;  4KOR A;  4MFP A;  4J3G A;  2GE3 A;  3W6S A;  2BEI A;  4BMH A;  2Z3M A;  2OH1 A;  4MY3 A;  1M4G A;  1YLE A;  4U9Z A;  4UWJ A;  5ISV A;  1M4D A;  2HUZ A;  3DNS A;  3TTH A;  3IU2 A;  1KUY A;  4CGP A;  4UFX A;  4KOX A;  2AJ6 A;  3ZJ0 A;  1CJW A;  5IB0 A;  3R9F A;  4CYP A;  2PSW A;  4MY0 A;  4UCN A;  2FL4 A;  1MK4 A;  4CAW A;  1LRZ A;  2GAN A;  3TCV A;  1GHE A;  3T90 A;  4FD4 A;  3ZZI A;  2VEZ A;  4YGO A;  4B11 A;  2K5T A;  4HKF A;  2GIV A;  1YK3 A;  1FY7 A;  1I12 A;  4LUA A;  1Z4E A;  3I9S A;  3S6G A;  1QSN A;  1P0H A;  4CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...