3TCVA

Crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
221
structure length
221
Chain Sequence
LQNWTPRPKPERKIFEGRYVRLEPLNAQKHGDELFAASSVEDAEQRFTWLFETPPATRAEFEPWLDKASKSDDPLFFAVIDKASGKVAGRQALMRIDPANGVIEIGSIYWGPLISRRPAATEAQFLFMQYVFDVLGYRRYEWECHNENGPSRRAAERFGFRFEGIFRQHMVVKGRNRDTAWFSVLDSEWPALKQAYQAWLAPENFDSAGQQKKTLQEFRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
publication title Crystal structure of a GCN5-related N-acetyltransferase from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus 2308
total genus 78
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3tcvA00
2R98A 2B3UA 4M85A 2Q4YA 2RC4A 1QSOA 2JLMA 3D8PA 4KLVA 5IV0A 3FYNA 4KVME 4U9YA 2OH1A 2REFA 3F0AA 4L89A 4FD5A 4R9MA 4JD6A 5J8CA 4MY3A 4MBUA 3K9UA 4OADA 1M4IA 1SQHA 1YGHA 4AVCA 1Z4RA 3G3SA 4JXRA 1Q2CA 2G3TA 2PQ8A 5I0CA 1XMTA 4YFJA 5C88A 4QUSA 1V0CA 1VHSA 2AJ6A 2VZYA 4EVYA 4MI4A 1S7NA 1BO4A 1M44A 2B5GA 2GANA 1Z9UA 1NSLA 2R1IA 1BOBA 3W91A 3CXSA 4U9ZA 3KKWA 4II9A 3I9SA 1XE4A 1I21A 2Z11A 4E8OA 2HQYA 1YREA 2QIRA 4JLYA 2REEA 3R96A 2PC1A 3FBUA 2OZUA 1S7KA 3FNCA 1RXTA 4ONUA 3FRMA 3BJ7A 4RS2A 1Z4EA 3TT2A 4FD4A 3JUWA 4QVTA 1MK4A 4NXYA 1M4GA 2Q44A 1J4JA 4LX9A 4R3LA 2P6GA 3BLNA 4I49A 4KOWA 1KUYA 2A4NA 3TTHA 2R8VA 3S6HA 3CXPA 2PDOA 1S5KA 3B8GA 4QC6A 4B5OA 2VZZA 3TE4A 4XPLA 4XPDB 2ATRA 3S6FA 2X7BA 5F48A 4KUBA 1KZFA 1QSMA 5DWNA 4H6ZA 4QBJA 4IUSA 1N71A 3T90A 1S7LA 2P6EA 1Q2DA 4R57A 2Q04A 3EO4A 2ZW5A 4UBRA 2J8RA 2QMLA 5F46A 3RYOA 4HNYB 5H84A 4OAEA 3TO9A 3TO7A 4L8AA 1YR0A 3W6SA 3MGDA 5EBVA 4MY0A 1IICA 3FIXA 1XIXA 5DWMA 5HH1A 4KVOE 4CRYB 2VQYA 4KOVA 2J8MA 4KOUA 2BUEA 2B58A 2Q7BA 2G0BA 1YVKA 5KTCA 2FE7A 2Z0ZA 4FD6A 5CNPA 3D3SA 3TOAA 5IB0A 4KUAA 2P6FA 2Q4VA 4HKFA 2PR1A 2ZW7A 3W6XA 4YRHA 3TO6A 2B5GB 5F49A 1Y9WA 3QAHA 2QECA 2R7HA 4PSWA 3TOBA 2GE3A 1MJBA 2CY2A 1NE9A 3VWEA 4BMHA 1YX0A 3GKRA 2JEVA 5F47A 4PK2A 3S6GA 3P2FA 1R57A 1WK4A 4JWPA 3EC4A 4AVBA 5JPHA 5KTDA 2FIWA 4R87A 5IX3A 1YLEA 1U6MA 1QSTA 4AG9A 2K5TA 4KOTA 4YGOA 3R1KA 2IL4A 3GYAA 1K4JA 4AVAA 1PU9A 3ZZIA 3P2HA 2VI7A 2NMTA 2ARHA 4PK3A 2VEZA 1YVOA 1VKCA 2B3VA 3NE7A 2FIAA 3DNSA 1TIQA 2JDDA 4QB9A 1MJAA 1IYLA 2FSRA 1XF8A 2OB0A 4MHDA 4KOXA 2OZGA 4H89A 5H86A 4HNWB 5GCNA 3V8IA 2EUIA 4GS4A 5KTAA 3EY5A 2HUZA 3FXTA 1PUAA 2H5MA 2C27A 2KCWA 1S3ZA 1UFHA 4LUAA 4F6AA 1Y7RA 3F5BA 4NF1A 3GY9A 3H4QA 3R9EA 3WR7A 4KZTA 3S6KA 2CNTA 3LODA 3UY5A 4XNHB 3T9YA 2O28A 2WPXA 1FY7A 3IWGA 4MJ8A 4PV6A 2PR8A 5ISVA 3EFAA 2BSWA 3QB8A 3JVNA 2ZW6A 3DDDA 3E0KA 4ZBGA 2FS5A 3D2MA 3LD2A 1Y9KA 4HNXB 2J8NA 4U5YA 3CXQA 1LRZA 2P0WA 4UA3A 2B4BA 1CM0A 3C26A 4Y49B 4AB7A 1S60A 4E2AA 3R9GA 2D4OA 4B5PA 1M1DA 4CAWA 2B4DA 3BJ8A 5JQ4A 4RI1A 1IYKA 4KLWA 4ORFA 3N7ZA 1P4NA 4FD7A 2Y0MA 3PZJA 4F0YA 1B6BA 4JJXA 1GHEA 4X5KA 2PSWA 4UWIA 4CS0B 1L0CA 4OLLA 4KOYA 4H6UA 4E0AA 1IIDA 3IGRA 4UWJA 1KUXA 4CRZB 1P0HA 3ZJ0A 2FL4A 2AE6A 3TFYA 2PRBA 4K30A 2CNSA 1QSNA 4CAVA 2Z10A 2G3AA 4NCZA 1KUVA 1XEBA 5E96A 4R3KA 4PSXA 4J3GA 4XPKA 3F8KA 1CJWA 4NSQA 3DR6A 3FB3A 1WWZA 5EC4A 2F5IA 2JDCA 3EXNA 4JXQA 4NEXA 4CAXA 4XPDC 3OWCA 2FT0A 1NMTA 2FXFA 2DXQA 2I00A 3DR8A 1RO5A 3D2PA 4M3SA 2CNMA 2GIVA 1S7FA 3R95A 3G8WA 3SXOA 4IF5A 2Q0YA 3TCVA 2OZHA 4XNHC 4KVXA 2ZW4A 4DNCA 2D4PA 1B87A 1ON0A 1YK3A 2VXKA 2ZXVA 2VBQA 1I1DA 1MJ9A 1I12A 2HV2A 2BEIA 3PP9A 1Q2YA 3SXNA 4KORA 2ZPAA 3I3GA 1IB1E 4Y49C 2FCKA 5C82A 3SHPA 1OZPA 2EVNA 1M4DA 2I79A 2WPWA 2OU2A 1QSRA 3PGPA 4AG7A 3R9FA 3VWDA 5FVJA 3DSBA 5HMNA 5J8FA 4KOSA 4B5PB 2B4DB 2BL1A
chains in the Genus database with same CATH superfamily
2R98A 4K3NA 2B3UA 4KS9A 3PB8X 3CPAA 5EMIA 4A95A 1IOIA 1ZO0A 4M85A 2J9AA 1ZLIA 2Q4YA 2RC4A 4JYWA 1QSOA 3SI2A 4WJBA 2PIZA 1M4LA 2JLMA 1FNOA 3D8PA 4KLVA 5IV0A 3FYNA 4KVME 4U9YA 2OH1A 2REFA 3F0AA 3PB9X 4FD5A 4L89A 4UCNA 2PJ4A 3D7HA 4R9MA 2Z3MA 2G9DA 3FMCA 1TF8A 4JD6A 2PJ6A 4IHMA 5J8CA 2XEFA 1XBUA 4MY3A 1NSAA 1AMPA 5F09A 1BAVA 4MBUA 3FVLA 3MRUA 4PXEA 3K9UA 4OADA 1R3NA 1M4IA 1SQHA 1YGHA 2JBJA 4TNUA 4CYQA 5A27A 3PFOA 4AVCA 1Z4RA 3G3SA 4JXRA 1ELMP 4UEZA 1Q2CA 2G3TA 3BI1A 1YW6A 4P10A 2PQ8A 1ZLHA 3B3TA 3RBUA 3VARA 2C6PA 5I0CA 3PFEA 2BO9A 3RAMA 3PBBA 1XMTA 5LRGA 4YFJA 5BWAB 5C88A 1QMUA 1RTQA 3BHXA 4QUSA 1V0CA 1VHSA 2AJ6A 2VZYA 4EVYA 4MI4A 1S7NA 4HPSA 4OMEA 1BO4A 1M44A 2B5GA 4CPAA 2AFMA 1EE3P 2GANA 1HDUA 1F2PA 3NH5A 5LYIA 1Z9UA 1NSLA 4LQ6A 4B13A 4P4IA 5AGEA 5LYLA 1UWYA 5A28A 2R1IA 1BOBA 3KQXA 4MXUA 3FX6A 1LCPA 4NGTA 3WT4A 3W91A 2O4HA 2ZEDA 3CXSA 4ZY1A 4NGNA 2PJ9A 2PJAA 1BPMA 4M6IA 4MFQA 4U9ZA 3KKWA 2ZOGA 4II9A 3I9SA 5CPAA 1XE4A 1I21A 4FAIA 2PRQA 1Y0YA 2Z11A 4E8OA 2HQYA 2IMOA 6CPAA 2AFXA 2I3CA 1YREA 1A2ZA 2QIRA 1Z8LA 4JLYA 4DJLA 2DEAA 3NH4A 2REEA 4YWYA 4P4BA 3R96A 2PC1A 3FBUA 3IWEA 3RO0A 2PJ5A 1Z8WA 3PB7X 1AYEA 2OZUA 4A33A 2JEWA 4M6HA 4UFVA 4ZY0A 1S7KA 3FNCA 1RXTA 4O23A 4ONUA 4W9YA 3FRMA 2GFQA 3BJ7A 4MCQA 4RS2A 4CGMA 8CPAA 1Z4EA 3KHZA 3TT2A 4OC5A 4FD4A 4ZX9A 3JUWA 3JTKA 4QVTA 4MCRA 4RUHA 4DUKA 1MK4A 2XEIA 4NXYA 1LANA 1M4GA 3FJUA 2Q44A 1J4JA 4LX9A 4R3LA 3H8GA 2P6GA 2EWBA 3BLNA 2PJ2A 4I49A 4KOWA 2PJ1A 3LMSA 1KUYA 4P4EA 3WC6A 1TKJA 5HXDA 3PB6X 3NFZA 1DTDA 2A4NA 3TTHA 2R8VA 3S6HA 2V8GA 3B3VA 3CXPA 2PDOA 3DLJA 1S5KA 3GUXA 3B8GA 3FEEA 4QC6A 2VZZA 4B5OA 2OR4A 4BD9A 2AFUA 2WSAA 4OC1A 5DS0A 3K2KA 2QJ8A 4XPLA 3TE4A 4XPDB 1KWMA 2ATRA 4MHNA 1ZG8A 3S6FA 2ZEMA 2V77A 2X7BA 4EMEA 1Q7LA 5F48A 2FVGA 3IFEA 3PRTA 4MMOA 2Z3PA 4KUBA 4OC3A 4TWEA 1KZFA 1QSMA 5LRJA 4EFDA 5DWNA 4H6ZA 4QBJA 1JWQA 4IUSA 4P44A 3DGVA 2NYQA 1N71A 3T90A 1F2OA 1FT7A 4A38A 4WWVA 1S7LA 2CTCA 1XMBA 1Q2DA 2P6EA 2PVWA 3CPXA 1IY7A 4F9UA 4R57A 5JH9A 2Q04A 2RB7A 3EO4A 1YLOA 1IGBA 2ZW5A 4UBRA 3GB0A 2J8RA 2QMLA 5AG5A 2O53A 2OOTA 5F46A 3RYOA 1CX8A 4HNYB 2YNCC 4OAEA 5H84A 5K8OA 3VH9A 3TO9A 3TO7A 4L8AA 1YR0A 4CGNA 2EK9A 3RZAA 3W6SA 3MGDA 3QAYA 4UCMA 5EBVA 4MY0A 3CT9A 1IICA 4KSIA 3FIXA 3KR4A 1XIXA 5D8NA 1Z2LA 5DWMA 4KVOE 5HH1A 3SI1A 4CRYB 5I4MA 2VQYA 4FWUA 4KOVA 4JZ0A 2J8MA 4B14A 2PJCA 4F8ZA 4KOUA 2BUEA 2B58A 3S9NA 4B6ZA 3KQZA 2Q7BA 2G0BA 3IC1A 3KHXA 1YVKA 4X3RA 5KTCA 1YQEA 2FE7A 2Z0ZA 4FD6A 4NJQA 5CNPA 3D3SA 3TOAA 4C7HA 4UIBA 5IB0A 2HB6A 2PJ7A 4KUAA 1OBRA 1VHOA 2P6FA 4R76A 2Q4VA 2IJZA 4HKFA 2PR1A 2ZW7A 2PJ0A 2Q51A 4MCPA 3W6XA 4OKOA 5K8PA 4YRHA 3TO6A 1YSJA 2B5GB 5F49A 5HVGA 1Y9WA 3QAHA 2QECA 2ZELA 4Q38A 2R7HA 4PSWA 4GXHA 2GE3A 1IOFA 1MJBA 1XFOA 2YNCA 3TOBA 5JM6A 3RNZA 2CY2A 1NE9A 3VWEA 1CG2A 4MFPA 2AFZA 4BMHA 4AXVA 1YX0A 3GKRA 2V8DA 2JEVA 1LAMA 3H8EA 4F0XA 4IAVA 5F47A 4PK2A 3S6GA 3P2FA 4G1PA 1R57A 3WC7A 4NGRA 1WK4A 4JWPA 5G21A 3EC4A 4P4DA 4AVBA 5JPHA 5KTDA 4R6TA 2FIWA 2NSMA 4R87A 2BOAA 4A94A 5IX3A 1ARLA 1U6MA 1YLEA 4A39A 4ZX8A 1QSTA 2IQ6A 4AG9A 1CP6A 4OC4A 4ONWA 2K5TA 3JRUA 1PCAA 4KOTA 1X10A 4CYPA 1VIXA 3R1KA 4YGOA 2IL4A 3GYAA 2XEJA 4Z65A 4NGSA 1K4JA 4OC0A 4AVAA 3B35A 1PU9A 4MHYA 4CGPA 2ZOFA 3ZZIA 3P2HA 1LFWA 2VI7A 2NMTA 2ARHA 4UFWA 4PK3A 2VEZA 1YVOA 1ELLP 1VKCA 2B3VA 3NE7A 2FIAA 3DNSA 1TIQA 2JDDA 4QB9A 2AFWA 1MJAA 1IYLA 3KGQA 3FF3A 4ZY2A 4CYNA 2FSRA 2CXAA 3LWUA 4C7IA 1AUGA 2WUUA 1PYTB 5ELYA 1XF8A 2CIJA 2OB0A 4MHDA 4MCSA 4KOXA 2OZGA 4OP4A 4H89A 3BXMA 5H86A 4HNWB 5GCNA 1ARMA 3V8IA 2EUIA 3B3CA 2GLFA 4GS4A 5KTAA 3B3WA 3EY5A 3LACA 2HUZA 3B2YA 4Q7AA 2ANPA 1ZG9A 3FXTA 1PUAA 2H5MA 2GLJA 4PXDA 2C27A 1ZG7A 2KCWA 4R7MA 3SJFA 3GIUA 4CGLA 1S3ZA 4A30A 1UFHA 2HC9A 1Y7EA 3I1UA 4P45A 4LUAA 4F6AA 1Y7RA 3F5BA 4NF1A 2DPTA 3GY9A 2ABZA 3D67A 4A37A 3H4QA 2QVPA 2ZEEA 3R9EA 3WR7A 4KZTA 3S6KA 3V38A 2CNTA 3LODA 4X8IA 3UY5A 4XNHB 3PB4X 3TC8A 5G22A 3T9YA 3D66A 4BBHA 2O28A 2WPXA 1FY7A 2CTBA 3HUVA 3IWGA 4MJ8A 4PV6A 1Y0RA 4MFZA 4C2XA 2PR8A 5ISVA 3QNVA 3EFAA 2Z3OA 2BSWA 3QB8A 5JGFA 7CPAA 3H8FA 3IIBA 2ODFA 3JVNA 4NJRA 2ZW6A 4Q36A 2BCOA 3DDDA 3E0KA 3K9TA 4ZBGA 4DYOA 2FS5A 3D2MA 3IU1A 3LD2A 1Y9KA 4HNXB 1TKFA 2J8NA 4OIDA 2GREA 2XEGA 4U5YA 3WC5A 3CXQA 2F8HA 1LRZA 4ZI6A 2P0WA 5AG4A 4UA3A 2B4BA 1CM0A 3C26A 4Y49B 3A9LA 2F7VA 1CBXA 4AB7A 3CDXA 1YMEA 3KR5A 1TF9A 1S60A 2Q7SA 4E2AA 2ZEHA 3R9GA 2D4OA 4B5PA 1M1DA 4CAWA 2B4DA 3PBEA 3BJ8A 5HVFA 1F57A 4YU9A 1IU8A 5JQ4A 2V8HA 4RI1A 1IYKA 4PPZA 1QQ9A 4ZYQA 1LOKA 3IO1A 4GM5A 4KLWA 4ORFA 3N7ZA 3L2NA 5LRKA 2C6GA 1P4NA 4FD7A 2Z3NA 2Y0MA 1TXRA 4P6YA 4B10A 3PZJA 4MFLA 4UF4A 4F0YA 1B6BA 4JJXA 1GHEA 4OC2A 3IEHA 4X5KA 1VHEA 2PJBA 2PSWA 2AFOA 4UWIA 4CS0B 1L0CA 2ZEOA 4OLLA 4CAEA 2V8VA 3WABA 4EWTA 2WZNA 4KOYA 1BPNA 2PE3A 2POKA 4H6UA 3S9LA 3FH4A 4E0AA 1IIDA 3FECA 3HLPA 3IGRA 4IK2A 2DF5A 1CPSA 1Z8XA 4UWJA 1HEEA 2VL1A 2PVVA 3H5ZA 5G20A 2EBJA 4NGPA 1KUXA 3ISXA 2ZEGA 5LYDA 4KSAA 4MRIA 1BLLE 4UCPA 1P0HA 4CRZB 4A31A 3D68A 4MHZA 3CZXA 3ZJ0A 2FL4A 2JBKA 2AE6A 3NH8A 3TFYA 2PRBA 2PJ3A 4K30A 4PXBA 3PEIA 2CNSA 4RN7A 4P4JA 4MFJA 2Q43A 1QSNA 4MHPA 2Z10A 4CAVA 2G3AA 4X2TA 2Z3LA 4FBEA 4NCZA 1KUVA 1GYTA 1TKHA 1XEBA 5E96A 4R3KA 4PSXA 1XOVA 3GLJA 1CPXA 3KI9A 4J3GA 4A32A 3SJGA 4XPKA 3F8KA 3VATA 2ZEFA 2EK8A 1CJWA 2C6CA 1H8LA 5J1QA 2GU2A 4NSQA 1R43A 3FEDA 3IJ3A 3DR6A 2WYRA 4LQGA 5CBMA 2AFSA 3NE8A 5AG6A 3FB3A 1WWZA 5EC4A 1XJOA 2F5IA 2DPSA 2JDCA 3EXNA 4JXQA 3N5FA 4NEXA 4XPDC 3OWCA 2FT0A 1NMTA 2FXFA 4UFXA 2DXQA 3MN8A 2I00A 5LYFA 3DR8A 4A2ZA 1RO5A 4CAFA 3V7ZA 3D2PA 2CNMA 4M3SA 2GIVA 1S7FA 4NFRA 4R8FA 3G8WA 4UEFA 3R95A 3TX8A 3SXOA 2YGWA 2CF4A 4IF5A 4KSFA 3S9MA 4C2ZA 2Q0YA 4C2YA 3TCVA 2OZHA 3D7DA 3SJEA 4XNHC 4KVXA 2ZW4A 1CP7A 4DNCA 2ZENA 4B11A 2D4PA 5IB9A 2PCUA 1B87A 3IU2A 4CGOA 3D7GA 4F9VA 3IWWA 3BI0A 1ON0A 5G1ZA 5THWA 4BINA 1YK3A 5K8NA 2VXKA 1VGYA 2YNEA 2ZXVA 2VBQA 1I1DA 1MJ9A 3SI0A 4PXCA 1I12A 1Z8TA 1YW4A 2BEIA 2HV2A 2ZEPA 3PP9A 4B12A 4UIAA 2Q4ZA 1HDQA 1Q2YA 4P4FA 3SXNA 1X12A 3D4UA 2YNDA 1XRYA 3B3SA 3KZWA 4CAXA 3B7IA 4KORA 2ZPAA 3I3GA 1IB1E 4PQAA 4NGQA 4Y49C 5K8MA 2FCKA 5C82A 3SHPA 4OIWA 4NGMA 1OZPA 3SJXA 3KASA 2EVNA 1M4DA 2I79A 3ISZA 4M6GA 2WPWA 4C68A 2OU2A 3NA6A 5D29A 1DE4C 2EO8A 1QSRA 3PGPA 4AG7A 1LAPA 4CYOA 4FUUA 3R9FA 5HVHA 2QYVA 3D7FA 3VWDA 2PIYA 3T8WA 5FVJA 1JQGA 4H2KA 5AG7A 4ZGYB 3DSBA 5HMNA 5J8FA 2RFHA 1Z5RA 2PJ8A 3KL9A 4KOSA 4UEEA 4B5PB 2B4DB 2BL1A 2C1CA 4MFKA 2Z3KA
chains in the Genus database with same CATH topology
2R98A 2B3UA 4KS9A 4A95A 1ZO0A 4M85A 2Q4YA 2RC4A 1QSOA 2JLMA 3D8PA 4KLVA 5IV0A 3FYNA 4KVME 4U9YA 2OH1A 2REFA 3F0AA 4L89A 4FD5A 4UCNA 4R9MA 2Z3MA 4JD6A 5J8CA 4MY3A 4MBUA 3K9UA 4OADA 1M4IA 1SQHA 1YGHA 4CYQA 5A27A 4AVCA 1Z4RA 3G3SA 4JXRA 1Q2CA 2G3TA 2PQ8A 5I0CA 1XMTA 4YFJA 5BWAB 5C88A 4QUSA 1V0CA 1VHSA 2AJ6A 2VZYA 4EVYA 4MI4A 1S7NA 1BO4A 1M44A 2B5GA 2GANA 1Z9UA 1NSLA 4B13A 5AGEA 5A28A 2R1IA 1BOBA 3W91A 3CXSA 4MFQA 4U9ZA 3KKWA 4II9A 3I9SA 1XE4A 1I21A 2Z11A 4E8OA 2HQYA 1YREA 2QIRA 4JLYA 2REEA 3R96A 2PC1A 3FBUA 3IWEA 2OZUA 4A33A 4UFVA 1S7KA 3FNCA 1RXTA 4ONUA 3FRMA 3BJ7A 4CGMA 4RS2A 1Z4EA 3TT2A 4FD4A 3JUWA 3JTKA 4QVTA 1MK4A 4NXYA 1M4GA 2Q44A 1J4JA 4LX9A 4R3LA 2P6GA 3BLNA 4I49A 4KOWA 1KUYA 2A4NA 3TTHA 2R8VA 3S6HA 3CXPA 2PDOA 1S5KA 3B8GA 4QC6A 4B5OA 2VZZA 2WSAA 3TE4A 4XPLA 4XPDB 2ATRA 3S6FA 2X7BA 5F48A 2Z3PA 4KUBA 1KZFA 1QSMA 5DWNA 4H6ZA 4QBJA 4IUSA 1N71A 3T90A 1S7LA 2P6EA 1Q2DA 4R57A 2Q04A 3EO4A 2ZW5A 4UBRA 2J8RA 2QMLA 5AG5A 5F46A 3RYOA 4HNYB 2YNCC 4OAEA 5H84A 3TO9A 3TO7A 4L8AA 1YR0A 4CGNA 3W6SA 3MGDA 4UCMA 5EBVA 4MY0A 1IICA 3FIXA 1XIXA 5DWMA 5HH1A 4KVOE 4CRYB 2VQYA 4KOVA 2J8MA 4B14A 4KOUA 2BUEA 2B58A 2Q7BA 2G0BA 1YVKA 5KTCA 2FE7A 2Z0ZA 4FD6A 5CNPA 3D3SA 3TOAA 4C7HA 5IB0A 4KUAA 2P6FA 2Q4VA 4HKFA 2PR1A 2ZW7A 3W6XA 4YRHA 3TO6A 2B5GB 5F49A 1Y9WA 3QAHA 2QECA 4Q38A 2R7HA 4PSWA 3TOBA 2GE3A 1MJBA 2YNCA 2CY2A 1NE9A 3VWEA 4MFPA 4BMHA 1YX0A 3GKRA 2JEVA 4F0XA 5F47A 4PK2A 3S6GA 3P2FA 1R57A 5G21A 1WK4A 4JWPA 3EC4A 4AVBA 5JPHA 5KTDA 2FIWA 4R87A 5IX3A 1YLEA 1U6MA 1QSTA 4AG9A 4ZGYB 2K5TA 4CYPA 4KOTA 4YGOA 3R1KA 2IL4A 3GYAA 1K4JA 4AVAA 1PU9A 4CGPA 3ZZIA 3P2HA 2VI7A 2NMTA 2ARHA 4UFWA 4PK3A 2VEZA 1YVOA 1VKCA 2B3VA 3NE7A 2FIAA 3DNSA 1TIQA 2JDDA 4QB9A 1MJAA 1IYLA 4CYNA 2FSRA 2CXAA 4C7IA 2WUUA 1XF8A 2OB0A 4MHDA 4KOXA 2OZGA 4H89A 5H86A 4HNWB 5GCNA 3V8IA 2EUIA 4GS4A 5KTAA 3EY5A 2HUZA 3FXTA 1PUAA 2H5MA 2C27A 2KCWA 4CGLA 1S3ZA 4A30A 1UFHA 4LUAA 4F6AA 1Y7RA 3F5BA 4NF1A 2DPTA 3GY9A 3H4QA 3R9EA 3WR7A 4KZTA 3S6KA 2CNTA 3LODA 3UY5A 4XNHB 5G22A 3T9YA 4BBHA 2O28A 2WPXA 1FY7A 3IWGA 4MJ8A 4PV6A 4C2XA 4MFZA 2PR8A 5ISVA 3EFAA 2Z3OA 2BSWA 3QB8A 3JVNA 2ZW6A 4Q36A 3DDDA 3E0KA 4ZBGA 2FS5A 3D2MA 3IU1A 3LD2A 1Y9KA 4HNXB 2J8NA 4U5YA 3CXQA 1LRZA 2P0WA 5AG4A 4UA3A 2B4BA 1CM0A 3C26A 4Y49B 3A9LA 4AB7A 1S60A 4E2AA 3R9GA 2D4OA 4B5PA 1M1DA 4CAWA 2B4DA 3BJ8A 5JQ4A 4RI1A 1IYKA 4KLWA 4ORFA 3N7ZA 1P4NA 4FD7A 2Z3NA 2Y0MA 4B10A 3PZJA 4MFLA 4F0YA 1B6BA 4JJXA 1GHEA 4X5KA 2PSWA 4UWIA 4CS0B 1L0CA 4OLLA 4CAEA 4KOYA 4H6UA 4E0AA 1IIDA 3IGRA 4UWJA 3H5ZA 5G20A 1KUXA 4KSAA 4UCPA 4CRZB 1P0HA 4A31A 3ZJ0A 2FL4A 2AE6A 3TFYA 2PRBA 4K30A 2CNSA 4MFJA 1QSNA 4CAVA 2Z10A 2G3AA 2Z3LA 4NCZA 1KUVA 1XEBA 5E96A 4R3KA 4PSXA 4A32A 4J3GA 4XPKA 3F8KA 1CJWA 4NSQA 3DR6A 5AG6A 3FB3A 1WWZA 5EC4A 2F5IA 2JDCA 2DPSA 4JXQA 3EXNA 4NEXA 4CAXA 4XPDC 3OWCA 2FT0A 1NMTA 2FXFA 4UFXA 2DXQA 2I00A 3DR8A 4A2ZA 1RO5A 4CAFA 3D2PA 2CNMA 4M3SA 2GIVA 1S7FA 3R95A 3G8WA 3SXOA 2YGWA 4IF5A 4KSFA 4C2ZA 2Q0YA 4C2YA 3TCVA 2OZHA 4XNHC 4KVXA 2ZW4A 4DNCA 4B11A 2D4PA 3IU2A 1B87A 4CGOA 5G1ZA 1ON0A 1YK3A 2VXKA 2YNEA 2ZXVA 2VBQA 1I1DA 1MJ9A 1I12A 2HV2A 2BEIA 4B12A 3PP9A 1Q2YA 3SXNA 2YNDA 4KORA 2ZPAA 3I3GA 1IB1E 4Y49C 2FCKA 5C82A 3SHPA 1OZPA 2EVNA 1M4DA 2I79A 2WPWA 4C68A 2OU2A 1QSRA 3PGPA 4AG7A 4CYOA 3R9FA 3VWDA 5FVJA 5AG7A 3DSBA 5HMNA 5J8FA 4KOSA 4B5PB 2B4DB 2BL1A 4MFKA 2Z3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R98 A;  2B3U A;  4M85 A;  2Q4Y A;  2RC4 A;  1QSO A;  2JLM A;  3D8P A;  4KLV A;  5IV0 A;  3FYN A;  4KVM E;  4U9Y A;  2OH1 A;  2REF A;  3F0A A;  4L89 A;  4FD5 A;  4R9M A;  4JD6 A;  5J8C A;  4MY3 A;  4MBU A;  3K9U A;  4OAD A;  1M4I A;  1SQH A;  1YGH A;  4AVC A;  1Z4R A;  3G3S A;  4JXR A;  1Q2C A;  2G3T A;  2PQ8 A;  5I0C A;  1XMT A;  4YFJ A;  5C88 A;  4QUS A;  1V0C A;  1VHS A;  2AJ6 A;  2VZY A;  4EVY A;  4MI4 A;  1S7N A;  1BO4 A;  1M44 A;  2B5G A;  2GAN A;  1Z9U A;  1NSL A;  2R1I A;  1BOB A;  3W91 A;  3CXS A;  4U9Z A;  3KKW A;  4II9 A;  3I9S A;  1XE4 A;  1I21 A;  2Z11 A;  4E8O A;  2HQY A;  1YRE A;  2QIR A;  4JLY A;  2REE A;  3R96 A;  2PC1 A;  3FBU A;  2OZU A;  1S7K A;  3FNC A;  1RXT A;  4ONU A;  3FRM A;  3BJ7 A;  4RS2 A;  1Z4E A;  3TT2 A;  4FD4 A;  3JUW A;  4QVT A;  1MK4 A;  4NXY A;  1M4G A;  2Q44 A;  1J4J A;  4LX9 A;  4R3L A;  2P6G A;  3BLN A;  4I49 A;  4KOW A;  1KUY A;  2A4N A;  3TTH A;  2R8V A;  3S6H A;  3CXP A;  2PDO A;  1S5K A;  3B8G A;  4QC6 A;  4B5O A;  2VZZ A;  3TE4 A;  4XPL A;  4XPD B;  2ATR A;  3S6F A;  2X7B A;  5F48 A;  4KUB A;  1KZF A;  1QSM A;  5DWN A;  4H6Z A;  4QBJ A;  4IUS A;  1N71 A;  3T90 A;  1S7L A;  2P6E A;  1Q2D A;  4R57 A;  2Q04 A;  3EO4 A;  2ZW5 A;  4UBR A;  2J8R A;  2QML A;  5F46 A;  3RYO A;  4HNY B;  5H84 A;  4OAE A;  3TO9 A;  3TO7 A;  4L8A A;  1YR0 A;  3W6S A;  3MGD A;  5EBV A;  4MY0 A;  1IIC A;  3FIX A;  1XIX A;  5DWM A;  5HH1 A;  4KVO E;  4CRY B;  2VQY A;  4KOV A;  2J8M A;  4KOU A;  2BUE A;  2B58 A;  2Q7B A;  2G0B A;  1YVK A;  5KTC A;  2FE7 A;  2Z0Z A;  4FD6 A;  5CNP A;  3D3S A;  3TOA A;  5IB0 A;  4KUA A;  2P6F A;  2Q4V A;  4HKF A;  2PR1 A;  2ZW7 A;  3W6X A;  4YRH A;  3TO6 A;  2B5G B;  5F49 A;  1Y9W A;  3QAH A;  2QEC A;  2R7H A;  4PSW A;  3TOB A;  2GE3 A;  1MJB A;  2CY2 A;  1NE9 A;  3VWE A;  4BMH A;  1YX0 A;  3GKR A;  2JEV A;  5F47 A;  4PK2 A;  3S6G A;  3P2F A;  1R57 A;  1WK4 A;  4JWP A;  3EC4 A;  4AVB A;  5JPH A;  5KTD A;  2FIW A;  4R87 A;  5IX3 A;  1YLE A;  1U6M A;  1QST A;  4AG9 A;  2K5T A;  4KOT A;  4YGO A;  3R1K A;  2IL4 A;  3GYA A;  1K4J A;  4AVA A;  1PU9 A;  3ZZI A;  3P2H A;  2VI7 A;  2NMT A;  2ARH A;  4PK3 A;  2VEZ A;  1YVO A;  1VKC A;  2B3V A;  3NE7 A;  2FIA A;  3DNS A;  1TIQ A;  2JDD A;  4QB9 A;  1MJA A;  1IYL A;  2FSR A;  1XF8 A;  2OB0 A;  4MHD A;  4KOX A;  2OZG A;  4H89 A;  5H86 A;  4HNW B;  5GCN A;  3V8I A;  2EUI A;  4GS4 A;  5KTA A;  3EY5 A;  2HUZ A;  3FXT A;  1PUA A;  2H5M A;  2C27 A;  2KCW A;  1S3Z A;  1UFH A;  4LUA A;  4F6A A;  1Y7R A;  3F5B A;  4NF1 A;  3GY9 A;  3H4Q A;  3R9E A;  3WR7 A;  4KZT A;  3S6K A;  2CNT A;  3LOD A;  3UY5 A;  4XNH B;  3T9Y A;  2O28 A;  2WPX A;  1FY7 A;  3IWG A;  4MJ8 A;  4PV6 A;  2PR8 A;  5ISV A;  3EFA A;  2BSW A;  3QB8 A;  3JVN A;  2ZW6 A;  3DDD A;  3E0K A;  4ZBG A;  2FS5 A;  3D2M A;  3LD2 A;  1Y9K A;  4HNX B;  2J8N A;  4U5Y A;  3CXQ A;  1LRZ A;  2P0W A;  4UA3 A;  2B4B A;  1CM0 A;  3C26 A;  4Y49 B;  4AB7 A;  1S60 A;  4E2A A;  3R9G A;  2D4O A;  4B5P A;  1M1D A;  4CAW A;  2B4D A;  3BJ8 A;  5JQ4 A;  4RI1 A;  1IYK A;  4KLW A;  4ORF A;  3N7Z A;  1P4N A;  4FD7 A;  2Y0M A;  3PZJ A;  4F0Y A;  1B6B A;  4JJX A;  1GHE A;  4X5K A;  2PSW A;  4UWI A;  4CS0 B;  1L0C A;  4OLL A;  4KOY A;  4H6U A;  4E0A A;  1IID A;  3IGR A;  4UWJ A;  1KUX A;  4CRZ B;  1P0H A;  3ZJ0 A;  2FL4 A;  2AE6 A;  3TFY A;  2PRB A;  4K30 A;  2CNS A;  1QSN A;  4CAV A;  2Z10 A;  2G3A A;  4NCZ A;  1KUV A;  1XEB A;  5E96 A;  4R3K A;  4PSX A;  4J3G A;  4XPK A;  3F8K A;  1CJW A;  4NSQ A;  3DR6 A;  3FB3 A;  1WWZ A;  5EC4 A;  2F5I A;  2JDC A;  3EXN A;  4JXQ A;  4NEX A;  4CAX A;  4XPD C;  3OWC A;  2FT0 A;  1NMT A;  2FXF A;  2DXQ A;  2I00 A;  3DR8 A;  1RO5 A;  3D2P A;  4M3S A;  2CNM A;  2GIV A;  1S7F A;  3R95 A;  3G8W A;  3SXO A;  4IF5 A;  2Q0Y A;  3TCV A;  2OZH A;  4XNH C;  4KVX A;  2ZW4 A;  4DNC A;  2D4P A;  1B87 A;  1ON0 A;  1YK3 A;  2VXK A;  2ZXV A;  2VBQ A;  1I1D A;  1MJ9 A;  1I12 A;  2HV2 A;  2BEI A;  3PP9 A;  1Q2Y A;  3SXN A;  4KOR A;  2ZPA A;  3I3G A;  1IB1 E;  4Y49 C;  2FCK A;  5C82 A;  3SHP A;  1OZP A;  2EVN A;  1M4D A;  2I79 A;  2WPW A;  2OU2 A;  1QSR A;  3PGP A;  4AG7 A;  3R9F A;  3VWD A;  5FVJ A;  3DSB A;  5HMN A;  5J8F A;  4KOS A;  4B5P B;  2B4D B;  2BL1 A; 
#chains in the Genus database with same CATH topology
 2R98 A;  4K3N A;  2B3U A;  4KS9 A;  3PB8 X;  3CPA A;  5EMI A;  4A95 A;  1IOI A;  1ZO0 A;  4M85 A;  2J9A A;  1ZLI A;  2Q4Y A;  2RC4 A;  4JYW A;  1QSO A;  3SI2 A;  4WJB A;  2PIZ A;  1M4L A;  2JLM A;  1FNO A;  3D8P A;  4KLV A;  5IV0 A;  3FYN A;  4KVM E;  4U9Y A;  2OH1 A;  2REF A;  3F0A A;  3PB9 X;  4FD5 A;  4L89 A;  4UCN A;  2PJ4 A;  3D7H A;  4R9M A;  2Z3M A;  2G9D A;  3FMC A;  1TF8 A;  4JD6 A;  2PJ6 A;  4IHM A;  5J8C A;  2XEF A;  1XBU A;  4MY3 A;  1NSA A;  1AMP A;  5F09 A;  1BAV A;  4MBU A;  3FVL A;  3MRU A;  4PXE A;  3K9U A;  4OAD A;  1R3N A;  1M4I A;  1SQH A;  1YGH A;  2JBJ A;  4TNU A;  4CYQ A;  5A27 A;  3PFO A;  4AVC A;  1Z4R A;  3G3S A;  4JXR A;  1ELM P;  4UEZ A;  1Q2C A;  2G3T A;  3BI1 A;  1YW6 A;  4P10 A;  2PQ8 A;  1ZLH A;  3B3T A;  3RBU A;  3VAR A;  2C6P A;  5I0C A;  3PFE A;  2BO9 A;  3RAM A;  3PBB A;  1XMT A;  5LRG A;  4YFJ A;  5BWA B;  5C88 A;  1QMU A;  1RTQ A;  3BHX A;  4QUS A;  1V0C A;  1VHS A;  2AJ6 A;  2VZY A;  4EVY A;  4MI4 A;  1S7N A;  4HPS A;  4OME A;  1BO4 A;  1M44 A;  2B5G A;  4CPA A;  2AFM A;  1EE3 P;  2GAN A;  1HDU A;  1F2P A;  3NH5 A;  5LYI A;  1Z9U A;  1NSL A;  4LQ6 A;  4B13 A;  4P4I A;  5AGE A;  5LYL A;  1UWY A;  5A28 A;  2R1I A;  1BOB A;  3KQX A;  4MXU A;  3FX6 A;  1LCP A;  4NGT A;  3WT4 A;  3W91 A;  2O4H A;  2ZED A;  3CXS A;  4ZY1 A;  4NGN A;  2PJ9 A;  2PJA A;  1BPM A;  4M6I A;  4MFQ A;  4U9Z A;  3KKW A;  2ZOG A;  4II9 A;  3I9S A;  5CPA A;  1XE4 A;  1I21 A;  4FAI A;  2PRQ A;  1Y0Y A;  2Z11 A;  4E8O A;  2HQY A;  2IMO A;  6CPA A;  2AFX A;  2I3C A;  1YRE A;  1A2Z A;  2QIR A;  1Z8L A;  4JLY A;  4DJL A;  2DEA A;  3NH4 A;  2REE A;  4YWY A;  4P4B A;  3R96 A;  2PC1 A;  3FBU A;  3IWE A;  3RO0 A;  2PJ5 A;  1Z8W A;  3PB7 X;  1AYE A;  2OZU A;  4A33 A;  2JEW A;  4M6H A;  4UFV A;  4ZY0 A;  1S7K A;  3FNC A;  1RXT A;  4O23 A;  4ONU A;  4W9Y A;  3FRM A;  2GFQ A;  3BJ7 A;  4MCQ A;  4RS2 A;  4CGM A;  8CPA A;  1Z4E A;  3KHZ A;  3TT2 A;  4OC5 A;  4FD4 A;  4ZX9 A;  3JUW A;  3JTK A;  4QVT A;  4MCR A;  4RUH A;  4DUK A;  1MK4 A;  2XEI A;  4NXY A;  1LAN A;  1M4G A;  3FJU A;  2Q44 A;  1J4J A;  4LX9 A;  4R3L A;  3H8G A;  2P6G A;  2EWB A;  3BLN A;  2PJ2 A;  4I49 A;  4KOW A;  2PJ1 A;  3LMS A;  1KUY A;  4P4E A;  3WC6 A;  1TKJ A;  5HXD A;  3PB6 X;  3NFZ A;  1DTD A;  2A4N A;  3TTH A;  2R8V A;  3S6H A;  2V8G A;  3B3V A;  3CXP A;  2PDO A;  3DLJ A;  1S5K A;  3GUX A;  3B8G A;  3FEE A;  4QC6 A;  2VZZ A;  4B5O A;  2OR4 A;  4BD9 A;  2AFU A;  2WSA A;  4OC1 A;  5DS0 A;  3K2K A;  2QJ8 A;  4XPL A;  3TE4 A;  4XPD B;  1KWM A;  2ATR A;  4MHN A;  1ZG8 A;  3S6F A;  2ZEM A;  2V77 A;  2X7B A;  4EME A;  1Q7L A;  5F48 A;  2FVG A;  3IFE A;  3PRT A;  4MMO A;  2Z3P A;  4KUB A;  4OC3 A;  4TWE A;  1KZF A;  1QSM A;  5LRJ A;  4EFD A;  5DWN A;  4H6Z A;  4QBJ A;  1JWQ A;  4IUS A;  4P44 A;  3DGV A;  2NYQ A;  1N71 A;  3T90 A;  1F2O A;  1FT7 A;  4A38 A;  4WWV A;  1S7L A;  2CTC A;  1XMB A;  1Q2D A;  2P6E A;  2PVW A;  3CPX A;  1IY7 A;  4F9U A;  4R57 A;  5JH9 A;  2Q04 A;  2RB7 A;  3EO4 A;  1YLO A;  1IGB A;  2ZW5 A;  4UBR A;  3GB0 A;  2J8R A;  2QML A;  5AG5 A;  2O53 A;  2OOT A;  5F46 A;  3RYO A;  1CX8 A;  4HNY B;  2YNC C;  4OAE A;  5H84 A;  5K8O A;  3VH9 A;  3TO9 A;  3TO7 A;  4L8A A;  1YR0 A;  4CGN A;  2EK9 A;  3RZA A;  3W6S A;  3MGD A;  3QAY A;  4UCM A;  5EBV A;  4MY0 A;  3CT9 A;  1IIC A;  4KSI A;  3FIX A;  3KR4 A;  1XIX A;  5D8N A;  1Z2L A;  5DWM A;  4KVO E;  5HH1 A;  3SI1 A;  4CRY B;  5I4M A;  2VQY A;  4FWU A;  4KOV A;  4JZ0 A;  2J8M A;  4B14 A;  2PJC A;  4F8Z A;  4KOU A;  2BUE A;  2B58 A;  3S9N A;  4B6Z A;  3KQZ A;  2Q7B A;  2G0B A;  3IC1 A;  3KHX A;  1YVK A;  4X3R A;  5KTC A;  1YQE A;  2FE7 A;  2Z0Z A;  4FD6 A;  4NJQ A;  5CNP A;  3D3S A;  3TOA A;  4C7H A;  4UIB A;  5IB0 A;  2HB6 A;  2PJ7 A;  4KUA A;  1OBR A;  1VHO A;  2P6F A;  4R76 A;  2Q4V A;  2IJZ A;  4HKF A;  2PR1 A;  2ZW7 A;  2PJ0 A;  2Q51 A;  4MCP A;  3W6X A;  4OKO A;  5K8P A;  4YRH A;  3TO6 A;  1YSJ A;  2B5G B;  5F49 A;  5HVG A;  1Y9W A;  3QAH A;  2QEC A;  2ZEL A;  4Q38 A;  2R7H A;  4PSW A;  4GXH A;  2GE3 A;  1IOF A;  1MJB A;  1XFO A;  2YNC A;  3TOB A;  5JM6 A;  3RNZ A;  2CY2 A;  1NE9 A;  3VWE A;  1CG2 A;  4MFP A;  2AFZ A;  4BMH A;  4AXV A;  1YX0 A;  3GKR A;  2V8D A;  2JEV A;  1LAM A;  3H8E A;  4F0X A;  4IAV A;  5F47 A;  4PK2 A;  3S6G A;  3P2F A;  4G1P A;  1R57 A;  3WC7 A;  4NGR A;  1WK4 A;  4JWP A;  5G21 A;  3EC4 A;  4P4D A;  4AVB A;  5JPH A;  5KTD A;  4R6T A;  2FIW A;  2NSM A;  4R87 A;  2BOA A;  4A94 A;  5IX3 A;  1ARL A;  1U6M A;  1YLE A;  4A39 A;  4ZX8 A;  1QST A;  2IQ6 A;  4AG9 A;  1CP6 A;  4OC4 A;  4ONW A;  2K5T A;  3JRU A;  1PCA A;  4KOT A;  1X10 A;  4CYP A;  1VIX A;  3R1K A;  4YGO A;  2IL4 A;  3GYA A;  2XEJ A;  4Z65 A;  4NGS A;  1K4J A;  4OC0 A;  4AVA A;  3B35 A;  1PU9 A;  4MHY A;  4CGP A;  2ZOF A;  3ZZI A;  3P2H A;  1LFW A;  2VI7 A;  2NMT A;  2ARH A;  4UFW A;  4PK3 A;  2VEZ A;  1YVO A;  1ELL P;  1VKC A;  2B3V A;  3NE7 A;  2FIA A;  3DNS A;  1TIQ A;  2JDD A;  4QB9 A;  2AFW A;  1MJA A;  1IYL A;  3KGQ A;  3FF3 A;  4ZY2 A;  4CYN A;  2FSR A;  2CXA A;  3LWU A;  4C7I A;  1AUG A;  2WUU A;  1PYT B;  5ELY A;  1XF8 A;  2CIJ A;  2OB0 A;  4MHD A;  4MCS A;  4KOX A;  2OZG A;  4OP4 A;  4H89 A;  3BXM A;  5H86 A;  4HNW B;  5GCN A;  1ARM A;  3V8I A;  2EUI A;  3B3C A;  2GLF A;  4GS4 A;  5KTA A;  3B3W A;  3EY5 A;  3LAC A;  2HUZ A;  3B2Y A;  4Q7A A;  2ANP A;  1ZG9 A;  3FXT A;  1PUA A;  2H5M A;  2GLJ A;  4PXD A;  2C27 A;  1ZG7 A;  2KCW A;  4R7M A;  3SJF A;  3GIU A;  4CGL A;  1S3Z A;  4A30 A;  1UFH A;  2HC9 A;  1Y7E A;  3I1U A;  4P45 A;  4LUA A;  4F6A A;  1Y7R A;  3F5B A;  4NF1 A;  2DPT A;  3GY9 A;  2ABZ A;  3D67 A;  4A37 A;  3H4Q A;  2QVP A;  2ZEE A;  3R9E A;  3WR7 A;  4KZT A;  3S6K A;  3V38 A;  2CNT A;  3LOD A;  4X8I A;  3UY5 A;  4XNH B;  3PB4 X;  3TC8 A;  5G22 A;  3T9Y A;  3D66 A;  4BBH A;  2O28 A;  2WPX A;  1FY7 A;  2CTB A;  3HUV A;  3IWG A;  4MJ8 A;  4PV6 A;  1Y0R A;  4MFZ A;  4C2X A;  2PR8 A;  5ISV A;  3QNV A;  3EFA A;  2Z3O A;  2BSW A;  3QB8 A;  5JGF A;  7CPA A;  3H8F A;  3IIB A;  2ODF A;  3JVN A;  4NJR A;  2ZW6 A;  4Q36 A;  2BCO A;  3DDD A;  3E0K A;  3K9T A;  4ZBG A;  4DYO A;  2FS5 A;  3D2M A;  3IU1 A;  3LD2 A;  1Y9K A;  4HNX B;  1TKF A;  2J8N A;  4OID A;  2GRE A;  2XEG A;  4U5Y A;  3WC5 A;  3CXQ A;  2F8H A;  1LRZ A;  4ZI6 A;  2P0W A;  5AG4 A;  4UA3 A;  2B4B A;  1CM0 A;  3C26 A;  4Y49 B;  3A9L A;  2F7V A;  1CBX A;  4AB7 A;  3CDX A;  1YME A;  3KR5 A;  1TF9 A;  1S60 A;  2Q7S A;  4E2A A;  2ZEH A;  3R9G A;  2D4O A;  4B5P A;  1M1D A;  4CAW A;  2B4D A;  3PBE A;  3BJ8 A;  5HVF A;  1F57 A;  4YU9 A;  1IU8 A;  5JQ4 A;  2V8H A;  4RI1 A;  1IYK A;  4PPZ A;  1QQ9 A;  4ZYQ A;  1LOK A;  3IO1 A;  4GM5 A;  4KLW A;  4ORF A;  3N7Z A;  3L2N A;  5LRK A;  2C6G A;  1P4N A;  4FD7 A;  2Z3N A;  2Y0M A;  1TXR A;  4P6Y A;  4B10 A;  3PZJ A;  4MFL A;  4UF4 A;  4F0Y A;  1B6B A;  4JJX A;  1GHE A;  4OC2 A;  3IEH A;  4X5K A;  1VHE A;  2PJB A;  2PSW A;  2AFO A;  4UWI A;  4CS0 B;  1L0C A;  2ZEO A;  4OLL A;  4CAE A;  2V8V A;  3WAB A;  4EWT A;  2WZN A;  4KOY A;  1BPN A;  2PE3 A;  2POK A;  4H6U A;  3S9L A;  3FH4 A;  4E0A A;  1IID A;  3FEC A;  3HLP A;  3IGR A;  4IK2 A;  2DF5 A;  1CPS A;  1Z8X A;  4UWJ A;  1HEE A;  2VL1 A;  2PVV A;  3H5Z A;  5G20 A;  2EBJ A;  4NGP A;  1KUX A;  3ISX A;  2ZEG A;  5LYD A;  4KSA A;  4MRI A;  1BLL E;  4UCP A;  1P0H A;  4CRZ B;  4A31 A;  3D68 A;  4MHZ A;  3CZX A;  3ZJ0 A;  2FL4 A;  2JBK A;  2AE6 A;  3NH8 A;  3TFY A;  2PRB A;  2PJ3 A;  4K30 A;  4PXB A;  3PEI A;  2CNS A;  4RN7 A;  4P4J A;  4MFJ A;  2Q43 A;  1QSN A;  4MHP A;  2Z10 A;  4CAV A;  2G3A A;  4X2T A;  2Z3L A;  4FBE A;  4NCZ A;  1KUV A;  1GYT A;  1TKH A;  1XEB A;  5E96 A;  4R3K A;  4PSX A;  1XOV A;  3GLJ A;  1CPX A;  3KI9 A;  4J3G A;  4A32 A;  3SJG A;  4XPK A;  3F8K A;  3VAT A;  2ZEF A;  2EK8 A;  1CJW A;  2C6C A;  1H8L A;  5J1Q A;  2GU2 A;  4NSQ A;  1R43 A;  3FED A;  3IJ3 A;  3DR6 A;  2WYR A;  4LQG A;  5CBM A;  2AFS A;  3NE8 A;  5AG6 A;  3FB3 A;  1WWZ A;  5EC4 A;  1XJO A;  2F5I A;  2DPS A;  2JDC A;  3EXN A;  4JXQ A;  3N5F A;  4NEX A;  4XPD C;  3OWC A;  2FT0 A;  1NMT A;  2FXF A;  4UFX A;  2DXQ A;  3MN8 A;  2I00 A;  5LYF A;  3DR8 A;  4A2Z A;  1RO5 A;  4CAF A;  3V7Z A;  3D2P A;  2CNM A;  4M3S A;  2GIV A;  1S7F A;  4NFR A;  4R8F A;  3G8W A;  4UEF A;  3R95 A;  3TX8 A;  3SXO A;  2YGW A;  2CF4 A;  4IF5 A;  4KSF A;  3S9M A;  4C2Z A;  2Q0Y A;  4C2Y A;  3TCV A;  2OZH A;  3D7D A;  3SJE A;  4XNH C;  4KVX A;  2ZW4 A;  1CP7 A;  4DNC A;  2ZEN A;  4B11 A;  2D4P A;  5IB9 A;  2PCU A;  1B87 A;  3IU2 A;  4CGO A;  3D7G A;  4F9V A;  3IWW A;  3BI0 A;  1ON0 A;  5G1Z A;  5THW A;  4BIN A;  1YK3 A;  5K8N A;  2VXK A;  1VGY A;  2YNE A;  2ZXV A;  2VBQ A;  1I1D A;  1MJ9 A;  3SI0 A;  4PXC A;  1I12 A;  1Z8T A;  1YW4 A;  2BEI A;  2HV2 A;  2ZEP A;  3PP9 A;  4B12 A;  4UIA A;  2Q4Z A;  1HDQ A;  1Q2Y A;  4P4F A;  3SXN A;  1X12 A;  3D4U A;  2YND A;  1XRY A;  3B3S A;  3KZW A;  4CAX A;  3B7I A;  4KOR A;  2ZPA A;  3I3G A;  1IB1 E;  4PQA A;  4NGQ A;  4Y49 C;  5K8M A;  2FCK A;  5C82 A;  3SHP A;  4OIW A;  4NGM A;  1OZP A;  3SJX A;  3KAS A;  2EVN A;  1M4D A;  2I79 A;  3ISZ A;  4M6G A;  2WPW A;  4C68 A;  2OU2 A;  3NA6 A;  5D29 A;  1DE4 C;  2EO8 A;  1QSR A;  3PGP A;  4AG7 A;  1LAP A;  4CYO A;  4FUU A;  3R9F A;  5HVH A;  2QYV A;  3D7F A;  3VWD A;  2PIY A;  3T8W A;  5FVJ A;  1JQG A;  4H2K A;  5AG7 A;  4ZGY B;  3DSB A;  5HMN A;  5J8F A;  2RFH A;  1Z5R A;  2PJ8 A;  3KL9 A;  4KOS A;  4UEE A;  4B5P B;  2B4D B;  2BL1 A;  2C1C A;  4MFK A;  2Z3K A; 
#chains in the Genus database with same CATH homology
 2R98 A;  2B3U A;  4KS9 A;  4A95 A;  1ZO0 A;  4M85 A;  2Q4Y A;  2RC4 A;  1QSO A;  2JLM A;  3D8P A;  4KLV A;  5IV0 A;  3FYN A;  4KVM E;  4U9Y A;  2OH1 A;  2REF A;  3F0A A;  4L89 A;  4FD5 A;  4UCN A;  4R9M A;  2Z3M A;  4JD6 A;  5J8C A;  4MY3 A;  4MBU A;  3K9U A;  4OAD A;  1M4I A;  1SQH A;  1YGH A;  4CYQ A;  5A27 A;  4AVC A;  1Z4R A;  3G3S A;  4JXR A;  1Q2C A;  2G3T A;  2PQ8 A;  5I0C A;  1XMT A;  4YFJ A;  5BWA B;  5C88 A;  4QUS A;  1V0C A;  1VHS A;  2AJ6 A;  2VZY A;  4EVY A;  4MI4 A;  1S7N A;  1BO4 A;  1M44 A;  2B5G A;  2GAN A;  1Z9U A;  1NSL A;  4B13 A;  5AGE A;  5A28 A;  2R1I A;  1BOB A;  3W91 A;  3CXS A;  4MFQ A;  4U9Z A;  3KKW A;  4II9 A;  3I9S A;  1XE4 A;  1I21 A;  2Z11 A;  4E8O A;  2HQY A;  1YRE A;  2QIR A;  4JLY A;  2REE A;  3R96 A;  2PC1 A;  3FBU A;  3IWE A;  2OZU A;  4A33 A;  4UFV A;  1S7K A;  3FNC A;  1RXT A;  4ONU A;  3FRM A;  3BJ7 A;  4CGM A;  4RS2 A;  1Z4E A;  3TT2 A;  4FD4 A;  3JUW A;  3JTK A;  4QVT A;  1MK4 A;  4NXY A;  1M4G A;  2Q44 A;  1J4J A;  4LX9 A;  4R3L A;  2P6G A;  3BLN A;  4I49 A;  4KOW A;  1KUY A;  2A4N A;  3TTH A;  2R8V A;  3S6H A;  3CXP A;  2PDO A;  1S5K A;  3B8G A;  4QC6 A;  4B5O A;  2VZZ A;  2WSA A;  3TE4 A;  4XPL A;  4XPD B;  2ATR A;  3S6F A;  2X7B A;  5F48 A;  2Z3P A;  4KUB A;  1KZF A;  1QSM A;  5DWN A;  4H6Z A;  4QBJ A;  4IUS A;  1N71 A;  3T90 A;  1S7L A;  2P6E A;  1Q2D A;  4R57 A;  2Q04 A;  3EO4 A;  2ZW5 A;  4UBR A;  2J8R A;  2QML A;  5AG5 A;  5F46 A;  3RYO A;  4HNY B;  2YNC C;  4OAE A;  5H84 A;  3TO9 A;  3TO7 A;  4L8A A;  1YR0 A;  4CGN A;  3W6S A;  3MGD A;  4UCM A;  5EBV A;  4MY0 A;  1IIC A;  3FIX A;  1XIX A;  5DWM A;  5HH1 A;  4KVO E;  4CRY B;  2VQY A;  4KOV A;  2J8M A;  4B14 A;  4KOU A;  2BUE A;  2B58 A;  2Q7B A;  2G0B A;  1YVK A;  5KTC A;  2FE7 A;  2Z0Z A;  4FD6 A;  5CNP A;  3D3S A;  3TOA A;  4C7H A;  5IB0 A;  4KUA A;  2P6F A;  2Q4V A;  4HKF A;  2PR1 A;  2ZW7 A;  3W6X A;  4YRH A;  3TO6 A;  2B5G B;  5F49 A;  1Y9W A;  3QAH A;  2QEC A;  4Q38 A;  2R7H A;  4PSW A;  3TOB A;  2GE3 A;  1MJB A;  2YNC A;  2CY2 A;  1NE9 A;  3VWE A;  4MFP A;  4BMH A;  1YX0 A;  3GKR A;  2JEV A;  4F0X A;  5F47 A;  4PK2 A;  3S6G A;  3P2F A;  1R57 A;  5G21 A;  1WK4 A;  4JWP A;  3EC4 A;  4AVB A;  5JPH A;  5KTD A;  2FIW A;  4R87 A;  5IX3 A;  1YLE A;  1U6M A;  1QST A;  4AG9 A;  4ZGY B;  2K5T A;  4CYP A;  4KOT A;  4YGO A;  3R1K A;  2IL4 A;  3GYA A;  1K4J A;  4AVA A;  1PU9 A;  4CGP A;  3ZZI A;  3P2H A;  2VI7 A;  2NMT A;  2ARH A;  4UFW A;  4PK3 A;  2VEZ A;  1YVO A;  1VKC A;  2B3V A;  3NE7 A;  2FIA A;  3DNS A;  1TIQ A;  2JDD A;  4QB9 A;  1MJA A;  1IYL A;  4CYN A;  2FSR A;  2CXA A;  4C7I A;  2WUU A;  1XF8 A;  2OB0 A;  4MHD A;  4KOX A;  2OZG A;  4H89 A;  5H86 A;  4HNW B;  5GCN A;  3V8I A;  2EUI A;  4GS4 A;  5KTA A;  3EY5 A;  2HUZ A;  3FXT A;  1PUA A;  2H5M A;  2C27 A;  2KCW A;  4CGL A;  1S3Z A;  4A30 A;  1UFH A;  4LUA A;  4F6A A;  1Y7R A;  3F5B A;  4NF1 A;  2DPT A;  3GY9 A;  3H4Q A;  3R9E A;  3WR7 A;  4KZT A;  3S6K A;  2CNT A;  3LOD A;  3UY5 A;  4XNH B;  5G22 A;  3T9Y A;  4BBH A;  2O28 A;  2WPX A;  1FY7 A;  3IWG A;  4MJ8 A;  4PV6 A;  4C2X A;  4MFZ A;  2PR8 A;  5ISV A;  3EFA A;  2Z3O A;  2BSW A;  3QB8 A;  3JVN A;  2ZW6 A;  4Q36 A;  3DDD A;  3E0K A;  4ZBG A;  2FS5 A;  3D2M A;  3IU1 A;  3LD2 A;  1Y9K A;  4HNX B;  2J8N A;  4U5Y A;  3CXQ A;  1LRZ A;  2P0W A;  5AG4 A;  4UA3 A;  2B4B A;  1CM0 A;  3C26 A;  4Y49 B;  3A9L A;  4AB7 A;  1S60 A;  4E2A A;  3R9G A;  2D4O A;  4B5P A;  1M1D A;  4CAW A;  2B4D A;  3BJ8 A;  5JQ4 A;  4RI1 A;  1IYK A;  4KLW A;  4ORF A;  3N7Z A;  1P4N A;  4FD7 A;  2Z3N A;  2Y0M A;  4B10 A;  3PZJ A;  4MFL A;  4F0Y A;  1B6B A;  4JJX A;  1GHE A;  4X5K A;  2PSW A;  4UWI A;  4CS0 B;  1L0C A;  4OLL A;  4CAE A;  4KOY A;  4H6U A;  4E0A A;  1IID A;  3IGR A;  4UWJ A;  3H5Z A;  5G20 A;  1KUX A;  4KSA A;  4UCP A;  4CRZ B;  1P0H A;  4A31 A;  3ZJ0 A;  2FL4 A;  2AE6 A;  3TFY A;  2PRB A;  4K30 A;  2CNS A;  4MFJ A;  1QSN A;  4CAV A;  2Z10 A;  2G3A A;  2Z3L A;  4NCZ A;  1KUV A;  1XEB A;  5E96 A;  4R3K A;  4PSX A;  4A32 A;  4J3G A;  4XPK A;  3F8K A;  1CJW A;  4NSQ A;  3DR6 A;  5AG6 A;  3FB3 A;  1WWZ A;  5EC4 A;  2F5I A;  2JDC A;  2DPS A;  4JXQ A;  3EXN A;  4NEX A;  4CAX A;  4XPD C;  3OWC A;  2FT0 A;  1NMT A;  2FXF A;  4UFX A;  2DXQ A;  2I00 A;  3DR8 A;  4A2Z A;  1RO5 A;  4CAF A;  3D2P A;  2CNM A;  4M3S A;  2GIV A;  1S7F A;  3R95 A;  3G8W A;  3SXO A;  2YGW A;  4IF5 A;  4KSF A;  4C2Z A;  2Q0Y A;  4C2Y A;  3TCV A;  2OZH A;  4XNH C;  4KVX A;  2ZW4 A;  4DNC A;  4B11 A;  2D4P A;  3IU2 A;  1B87 A;  4CGO A;  5G1Z A;  1ON0 A;  1YK3 A;  2VXK A;  2YNE A;  2ZXV A;  2VBQ A;  1I1D A;  1MJ9 A;  1I12 A;  2HV2 A;  2BEI A;  4B12 A;  3PP9 A;  1Q2Y A;  3SXN A;  2YND A;  4KOR A;  2ZPA A;  3I3G A;  1IB1 E;  4Y49 C;  2FCK A;  5C82 A;  3SHP A;  1OZP A;  2EVN A;  1M4D A;  2I79 A;  2WPW A;  4C68 A;  2OU2 A;  1QSR A;  3PGP A;  4AG7 A;  4CYO A;  3R9F A;  3VWD A;  5FVJ A;  5AG7 A;  3DSB A;  5HMN A;  5J8F A;  4KOS A;  4B5P B;  2B4D B;  2BL1 A;  4MFK A;  2Z3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...