3TCVA

Crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
221
structure length
221
Chain Sequence
LQNWTPRPKPERKIFEGRYVRLEPLNAQKHGDELFAASSVEDAEQRFTWLFETPPATRAEFEPWLDKASKSDDPLFFAVIDKASGKVAGRQALMRIDPANGVIEIGSIYWGPLISRRPAATEAQFLFMQYVFDVLGYRRYEWECHNENGPSRRAAERFGFRFEGIFRQHMVVKGRNRDTAWFSVLDSEWPALKQAYQAWLAPENFDSAGQQKKTLQEFRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a GCN5-related N-acetyltransferase from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus 2308
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
total genus 78
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3tcvA00
3EY5A 3FYNA 1R57A 3JVNA 3ZJ0A 4QBJA 5KTCA 5J8FA 1YREA 1M44A 3LODA 3S6GA 5J8CA 4OADA 3FXTA 4B5OA 4PK2A 1S5KA 2OB0A 1I1DA 2JEVA 3W6SA 1V0CA 2D4OA 3W91A 1Q2DA 2PDOA 4E2AA 2WPWA 4YFJA 1B6BA 2R1IA 4AVAA 1BO4A 3ZZIA 2R98A 4IUSA 1KZFA 1S7FA 5F48A 2Q4YA 2Q7BA 4KUBA 3NE7A 2B4DB 1QSTA 5ISVA 1CJWA 4PK3A 3F5BA 4JJXA 2ZPAA 2Z0ZA 1PUAA 2IL4A 2OZHA 4KOVA 2PRBA 4RS2A 4R87A 4ORFA 1M4DA 2HQYA 2H5MA 4AVBA 4FD4A 3D3SA 4YGOA 3EO4A 1IYLA 1WWZA 2VQYA 2VI7A 3CXSA 4KOWA 3BJ8A 2JLMA 4CAXA 2VBQA 2PQ8A 2BUEA 2JDDA 4MHDA 5CNPA 4UWJA 3R9FA 2Q0YA 2C27A 2B4DA 3UY5A 1S7NA 1L0CA 2I00A 2FXFA 4R3KA 4E8OA 4UA3A 1OZPA 3TT2A 4XPDB 2Z11A 4KOSA 1FY7A 2O28A 5GCNA 2EUIA 5EC4A 3D2MA 3PGPA 4JLYA 2R7HA 4H89A 4HNXB 1Q2YA 2AE6A 4KOTA 2VXKA 3KKWA 4OAEA 4CAVA 1NSLA 2FE7A 2ZXVA 4U9ZA 2B58A 3R9EA 2WPXA 2GE3A 2KCWA 3OWCA 1QSMA 4U9YA 4GS4A 3TO9A 2J8RA 1YX0A 3FIXA 4J3GA 1J4JA 5JPHA 1M1DA 1MJAA 3FB3A 1YR0A 4II9A 1XIXA 4JD6A 3TTHA 1I12A 4RI1A 1YLEA 1XE4A 3D8PA 1Y9WA 4DNCA 2CNTA 5EBVA 1N71A 2OU2A 3T9YA 3DR8A 5F46A 2BSWA 3DNSA 3TO7A 4H6ZA 1YGHA 2PR8A 2B5GB 2Y0MA 2DXQA 1S7KA 2REFA 3P2FA 4ZBGA 5H86A 3FNCA 2BL1A 1CM0A 2P6FA 4OLLA 4U5YA 3C26A 3K9UA 5IB0A 3TFYA 2FS5A 3PZJA 4MY3A 1YVKA 1IICA 2ZW6A 1KUXA 2Q04A 4XPDC 4KORA 3N7ZA 4MY0A 3TOBA 2G3AA 4AVCA 2Z10A 3RYOA 4R57A 2FCKA 4UWIA 5KTAA 1KUYA 4QUSA 4KLVA 2CY2A 4NEXA 1M4IA 2B4BA 4E0AA 2J8MA 2G3TA 2OZGA 2G0BA 3R9GA 5HH1A 1XEBA 3TE4A 4PSWA 1PU9A 4KVXA 3BJ7A 4LX9A 2QMLA 3SXOA 2HUZA 1B87A 3VWEA 4KZTA 1YK3A 3TO6A 3GY9A 4R9MA 2NMTA 3JUWA 4QC6A 5F47A 2OZUA 4NSQA 4FD7A 4HKFA 1P0HA 3I3GA 3R1KA 4KUAA 5FVJA 4M3SA 1MJBA 5IX3A 1Z4RA 4BMHA 2FL4A 1Z4EA 4KVOE 3EC4A 4UBRA 1Y9KA 3FBUA 3EXNA 2FIAA 2F5IA 3FRMA 3S6KA 4JXQA 4L8AA 3TOAA 3IWGA 2P0WA 4L89A 2QECA 3BLNA 1I21A 4LUAA 4X5KA 4KOXA 1RXTA 3IGRA 2GIVA 1TIQA 1NMTA 4JWPA 4NCZA 3W6XA 4I49A 1P4NA 1QSNA 4ONUA 4HNWB 1Y7RA 4AG9A 3QB8A 1SQHA 4XNHC 2VZZA 4MBUA 4R3LA 2JDCA 2QIRA 4H6UA 1RO5A 2P6GA 4KOYA 2A4NA 3EFAA 2K5TA 1MK4A 2GANA 4KVME 4K30A 3E0KA 4B5PA 4QVTA 1ON0A 3P2HA 2ZW5A 4XPLA 2B5GA 3G3SA 2ARHA 1QSRA 5C88A 1K4JA 3TCVA 3DR6A 4FD6A 1BOBA 3I9SA 4F0YA 2B3VA 1U6MA 2BEIA 1IIDA 2OH1A 1IYKA 3WR7A 3R95A 3SHPA 4IF5A 4B5PB 4CS0B 4JXRA 1XMTA 2HV2A 1YVOA 4PSXA 5C82A 3B8GA 3VWDA 2FSRA 2R8VA 4NF1A 3G8WA 4KLWA 2P6EA 2VZYA 4AB7A 1LRZA 4XNHB 2ATRA 1KUVA 2PC1A 2Q4VA 5DWNA 5DWMA 2ZW7A 4NXYA 4EVYA 5KTDA 4AG7A 3D2PA 2EVNA 3F0AA 2D4PA 1S3ZA 1IB1E 4KOUA 2I79A 2X7BA 5I0CA 2PSWA 3SXNA 5F49A 4FD5A 3H4QA 1UFHA 2FT0A 3DDDA 1Z9UA 5HMNA 1M4GA 5H84A 4YRHA 2J8NA 3GKRA 1VHSA 2Q44A 4Y49C 4CRYB 2VEZA 3V8IA 1GHEA 3PP9A 1NE9A 3MGDA 5E96A 4MJ8A 5IV0A 4MI4A 1MJ9A 1Q2CA 2ZW4A 3LD2A 1XF8A 3QAHA 3DSBA 4HNYB 3CXPA 4XPKA 2CNMA 2B3UA 4F6AA 3F8KA 4M85A 2CNSA 2RC4A 2AJ6A 3T90A 4PV6A 4QB9A 5JQ4A 1WK4A 4CRZB 3S6HA 1S60A 1QSOA 3S6FA 2REEA 3GYAA 1S7LA 4Y49B 3CXQA 1VKCA 2PR1A 3R96A 4CAWA 2FIWA
chains in the Genus database with same CATH superfamily
2CIJA 3EY5A 3KR4A 2GREA 1BAVA 1DTDA 3FYNA 1R57A 4OC0A 3JVNA 4FUUA 4PXDA 1FT7A 2YNEA 2POKA 4CAFA 4GM5A 3ZJ0A 4QBJA 5KTCA 3PFOA 5J8FA 4X3RA 1YREA 4CAEA 1M44A 3LODA 3S6GA 4MFKA 5J8CA 4OADA 3FXTA 5AG5A 4B5OA 5AG4A 2Z3PA 2IJZA 2Z3OA 4PK2A 1S5KA 1YMEA 4X2TA 2O53A 4NGSA 2AFOA 2OB0A 3S9LA 2OOTA 1I1DA 2JEVA 2Q7SA 1X12A 3KHXA 3FMCA 1TKJA 1VHOA 1V0CA 2D4OA 3W6SA 3B3VA 3W91A 1Q2DA 4NGRA 1FNOA 2HB6A 4UCMA 4EWTA 2PDOA 3KQZA 4IK2A 4MHNA 4E2AA 1Z8TA 1KWMA 2WPWA 4YFJA 3IU2A 2PVVA 1B6BA 2R1IA 4AVAA 4GXHA 1ARLA 2PRQA 1BO4A 5D29A 5G21A 3ZZIA 1BPMA 5JM6A 2R98A 3SI0A 3MRUA 1VIXA 2QYVA 1Z5RA 4IUSA 1KZFA 3CZXA 1S7FA 3NFZA 2ZEPA 2NYQA 5F48A 2Q4YA 2Q7BA 4KUBA 5HVHA 3NE7A 2PJ7A 2B4DB 1QSTA 7CPAA 5ISVA 1CJWA 4PK3A 3F5BA 4JJXA 2ZPAA 2NSMA 2Z0ZA 3B3SA 1PUAA 3BXMA 2RFHA 3TX8A 2IL4A 4UEFA 2OZHA 1LANA 3B7IA 3FECA 4KOVA 2PRBA 4OC4A 4RS2A 5CBMA 4R87A 4ORFA 2YNCC 3ISZA 1M4DA 2HQYA 4A31A 2H5MA 4AVBA 3PBEA 4FD4A 3IO1A 4F8ZA 3D3SA 4YGOA 4FAIA 3EO4A 3GIUA 1CPXA 3KL9A 1IYLA 1WWZA 2VQYA 2VI7A 1Y0YA 3CXSA 4K3NA 4KOWA 4MFLA 3IEHA 1ZG8A 3D7HA 3BJ8A 4Q7AA 2JLMA 4OKOA 4CAXA 3QNVA 2VBQA 2PQ8A 1CP7A 2BUEA 3VH9A 2JDDA 4MHDA 5CNPA 2DPTA 2ODFA 4UWJA 4MFJA 4OC1A 2PE3A 2XEGA 3SJEA 2CXAA 3IWWA 5LYLA 3R9FA 1PCAA 2C27A 2Q0YA 4P4EA 5K8MA 1LCPA 2B4DA 2PJBA 5K8PA 3WC7A 3UY5A 1UWYA 1S7NA 1VGYA 1ZO0A 4NGQA 1HEEA 4A33A 4LQ6A 4ONWA 1L0CA 2I00A 2FXFA 3PB8X 4R3KA 3D7GA 4E8OA 4UA3A 2O4HA 1OZPA 1CP6A 1PYTB 2GLJA 2ZOFA 4XPDB 2Z11A 4KOSA 1FY7A 3GUXA 2O28A 4UIBA 5GCNA 3PB4X 2EUIA 5EC4A 1XOVA 3D2MA 3PGPA 4JLYA 3NH5A 2R7HA 1Z8LA 4H89A 1ZG9A 4HNXB 1Q2YA 4NGNA 1ELLP 5AGEA 2AE6A 3KHZA 4KOTA 4A38A 4CYPA 2VXKA 3KKWA 4OAEA 4CAVA 1JWQA 1NSLA 2FE7A 2ZXVA 3SJFA 1YSJA 4U9ZA 2B58A 3RBUA 2AFZA 5LRGA 3R9EA 4ZY0A 2WPXA 2GE3A 5THWA 2Z3MA 2KCWA 1BPNA 3SJXA 3OWCA 1QSMA 4U9YA 2GU2A 2EO8A 5D8NA 4GS4A 1LFWA 4A39A 3TO9A 2J8RA 4UCNA 1CX8A 1YX0A 3D4UA 5BWAB 1AMPA 1EE3P 3FIXA 1GYTA 4MCSA 3FX6A 4J3GA 1J4JA 5JPHA 1M1DA 1MJAA 2PCUA 3H5ZA 1H8LA 4NGPA 3NH4A 3NH8A 3PRTA 3FB3A 1YR0A 5ELYA 4II9A 2AFSA 2Q51A 1ZG7A 1XIXA 1TF8A 4MHPA 4JD6A 4A94A 2ZEGA 3TTHA 3RAMA 1I12A 4JYWA 4RI1A 1YLEA 2Z3NA 4CYQA 2RB7A 1XE4A 3D8PA 2ZOGA 3L2NA 5LRJA 3D67A 2Z3LA 4Q36A 1Y9WA 4MRIA 2GFQA 1AYEA 4R7MA 4DNCA 3FVLA 2CNTA 4ZYQA 3QAYA 5EBVA 3CT9A 1N71A 3VARA 3N5FA 2JBKA 2OU2A 3T9YA 5HXDA 4RUHA 4CYOA 3DR8A 1IU8A 4UEEA 5F46A 2QVPA 2BSWA 3DLJA 3DNSA 3TO7A 4H6ZA 1Q7LA 1YGHA 2PR8A 2B5GB 2JBJA 3WC6A 2DEAA 2Y0MA 1YW6A 2DXQA 3B3CA 1IGBA 3B3TA 4ZGYB 5HVFA 1S7KA 2REFA 3P2FA 1LOKA 4ZBGA 5H86A 3FNCA 2BL1A 1CM0A 2CTBA 2P6FA 2YNDA 4OLLA 1X10A 4U5YA 5LRKA 3DGVA 3C26A 3K9UA 4KSAA 5IB0A 3TFYA 2FS5A 3B2YA 3PZJA 1DE4C 4ZI6A 2PJ3A 2WSAA 2WUUA 2Q43A 1YVKA 4MY3A 1IICA 4NJQA 2ZW6A 3GB0A 3MN8A 1KUXA 4P4FA 2Q04A 4XPDC 4KORA 5AG6A 4P6YA 2IMOA 2PJ8A 2V8VA 3N7ZA 2G3AA 4MY0A 3TOBA 4EFDA 2F8HA 2V8GA 4AVCA 2Z10A 5LYFA 4MCRA 3RYOA 5J1QA 4P4JA 2FCKA 4R57A 4UWIA 5KTAA 1KUYA 2G9DA 3BI0A 5IB9A 4QUSA 3SI1A 4DJLA 4KLVA 2CY2A 2PJ0A 5JH9A 4NEXA 1M4IA 2B4BA 4CGNA 4E0AA 1XMBA 1Z2LA 2J8MA 2AFMA 2G3TA 2ZELA 4B13A 2OZGA 2G0BA 4MCQA 2ANPA 3R9GA 4P4BA 4W9YA 1XEBA 5HH1A 2CTCA 2BOAA 4UIAA 1A2ZA 4PSWA 1PU9A 1Z8XA 3BJ7A 3JTKA 4KVXA 2ZEMA 2XEJA 3A9LA 1ZLHA 4HPSA 4LX9A 2QMLA 3D68A 4UEZA 3SXOA 2HUZA 6CPAA 1B87A 3VWEA 2DPSA 4KZTA 4OC5A 1YK3A 3TO6A 3GY9A 4B14A 3SI2A 4R9MA 3FJUA 2NMTA 3JUWA 4QC6A 4C68A 4BINA 5F47A 1AUGA 3KZWA 2OZUA 1IOIA 4NSQA 4FD7A 2ZEHA 4HKFA 2C1CA 4MHYA 4R8FA 4CGPA 1P0HA 3I3GA 4PQAA 3R1KA 4KUAA 5FVJA 3WT4A 1YW4A 4M3SA 1MJBA 1TXRA 1IY7A 4MFQA 4YWYA 5IX3A 3HLPA 1Z4RA 4BMHA 2PJ6A 4BBHA 5LYIA 2FL4A 4NJRA 5G1ZA 4LQGA 1Z4EA 4KVOE 2JEWA 3EC4A 3K9TA 4UBRA 1Y9KA 3FBUA 3CPXA 3PB7X 4UFXA 4CGLA 2PIZA 4KSIA 3V7ZA 4F9UA 4P4DA 3EXNA 3H8FA 3D7DA 2FIAA 2V8HA 2PJ4A 2F5IA 1XBUA 1XJOA 4IAVA 3FRMA 3S6KA 4JXQA 4L8AA 5LYDA 5DS0A 3TOAA 4DYOA 4RN7A 4CGMA 3IWGA 2P0WA 2BCOA 3IJ3A 2ZENA 4L89A 1YLOA 2QECA 1I21A 3BLNA 4LUAA 4Q38A 4X5KA 4KOXA 1RXTA 4OP4A 4MFPA 3IGRA 2ZEEA 1JQGA 4UCPA 1CG2A 4F9VA 4NGTA 2GIVA 4PXCA 1BLLE 1TIQA 2Q4ZA 2C6CA 1NMTA 4M6HA 4JWPA 2PJCA 5HVGA 4WJBA 4NCZA 3LWUA 2C6GA 3W6XA 4I49A 1P4NA 1RTQA 3V38A 1ARMA 1QSNA 4ONUA 2OR4A 3D66A 4HNWB 1Y7RA 3I1UA 3PBBA 4AG9A 4M6IA 3QB8A 4A32A 1SQHA 2PIYA 3IU1A 4XNHC 1CPSA 4F0XA 1Y7EA 4MFZA 4ZY1A 4PPZA 2EWBA 2PJ1A 2VZZA 2QJ8A 4MBUA 4R6TA 4B6ZA 4R3LA 2JDCA 2QIRA 4H6UA 1RO5A 2P6GA 4KOYA 2A4NA 2PJ2A 3EFAA 2K5TA 3ISXA 4CGOA 4OIDA 4C2XA 1MK4A 4FWUA 2GANA 3LACA 4KVME 4K30A 3E0KA 2YNCA 2C6PA 4QVTA 4B5PA 1ON0A 3K2KA 2ZW5A 3P2HA 4XPLA 4H2KA 4P45A 2B5GA 4C2ZA 3G3SA 2ARHA 1QSRA 4OC2A 4MHZA 4KSFA 5C88A 4B12A 5K8OA 4OC3A 1K4JA 3TCVA 4KS9A 5A28A 4BD9A 3DR6A 4FD6A 2EBJA 2XEFA 1BOBA 2WYRA 3CDXA 3I9SA 4F0YA 2J9AA 4NGMA 4ZY2A 2B3VA 4MMOA 1U6MA 4OMEA 4C7HA 2BEIA 4IHMA 1F57A 3TE4A 4P44A 4PXEA 1IIDA 1NSAA 2OH1A 3S9NA 1TF9A 1XFOA 1IYKA 3WR7A 3R95A 3H8EA 4O23A 4UFWA 5EMIA 1R3NA 1OBRA 3SHPA 3TT2A 5A27A 4IF5A 4B5PB 5G20A 4CS0B 2EK9A 4JXRA 4R76A 3VATA 1ELMP 1XMTA 2HV2A 3PFEA 2EK8A 1YVOA 4MCPA 5JGFA 4ZX9A 2YGWA 4PSXA 4UF4A 5C82A 3GLJA 3B8GA 3IC1A 3VWDA 2FSRA 2R8VA 4NF1A 4JZ0A 3G8WA 1IOFA 1TKFA 2AFWA 4KLWA 4OIWA 4EMEA 2P6EA 2ZEFA 4P10A 5G22A 2VZYA 1F2PA 4AB7A 4AXVA 1LRZA 3FH4A 4XNHB 3B35A 3WABA 2ATRA 3RZAA 2XEIA 3KASA 1R43A 1KUVA 4X8IA 3TC8A 3D7FA 2PC1A 3IWEA 3B3WA 2GLFA 2FVGA 2Q4VA 5DWNA 3T8WA 4CYNA 5DWMA 2ZW7A 2PJ5A 4NXYA 3IFEA 4EVYA 5KTDA 2DF5A 5AG7A 4AG7A 3HUVA 4NFRA 4TNUA 2PJAA 4WWVA 3D2PA 1HDUA 2CF4A 2AFUA 4A37A 4A30A 1YQEA 2EVNA 5F09A 3BI1A 3F0AA 4C7IA 2I3CA 3S9MA 4TWEA 2D4PA 1S3ZA 1IB1E 2ABZA 4KOUA 3NA6A 2I79A 2X7BA 5I0CA 2PSWA 3KQXA 1ZLIA 4UFVA 3SXNA 2IQ6A 5F49A 4FD5A 3H4QA 1UFHA 5CPAA 8CPAA 2FT0A 2ZEDA 2V77A 4YU9A 3DDDA 1Z9UA 5HMNA 1VHEA 1M4GA 3BHXA 5H84A 4ZX8A 2ZEOA 4YRHA 4P4IA 2J8NA 3GKRA 3RO0A 1VHSA 2HC9A 4B10A 1Y0RA 4M6GA 1CBXA 3FF3A 2Q44A 4CPAA 2VL1A 4Y49C 4CRYB 4FBEA 5I4MA 1QQ9A 1Z8WA 2VEZA 3V8IA 1GHEA 3PEIA 1NE9A 3PP9A 4A2ZA 1HDQA 3MGDA 3IIBA 3KI9A 5E96A 4MJ8A 1XRYA 5IV0A 2PJ9A 4MI4A 1MJ9A 1Q2CA 2ZW4A 3JRUA 3LD2A 4G1PA 1XF8A 3KR5A 3SJGA 3QAHA 3DSBA 4HNYB 1F2OA 3CXPA 4XPKA 1TKHA 3PB9X 2CNMA 2B3UA 3PB6X 3LMSA 4F6AA 1LAPA 4C2YA 3F8KA 4M85A 3NE8A 1M4LA 2CNSA 2RC4A 2AJ6A 3FEEA 2PVWA 3T90A 4PV6A 4PXBA 3KGQA 5K8NA 4QB9A 2BO9A 4DUKA 1WK4A 4MXUA 4CRZB 5JQ4A 3S6HA 3FEDA 2V8DA 1S60A 3WC5A 1QSOA 3S6FA 2WZNA 2F7VA 2REEA 3RNZA 4Z65A 3GYAA 1S7LA 2AFXA 3CPAA 3H8GA 1LAMA 4Y49B 2Z3KA 4A95A 4B11A 3CXQA 1VKCA 1QMUA 2PR1A 3R96A 4CAWA 2FIWA
chains in the Genus database with same CATH topology
3EY5A 3FYNA 1R57A 3JVNA 2YNEA 4CAFA 3ZJ0A 4QBJA 5KTCA 5J8FA 1YREA 4CAEA 1M44A 3LODA 3S6GA 4MFKA 5J8CA 4OADA 3FXTA 5AG5A 4B5OA 5AG4A 2Z3PA 2Z3OA 4PK2A 1S5KA 2OB0A 1I1DA 2JEVA 3W6SA 1V0CA 2D4OA 3W91A 1Q2DA 4UCMA 2PDOA 4E2AA 2WPWA 4YFJA 3IU2A 1B6BA 2R1IA 4AVAA 1BO4A 3ZZIA 5G21A 2R98A 4IUSA 1KZFA 1S7FA 5F48A 2Q4YA 2Q7BA 4KUBA 3NE7A 2B4DB 1QSTA 5ISVA 1CJWA 4PK3A 3F5BA 4JJXA 2ZPAA 2Z0ZA 1PUAA 2IL4A 2OZHA 4KOVA 2PRBA 4RS2A 4R87A 4ORFA 2YNCC 1M4DA 2HQYA 4A31A 2H5MA 4AVBA 4FD4A 3D3SA 4YGOA 3EO4A 1IYLA 1WWZA 2VQYA 2VI7A 3CXSA 4KOWA 4MFLA 3BJ8A 2JLMA 4CAXA 2VBQA 2PQ8A 2BUEA 2JDDA 4MHDA 5CNPA 2DPTA 4UWJA 4MFJA 2CXAA 3R9FA 2Q0YA 2C27A 2B4DA 3UY5A 1S7NA 1ZO0A 4A33A 1L0CA 2I00A 2FXFA 4R3KA 4E8OA 4UA3A 1OZPA 3TT2A 4XPDB 2Z11A 4KOSA 1FY7A 2O28A 5GCNA 2EUIA 5EC4A 3D2MA 3PGPA 4JLYA 2R7HA 4H89A 4HNXB 1Q2YA 5AGEA 2AE6A 4KOTA 4CYPA 2VXKA 3KKWA 4OAEA 4CAVA 1NSLA 2FE7A 2ZXVA 4U9ZA 2B58A 3R9EA 2WPXA 2GE3A 2Z3MA 2KCWA 3OWCA 1QSMA 4U9YA 4GS4A 3TO9A 2J8RA 4UCNA 1YX0A 5BWAB 3FIXA 4J3GA 1J4JA 5JPHA 1M1DA 1MJAA 3H5ZA 3FB3A 1YR0A 4II9A 1XIXA 4JD6A 3TTHA 1I12A 4RI1A 1YLEA 2Z3NA 4CYQA 1XE4A 3D8PA 2Z3LA 4Q36A 1Y9WA 4DNCA 2CNTA 5EBVA 1N71A 2OU2A 3T9YA 4CYOA 3DR8A 5F46A 2BSWA 3DNSA 3TO7A 4H6ZA 1YGHA 2PR8A 2B5GB 2Y0MA 2DXQA 4ZGYB 1S7KA 2REFA 3P2FA 4ZBGA 5H86A 3FNCA 2BL1A 1CM0A 2P6FA 2YNDA 4OLLA 4U5YA 3C26A 3K9UA 4KSAA 5IB0A 3TFYA 2FS5A 3PZJA 2WSAA 2WUUA 1YVKA 4MY3A 1IICA 2ZW6A 1KUXA 2Q04A 4XPDC 4KORA 5AG6A 3N7ZA 4MY0A 3TOBA 2G3AA 4AVCA 2Z10A 3RYOA 4R57A 2FCKA 4UWIA 5KTAA 1KUYA 4QUSA 4KLVA 2CY2A 4NEXA 1M4IA 2B4BA 4CGNA 4E0AA 2J8MA 2G3TA 4B13A 2OZGA 2G0BA 3R9GA 5HH1A 1XEBA 3TE4A 4PSWA 1PU9A 3JTKA 3BJ7A 4KVXA 3A9LA 4LX9A 2QMLA 3SXOA 2HUZA 1B87A 3VWEA 2DPSA 4KZTA 1YK3A 3TO6A 3GY9A 4B14A 4R9MA 2NMTA 3JUWA 4QC6A 4C68A 5F47A 2OZUA 4NSQA 4FD7A 4CGPA 4HKFA 1P0HA 3I3GA 3R1KA 4KUAA 5FVJA 4M3SA 1MJBA 4MFQA 5IX3A 1Z4RA 4BMHA 4BBHA 2FL4A 5G1ZA 1Z4EA 4KVOE 3EC4A 4UBRA 1Y9KA 3FBUA 4UFXA 4CGLA 3EXNA 2FIAA 2F5IA 3FRMA 3S6KA 4JXQA 4L8AA 3TOAA 4CGMA 3IWGA 2P0WA 4L89A 2QECA 3BLNA 1I21A 4LUAA 4Q38A 4X5KA 4KOXA 1RXTA 4MFPA 3IGRA 4UCPA 2GIVA 1TIQA 1NMTA 4JWPA 4NCZA 3W6XA 4I49A 1P4NA 1QSNA 4ONUA 4HNWB 1Y7RA 4AG9A 3QB8A 4A32A 1SQHA 3IU1A 4XNHC 4F0XA 4MFZA 2VZZA 4MBUA 4R3LA 2JDCA 2QIRA 4H6UA 1RO5A 2P6GA 4KOYA 2A4NA 3EFAA 2K5TA 4CGOA 4C2XA 1MK4A 2GANA 4KVME 4K30A 3E0KA 2YNCA 4QVTA 4B5PA 1ON0A 3P2HA 2ZW5A 4XPLA 2B5GA 4C2ZA 3G3SA 2ARHA 1QSRA 4KSFA 5C88A 4B12A 1K4JA 3TCVA 4KS9A 5A28A 3DR6A 4FD6A 1BOBA 3I9SA 4F0YA 2B3VA 1U6MA 4C7HA 2BEIA 1IIDA 2OH1A 1IYKA 3WR7A 3R95A 4UFWA 5A27A 3SHPA 4IF5A 4B5PB 5G20A 4CS0B 4JXRA 1XMTA 2HV2A 1YVOA 2YGWA 4PSXA 5C82A 3B8GA 3VWDA 2FSRA 2R8VA 4NF1A 3G8WA 4KLWA 2P6EA 5G22A 2VZYA 4AB7A 1LRZA 4XNHB 2ATRA 1KUVA 2PC1A 3IWEA 2Q4VA 5DWNA 4CYNA 5DWMA 2ZW7A 4NXYA 4EVYA 5KTDA 5AG7A 4AG7A 3D2PA 4A30A 2EVNA 3F0AA 4C7IA 2D4PA 1S3ZA 1IB1E 4KOUA 2I79A 2X7BA 5I0CA 2PSWA 3SXNA 4UFVA 5F49A 4FD5A 3H4QA 1UFHA 2FT0A 3DDDA 1Z9UA 5HMNA 1M4GA 5H84A 4YRHA 2J8NA 3GKRA 1VHSA 4B10A 2Q44A 4Y49C 4CRYB 2VEZA 3V8IA 3PP9A 1GHEA 1NE9A 4A2ZA 3MGDA 5E96A 4MJ8A 5IV0A 4MI4A 1MJ9A 1Q2CA 2ZW4A 3LD2A 1XF8A 3QAHA 3DSBA 4HNYB 3CXPA 4XPKA 2CNMA 2B3UA 4F6AA 4C2YA 3F8KA 4M85A 2CNSA 2RC4A 2AJ6A 3T90A 4PV6A 4QB9A 5JQ4A 1WK4A 4CRZB 3S6HA 1S60A 1QSOA 3S6FA 2REEA 3GYAA 1S7LA 4Y49B 2Z3KA 4A95A 4B11A 3CXQA 1VKCA 2PR1A 3R96A 4CAWA 2FIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY5 A;  3FYN A;  1R57 A;  3JVN A;  3ZJ0 A;  4QBJ A;  5KTC A;  5J8F A;  1YRE A;  1M44 A;  3LOD A;  3S6G A;  5J8C A;  4OAD A;  3FXT A;  4B5O A;  4PK2 A;  1S5K A;  2OB0 A;  1I1D A;  2JEV A;  3W6S A;  1V0C A;  2D4O A;  3W91 A;  1Q2D A;  2PDO A;  4E2A A;  2WPW A;  4YFJ A;  1B6B A;  2R1I A;  4AVA A;  1BO4 A;  3ZZI A;  2R98 A;  4IUS A;  1KZF A;  1S7F A;  5F48 A;  2Q4Y A;  2Q7B A;  4KUB A;  3NE7 A;  2B4D B;  1QST A;  5ISV A;  1CJW A;  4PK3 A;  3F5B A;  4JJX A;  2ZPA A;  2Z0Z A;  1PUA A;  2IL4 A;  2OZH A;  4KOV A;  2PRB A;  4RS2 A;  4R87 A;  4ORF A;  1M4D A;  2HQY A;  2H5M A;  4AVB A;  4FD4 A;  3D3S A;  4YGO A;  3EO4 A;  1IYL A;  1WWZ A;  2VQY A;  2VI7 A;  3CXS A;  4KOW A;  3BJ8 A;  2JLM A;  4CAX A;  2VBQ A;  2PQ8 A;  2BUE A;  2JDD A;  4MHD A;  5CNP A;  4UWJ A;  3R9F A;  2Q0Y A;  2C27 A;  2B4D A;  3UY5 A;  1S7N A;  1L0C A;  2I00 A;  2FXF A;  4R3K A;  4E8O A;  4UA3 A;  1OZP A;  3TT2 A;  4XPD B;  2Z11 A;  4KOS A;  1FY7 A;  2O28 A;  5GCN A;  2EUI A;  5EC4 A;  3D2M A;  3PGP A;  4JLY A;  2R7H A;  4H89 A;  4HNX B;  1Q2Y A;  2AE6 A;  4KOT A;  2VXK A;  3KKW A;  4OAE A;  4CAV A;  1NSL A;  2FE7 A;  2ZXV A;  4U9Z A;  2B58 A;  3R9E A;  2WPX A;  2GE3 A;  2KCW A;  3OWC A;  1QSM A;  4U9Y A;  4GS4 A;  3TO9 A;  2J8R A;  1YX0 A;  3FIX A;  4J3G A;  1J4J A;  5JPH A;  1M1D A;  1MJA A;  3FB3 A;  1YR0 A;  4II9 A;  1XIX A;  4JD6 A;  3TTH A;  1I12 A;  4RI1 A;  1YLE A;  1XE4 A;  3D8P A;  1Y9W A;  4DNC A;  2CNT A;  5EBV A;  1N71 A;  2OU2 A;  3T9Y A;  3DR8 A;  5F46 A;  2BSW A;  3DNS A;  3TO7 A;  4H6Z A;  1YGH A;  2PR8 A;  2B5G B;  2Y0M A;  2DXQ A;  1S7K A;  2REF A;  3P2F A;  4ZBG A;  5H86 A;  3FNC A;  2BL1 A;  1CM0 A;  2P6F A;  4OLL A;  4U5Y A;  3C26 A;  3K9U A;  5IB0 A;  3TFY A;  2FS5 A;  3PZJ A;  4MY3 A;  1YVK A;  1IIC A;  2ZW6 A;  1KUX A;  2Q04 A;  4XPD C;  4KOR A;  3N7Z A;  4MY0 A;  3TOB A;  2G3A A;  4AVC A;  2Z10 A;  3RYO A;  4R57 A;  2FCK A;  4UWI A;  5KTA A;  1KUY A;  4QUS A;  4KLV A;  2CY2 A;  4NEX A;  1M4I A;  2B4B A;  4E0A A;  2J8M A;  2G3T A;  2OZG A;  2G0B A;  3R9G A;  5HH1 A;  1XEB A;  3TE4 A;  4PSW A;  1PU9 A;  4KVX A;  3BJ7 A;  4LX9 A;  2QML A;  3SXO A;  2HUZ A;  1B87 A;  3VWE A;  4KZT A;  1YK3 A;  3TO6 A;  3GY9 A;  4R9M A;  2NMT A;  3JUW A;  4QC6 A;  5F47 A;  2OZU A;  4NSQ A;  4FD7 A;  4HKF A;  1P0H A;  3I3G A;  3R1K A;  4KUA A;  5FVJ A;  4M3S A;  1MJB A;  5IX3 A;  1Z4R A;  4BMH A;  2FL4 A;  1Z4E A;  4KVO E;  3EC4 A;  4UBR A;  1Y9K A;  3FBU A;  3EXN A;  2FIA A;  2F5I A;  3FRM A;  3S6K A;  4JXQ A;  4L8A A;  3TOA A;  3IWG A;  2P0W A;  4L89 A;  2QEC A;  3BLN A;  1I21 A;  4LUA A;  4X5K A;  4KOX A;  1RXT A;  3IGR A;  2GIV A;  1TIQ A;  1NMT A;  4JWP A;  4NCZ A;  3W6X A;  4I49 A;  1P4N A;  1QSN A;  4ONU A;  4HNW B;  1Y7R A;  4AG9 A;  3QB8 A;  1SQH A;  4XNH C;  2VZZ A;  4MBU A;  4R3L A;  2JDC A;  2QIR A;  4H6U A;  1RO5 A;  2P6G A;  4KOY A;  2A4N A;  3EFA A;  2K5T A;  1MK4 A;  2GAN A;  4KVM E;  4K30 A;  3E0K A;  4B5P A;  4QVT A;  1ON0 A;  3P2H A;  2ZW5 A;  4XPL A;  2B5G A;  3G3S A;  2ARH A;  1QSR A;  5C88 A;  1K4J A;  3TCV A;  3DR6 A;  4FD6 A;  1BOB A;  3I9S A;  4F0Y A;  2B3V A;  1U6M A;  2BEI A;  1IID A;  2OH1 A;  1IYK A;  3WR7 A;  3R95 A;  3SHP A;  4IF5 A;  4B5P B;  4CS0 B;  4JXR A;  1XMT A;  2HV2 A;  1YVO A;  4PSX A;  5C82 A;  3B8G A;  3VWD A;  2FSR A;  2R8V A;  4NF1 A;  3G8W A;  4KLW A;  2P6E A;  2VZY A;  4AB7 A;  1LRZ A;  4XNH B;  2ATR A;  1KUV A;  2PC1 A;  2Q4V A;  5DWN A;  5DWM A;  2ZW7 A;  4NXY A;  4EVY A;  5KTD A;  4AG7 A;  3D2P A;  2EVN A;  3F0A A;  2D4P A;  1S3Z A;  1IB1 E;  4KOU A;  2I79 A;  2X7B A;  5I0C A;  2PSW A;  3SXN A;  5F49 A;  4FD5 A;  3H4Q A;  1UFH A;  2FT0 A;  3DDD A;  1Z9U A;  5HMN A;  1M4G A;  5H84 A;  4YRH A;  2J8N A;  3GKR A;  1VHS A;  2Q44 A;  4Y49 C;  4CRY B;  2VEZ A;  3V8I A;  1GHE A;  3PP9 A;  1NE9 A;  3MGD A;  5E96 A;  4MJ8 A;  5IV0 A;  4MI4 A;  1MJ9 A;  1Q2C A;  2ZW4 A;  3LD2 A;  1XF8 A;  3QAH A;  3DSB A;  4HNY B;  3CXP A;  4XPK A;  2CNM A;  2B3U A;  4F6A A;  3F8K A;  4M85 A;  2CNS A;  2RC4 A;  2AJ6 A;  3T90 A;  4PV6 A;  4QB9 A;  5JQ4 A;  1WK4 A;  4CRZ B;  3S6H A;  1S60 A;  1QSO A;  3S6F A;  2REE A;  3GYA A;  1S7L A;  4Y49 B;  3CXQ A;  1VKC A;  2PR1 A;  3R96 A;  4CAW A;  2FIW A; 
#chains in the Genus database with same CATH topology
 2CIJ A;  3EY5 A;  3KR4 A;  2GRE A;  1BAV A;  1DTD A;  3FYN A;  1R57 A;  4OC0 A;  3JVN A;  4FUU A;  4PXD A;  1FT7 A;  2YNE A;  2POK A;  4CAF A;  4GM5 A;  3ZJ0 A;  4QBJ A;  5KTC A;  3PFO A;  5J8F A;  4X3R A;  1YRE A;  4CAE A;  1M44 A;  3LOD A;  3S6G A;  4MFK A;  5J8C A;  4OAD A;  3FXT A;  5AG5 A;  4B5O A;  5AG4 A;  2Z3P A;  2IJZ A;  2Z3O A;  4PK2 A;  1S5K A;  1YME A;  4X2T A;  2O53 A;  4NGS A;  2AFO A;  2OB0 A;  3S9L A;  2OOT A;  1I1D A;  2JEV A;  2Q7S A;  1X12 A;  3KHX A;  3FMC A;  1TKJ A;  1VHO A;  1V0C A;  2D4O A;  3W6S A;  3B3V A;  3W91 A;  1Q2D A;  4NGR A;  1FNO A;  2HB6 A;  4UCM A;  4EWT A;  2PDO A;  3KQZ A;  4IK2 A;  4MHN A;  4E2A A;  1Z8T A;  1KWM A;  2WPW A;  4YFJ A;  3IU2 A;  2PVV A;  1B6B A;  2R1I A;  4AVA A;  4GXH A;  1ARL A;  2PRQ A;  1BO4 A;  5D29 A;  5G21 A;  3ZZI A;  1BPM A;  5JM6 A;  2R98 A;  3SI0 A;  3MRU A;  1VIX A;  2QYV A;  1Z5R A;  4IUS A;  1KZF A;  3CZX A;  1S7F A;  3NFZ A;  2ZEP A;  2NYQ A;  5F48 A;  2Q4Y A;  2Q7B A;  4KUB A;  5HVH A;  3NE7 A;  2PJ7 A;  2B4D B;  1QST A;  7CPA A;  5ISV A;  1CJW A;  4PK3 A;  3F5B A;  4JJX A;  2ZPA A;  2NSM A;  2Z0Z A;  3B3S A;  1PUA A;  3BXM A;  2RFH A;  3TX8 A;  2IL4 A;  4UEF A;  2OZH A;  1LAN A;  3B7I A;  3FEC A;  4KOV A;  2PRB A;  4OC4 A;  4RS2 A;  5CBM A;  4R87 A;  4ORF A;  2YNC C;  3ISZ A;  1M4D A;  2HQY A;  4A31 A;  2H5M A;  4AVB A;  3PBE A;  4FD4 A;  3IO1 A;  4F8Z A;  3D3S A;  4YGO A;  4FAI A;  3EO4 A;  3GIU A;  1CPX A;  3KL9 A;  1IYL A;  1WWZ A;  2VQY A;  2VI7 A;  1Y0Y A;  3CXS A;  4K3N A;  4KOW A;  4MFL A;  3IEH A;  1ZG8 A;  3D7H A;  3BJ8 A;  4Q7A A;  2JLM A;  4OKO A;  4CAX A;  3QNV A;  2VBQ A;  2PQ8 A;  1CP7 A;  2BUE A;  3VH9 A;  2JDD A;  4MHD A;  5CNP A;  2DPT A;  2ODF A;  4UWJ A;  4MFJ A;  4OC1 A;  2PE3 A;  2XEG A;  3SJE A;  2CXA A;  3IWW A;  5LYL A;  3R9F A;  1PCA A;  2C27 A;  2Q0Y A;  4P4E A;  5K8M A;  1LCP A;  2B4D A;  2PJB A;  5K8P A;  3WC7 A;  3UY5 A;  1UWY A;  1S7N A;  1VGY A;  1ZO0 A;  4NGQ A;  1HEE A;  4A33 A;  4LQ6 A;  4ONW A;  1L0C A;  2I00 A;  2FXF A;  3PB8 X;  4R3K A;  3D7G A;  4E8O A;  4UA3 A;  2O4H A;  1OZP A;  1CP6 A;  1PYT B;  2GLJ A;  2ZOF A;  4XPD B;  2Z11 A;  4KOS A;  1FY7 A;  3GUX A;  2O28 A;  4UIB A;  5GCN A;  3PB4 X;  2EUI A;  5EC4 A;  1XOV A;  3D2M A;  3PGP A;  4JLY A;  3NH5 A;  2R7H A;  1Z8L A;  4H89 A;  1ZG9 A;  4HNX B;  1Q2Y A;  4NGN A;  1ELL P;  5AGE A;  2AE6 A;  3KHZ A;  4KOT A;  4A38 A;  4CYP A;  2VXK A;  3KKW A;  4OAE A;  4CAV A;  1JWQ A;  1NSL A;  2FE7 A;  2ZXV A;  3SJF A;  1YSJ A;  4U9Z A;  2B58 A;  3RBU A;  2AFZ A;  5LRG A;  3R9E A;  4ZY0 A;  2WPX A;  2GE3 A;  5THW A;  2Z3M A;  2KCW A;  1BPN A;  3SJX A;  3OWC A;  1QSM A;  4U9Y A;  2GU2 A;  2EO8 A;  5D8N A;  4GS4 A;  1LFW A;  4A39 A;  3TO9 A;  2J8R A;  4UCN A;  1CX8 A;  1YX0 A;  3D4U A;  5BWA B;  1AMP A;  1EE3 P;  3FIX A;  1GYT A;  4MCS A;  3FX6 A;  4J3G A;  1J4J A;  5JPH A;  1M1D A;  1MJA A;  2PCU A;  3H5Z A;  1H8L A;  4NGP A;  3NH4 A;  3NH8 A;  3PRT A;  3FB3 A;  1YR0 A;  5ELY A;  4II9 A;  2AFS A;  2Q51 A;  1ZG7 A;  1XIX A;  1TF8 A;  4MHP A;  4JD6 A;  4A94 A;  2ZEG A;  3TTH A;  3RAM A;  1I12 A;  4JYW A;  4RI1 A;  1YLE A;  2Z3N A;  4CYQ A;  2RB7 A;  1XE4 A;  3D8P A;  2ZOG A;  3L2N A;  5LRJ A;  3D67 A;  2Z3L A;  4Q36 A;  1Y9W A;  4MRI A;  2GFQ A;  1AYE A;  4R7M A;  4DNC A;  3FVL A;  2CNT A;  4ZYQ A;  3QAY A;  5EBV A;  3CT9 A;  1N71 A;  3VAR A;  3N5F A;  2JBK A;  2OU2 A;  3T9Y A;  5HXD A;  4RUH A;  4CYO A;  3DR8 A;  1IU8 A;  4UEE A;  5F46 A;  2QVP A;  2BSW A;  3DLJ A;  3DNS A;  3TO7 A;  4H6Z A;  1Q7L A;  1YGH A;  2PR8 A;  2B5G B;  2JBJ A;  3WC6 A;  2DEA A;  2Y0M A;  1YW6 A;  2DXQ A;  3B3C A;  1IGB A;  3B3T A;  4ZGY B;  5HVF A;  1S7K A;  2REF A;  3P2F A;  1LOK A;  4ZBG A;  5H86 A;  3FNC A;  2BL1 A;  1CM0 A;  2CTB A;  2P6F A;  2YND A;  4OLL A;  1X10 A;  4U5Y A;  5LRK A;  3DGV A;  3C26 A;  3K9U A;  4KSA A;  5IB0 A;  3TFY A;  2FS5 A;  3B2Y A;  3PZJ A;  1DE4 C;  4ZI6 A;  2PJ3 A;  2WSA A;  2WUU A;  2Q43 A;  1YVK A;  4MY3 A;  1IIC A;  4NJQ A;  2ZW6 A;  3GB0 A;  3MN8 A;  1KUX A;  4P4F A;  2Q04 A;  4XPD C;  4KOR A;  5AG6 A;  4P6Y A;  2IMO A;  2PJ8 A;  2V8V A;  3N7Z A;  2G3A A;  4MY0 A;  3TOB A;  4EFD A;  2F8H A;  2V8G A;  4AVC A;  2Z10 A;  5LYF A;  4MCR A;  3RYO A;  5J1Q A;  4P4J A;  2FCK A;  4R57 A;  4UWI A;  5KTA A;  1KUY A;  2G9D A;  3BI0 A;  5IB9 A;  4QUS A;  3SI1 A;  4DJL A;  4KLV A;  2CY2 A;  2PJ0 A;  5JH9 A;  4NEX A;  1M4I A;  2B4B A;  4CGN A;  4E0A A;  1XMB A;  1Z2L A;  2J8M A;  2AFM A;  2G3T A;  2ZEL A;  4B13 A;  2OZG A;  2G0B A;  4MCQ A;  2ANP A;  3R9G A;  4P4B A;  4W9Y A;  1XEB A;  5HH1 A;  2CTC A;  2BOA A;  4UIA A;  1A2Z A;  4PSW A;  1PU9 A;  1Z8X A;  3BJ7 A;  3JTK A;  4KVX A;  2ZEM A;  2XEJ A;  3A9L A;  1ZLH A;  4HPS A;  4LX9 A;  2QML A;  3D68 A;  4UEZ A;  3SXO A;  2HUZ A;  6CPA A;  1B87 A;  3VWE A;  2DPS A;  4KZT A;  4OC5 A;  1YK3 A;  3TO6 A;  3GY9 A;  4B14 A;  3SI2 A;  4R9M A;  3FJU A;  2NMT A;  3JUW A;  4QC6 A;  4C68 A;  4BIN A;  5F47 A;  1AUG A;  3KZW A;  2OZU A;  1IOI A;  4NSQ A;  4FD7 A;  2ZEH A;  4HKF A;  2C1C A;  4MHY A;  4R8F A;  4CGP A;  1P0H A;  3I3G A;  4PQA A;  3R1K A;  4KUA A;  5FVJ A;  3WT4 A;  1YW4 A;  4M3S A;  1MJB A;  1TXR A;  1IY7 A;  4MFQ A;  4YWY A;  5IX3 A;  3HLP A;  1Z4R A;  4BMH A;  2PJ6 A;  4BBH A;  5LYI A;  2FL4 A;  4NJR A;  5G1Z A;  4LQG A;  1Z4E A;  4KVO E;  2JEW A;  3EC4 A;  3K9T A;  4UBR A;  1Y9K A;  3FBU A;  3CPX A;  3PB7 X;  4UFX A;  4CGL A;  2PIZ A;  4KSI A;  3V7Z A;  4F9U A;  4P4D A;  3EXN A;  3H8F A;  3D7D A;  2FIA A;  2V8H A;  2PJ4 A;  2F5I A;  1XBU A;  1XJO A;  4IAV A;  3FRM A;  3S6K A;  4JXQ A;  4L8A A;  5LYD A;  5DS0 A;  3TOA A;  4DYO A;  4RN7 A;  4CGM A;  3IWG A;  2P0W A;  2BCO A;  3IJ3 A;  2ZEN A;  4L89 A;  1YLO A;  2QEC A;  1I21 A;  3BLN A;  4LUA A;  4Q38 A;  4X5K A;  4KOX A;  1RXT A;  4OP4 A;  4MFP A;  3IGR A;  2ZEE A;  1JQG A;  4UCP A;  1CG2 A;  4F9V A;  4NGT A;  2GIV A;  4PXC A;  1BLL E;  1TIQ A;  2Q4Z A;  2C6C A;  1NMT A;  4M6H A;  4JWP A;  2PJC A;  5HVG A;  4WJB A;  4NCZ A;  3LWU A;  2C6G A;  3W6X A;  4I49 A;  1P4N A;  1RTQ A;  3V38 A;  1ARM A;  1QSN A;  4ONU A;  2OR4 A;  3D66 A;  4HNW B;  1Y7R A;  3I1U A;  3PBB A;  4AG9 A;  4M6I A;  3QB8 A;  4A32 A;  1SQH A;  2PIY A;  3IU1 A;  4XNH C;  1CPS A;  4F0X A;  1Y7E A;  4MFZ A;  4ZY1 A;  4PPZ A;  2EWB A;  2PJ1 A;  2VZZ A;  2QJ8 A;  4MBU A;  4R6T A;  4B6Z A;  4R3L A;  2JDC A;  2QIR A;  4H6U A;  1RO5 A;  2P6G A;  4KOY A;  2A4N A;  2PJ2 A;  3EFA A;  2K5T A;  3ISX A;  4CGO A;  4OID A;  4C2X A;  1MK4 A;  4FWU A;  2GAN A;  3LAC A;  4KVM E;  4K30 A;  3E0K A;  2YNC A;  2C6P A;  4QVT A;  4B5P A;  1ON0 A;  3K2K A;  2ZW5 A;  3P2H A;  4XPL A;  4H2K A;  4P45 A;  2B5G A;  4C2Z A;  3G3S A;  2ARH A;  1QSR A;  4OC2 A;  4MHZ A;  4KSF A;  5C88 A;  4B12 A;  5K8O A;  4OC3 A;  1K4J A;  3TCV A;  4KS9 A;  5A28 A;  4BD9 A;  3DR6 A;  4FD6 A;  2EBJ A;  2XEF A;  1BOB A;  2WYR A;  3CDX A;  3I9S A;  4F0Y A;  2J9A A;  4NGM A;  4ZY2 A;  2B3V A;  4MMO A;  1U6M A;  4OME A;  4C7H A;  2BEI A;  4IHM A;  1F57 A;  3TE4 A;  4P44 A;  4PXE A;  1IID A;  1NSA A;  2OH1 A;  3S9N A;  1TF9 A;  1XFO A;  1IYK A;  3WR7 A;  3R95 A;  3H8E A;  4O23 A;  4UFW A;  5EMI A;  1R3N A;  1OBR A;  3SHP A;  3TT2 A;  5A27 A;  4IF5 A;  4B5P B;  5G20 A;  4CS0 B;  2EK9 A;  4JXR A;  4R76 A;  3VAT A;  1ELM P;  1XMT A;  2HV2 A;  3PFE A;  2EK8 A;  1YVO A;  4MCP A;  5JGF A;  4ZX9 A;  2YGW A;  4PSX A;  4UF4 A;  5C82 A;  3GLJ A;  3B8G A;  3IC1 A;  3VWD A;  2FSR A;  2R8V A;  4NF1 A;  4JZ0 A;  3G8W A;  1IOF A;  1TKF A;  2AFW A;  4KLW A;  4OIW A;  4EME A;  2P6E A;  2ZEF A;  4P10 A;  5G22 A;  2VZY A;  1F2P A;  4AB7 A;  4AXV A;  1LRZ A;  3FH4 A;  4XNH B;  3B35 A;  3WAB A;  2ATR A;  3RZA A;  2XEI A;  3KAS A;  1R43 A;  1KUV A;  4X8I A;  3TC8 A;  3D7F A;  2PC1 A;  3IWE A;  3B3W A;  2GLF A;  2FVG A;  2Q4V A;  5DWN A;  3T8W A;  4CYN A;  5DWM A;  2ZW7 A;  2PJ5 A;  4NXY A;  3IFE A;  4EVY A;  5KTD A;  2DF5 A;  5AG7 A;  4AG7 A;  3HUV A;  4NFR A;  4TNU A;  2PJA A;  4WWV A;  3D2P A;  1HDU A;  2CF4 A;  2AFU A;  4A37 A;  4A30 A;  1YQE A;  2EVN A;  5F09 A;  3BI1 A;  3F0A A;  4C7I A;  2I3C A;  3S9M A;  4TWE A;  2D4P A;  1S3Z A;  1IB1 E;  2ABZ A;  4KOU A;  3NA6 A;  2I79 A;  2X7B A;  5I0C A;  2PSW A;  3KQX A;  1ZLI A;  4UFV A;  3SXN A;  2IQ6 A;  5F49 A;  4FD5 A;  3H4Q A;  1UFH A;  5CPA A;  8CPA A;  2FT0 A;  2ZED A;  2V77 A;  4YU9 A;  3DDD A;  1Z9U A;  5HMN A;  1VHE A;  1M4G A;  3BHX A;  5H84 A;  4ZX8 A;  2ZEO A;  4YRH A;  4P4I A;  2J8N A;  3GKR A;  3RO0 A;  1VHS A;  2HC9 A;  4B10 A;  1Y0R A;  4M6G A;  1CBX A;  3FF3 A;  2Q44 A;  4CPA A;  2VL1 A;  4Y49 C;  4CRY B;  4FBE A;  5I4M A;  1QQ9 A;  1Z8W A;  2VEZ A;  3V8I A;  1GHE A;  3PEI A;  1NE9 A;  3PP9 A;  4A2Z A;  1HDQ A;  3MGD A;  3IIB A;  3KI9 A;  5E96 A;  4MJ8 A;  1XRY A;  5IV0 A;  2PJ9 A;  4MI4 A;  1MJ9 A;  1Q2C A;  2ZW4 A;  3JRU A;  3LD2 A;  4G1P A;  1XF8 A;  3KR5 A;  3SJG A;  3QAH A;  3DSB A;  4HNY B;  1F2O A;  3CXP A;  4XPK A;  1TKH A;  3PB9 X;  2CNM A;  2B3U A;  3PB6 X;  3LMS A;  4F6A A;  1LAP A;  4C2Y A;  3F8K A;  4M85 A;  3NE8 A;  1M4L A;  2CNS A;  2RC4 A;  2AJ6 A;  3FEE A;  2PVW A;  3T90 A;  4PV6 A;  4PXB A;  3KGQ A;  5K8N A;  4QB9 A;  2BO9 A;  4DUK A;  1WK4 A;  4MXU A;  4CRZ B;  5JQ4 A;  3S6H A;  3FED A;  2V8D A;  1S60 A;  3WC5 A;  1QSO A;  3S6F A;  2WZN A;  2F7V A;  2REE A;  3RNZ A;  4Z65 A;  3GYA A;  1S7L A;  2AFX A;  3CPA A;  3H8G A;  1LAM A;  4Y49 B;  2Z3K A;  4A95 A;  4B11 A;  3CXQ A;  1VKC A;  1QMU A;  2PR1 A;  3R96 A;  4CAW A;  2FIW A; 
#chains in the Genus database with same CATH homology
 3EY5 A;  3FYN A;  1R57 A;  3JVN A;  2YNE A;  4CAF A;  3ZJ0 A;  4QBJ A;  5KTC A;  5J8F A;  1YRE A;  4CAE A;  1M44 A;  3LOD A;  3S6G A;  4MFK A;  5J8C A;  4OAD A;  3FXT A;  5AG5 A;  4B5O A;  5AG4 A;  2Z3P A;  2Z3O A;  4PK2 A;  1S5K A;  2OB0 A;  1I1D A;  2JEV A;  3W6S A;  1V0C A;  2D4O A;  3W91 A;  1Q2D A;  4UCM A;  2PDO A;  4E2A A;  2WPW A;  4YFJ A;  3IU2 A;  1B6B A;  2R1I A;  4AVA A;  1BO4 A;  3ZZI A;  5G21 A;  2R98 A;  4IUS A;  1KZF A;  1S7F A;  5F48 A;  2Q4Y A;  2Q7B A;  4KUB A;  3NE7 A;  2B4D B;  1QST A;  5ISV A;  1CJW A;  4PK3 A;  3F5B A;  4JJX A;  2ZPA A;  2Z0Z A;  1PUA A;  2IL4 A;  2OZH A;  4KOV A;  2PRB A;  4RS2 A;  4R87 A;  4ORF A;  2YNC C;  1M4D A;  2HQY A;  4A31 A;  2H5M A;  4AVB A;  4FD4 A;  3D3S A;  4YGO A;  3EO4 A;  1IYL A;  1WWZ A;  2VQY A;  2VI7 A;  3CXS A;  4KOW A;  4MFL A;  3BJ8 A;  2JLM A;  4CAX A;  2VBQ A;  2PQ8 A;  2BUE A;  2JDD A;  4MHD A;  5CNP A;  2DPT A;  4UWJ A;  4MFJ A;  2CXA A;  3R9F A;  2Q0Y A;  2C27 A;  2B4D A;  3UY5 A;  1S7N A;  1ZO0 A;  4A33 A;  1L0C A;  2I00 A;  2FXF A;  4R3K A;  4E8O A;  4UA3 A;  1OZP A;  3TT2 A;  4XPD B;  2Z11 A;  4KOS A;  1FY7 A;  2O28 A;  5GCN A;  2EUI A;  5EC4 A;  3D2M A;  3PGP A;  4JLY A;  2R7H A;  4H89 A;  4HNX B;  1Q2Y A;  5AGE A;  2AE6 A;  4KOT A;  4CYP A;  2VXK A;  3KKW A;  4OAE A;  4CAV A;  1NSL A;  2FE7 A;  2ZXV A;  4U9Z A;  2B58 A;  3R9E A;  2WPX A;  2GE3 A;  2Z3M A;  2KCW A;  3OWC A;  1QSM A;  4U9Y A;  4GS4 A;  3TO9 A;  2J8R A;  4UCN A;  1YX0 A;  5BWA B;  3FIX A;  4J3G A;  1J4J A;  5JPH A;  1M1D A;  1MJA A;  3H5Z A;  3FB3 A;  1YR0 A;  4II9 A;  1XIX A;  4JD6 A;  3TTH A;  1I12 A;  4RI1 A;  1YLE A;  2Z3N A;  4CYQ A;  1XE4 A;  3D8P A;  2Z3L A;  4Q36 A;  1Y9W A;  4DNC A;  2CNT A;  5EBV A;  1N71 A;  2OU2 A;  3T9Y A;  4CYO A;  3DR8 A;  5F46 A;  2BSW A;  3DNS A;  3TO7 A;  4H6Z A;  1YGH A;  2PR8 A;  2B5G B;  2Y0M A;  2DXQ A;  4ZGY B;  1S7K A;  2REF A;  3P2F A;  4ZBG A;  5H86 A;  3FNC A;  2BL1 A;  1CM0 A;  2P6F A;  2YND A;  4OLL A;  4U5Y A;  3C26 A;  3K9U A;  4KSA A;  5IB0 A;  3TFY A;  2FS5 A;  3PZJ A;  2WSA A;  2WUU A;  1YVK A;  4MY3 A;  1IIC A;  2ZW6 A;  1KUX A;  2Q04 A;  4XPD C;  4KOR A;  5AG6 A;  3N7Z A;  4MY0 A;  3TOB A;  2G3A A;  4AVC A;  2Z10 A;  3RYO A;  4R57 A;  2FCK A;  4UWI A;  5KTA A;  1KUY A;  4QUS A;  4KLV A;  2CY2 A;  4NEX A;  1M4I A;  2B4B A;  4CGN A;  4E0A A;  2J8M A;  2G3T A;  4B13 A;  2OZG A;  2G0B A;  3R9G A;  5HH1 A;  1XEB A;  3TE4 A;  4PSW A;  1PU9 A;  3JTK A;  3BJ7 A;  4KVX A;  3A9L A;  4LX9 A;  2QML A;  3SXO A;  2HUZ A;  1B87 A;  3VWE A;  2DPS A;  4KZT A;  1YK3 A;  3TO6 A;  3GY9 A;  4B14 A;  4R9M A;  2NMT A;  3JUW A;  4QC6 A;  4C68 A;  5F47 A;  2OZU A;  4NSQ A;  4FD7 A;  4CGP A;  4HKF A;  1P0H A;  3I3G A;  3R1K A;  4KUA A;  5FVJ A;  4M3S A;  1MJB A;  4MFQ A;  5IX3 A;  1Z4R A;  4BMH A;  4BBH A;  2FL4 A;  5G1Z A;  1Z4E A;  4KVO E;  3EC4 A;  4UBR A;  1Y9K A;  3FBU A;  4UFX A;  4CGL A;  3EXN A;  2FIA A;  2F5I A;  3FRM A;  3S6K A;  4JXQ A;  4L8A A;  3TOA A;  4CGM A;  3IWG A;  2P0W A;  4L89 A;  2QEC A;  3BLN A;  1I21 A;  4LUA A;  4Q38 A;  4X5K A;  4KOX A;  1RXT A;  4MFP A;  3IGR A;  4UCP A;  2GIV A;  1TIQ A;  1NMT A;  4JWP A;  4NCZ A;  3W6X A;  4I49 A;  1P4N A;  1QSN A;  4ONU A;  4HNW B;  1Y7R A;  4AG9 A;  3QB8 A;  4A32 A;  1SQH A;  3IU1 A;  4XNH C;  4F0X A;  4MFZ A;  2VZZ A;  4MBU A;  4R3L A;  2JDC A;  2QIR A;  4H6U A;  1RO5 A;  2P6G A;  4KOY A;  2A4N A;  3EFA A;  2K5T A;  4CGO A;  4C2X A;  1MK4 A;  2GAN A;  4KVM E;  4K30 A;  3E0K A;  2YNC A;  4QVT A;  4B5P A;  1ON0 A;  3P2H A;  2ZW5 A;  4XPL A;  2B5G A;  4C2Z A;  3G3S A;  2ARH A;  1QSR A;  4KSF A;  5C88 A;  4B12 A;  1K4J A;  3TCV A;  4KS9 A;  5A28 A;  3DR6 A;  4FD6 A;  1BOB A;  3I9S A;  4F0Y A;  2B3V A;  1U6M A;  4C7H A;  2BEI A;  1IID A;  2OH1 A;  1IYK A;  3WR7 A;  3R95 A;  4UFW A;  5A27 A;  3SHP A;  4IF5 A;  4B5P B;  5G20 A;  4CS0 B;  4JXR A;  1XMT A;  2HV2 A;  1YVO A;  2YGW A;  4PSX A;  5C82 A;  3B8G A;  3VWD A;  2FSR A;  2R8V A;  4NF1 A;  3G8W A;  4KLW A;  2P6E A;  5G22 A;  2VZY A;  4AB7 A;  1LRZ A;  4XNH B;  2ATR A;  1KUV A;  2PC1 A;  3IWE A;  2Q4V A;  5DWN A;  4CYN A;  5DWM A;  2ZW7 A;  4NXY A;  4EVY A;  5KTD A;  5AG7 A;  4AG7 A;  3D2P A;  4A30 A;  2EVN A;  3F0A A;  4C7I A;  2D4P A;  1S3Z A;  1IB1 E;  4KOU A;  2I79 A;  2X7B A;  5I0C A;  2PSW A;  3SXN A;  4UFV A;  5F49 A;  4FD5 A;  3H4Q A;  1UFH A;  2FT0 A;  3DDD A;  1Z9U A;  5HMN A;  1M4G A;  5H84 A;  4YRH A;  2J8N A;  3GKR A;  1VHS A;  4B10 A;  2Q44 A;  4Y49 C;  4CRY B;  2VEZ A;  3V8I A;  3PP9 A;  1GHE A;  1NE9 A;  4A2Z A;  3MGD A;  5E96 A;  4MJ8 A;  5IV0 A;  4MI4 A;  1MJ9 A;  1Q2C A;  2ZW4 A;  3LD2 A;  1XF8 A;  3QAH A;  3DSB A;  4HNY B;  3CXP A;  4XPK A;  2CNM A;  2B3U A;  4F6A A;  4C2Y A;  3F8K A;  4M85 A;  2CNS A;  2RC4 A;  2AJ6 A;  3T90 A;  4PV6 A;  4QB9 A;  5JQ4 A;  1WK4 A;  4CRZ B;  3S6H A;  1S60 A;  1QSO A;  3S6F A;  2REE A;  3GYA A;  1S7L A;  4Y49 B;  2Z3K A;  4A95 A;  4B11 A;  3CXQ A;  1VKC A;  2PR1 A;  3R96 A;  4CAW A;  2FIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...