4KUAA

Crystal structure of a gnat superfamily acetyltransferase pa4794
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
GHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 43
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kuaA00
1BO4A 3I3GA 4JD6A 3LD2A 1J4JA 4MHDA 2BSWA 3GYAA 2PC1A 1Q2YA 2D4OA 1IYKA 1RXTA 4Y49B 4OAEA 1PUAA 3R9EA 3FNCA 1YREA 4MJ8A 2FSRA 4J3GA 4II9A 2J8NA 2REEA 1YR0A 1OZPA 1GHEA 2AE6A 4PK3A 3G3SA 4R3KA 2R7HA 2VI7A 1BOBA 3R1KA 3TOBA 4JXRA 4MY3A 3IGRA 2FIWA 4QB9A 4E8OA 4R87A 4K30A 3W91A 4LUAA 2QMLA 1MJ9A 3TTHA 3V8IA 3W6SA 4LX9A 4UWJA 4B5OA 1ON0A 4YRHA 2OZGA 3F8KA 4YFJA 3NE7A 4FD6A 4ONUA 4U9ZA 5E96A 1IIDA 2Q04A 2B4DA 4RI1A 4KOYA 3B8GA 1PU9A 2Z0ZA 3R96A 2VBQA 3DDDA 1Q2CA 4M85A 4F6AA 2G3AA 3P2HA 5I0CA 3FXTA 4UA3A 2F5IA 2Q4YA 3G8WA 2PQ8A 2FL4A 1I21A 3EC4A 5IV0A 1S3ZA 4U9YA 1P4NA 1M4GA 2JLMA 2EVNA 3TO6A 1B87A 4JLYA 5JPHA 1XEBA 4MY0A 1QSOA 3KKWA 2P6GA 4NXYA 2REFA 4FD5A 4KUBA 2R1IA 1NE9A 2FIAA 2J8RA 2NMTA 2G0BA 3D2PA 1M4DA 1Q2DA 2P6FA 2BUEA 4QUSA 2G3TA 1QSRA 5KTAA 2K5TA 1RO5A 4FD7A 5HMNA 3FRMA 4U5YA 5CNPA 4ZBGA 3BLNA 4AG7A 4MBUA 1L0CA 4KLWA 3FBUA 4KOUA 2I00A 1MJAA 1LRZA 5F46A 3EFAA 4I49A 1VHSA 5IB0A 2FCKA 1KUVA 4MI4A 2B5GB 5ISVA 4XNHC 2X7BA 3R9FA 2FT0A 4OLLA 4PSWA 3D3SA 3P2FA 2ZW4A 3SXNA 2JEVA 2PR1A 2ZW7A 1S7LA 5KTCA 4KOSA 2HV2A 4KZTA 4JXQA 4NF1A 2Q0YA 1IB1E 3VWDA 1KUXA 2HQYA 2WPWA 2CY2A 5H84A 3TCVA 3T9YA 3FYNA 2QIRA 1Y9WA 3SHPA 2OU2A 4CRZB 1WWZA 2HUZA 2DXQA 3DR6A 4CAVA 3S6GA 1MJBA 5GCNA 2H5MA 4QC6A 4R3LA 4KOVA 3DSBA 1S5KA 2FXFA 2GIVA 1M4IA 3QAHA 5IX3A 3CXSA 4KORA 1QSMA 3T90A 1I12A 4H89A 4E0AA 1IICA 2IL4A 3BJ7A 3DR8A 3TE4A 2VZZA 1Z4EA 2Q4VA 2B4DB 2GE3A 3C26A 3GY9A 4R9MA 3CXPA 4AVAA 2B3VA 3MGDA 5J8CA 4R57A 4DNCA 2B58A 3E0KA 1TIQA 4XNHB 5JQ4A 4HNXB 2Q44A 3FB3A 4KOXA 2ZW6A 3VWEA 4XPDB 2WPXA 1YVKA 4UWIA 3LODA 3TO7A 1YLEA 5DWMA 1YX0A 4KOTA 2BEIA 3S6KA 4B5PA 1N71A 1YGHA 4BMHA 3PZJA 1S7KA 3TT2A 1R57A 2Q7BA 1S7NA 2BL1A 3UY5A 3RYOA 2AJ6A 2GANA 2Y0MA 3D2MA 3FIXA 1Z9UA 2ZW5A 4CS0B 4AB7A 4NEXA 4UBRA 4F0YA 4KUAA 4EVYA 2PRBA 2CNTA 4IF5A 1U6MA 3K9UA 3H4QA 2B5GA 4H6ZA 1KZFA 2VXKA 1Y7RA 2OZHA 4PSXA 4JJXA 4XPDC 1M1DA 4KVME 1KUYA 1NMTA 1XF8A 4NCZA 4KVOE 4CAXA 3I9SA 3PP9A 1K4JA 4IUSA 4FD4A 2JDCA 4HKFA 1Z4RA 1VKCA 2B4BA 1UFHA 4AVCA 3EY5A 4QVTA 2R8VA 2D4PA 2J8MA 1SQHA 4PK2A 2O28A 1XE4A 1YK3A 3TO9A 1V0CA 5EBVA 4KLVA 4AVBA 3QB8A 2EUIA 1MK4A 5HH1A 1YVOA 3N7ZA 2KCWA 2VQYA 4CRYB 4M3SA 4RS2A 2Z11A 4L89A 5F48A 5EC4A 3R95A 4JWPA 2FS5A 4X5KA 1XMTA 1CM0A 4ORFA 1I1DA 2VZYA 4XPLA 4Y49C 2ATRA 3OWCA 4XPKA 4H6UA 3S6FA 5KTDA 4KVXA 3DNSA 2A4NA 3TOAA 2JDDA 3CXQA 2PR8A 2ZXVA 3EO4A 2I79A 2R98A 4KOWA 3EXNA 1CJWA 4L8AA 3GKRA 3JUWA 5F47A 2OZUA 5C82A 2CNMA 3R9GA 3TFYA 2RC4A 1WK4A 3JVNA 5C88A 4GS4A 4PV6A 4NSQA 2Z10A 1QSTA 2PDOA 2FE7A 1XIXA 2C27A 1S60A 4CAWA 2VEZA 5H86A 2ZPAA 4HNYB 4YGOA 2P6EA 3S6HA 1M44A 1S7FA 1FY7A 3F0AA 3WR7A 4OADA 2OB0A 5J8FA 1Y9KA 2PSWA 3PGPA 4B5PB 1P0HA 3SXOA 3ZZIA 3IWGA 3W6XA 2CNSA 1IYLA 2OH1A 2QECA 2ARHA 2P0WA 4QBJA 2B3UA 3F5BA 1B6BA 1NSLA 4E2AA 5DWNA 4HNWB 1QSNA 3ZJ0A 5F49A 3BJ8A 5FVJA 4AG9A 3D8PA
chains in the Genus database with same CATH superfamily
1BO4A 2C6CA 3I3GA 4JD6A 1VHEA 2DEAA 3LD2A 3IO1A 1J4JA 2F7VA 2BSWA 4MHDA 3GYAA 2PC1A 1Q2YA 2D4OA 1IYKA 1RXTA 2PJAA 4Y49B 4OAEA 1F2PA 1PUAA 3R9EA 4A39A 3WABA 1TKJA 8CPAA 3NH8A 2YGWA 1YREA 3FNCA 4MJ8A 4PXDA 1CP7A 1CPSA 2FSRA 4J3GA 4II9A 1F2OA 2J8NA 2REEA 1YR0A 1ELLP 5D29A 1OZPA 1GHEA 4MCRA 2AE6A 4F9VA 4PK3A 2WUUA 3G3SA 3B2YA 4R3KA 2R7HA 4R6TA 2VI7A 3KI9A 1BOBA 4PXEA 3R1KA 3IWEA 3KZWA 1A2ZA 4ZX9A 3TOBA 4Q36A 4BINA 4CGLA 4JXRA 5HVGA 2ZEFA 4MY3A 3IGRA 2FIWA 2PIZA 4QB9A 3NFZA 4E8OA 4R87A 1IOFA 2ANPA 4K30A 3W91A 3B35A 4LUAA 2QMLA 5HVHA 1MJ9A 3TTHA 3V8IA 3W6SA 4LX9A 2PJ0A 4UWJA 4B5OA 3WC7A 1ON0A 2Q43A 2DPSA 2I3CA 4YRHA 4C2ZA 4W9YA 2OZGA 4MHPA 4DYOA 2HC9A 3CT9A 4JYWA 4Q38A 3F8KA 4C68A 2PJ7A 3IC1A 4OP4A 3KHZA 3PBEA 2GLJA 5AG6A 4YFJA 4CAEA 4F9UA 1TKHA 3NE7A 4NGNA 4FD6A 4CGOA 4ONUA 4U9ZA 4PPZA 5E96A 5G21A 1IIDA 1NSAA 2BOAA 2Q04A 2B4DA 2BO9A 5LRJA 4RI1A 4B11A 1ZO0A 4KOYA 2PJCA 4UEZA 5J1QA 2XEJA 2CF4A 3SI2A 4A33A 4OC5A 2V77A 4OC0A 1IU8A 3V7ZA 3B8GA 1ELMP 2G9DA 4UIBA 2JBKA 2YNCA 2PJ2A 4IK2A 1PU9A 1TF8A 2Z0ZA 2QVPA 4KSIA 4G1PA 4UF4A 3BI1A 5THWA 1PCAA 3R96A 2VBQA 3DDDA 1Q2CA 3H8FA 4M85A 2OOTA 4F6AA 2G3AA 3P2HA 4MCSA 4UCPA 5I0CA 4B10A 2EBJA 3FXTA 4UA3A 2F5IA 3S9NA 3RZAA 2ZOFA 2Q4YA 2AFOA 4RUHA 3G8WA 2PQ8A 2PVVA 3S9MA 4MXUA 2FL4A 4OC2A 1I21A 3EC4A 5IV0A 1S3ZA 4U9YA 2PCUA 1P4NA 3QAYA 3VATA 1M4GA 2JLMA 2EVNA 3KL9A 3TO6A 3HUVA 3MN8A 4FWUA 5CPAA 1B87A 2QJ8A 5LYDA 5A27A 5HVFA 4JLYA 4F0XA 5JPHA 4R7MA 1XEBA 2V8DA 2ZOGA 1VIXA 2PVWA 4MY0A 1QSOA 3KKWA 2IJZA 2XEGA 2P6GA 4NXYA 2J9AA 4LQ6A 2DPTA 2REFA 4CPAA 2C6GA 4FD5A 4BD9A 2C6PA 4KUBA 2R1IA 5IB9A 1NE9A 2FIAA 1YLOA 2J8RA 1HDUA 3D67A 1LFWA 2NMTA 4F8ZA 2ODFA 2G0BA 2WSAA 3SJEA 2JBJA 3D2PA 2AFZA 3KQZA 3PB9X 1M4DA 1Q2DA 1UWYA 2P6FA 2BUEA 3FMCA 4MHYA 4QUSA 2G3TA 5JM6A 1TKFA 3BI0A 1QSRA 3BHXA 5KTAA 2IMOA 2K5TA 4M6IA 2PJ4A 1RO5A 2ZEPA 2Z3PA 4PXCA 5AG4A 2PJBA 2O4HA 4FD7A 5HMNA 3FRMA 2PJ5A 2YNEA 3SI1A 4U5YA 3PRTA 5CNPA 4ZBGA 2CXAA 4IAVA 2XEIA 4MRIA 3BLNA 2EO8A 1EE3P 1L0CA 4KLWA 4MBUA 3RBUA 4AG7A 4FBEA 2OR4A 3FBUA 3RO0A 4KOUA 2I00A 1MJAA 1LRZA 5F46A 3EFAA 3I1UA 4I49A 4OIWA 1VHSA 5IB0A 4NJQA 4MFZA 2Z3OA 3IU1A 3LMSA 1IGBA 1YSJA 1KUVA 2FCKA 4WWVA 3IFEA 4MI4A 5LYLA 2B5GB 5ISVA 4XNHC 2X7BA 3R9FA 5LYFA 2ZEOA 3K9TA 2QYVA 2FT0A 1KWMA 4OLLA 4MCQA 4JZ0A 4PSWA 3D3SA 3P2FA 2ZW4A 4C7HA 4CYNA 2HB6A 2Z3MA 2JEVA 3SXNA 4A38A 4C2XA 2PJ1A 2PR1A 2ZW7A 1S7LA 2RB7A 5KTCA 2ZEMA 4KOSA 4X2TA 2HV2A 4KZTA 4JXQA 4NF1A 4P6YA 2Q0YA 1IB1E 3VWDA 1KUXA 1Z5RA 2HQYA 2WPWA 2CY2A 2AFWA 5H84A 2NSMA 2YNDA 3TCVA 3T9YA 3FYNA 1AMPA 2QIRA 1Y9WA 3IIBA 4MFQA 1DTDA 3SHPA 2ZEEA 2PIYA 3MRUA 2OU2A 4CRZB 1IOIA 1WWZA 3GB0A 2HUZA 5ELYA 4KSAA 4YWYA 4ONWA 4B12A 2DXQA 4ZI6A 3DR6A 3L2NA 4CAVA 3S6GA 1MJBA 3D4UA 5GCNA 2H5MA 4P4IA 3VARA 4QC6A 3PFEA 4OC1A 4R3LA 4KOVA 3DSBA 1S5KA 5AG5A 4FAIA 2FXFA 4M6HA 1ZG9A 1LAPA 2GIVA 5DS0A 1LOKA 3N5FA 2AFXA 2PJ9A 4OIDA 1M4IA 3QAHA 4MFJA 2PJ3A 3CXSA 5IX3A 3ISZA 4KORA 1QSMA 4MMOA 3T90A 2POKA 1I12A 4H89A 5BWAB 3KGQA 1DE4C 3D68A 3NH4A 4E0AA 3H8GA 1IICA 2IL4A 3H8EA 3JTKA 4X8IA 4X3RA 4NFRA 3B7IA 3IJ3A 3BJ7A 1CG2A 3DR8A 3D66A 4MFKA 4P10A 3D7GA 3TE4A 2VZZA 1Z4EA 1IY7A 2Q4VA 2B4DB 2GE3A 2XEFA 4B13A 4A37A 4ZY2A 3C26A 3GY9A 4R9MA 3CXPA 4AVAA 4Q7AA 2B3VA 3PEIA 3MGDA 2ABZA 1ZG8A 4CGMA 5I4MA 5J8CA 2ZEHA 2Z3LA 3B3TA 1XJOA 4NGRA 4R57A 4ZY0A 4DNCA 2B58A 3E0KA 1TIQA 4XNHB 3DLJA 5JQ4A 4UEFA 1VHOA 1AYEA 3D7FA 4HNXB 2DF5A 5F09A 5HXDA 4UEEA 2Q44A 3FB3A 2CTBA 1JQGA 2ZW6A 4KOXA 3VWEA 3WT4A 4MCPA 4XPDB 1OBRA 2WPXA 3PB6X 4R76A 1YVKA 4UWIA 3LODA 3TO7A 1YLEA 3FF3A 5DWMA 1YX0A 1Z8TA 4UCMA 4KOTA 5LYIA 2BCOA 2BEIA 3S6KA 3CPXA 2IQ6A 4B5PA 1N71A 1YGHA 1Z8WA 4TWEA 4BMHA 4NGQA 2EWBA 3H5ZA 4CAFA 5CBMA 3FX6A 3FVLA 4P4BA 1FT7A 3PZJA 1H8LA 1S7KA 3TT2A 4A95A 3RAMA 3DGVA 4MFPA 3SJGA 4P4JA 1R57A 2Q7BA 1S7NA 4TNUA 1Y7EA 1BLLE 2BL1A 2ZEGA 3UY5A 1R43A 3RYOA 1FNOA 1F57A 1ZLIA 2EK9A 2AJ6A 1Z8XA 3PBBA 3TX8A 2GANA 1Z2LA 4PXBA 4NGPA 4CYQA 4DUKA 2Y0MA 4CGPA 2GU2A 3D2MA 3FIXA 2CTCA 4B14A 5K8PA 1Z9UA 2YNCC 2ZW5A 5G1ZA 4CS0B 4AB7A 4NEXA 4UBRA 1Y0RA 2CIJA 4KUAA 4F0YA 2Q51A 4LQGA 4EVYA 2PRBA 2CNTA 1VGYA 4IF5A 1U6MA 3K9UA 4PQAA 3GLJA 4MHNA 3ISXA 3H4QA 1CBXA 2WZNA 1ARLA 2B5GA 3RNZA 4H6ZA 1KZFA 2VXKA 1Y7RA 3D7HA 2OZHA 4PSXA 4FUUA 4JJXA 4XPDC 3VH9A 3B3VA 1M1DA 4KVME 3JRUA 1KUYA 4RN7A 1NMTA 1XF8A 4NCZA 4OC4A 5AGEA 2WYRA 4IHMA 2V8GA 4KVOE 2Q4ZA 4CAXA 4A30A 3I9SA 3PP9A 1TF9A 1YMEA 3FECA 1K4JA 3WC5A 4IUSA 4FD4A 3SJFA 1YW4A 5JGFA 2JDCA 3GUXA 4HKFA 1Z4RA 3PFOA 4R8FA 4HPSA 1R3NA 1VKCA 2B4BA 1UFHA 4AVCA 3CDXA 1CX8A 2PRQA 4C7IA 3EY5A 4QVTA 4KSFA 2R8VA 6CPAA 1ZG7A 4A94A 2D4PA 3IWWA 2J8MA 1SQHA 4PK2A 4ZX8A 1Z8LA 2O28A 1XE4A 1YK3A 4MFLA 3CZXA 3TO9A 4A2ZA 3KQXA 1V0CA 2ZENA 4BBHA 5EBVA 4KLVA 1LCPA 4YU9A 3QB8A 4AVBA 1CP6A 2EUIA 1MK4A 4C2YA 4P45A 5HH1A 1JWQA 1YVOA 2F8HA 3N7ZA 4OKOA 2KCWA 2VQYA 3FH4A 4K3NA 4CRYB 3LWUA 4M3SA 4RS2A 2Z11A 4L89A 4MHZA 4NGMA 4UIAA 5F48A 5EC4A 3WC6A 3KR5A 3R95A 1LAMA 1XMBA 3KHXA 2GFQA 3B3CA 1GYTA 4JWPA 2FS5A 4X5KA 1YQEA 5LRKA 1XMTA 4GXHA 1CM0A 4KS9A 2ZEDA 4ORFA 3T8WA 2ZELA 1I1DA 1LANA 3KASA 2VZYA 4XPLA 4ZGYB 3A9LA 3PB4X 1HEEA 1ZLHA 3TC8A 4Y49C 3IU2A 2ATRA 3OWCA 4XPKA 4H6UA 2AFMA 3S6FA 3NE8A 1Q7LA 4EFDA 5KTDA 2VL1A 4KVXA 3DNSA 5K8NA 2AFUA 4CGNA 2O53A 4ZYQA 3NA6A 2A4NA 3TOAA 2JDDA 2RFHA 3CXQA 4P4FA 1XOVA 2PR8A 5D8NA 2ZXVA 3EO4A 2I79A 2NYQA 3B3SA 2R98A 4ZY1A 4GM5A 4CYPA 4KOWA 4UFWA 3EXNA 1CJWA 3B3WA 4L8AA 2Z3KA 3GKRA 1X12A 2FVGA 2Z3NA 3JUWA 3V38A 5F47A 4NGTA 2OZUA 4AXVA 5C82A 1AUGA 4NJRA 2CNMA 1QQ9A 3R9GA 5JH9A 3KR4A 2RC4A 4DJLA 3TFYA 1WK4A 4Z65A 3JVNA 4M6GA 4GS4A 3FEEA 5C88A 5K8OA 3K2KA 4PV6A 4B6ZA 4NSQA 2Z10A 1QSTA 2EK8A 2FE7A 2PDOA 4A32A 4UFXA 1XIXA 4OMEA 4P4DA 5AG7A 4OC3A 2C27A 1S60A 4CAWA 5G22A 2VEZA 5H86A 2ZPAA 3BXMA 3GIUA 2C1CA 2PJ8A 4HNYB 4YGOA 2P6EA 3S6HA 3SJXA 1PYTB 2AFSA 2JEWA 3D7DA 3FEDA 4UFVA 1M44A 1S7FA 1Y0YA 1FY7A 3F0AA 1HDQA 5G20A 3WR7A 4P4EA 4EWTA 4OADA 2PJ6A 1XFOA 4WJBA 2OB0A 1BAVA 2Q7SA 3CPAA 5J8FA 3FJUA 1Y9KA 3QNVA 1M4LA 1XRYA 2PE3A 1XBUA 2PSWA 3PGPA 1RTQA 1CPXA 4H2KA 4P44A 5EMIA 1TXRA 4A31A 4B5PB 1YW6A 1P0HA 3SXOA 3ZZIA 3S9LA 3IWGA 3HLPA 3LACA 3W6XA 2CNSA 1IYLA 3SI0A 2OH1A 2QECA 5A28A 2ARHA 1ARMA 1X10A 2P0WA 4QBJA 2B3UA 3F5BA 1B6BA 2GREA 1NSLA 4E2AA 4O23A 5DWNA 1BPMA 2V8VA 4HNWB 1QSNA 5K8MA 1BPNA 3PB8X 1QMUA 4UCNA 3BJ8A 5F49A 2GLFA 3PB7X 3ZJ0A 5FVJA 2V8HA 3IEHA 3NH5A 5LRGA 4AG9A 4EMEA 7CPAA 4CYOA 3D8PA 4NGSA
chains in the Genus database with same CATH topology
1BO4A 3I3GA 4JD6A 3LD2A 1J4JA 4MHDA 2BSWA 3GYAA 2PC1A 1Q2YA 2D4OA 1IYKA 1RXTA 4Y49B 4OAEA 1PUAA 3R9EA 2YGWA 1YREA 3FNCA 4MJ8A 2FSRA 4J3GA 4II9A 2J8NA 2REEA 1YR0A 1OZPA 1GHEA 2AE6A 4PK3A 2WUUA 3G3SA 4R3KA 2R7HA 2VI7A 1BOBA 3R1KA 3IWEA 3TOBA 4Q36A 4CGLA 4JXRA 4MY3A 3IGRA 2FIWA 4QB9A 4E8OA 4R87A 4K30A 3W91A 4LUAA 2QMLA 1MJ9A 3TTHA 3V8IA 3W6SA 4LX9A 4UWJA 4B5OA 1ON0A 2DPSA 4YRHA 4C2ZA 2OZGA 4Q38A 3F8KA 4C68A 4YFJA 4CAEA 3NE7A 4CGOA 4FD6A 4ONUA 4U9ZA 5E96A 5G21A 1IIDA 2Q04A 2B4DA 4RI1A 4B11A 1ZO0A 4KOYA 4A33A 3B8GA 5AG6A 2YNCA 4CGNA 1PU9A 2Z0ZA 3R96A 2VBQA 3DDDA 1Q2CA 4M85A 4F6AA 2G3AA 3P2HA 4UCPA 5I0CA 4B10A 3FXTA 4UA3A 2F5IA 2Q4YA 3G8WA 2PQ8A 2FL4A 1I21A 3EC4A 5IV0A 1S3ZA 4U9YA 1P4NA 1M4GA 2JLMA 2EVNA 3TO6A 1B87A 5A27A 4F0XA 4JLYA 5JPHA 1XEBA 4MY0A 1QSOA 3KKWA 2P6GA 4NXYA 2DPTA 2REFA 4FD5A 4KUBA 2R1IA 1NE9A 2FIAA 2J8RA 2NMTA 2G0BA 2WSAA 3D2PA 1M4DA 1Q2DA 2P6FA 2BUEA 4QUSA 2G3TA 1QSRA 5KTAA 2K5TA 1RO5A 2Z3PA 5AG4A 4FD7A 5HMNA 3FRMA 2YNEA 4U5YA 5CNPA 4ZBGA 2CXAA 3BLNA 4AG7A 4MBUA 1L0CA 4KLWA 3FBUA 4KOUA 2I00A 1MJAA 1LRZA 5F46A 3EFAA 4I49A 1VHSA 5IB0A 4MFZA 2Z3OA 3IU1A 2FCKA 1KUVA 4MI4A 2B5GB 5ISVA 4XNHC 2X7BA 3R9FA 2FT0A 4OLLA 4PSWA 4CYNA 4C7HA 3D3SA 3P2FA 2ZW4A 2Z3MA 2JEVA 3SXNA 4C2XA 2PR1A 2ZW7A 1S7LA 5KTCA 4KOSA 2HV2A 4KZTA 4JXQA 4NF1A 2Q0YA 1IB1E 3VWDA 1KUXA 2HQYA 2WPWA 2CY2A 5H84A 2YNDA 3TCVA 3T9YA 3FYNA 2QIRA 1Y9WA 4MFQA 3SHPA 2OU2A 4CRZB 1WWZA 2HUZA 4KSAA 4B12A 2DXQA 3DR6A 4CAVA 3S6GA 1MJBA 5GCNA 2H5MA 4QC6A 4R3LA 4KOVA 3DSBA 1S5KA 5AG5A 2FXFA 2GIVA 1M4IA 3QAHA 4MFJA 5IX3A 3CXSA 4KORA 1QSMA 3T90A 1I12A 4H89A 5BWAB 4E0AA 1IICA 2IL4A 3JTKA 3BJ7A 3DR8A 4MFKA 3TE4A 2VZZA 1Z4EA 2Q4VA 2B4DB 2GE3A 4B13A 3C26A 3GY9A 4R9MA 3CXPA 4AVAA 2B3VA 3MGDA 4CGMA 5J8CA 2Z3LA 4R57A 4DNCA 2B58A 3E0KA 1TIQA 4XNHB 5JQ4A 4HNXB 2Q44A 3FB3A 4KOXA 2ZW6A 3VWEA 4XPDB 2WPXA 1YVKA 4UWIA 3LODA 3TO7A 1YLEA 5DWMA 1YX0A 4UCMA 4KOTA 2BEIA 3S6KA 4B5PA 1N71A 1YGHA 4BMHA 4CAFA 3H5ZA 3PZJA 1S7KA 3TT2A 4A95A 4MFPA 1R57A 2Q7BA 1S7NA 2BL1A 3UY5A 3RYOA 2AJ6A 2GANA 4CYQA 2Y0MA 4CGPA 3D2MA 3FIXA 4B14A 1Z9UA 2YNCC 2ZW5A 5G1ZA 4CS0B 4AB7A 4NEXA 4UBRA 4F0YA 4KUAA 4EVYA 2PRBA 2CNTA 4IF5A 1U6MA 3K9UA 3H4QA 2B5GA 4H6ZA 1KZFA 2VXKA 1Y7RA 2OZHA 4PSXA 4JJXA 4XPDC 1M1DA 4KVME 1KUYA 1NMTA 1XF8A 4NCZA 5AGEA 4KVOE 4CAXA 4A30A 3I9SA 3PP9A 1K4JA 4IUSA 4FD4A 2JDCA 4HKFA 1Z4RA 1VKCA 2B4BA 1UFHA 4AVCA 4C7IA 3EY5A 4QVTA 4KSFA 2R8VA 2D4PA 2J8MA 1SQHA 4PK2A 2O28A 1XE4A 1YK3A 4MFLA 3TO9A 4A2ZA 1V0CA 4BBHA 5EBVA 4KLVA 4AVBA 3QB8A 2EUIA 1MK4A 4C2YA 5HH1A 1YVOA 3N7ZA 2KCWA 2VQYA 4CRYB 4M3SA 4RS2A 2Z11A 4L89A 5F48A 5EC4A 3R95A 4JWPA 2FS5A 4X5KA 1XMTA 1CM0A 4KS9A 4ORFA 1I1DA 4ZGYB 2VZYA 4XPLA 3A9LA 4Y49C 3IU2A 2ATRA 3OWCA 4XPKA 4H6UA 3S6FA 5KTDA 4KVXA 3DNSA 2A4NA 3TOAA 2JDDA 3CXQA 2PR8A 2ZXVA 3EO4A 2I79A 2R98A 4CYPA 4KOWA 4UFWA 3EXNA 1CJWA 4L8AA 2Z3KA 3GKRA 2Z3NA 3JUWA 5F47A 2OZUA 5C82A 2CNMA 3R9GA 3TFYA 2RC4A 1WK4A 3JVNA 5C88A 4GS4A 4PV6A 4NSQA 2Z10A 1QSTA 2PDOA 2FE7A 4A32A 4UFXA 1XIXA 5AG7A 2C27A 1S60A 4CAWA 5G22A 2VEZA 5H86A 2ZPAA 4HNYB 4YGOA 2P6EA 3S6HA 4UFVA 1M44A 1S7FA 1FY7A 3F0AA 5G20A 3WR7A 4OADA 2OB0A 5J8FA 1Y9KA 2PSWA 3PGPA 4A31A 4B5PB 1P0HA 3SXOA 3ZZIA 3IWGA 3W6XA 2CNSA 1IYLA 2OH1A 2QECA 5A28A 2ARHA 2P0WA 4QBJA 2B3UA 3F5BA 1B6BA 1NSLA 4E2AA 5DWNA 4HNWB 1QSNA 4UCNA 5F49A 3BJ8A 3ZJ0A 5FVJA 4AG9A 4CYOA 3D8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BO4 A;  3I3G A;  4JD6 A;  3LD2 A;  1J4J A;  4MHD A;  2BSW A;  3GYA A;  2PC1 A;  1Q2Y A;  2D4O A;  1IYK A;  1RXT A;  4Y49 B;  4OAE A;  1PUA A;  3R9E A;  3FNC A;  1YRE A;  4MJ8 A;  2FSR A;  4J3G A;  4II9 A;  2J8N A;  2REE A;  1YR0 A;  1OZP A;  1GHE A;  2AE6 A;  4PK3 A;  3G3S A;  4R3K A;  2R7H A;  2VI7 A;  1BOB A;  3R1K A;  3TOB A;  4JXR A;  4MY3 A;  3IGR A;  2FIW A;  4QB9 A;  4E8O A;  4R87 A;  4K30 A;  3W91 A;  4LUA A;  2QML A;  1MJ9 A;  3TTH A;  3V8I A;  3W6S A;  4LX9 A;  4UWJ A;  4B5O A;  1ON0 A;  4YRH A;  2OZG A;  3F8K A;  4YFJ A;  3NE7 A;  4FD6 A;  4ONU A;  4U9Z A;  5E96 A;  1IID A;  2Q04 A;  2B4D A;  4RI1 A;  4KOY A;  3B8G A;  1PU9 A;  2Z0Z A;  3R96 A;  2VBQ A;  3DDD A;  1Q2C A;  4M85 A;  4F6A A;  2G3A A;  3P2H A;  5I0C A;  3FXT A;  4UA3 A;  2F5I A;  2Q4Y A;  3G8W A;  2PQ8 A;  2FL4 A;  1I21 A;  3EC4 A;  5IV0 A;  1S3Z A;  4U9Y A;  1P4N A;  1M4G A;  2JLM A;  2EVN A;  3TO6 A;  1B87 A;  4JLY A;  5JPH A;  1XEB A;  4MY0 A;  1QSO A;  3KKW A;  2P6G A;  4NXY A;  2REF A;  4FD5 A;  4KUB A;  2R1I A;  1NE9 A;  2FIA A;  2J8R A;  2NMT A;  2G0B A;  3D2P A;  1M4D A;  1Q2D A;  2P6F A;  2BUE A;  4QUS A;  2G3T A;  1QSR A;  5KTA A;  2K5T A;  1RO5 A;  4FD7 A;  5HMN A;  3FRM A;  4U5Y A;  5CNP A;  4ZBG A;  3BLN A;  4AG7 A;  4MBU A;  1L0C A;  4KLW A;  3FBU A;  4KOU A;  2I00 A;  1MJA A;  1LRZ A;  5F46 A;  3EFA A;  4I49 A;  1VHS A;  5IB0 A;  2FCK A;  1KUV A;  4MI4 A;  2B5G B;  5ISV A;  4XNH C;  2X7B A;  3R9F A;  2FT0 A;  4OLL A;  4PSW A;  3D3S A;  3P2F A;  2ZW4 A;  3SXN A;  2JEV A;  2PR1 A;  2ZW7 A;  1S7L A;  5KTC A;  4KOS A;  2HV2 A;  4KZT A;  4JXQ A;  4NF1 A;  2Q0Y A;  1IB1 E;  3VWD A;  1KUX A;  2HQY A;  2WPW A;  2CY2 A;  5H84 A;  3TCV A;  3T9Y A;  3FYN A;  2QIR A;  1Y9W A;  3SHP A;  2OU2 A;  4CRZ B;  1WWZ A;  2HUZ A;  2DXQ A;  3DR6 A;  4CAV A;  3S6G A;  1MJB A;  5GCN A;  2H5M A;  4QC6 A;  4R3L A;  4KOV A;  3DSB A;  1S5K A;  2FXF A;  2GIV A;  1M4I A;  3QAH A;  5IX3 A;  3CXS A;  4KOR A;  1QSM A;  3T90 A;  1I12 A;  4H89 A;  4E0A A;  1IIC A;  2IL4 A;  3BJ7 A;  3DR8 A;  3TE4 A;  2VZZ A;  1Z4E A;  2Q4V A;  2B4D B;  2GE3 A;  3C26 A;  3GY9 A;  4R9M A;  3CXP A;  4AVA A;  2B3V A;  3MGD A;  5J8C A;  4R57 A;  4DNC A;  2B58 A;  3E0K A;  1TIQ A;  4XNH B;  5JQ4 A;  4HNX B;  2Q44 A;  3FB3 A;  4KOX A;  2ZW6 A;  3VWE A;  4XPD B;  2WPX A;  1YVK A;  4UWI A;  3LOD A;  3TO7 A;  1YLE A;  5DWM A;  1YX0 A;  4KOT A;  2BEI A;  3S6K A;  4B5P A;  1N71 A;  1YGH A;  4BMH A;  3PZJ A;  1S7K A;  3TT2 A;  1R57 A;  2Q7B A;  1S7N A;  2BL1 A;  3UY5 A;  3RYO A;  2AJ6 A;  2GAN A;  2Y0M A;  3D2M A;  3FIX A;  1Z9U A;  2ZW5 A;  4CS0 B;  4AB7 A;  4NEX A;  4UBR A;  4F0Y A;  4KUA A;  4EVY A;  2PRB A;  2CNT A;  4IF5 A;  1U6M A;  3K9U A;  3H4Q A;  2B5G A;  4H6Z A;  1KZF A;  2VXK A;  1Y7R A;  2OZH A;  4PSX A;  4JJX A;  4XPD C;  1M1D A;  4KVM E;  1KUY A;  1NMT A;  1XF8 A;  4NCZ A;  4KVO E;  4CAX A;  3I9S A;  3PP9 A;  1K4J A;  4IUS A;  4FD4 A;  2JDC A;  4HKF A;  1Z4R A;  1VKC A;  2B4B A;  1UFH A;  4AVC A;  3EY5 A;  4QVT A;  2R8V A;  2D4P A;  2J8M A;  1SQH A;  4PK2 A;  2O28 A;  1XE4 A;  1YK3 A;  3TO9 A;  1V0C A;  5EBV A;  4KLV A;  4AVB A;  3QB8 A;  2EUI A;  1MK4 A;  5HH1 A;  1YVO A;  3N7Z A;  2KCW A;  2VQY A;  4CRY B;  4M3S A;  4RS2 A;  2Z11 A;  4L89 A;  5F48 A;  5EC4 A;  3R95 A;  4JWP A;  2FS5 A;  4X5K A;  1XMT A;  1CM0 A;  4ORF A;  1I1D A;  2VZY A;  4XPL A;  4Y49 C;  2ATR A;  3OWC A;  4XPK A;  4H6U A;  3S6F A;  5KTD A;  4KVX A;  3DNS A;  2A4N A;  3TOA A;  2JDD A;  3CXQ A;  2PR8 A;  2ZXV A;  3EO4 A;  2I79 A;  2R98 A;  4KOW A;  3EXN A;  1CJW A;  4L8A A;  3GKR A;  3JUW A;  5F47 A;  2OZU A;  5C82 A;  2CNM A;  3R9G A;  3TFY A;  2RC4 A;  1WK4 A;  3JVN A;  5C88 A;  4GS4 A;  4PV6 A;  4NSQ A;  2Z10 A;  1QST A;  2PDO A;  2FE7 A;  1XIX A;  2C27 A;  1S60 A;  4CAW A;  2VEZ A;  5H86 A;  2ZPA A;  4HNY B;  4YGO A;  2P6E A;  3S6H A;  1M44 A;  1S7F A;  1FY7 A;  3F0A A;  3WR7 A;  4OAD A;  2OB0 A;  5J8F A;  1Y9K A;  2PSW A;  3PGP A;  4B5P B;  1P0H A;  3SXO A;  3ZZI A;  3IWG A;  3W6X A;  2CNS A;  1IYL A;  2OH1 A;  2QEC A;  2ARH A;  2P0W A;  4QBJ A;  2B3U A;  3F5B A;  1B6B A;  1NSL A;  4E2A A;  5DWN A;  4HNW B;  1QSN A;  3ZJ0 A;  5F49 A;  3BJ8 A;  5FVJ A;  4AG9 A;  3D8P A; 
#chains in the Genus database with same CATH topology
 1BO4 A;  2C6C A;  3I3G A;  4JD6 A;  1VHE A;  2DEA A;  3LD2 A;  3IO1 A;  1J4J A;  2F7V A;  2BSW A;  4MHD A;  3GYA A;  2PC1 A;  1Q2Y A;  2D4O A;  1IYK A;  1RXT A;  2PJA A;  4Y49 B;  4OAE A;  1F2P A;  1PUA A;  3R9E A;  4A39 A;  3WAB A;  1TKJ A;  8CPA A;  3NH8 A;  2YGW A;  1YRE A;  3FNC A;  4MJ8 A;  4PXD A;  1CP7 A;  1CPS A;  2FSR A;  4J3G A;  4II9 A;  1F2O A;  2J8N A;  2REE A;  1YR0 A;  1ELL P;  5D29 A;  1OZP A;  1GHE A;  4MCR A;  2AE6 A;  4F9V A;  4PK3 A;  2WUU A;  3G3S A;  3B2Y A;  4R3K A;  2R7H A;  4R6T A;  2VI7 A;  3KI9 A;  1BOB A;  4PXE A;  3R1K A;  3IWE A;  3KZW A;  1A2Z A;  4ZX9 A;  3TOB A;  4Q36 A;  4BIN A;  4CGL A;  4JXR A;  5HVG A;  2ZEF A;  4MY3 A;  3IGR A;  2FIW A;  2PIZ A;  4QB9 A;  3NFZ A;  4E8O A;  4R87 A;  1IOF A;  2ANP A;  4K30 A;  3W91 A;  3B35 A;  4LUA A;  2QML A;  5HVH A;  1MJ9 A;  3TTH A;  3V8I A;  3W6S A;  4LX9 A;  2PJ0 A;  4UWJ A;  4B5O A;  3WC7 A;  1ON0 A;  2Q43 A;  2DPS A;  2I3C A;  4YRH A;  4C2Z A;  4W9Y A;  2OZG A;  4MHP A;  4DYO A;  2HC9 A;  3CT9 A;  4JYW A;  4Q38 A;  3F8K A;  4C68 A;  2PJ7 A;  3IC1 A;  4OP4 A;  3KHZ A;  3PBE A;  2GLJ A;  5AG6 A;  4YFJ A;  4CAE A;  4F9U A;  1TKH A;  3NE7 A;  4NGN A;  4FD6 A;  4CGO A;  4ONU A;  4U9Z A;  4PPZ A;  5E96 A;  5G21 A;  1IID A;  1NSA A;  2BOA A;  2Q04 A;  2B4D A;  2BO9 A;  5LRJ A;  4RI1 A;  4B11 A;  1ZO0 A;  4KOY A;  2PJC A;  4UEZ A;  5J1Q A;  2XEJ A;  2CF4 A;  3SI2 A;  4A33 A;  4OC5 A;  2V77 A;  4OC0 A;  1IU8 A;  3V7Z A;  3B8G A;  1ELM P;  2G9D A;  4UIB A;  2JBK A;  2YNC A;  2PJ2 A;  4IK2 A;  1PU9 A;  1TF8 A;  2Z0Z A;  2QVP A;  4KSI A;  4G1P A;  4UF4 A;  3BI1 A;  5THW A;  1PCA A;  3R96 A;  2VBQ A;  3DDD A;  1Q2C A;  3H8F A;  4M85 A;  2OOT A;  4F6A A;  2G3A A;  3P2H A;  4MCS A;  4UCP A;  5I0C A;  4B10 A;  2EBJ A;  3FXT A;  4UA3 A;  2F5I A;  3S9N A;  3RZA A;  2ZOF A;  2Q4Y A;  2AFO A;  4RUH A;  3G8W A;  2PQ8 A;  2PVV A;  3S9M A;  4MXU A;  2FL4 A;  4OC2 A;  1I21 A;  3EC4 A;  5IV0 A;  1S3Z A;  4U9Y A;  2PCU A;  1P4N A;  3QAY A;  3VAT A;  1M4G A;  2JLM A;  2EVN A;  3KL9 A;  3TO6 A;  3HUV A;  3MN8 A;  4FWU A;  5CPA A;  1B87 A;  2QJ8 A;  5LYD A;  5A27 A;  5HVF A;  4JLY A;  4F0X A;  5JPH A;  4R7M A;  1XEB A;  2V8D A;  2ZOG A;  1VIX A;  2PVW A;  4MY0 A;  1QSO A;  3KKW A;  2IJZ A;  2XEG A;  2P6G A;  4NXY A;  2J9A A;  4LQ6 A;  2DPT A;  2REF A;  4CPA A;  2C6G A;  4FD5 A;  4BD9 A;  2C6P A;  4KUB A;  2R1I A;  5IB9 A;  1NE9 A;  2FIA A;  1YLO A;  2J8R A;  1HDU A;  3D67 A;  1LFW A;  2NMT A;  4F8Z A;  2ODF A;  2G0B A;  2WSA A;  3SJE A;  2JBJ A;  3D2P A;  2AFZ A;  3KQZ A;  3PB9 X;  1M4D A;  1Q2D A;  1UWY A;  2P6F A;  2BUE A;  3FMC A;  4MHY A;  4QUS A;  2G3T A;  5JM6 A;  1TKF A;  3BI0 A;  1QSR A;  3BHX A;  5KTA A;  2IMO A;  2K5T A;  4M6I A;  2PJ4 A;  1RO5 A;  2ZEP A;  2Z3P A;  4PXC A;  5AG4 A;  2PJB A;  2O4H A;  4FD7 A;  5HMN A;  3FRM A;  2PJ5 A;  2YNE A;  3SI1 A;  4U5Y A;  3PRT A;  5CNP A;  4ZBG A;  2CXA A;  4IAV A;  2XEI A;  4MRI A;  3BLN A;  2EO8 A;  1EE3 P;  1L0C A;  4KLW A;  4MBU A;  3RBU A;  4AG7 A;  4FBE A;  2OR4 A;  3FBU A;  3RO0 A;  4KOU A;  2I00 A;  1MJA A;  1LRZ A;  5F46 A;  3EFA A;  3I1U A;  4I49 A;  4OIW A;  1VHS A;  5IB0 A;  4NJQ A;  4MFZ A;  2Z3O A;  3IU1 A;  3LMS A;  1IGB A;  1YSJ A;  1KUV A;  2FCK A;  4WWV A;  3IFE A;  4MI4 A;  5LYL A;  2B5G B;  5ISV A;  4XNH C;  2X7B A;  3R9F A;  5LYF A;  2ZEO A;  3K9T A;  2QYV A;  2FT0 A;  1KWM A;  4OLL A;  4MCQ A;  4JZ0 A;  4PSW A;  3D3S A;  3P2F A;  2ZW4 A;  4C7H A;  4CYN A;  2HB6 A;  2Z3M A;  2JEV A;  3SXN A;  4A38 A;  4C2X A;  2PJ1 A;  2PR1 A;  2ZW7 A;  1S7L A;  2RB7 A;  5KTC A;  2ZEM A;  4KOS A;  4X2T A;  2HV2 A;  4KZT A;  4JXQ A;  4NF1 A;  4P6Y A;  2Q0Y A;  1IB1 E;  3VWD A;  1KUX A;  1Z5R A;  2HQY A;  2WPW A;  2CY2 A;  2AFW A;  5H84 A;  2NSM A;  2YND A;  3TCV A;  3T9Y A;  3FYN A;  1AMP A;  2QIR A;  1Y9W A;  3IIB A;  4MFQ A;  1DTD A;  3SHP A;  2ZEE A;  2PIY A;  3MRU A;  2OU2 A;  4CRZ B;  1IOI A;  1WWZ A;  3GB0 A;  2HUZ A;  5ELY A;  4KSA A;  4YWY A;  4ONW A;  4B12 A;  2DXQ A;  4ZI6 A;  3DR6 A;  3L2N A;  4CAV A;  3S6G A;  1MJB A;  3D4U A;  5GCN A;  2H5M A;  4P4I A;  3VAR A;  4QC6 A;  3PFE A;  4OC1 A;  4R3L A;  4KOV A;  3DSB A;  1S5K A;  5AG5 A;  4FAI A;  2FXF A;  4M6H A;  1ZG9 A;  1LAP A;  2GIV A;  5DS0 A;  1LOK A;  3N5F A;  2AFX A;  2PJ9 A;  4OID A;  1M4I A;  3QAH A;  4MFJ A;  2PJ3 A;  3CXS A;  5IX3 A;  3ISZ A;  4KOR A;  1QSM A;  4MMO A;  3T90 A;  2POK A;  1I12 A;  4H89 A;  5BWA B;  3KGQ A;  1DE4 C;  3D68 A;  3NH4 A;  4E0A A;  3H8G A;  1IIC A;  2IL4 A;  3H8E A;  3JTK A;  4X8I A;  4X3R A;  4NFR A;  3B7I A;  3IJ3 A;  3BJ7 A;  1CG2 A;  3DR8 A;  3D66 A;  4MFK A;  4P10 A;  3D7G A;  3TE4 A;  2VZZ A;  1Z4E A;  1IY7 A;  2Q4V A;  2B4D B;  2GE3 A;  2XEF A;  4B13 A;  4A37 A;  4ZY2 A;  3C26 A;  3GY9 A;  4R9M A;  3CXP A;  4AVA A;  4Q7A A;  2B3V A;  3PEI A;  3MGD A;  2ABZ A;  1ZG8 A;  4CGM A;  5I4M A;  5J8C A;  2ZEH A;  2Z3L A;  3B3T A;  1XJO A;  4NGR A;  4R57 A;  4ZY0 A;  4DNC A;  2B58 A;  3E0K A;  1TIQ A;  4XNH B;  3DLJ A;  5JQ4 A;  4UEF A;  1VHO A;  1AYE A;  3D7F A;  4HNX B;  2DF5 A;  5F09 A;  5HXD A;  4UEE A;  2Q44 A;  3FB3 A;  2CTB A;  1JQG A;  2ZW6 A;  4KOX A;  3VWE A;  3WT4 A;  4MCP A;  4XPD B;  1OBR A;  2WPX A;  3PB6 X;  4R76 A;  1YVK A;  4UWI A;  3LOD A;  3TO7 A;  1YLE A;  3FF3 A;  5DWM A;  1YX0 A;  1Z8T A;  4UCM A;  4KOT A;  5LYI A;  2BCO A;  2BEI A;  3S6K A;  3CPX A;  2IQ6 A;  4B5P A;  1N71 A;  1YGH A;  1Z8W A;  4TWE A;  4BMH A;  4NGQ A;  2EWB A;  3H5Z A;  4CAF A;  5CBM A;  3FX6 A;  3FVL A;  4P4B A;  1FT7 A;  3PZJ A;  1H8L A;  1S7K A;  3TT2 A;  4A95 A;  3RAM A;  3DGV A;  4MFP A;  3SJG A;  4P4J A;  1R57 A;  2Q7B A;  1S7N A;  4TNU A;  1Y7E A;  1BLL E;  2BL1 A;  2ZEG A;  3UY5 A;  1R43 A;  3RYO A;  1FNO A;  1F57 A;  1ZLI A;  2EK9 A;  2AJ6 A;  1Z8X A;  3PBB A;  3TX8 A;  2GAN A;  1Z2L A;  4PXB A;  4NGP A;  4CYQ A;  4DUK A;  2Y0M A;  4CGP A;  2GU2 A;  3D2M A;  3FIX A;  2CTC A;  4B14 A;  5K8P A;  1Z9U A;  2YNC C;  2ZW5 A;  5G1Z A;  4CS0 B;  4AB7 A;  4NEX A;  4UBR A;  1Y0R A;  2CIJ A;  4KUA A;  4F0Y A;  2Q51 A;  4LQG A;  4EVY A;  2PRB A;  2CNT A;  1VGY A;  4IF5 A;  1U6M A;  3K9U A;  4PQA A;  3GLJ A;  4MHN A;  3ISX A;  3H4Q A;  1CBX A;  2WZN A;  1ARL A;  2B5G A;  3RNZ A;  4H6Z A;  1KZF A;  2VXK A;  1Y7R A;  3D7H A;  2OZH A;  4PSX A;  4FUU A;  4JJX A;  4XPD C;  3VH9 A;  3B3V A;  1M1D A;  4KVM E;  3JRU A;  1KUY A;  4RN7 A;  1NMT A;  1XF8 A;  4NCZ A;  4OC4 A;  5AGE A;  2WYR A;  4IHM A;  2V8G A;  4KVO E;  2Q4Z A;  4CAX A;  4A30 A;  3I9S A;  3PP9 A;  1TF9 A;  1YME A;  3FEC A;  1K4J A;  3WC5 A;  4IUS A;  4FD4 A;  3SJF A;  1YW4 A;  5JGF A;  2JDC A;  3GUX A;  4HKF A;  1Z4R A;  3PFO A;  4R8F A;  4HPS A;  1R3N A;  1VKC A;  2B4B A;  1UFH A;  4AVC A;  3CDX A;  1CX8 A;  2PRQ A;  4C7I A;  3EY5 A;  4QVT A;  4KSF A;  2R8V A;  6CPA A;  1ZG7 A;  4A94 A;  2D4P A;  3IWW A;  2J8M A;  1SQH A;  4PK2 A;  4ZX8 A;  1Z8L A;  2O28 A;  1XE4 A;  1YK3 A;  4MFL A;  3CZX A;  3TO9 A;  4A2Z A;  3KQX A;  1V0C A;  2ZEN A;  4BBH A;  5EBV A;  4KLV A;  1LCP A;  4YU9 A;  3QB8 A;  4AVB A;  1CP6 A;  2EUI A;  1MK4 A;  4C2Y A;  4P45 A;  5HH1 A;  1JWQ A;  1YVO A;  2F8H A;  3N7Z A;  4OKO A;  2KCW A;  2VQY A;  3FH4 A;  4K3N A;  4CRY B;  3LWU A;  4M3S A;  4RS2 A;  2Z11 A;  4L89 A;  4MHZ A;  4NGM A;  4UIA A;  5F48 A;  5EC4 A;  3WC6 A;  3KR5 A;  3R95 A;  1LAM A;  1XMB A;  3KHX A;  2GFQ A;  3B3C A;  1GYT A;  4JWP A;  2FS5 A;  4X5K A;  1YQE A;  5LRK A;  1XMT A;  4GXH A;  1CM0 A;  4KS9 A;  2ZED A;  4ORF A;  3T8W A;  2ZEL A;  1I1D A;  1LAN A;  3KAS A;  2VZY A;  4XPL A;  4ZGY B;  3A9L A;  3PB4 X;  1HEE A;  1ZLH A;  3TC8 A;  4Y49 C;  3IU2 A;  2ATR A;  3OWC A;  4XPK A;  4H6U A;  2AFM A;  3S6F A;  3NE8 A;  1Q7L A;  4EFD A;  5KTD A;  2VL1 A;  4KVX A;  3DNS A;  5K8N A;  2AFU A;  4CGN A;  2O53 A;  4ZYQ A;  3NA6 A;  2A4N A;  3TOA A;  2JDD A;  2RFH A;  3CXQ A;  4P4F A;  1XOV A;  2PR8 A;  5D8N A;  2ZXV A;  3EO4 A;  2I79 A;  2NYQ A;  3B3S A;  2R98 A;  4ZY1 A;  4GM5 A;  4CYP A;  4KOW A;  4UFW A;  3EXN A;  1CJW A;  3B3W A;  4L8A A;  2Z3K A;  3GKR A;  1X12 A;  2FVG A;  2Z3N A;  3JUW A;  3V38 A;  5F47 A;  4NGT A;  2OZU A;  4AXV A;  5C82 A;  1AUG A;  4NJR A;  2CNM A;  1QQ9 A;  3R9G A;  5JH9 A;  3KR4 A;  2RC4 A;  4DJL A;  3TFY A;  1WK4 A;  4Z65 A;  3JVN A;  4M6G A;  4GS4 A;  3FEE A;  5C88 A;  5K8O A;  3K2K A;  4PV6 A;  4B6Z A;  4NSQ A;  2Z10 A;  1QST A;  2EK8 A;  2FE7 A;  2PDO A;  4A32 A;  4UFX A;  1XIX A;  4OME A;  4P4D A;  5AG7 A;  4OC3 A;  2C27 A;  1S60 A;  4CAW A;  5G22 A;  2VEZ A;  5H86 A;  2ZPA A;  3BXM A;  3GIU A;  2C1C A;  2PJ8 A;  4HNY B;  4YGO A;  2P6E A;  3S6H A;  3SJX A;  1PYT B;  2AFS A;  2JEW A;  3D7D A;  3FED A;  4UFV A;  1M44 A;  1S7F A;  1Y0Y A;  1FY7 A;  3F0A A;  1HDQ A;  5G20 A;  3WR7 A;  4P4E A;  4EWT A;  4OAD A;  2PJ6 A;  1XFO A;  4WJB A;  2OB0 A;  1BAV A;  2Q7S A;  3CPA A;  5J8F A;  3FJU A;  1Y9K A;  3QNV A;  1M4L A;  1XRY A;  2PE3 A;  1XBU A;  2PSW A;  3PGP A;  1RTQ A;  1CPX A;  4H2K A;  4P44 A;  5EMI A;  1TXR A;  4A31 A;  4B5P B;  1YW6 A;  1P0H A;  3SXO A;  3ZZI A;  3S9L A;  3IWG A;  3HLP A;  3LAC A;  3W6X A;  2CNS A;  1IYL A;  3SI0 A;  2OH1 A;  2QEC A;  5A28 A;  2ARH A;  1ARM A;  1X10 A;  2P0W A;  4QBJ A;  2B3U A;  3F5B A;  1B6B A;  2GRE A;  1NSL A;  4E2A A;  4O23 A;  5DWN A;  1BPM A;  2V8V A;  4HNW B;  1QSN A;  5K8M A;  1BPN A;  3PB8 X;  1QMU A;  4UCN A;  3BJ8 A;  5F49 A;  2GLF A;  3PB7 X;  3ZJ0 A;  5FVJ A;  2V8H A;  3IEH A;  3NH5 A;  5LRG A;  4AG9 A;  4EME A;  7CPA A;  4CYO A;  3D8P A;  4NGS A; 
#chains in the Genus database with same CATH homology
 1BO4 A;  3I3G A;  4JD6 A;  3LD2 A;  1J4J A;  4MHD A;  2BSW A;  3GYA A;  2PC1 A;  1Q2Y A;  2D4O A;  1IYK A;  1RXT A;  4Y49 B;  4OAE A;  1PUA A;  3R9E A;  2YGW A;  1YRE A;  3FNC A;  4MJ8 A;  2FSR A;  4J3G A;  4II9 A;  2J8N A;  2REE A;  1YR0 A;  1OZP A;  1GHE A;  2AE6 A;  4PK3 A;  2WUU A;  3G3S A;  4R3K A;  2R7H A;  2VI7 A;  1BOB A;  3R1K A;  3IWE A;  3TOB A;  4Q36 A;  4CGL A;  4JXR A;  4MY3 A;  3IGR A;  2FIW A;  4QB9 A;  4E8O A;  4R87 A;  4K30 A;  3W91 A;  4LUA A;  2QML A;  1MJ9 A;  3TTH A;  3V8I A;  3W6S A;  4LX9 A;  4UWJ A;  4B5O A;  1ON0 A;  2DPS A;  4YRH A;  4C2Z A;  2OZG A;  4Q38 A;  3F8K A;  4C68 A;  4YFJ A;  4CAE A;  3NE7 A;  4CGO A;  4FD6 A;  4ONU A;  4U9Z A;  5E96 A;  5G21 A;  1IID A;  2Q04 A;  2B4D A;  4RI1 A;  4B11 A;  1ZO0 A;  4KOY A;  4A33 A;  3B8G A;  5AG6 A;  2YNC A;  4CGN A;  1PU9 A;  2Z0Z A;  3R96 A;  2VBQ A;  3DDD A;  1Q2C A;  4M85 A;  4F6A A;  2G3A A;  3P2H A;  4UCP A;  5I0C A;  4B10 A;  3FXT A;  4UA3 A;  2F5I A;  2Q4Y A;  3G8W A;  2PQ8 A;  2FL4 A;  1I21 A;  3EC4 A;  5IV0 A;  1S3Z A;  4U9Y A;  1P4N A;  1M4G A;  2JLM A;  2EVN A;  3TO6 A;  1B87 A;  5A27 A;  4F0X A;  4JLY A;  5JPH A;  1XEB A;  4MY0 A;  1QSO A;  3KKW A;  2P6G A;  4NXY A;  2DPT A;  2REF A;  4FD5 A;  4KUB A;  2R1I A;  1NE9 A;  2FIA A;  2J8R A;  2NMT A;  2G0B A;  2WSA A;  3D2P A;  1M4D A;  1Q2D A;  2P6F A;  2BUE A;  4QUS A;  2G3T A;  1QSR A;  5KTA A;  2K5T A;  1RO5 A;  2Z3P A;  5AG4 A;  4FD7 A;  5HMN A;  3FRM A;  2YNE A;  4U5Y A;  5CNP A;  4ZBG A;  2CXA A;  3BLN A;  4AG7 A;  4MBU A;  1L0C A;  4KLW A;  3FBU A;  4KOU A;  2I00 A;  1MJA A;  1LRZ A;  5F46 A;  3EFA A;  4I49 A;  1VHS A;  5IB0 A;  4MFZ A;  2Z3O A;  3IU1 A;  2FCK A;  1KUV A;  4MI4 A;  2B5G B;  5ISV A;  4XNH C;  2X7B A;  3R9F A;  2FT0 A;  4OLL A;  4PSW A;  4CYN A;  4C7H A;  3D3S A;  3P2F A;  2ZW4 A;  2Z3M A;  2JEV A;  3SXN A;  4C2X A;  2PR1 A;  2ZW7 A;  1S7L A;  5KTC A;  4KOS A;  2HV2 A;  4KZT A;  4JXQ A;  4NF1 A;  2Q0Y A;  1IB1 E;  3VWD A;  1KUX A;  2HQY A;  2WPW A;  2CY2 A;  5H84 A;  2YND A;  3TCV A;  3T9Y A;  3FYN A;  2QIR A;  1Y9W A;  4MFQ A;  3SHP A;  2OU2 A;  4CRZ B;  1WWZ A;  2HUZ A;  4KSA A;  4B12 A;  2DXQ A;  3DR6 A;  4CAV A;  3S6G A;  1MJB A;  5GCN A;  2H5M A;  4QC6 A;  4R3L A;  4KOV A;  3DSB A;  1S5K A;  5AG5 A;  2FXF A;  2GIV A;  1M4I A;  3QAH A;  4MFJ A;  5IX3 A;  3CXS A;  4KOR A;  1QSM A;  3T90 A;  1I12 A;  4H89 A;  5BWA B;  4E0A A;  1IIC A;  2IL4 A;  3JTK A;  3BJ7 A;  3DR8 A;  4MFK A;  3TE4 A;  2VZZ A;  1Z4E A;  2Q4V A;  2B4D B;  2GE3 A;  4B13 A;  3C26 A;  3GY9 A;  4R9M A;  3CXP A;  4AVA A;  2B3V A;  3MGD A;  4CGM A;  5J8C A;  2Z3L A;  4R57 A;  4DNC A;  2B58 A;  3E0K A;  1TIQ A;  4XNH B;  5JQ4 A;  4HNX B;  2Q44 A;  3FB3 A;  4KOX A;  2ZW6 A;  3VWE A;  4XPD B;  2WPX A;  1YVK A;  4UWI A;  3LOD A;  3TO7 A;  1YLE A;  5DWM A;  1YX0 A;  4UCM A;  4KOT A;  2BEI A;  3S6K A;  4B5P A;  1N71 A;  1YGH A;  4BMH A;  4CAF A;  3H5Z A;  3PZJ A;  1S7K A;  3TT2 A;  4A95 A;  4MFP A;  1R57 A;  2Q7B A;  1S7N A;  2BL1 A;  3UY5 A;  3RYO A;  2AJ6 A;  2GAN A;  4CYQ A;  2Y0M A;  4CGP A;  3D2M A;  3FIX A;  4B14 A;  1Z9U A;  2YNC C;  2ZW5 A;  5G1Z A;  4CS0 B;  4AB7 A;  4NEX A;  4UBR A;  4F0Y A;  4KUA A;  4EVY A;  2PRB A;  2CNT A;  4IF5 A;  1U6M A;  3K9U A;  3H4Q A;  2B5G A;  4H6Z A;  1KZF A;  2VXK A;  1Y7R A;  2OZH A;  4PSX A;  4JJX A;  4XPD C;  1M1D A;  4KVM E;  1KUY A;  1NMT A;  1XF8 A;  4NCZ A;  5AGE A;  4KVO E;  4CAX A;  4A30 A;  3I9S A;  3PP9 A;  1K4J A;  4IUS A;  4FD4 A;  2JDC A;  4HKF A;  1Z4R A;  1VKC A;  2B4B A;  1UFH A;  4AVC A;  4C7I A;  3EY5 A;  4QVT A;  4KSF A;  2R8V A;  2D4P A;  2J8M A;  1SQH A;  4PK2 A;  2O28 A;  1XE4 A;  1YK3 A;  4MFL A;  3TO9 A;  4A2Z A;  1V0C A;  4BBH A;  5EBV A;  4KLV A;  4AVB A;  3QB8 A;  2EUI A;  1MK4 A;  4C2Y A;  5HH1 A;  1YVO A;  3N7Z A;  2KCW A;  2VQY A;  4CRY B;  4M3S A;  4RS2 A;  2Z11 A;  4L89 A;  5F48 A;  5EC4 A;  3R95 A;  4JWP A;  2FS5 A;  4X5K A;  1XMT A;  1CM0 A;  4KS9 A;  4ORF A;  1I1D A;  4ZGY B;  2VZY A;  4XPL A;  3A9L A;  4Y49 C;  3IU2 A;  2ATR A;  3OWC A;  4XPK A;  4H6U A;  3S6F A;  5KTD A;  4KVX A;  3DNS A;  2A4N A;  3TOA A;  2JDD A;  3CXQ A;  2PR8 A;  2ZXV A;  3EO4 A;  2I79 A;  2R98 A;  4CYP A;  4KOW A;  4UFW A;  3EXN A;  1CJW A;  4L8A A;  2Z3K A;  3GKR A;  2Z3N A;  3JUW A;  5F47 A;  2OZU A;  5C82 A;  2CNM A;  3R9G A;  3TFY A;  2RC4 A;  1WK4 A;  3JVN A;  5C88 A;  4GS4 A;  4PV6 A;  4NSQ A;  2Z10 A;  1QST A;  2PDO A;  2FE7 A;  4A32 A;  4UFX A;  1XIX A;  5AG7 A;  2C27 A;  1S60 A;  4CAW A;  5G22 A;  2VEZ A;  5H86 A;  2ZPA A;  4HNY B;  4YGO A;  2P6E A;  3S6H A;  4UFV A;  1M44 A;  1S7F A;  1FY7 A;  3F0A A;  5G20 A;  3WR7 A;  4OAD A;  2OB0 A;  5J8F A;  1Y9K A;  2PSW A;  3PGP A;  4A31 A;  4B5P B;  1P0H A;  3SXO A;  3ZZI A;  3IWG A;  3W6X A;  2CNS A;  1IYL A;  2OH1 A;  2QEC A;  5A28 A;  2ARH A;  2P0W A;  4QBJ A;  2B3U A;  3F5B A;  1B6B A;  1NSL A;  4E2A A;  5DWN A;  4HNW B;  1QSN A;  4UCN A;  5F49 A;  3BJ8 A;  3ZJ0 A;  5FVJ A;  4AG9 A;  4CYO A;  3D8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...