4KUAA

Crystal structure of a gnat superfamily acetyltransferase pa4794
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
GHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 43
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kuaA00
4KUBA 5C88A 1Y9WA 1RXTA 3R96A 1V0CA 3K9UA 3FB3A 2OZGA 4KOTA 5KTCA 2FIAA 3RYOA 2ZW6A 4NXYA 4AVBA 4NEXA 4OADA 3DR8A 1Q2DA 1ON0A 4IUSA 3N7ZA 4KORA 3PGPA 2REFA 1R57A 1PUAA 4I49A 3E0KA 1XF8A 3UY5A 2DXQA 3GKRA 4JWPA 4B5OA 2ZW7A 3P2FA 4MI4A 1U6MA 1KUYA 4AVCA 2VQYA 4F6AA 1M1DA 2KCWA 2AJ6A 5CNPA 2P6EA 4JLYA 2HQYA 4PK3A 3WR7A 4HNYB 1RO5A 1M4IA 2B5GA 1QSRA 3F5BA 3FBUA 2A4NA 1CJWA 4PSWA 5E96A 1NE9A 1YREA 1I21A 3FYNA 4FD4A 4JXQA 5DWNA 2R98A 4AG7A 1XIXA 4ZBGA 1Y9KA 2BUEA 4KZTA 1YGHA 3QB8A 2J8MA 4KOWA 2FSRA 5ISVA 2B3VA 2QECA 2ZXVA 1CM0A 3KKWA 2B3UA 2B58A 4NCZA 2CNMA 1IIDA 2GE3A 4MY0A 1S5KA 1KUXA 2BEIA 3W91A 3IGRA 4CAXA 4UBRA 3C26A 3W6SA 2FE7A 1I1DA 4QBJA 2PSWA 1XMTA 4XPKA 3W6XA 1NMTA 2FIWA 2I00A 3F8KA 1KZFA 3DR6A 3FNCA 1TIQA 1XEBA 1Y7RA 4JD6A 4KOUA 4R3KA 3ZJ0A 3D3SA 1M44A 4II9A 1S7NA 2PQ8A 2R7HA 4KOYA 5KTDA 4FD5A 3TTHA 4L89A 2QMLA 4UWIA 4FD6A 3EFAA 4Y49C 4H89A 2VI7A 4X5KA 1S7KA 1OZPA 2C27A 4MY3A 2EVNA 4LUAA 2ATRA 4E0AA 4Y49B 1Q2YA 3T90A 3D2PA 4UA3A 4K30A 2O28A 2WPXA 5JQ4A 1Z4EA 1WWZA 2IL4A 4KUAA 4EVYA 4PK2A 3P2HA 2CY2A 4KLWA 5F49A 1PU9A 1SQHA 1IICA 5C82A 2BL1A 1M4GA 2Q04A 2WPWA 2FT0A 4J3GA 3T9YA 3TOBA 4FD7A 3R95A 2G3TA 3PP9A 4RI1A 4BMHA 5JPHA 3EO4A 2RC4A 1S7LA 2PRBA 5HH1A 1KUVA 2VZZA 1YX0A 4DNCA 2NMTA 5H84A 3TO9A 2I79A 3LODA 4YFJA 3EXNA 2PDOA 3BJ8A 1GHEA 4AVAA 4GS4A 3R1KA 3G8WA 4MJ8A 3I3GA 4PSXA 3TE4A 1P4NA 4NF1A 3OWCA 4JJXA 2Y0MA 2H5MA 4M85A 2Q4YA 4AB7A 1WK4A 3I9SA 3V8IA 1IYKA 3FRMA 2QIRA 3S6FA 4KVME 5FVJA 1P0HA 1BO4A 3BLNA 5GCNA 2BSWA 1QSNA 2HV2A 3CXQA 2K5TA 3TCVA 3TOAA 1BOBA 3ZZIA 4KLVA 4E2AA 3GYAA 4UWJA 2PC1A 1S7FA 4QB9A 1YR0A 3JVNA 2P6FA 2X7BA 3B8GA 3DSBA 3S6HA 1XE4A 4R87A 2REEA 2Z10A 4L8AA 1IYLA 4H6ZA 5F48A 2F5IA 2GIVA 4KVXA 1S3ZA 3TFYA 3EY5A 1QSMA 3F0AA 1QSTA 1B87A 1MJ9A 3TO6A 4U9ZA 4RS2A 4MHDA 2J8RA 3JUWA 2GANA 4ORFA 3TT2A 1LRZA 1IB1E 4QVTA 3VWEA 1L0CA 1Z4RA 1MJAA 4XNHC 2Z11A 1QSOA 2OH1A 4NSQA 2ZW5A 2FS5A 5F47A 2OU2A 4XNHB 4YRHA 5I0CA 1Q2CA 2D4OA 4HKFA 2VBQA 4CS0B 3NE7A 3CXSA 3SHPA 1B6BA 2Q44A 2PR1A 4E8OA 2B4DB 4XPDC 2R8VA 4PV6A 5IX3A 2ZW4A 5HMNA 2JEVA 2G0BA 4XPDB 2P0WA 5EC4A 2B5GB 4AG9A 4KVOE 2VEZA 4YGOA 2AE6A 2JDCA 5EBVA 5KTAA 4U9YA 2FXFA 1VHSA 4OLLA 4LX9A 1NSLA 3G3SA 5IV0A 2EUIA 1S60A 5F46A 2D4PA 3FIXA 3D2MA 2B4DA 2Q4VA 1M4DA 4KOVA 3IWGA 4MBUA 4KOXA 2ZPAA 4HNWB 3CXPA 2CNSA 4CRZB 1Z9UA 5H86A 3S6GA 3FXTA 3SXNA 4OAEA 3EC4A 3S6KA 1FY7A 2Z0ZA 1MK4A 3MGDA 4QUSA 3D8PA 2JLMA 1YVOA 3QAHA 1I12A 1YVKA 4CRYB 4R3LA 4B5PB 2FL4A 5IB0A 4IF5A 2J8NA 1YLEA 4H6UA 1YK3A 4R9MA 4QC6A 3DDDA 4F0YA 2ARHA 1MJBA 4CAWA 3BJ7A 2VXKA 4XPLA 2B4BA 2FCKA 2G3AA 4KOSA 4CAVA 4JXRA 5DWMA 3R9GA 1VKCA 3PZJA 5J8FA 5J8CA 2HUZA 2OZHA 4B5PA 2P6GA 2Q7BA 2Q0YA 1J4JA 3VWDA 1UFHA 3SXOA 1N71A 1K4JA 3TO7A 2VZYA 4HNXB 2OZUA 3GY9A 3DNSA 4ONUA 4U5YA 3H4QA 3R9FA 2PR8A 2R1IA 2JDDA 2CNTA 3LD2A 4M3SA 2OB0A 4R57A 3R9EA
chains in the Genus database with same CATH superfamily
1TKJA 4KUBA 1KWMA 2JBKA 5C88A 1Y9WA 4A32A 1RXTA 3B3SA 1V0CA 3R96A 1XJOA 4MFLA 3IO1A 3K9UA 4X2TA 1GYTA 1YQEA 2O53A 3FB3A 3LACA 2OZGA 3BI0A 4NJRA 4KOTA 5KTCA 2IQ6A 1HEEA 2FIAA 2GREA 3RYOA 3SI2A 5JGFA 1BPMA 2ZW6A 4NXYA 4ZY0A 4AVBA 3FMCA 4NEXA 4OADA 3DR8A 4YWYA 1Q2DA 4A37A 1ON0A 3RBUA 4IUSA 3NH5A 3N7ZA 4KORA 3PGPA 2REFA 5G1ZA 2C1CA 1R57A 1PUAA 3NH4A 3S6HA 2ANPA 1IY7A 4I49A 1BAVA 2ABZA 2Z3KA 2CTBA 3E0KA 2PJCA 1XF8A 4NGPA 3UY5A 2GLFA 2DXQA 3GKRA 1TKHA 4NGMA 2BCOA 2Z3LA 4JWPA 3V7ZA 4B5OA 2ZW7A 1LAPA 1F2OA 3P2FA 1U6MA 4MI4A 4KSIA 1KUYA 4UFXA 4X3RA 5G21A 2VQYA 5LYDA 4AVCA 1VIXA 4MXUA 4CYOA 1F57A 1XOVA 4F6AA 1M1DA 4C68A 2KCWA 2AJ6A 4P10A 2P6EA 4R8FA 5CNPA 3SJGA 1Q7LA 2JBJA 3K9TA 4JLYA 3IEHA 2HQYA 2Z3NA 4PK3A 3WR7A 3SI1A 4HNYB 3RZAA 2HB6A 3B3VA 1RO5A 1LANA 2PIYA 4MCQA 1M4IA 2B5GA 1R3NA 1QSRA 2EBJA 3F5BA 3FBUA 3JRUA 2A4NA 4M6GA 1CJWA 4PSWA 5E96A 1NE9A 1YREA 2CIJA 1I21A 4CYNA 3FYNA 4FD4A 4JXQA 5DWNA 2R98A 4AG7A 1XIXA 3D67A 4YU9A 4ZBGA 3IJ3A 3NA6A 1Y9KA 2BUEA 2Q43A 4KZTA 3IFEA 1YGHA 4JYWA 3QB8A 3WC6A 3NE8A 2J8MA 3FEDA 4KOWA 1AUGA 4P4DA 4O23A 2ZEGA 2ZEHA 6CPAA 2FSRA 5ISVA 3CPAA 1YW6A 2XEGA 2V8GA 2B3VA 2QECA 2ZXVA 2AFWA 1TF8A 5HVFA 2ZEMA 2J9AA 1CM0A 3D66A 3KKWA 2B3UA 2B58A 4NCZA 1VHOA 2CNMA 1IIDA 2GE3A 4MY0A 1S5KA 4FAIA 1KUXA 2BEIA 3W91A 1IOFA 3IGRA 4JZ0A 4CAXA 1ZO0A 4UBRA 3C26A 5LRGA 3W6SA 4CYQA 1YW4A 1I1DA 2FE7A 4QBJA 4M6HA 2Z3MA 4CGNA 4CGMA 4AXVA 2CXAA 4OC5A 1HDUA 2PSWA 3H8GA 3PFEA 4LQ6A 1XMTA 2WSAA 4P4EA 4CGPA 4P6YA 4XPKA 4Q7AA 3RO0A 3W6XA 3IU1A 4KSFA 3NFZA 4NGSA 1NMTA 2FIWA 2I00A 3F8KA 4OMEA 1LOKA 3SJEA 1Y7EA 2RFHA 5JH9A 1KZFA 3DR6A 3MN8A 3ISZA 3GB0A 3WC5A 3FNCA 4RUHA 5HVGA 1YSJA 1TIQA 1XEBA 4CYPA 3H5ZA 1Y7RA 4JD6A 5A27A 4K3NA 8CPAA 1QQ9A 3PB8X 4KOUA 4R3KA 1IGBA 3ZJ0A 3D3SA 1BPNA 3ISXA 1M44A 4MRIA 4OIDA 4II9A 1S7NA 2PQ8A 2R7HA 4KOYA 2PJ9A 5KTDA 2VL1A 4FD5A 3TTHA 4Q38A 5J1QA 4L89A 2QMLA 2DPTA 4UWIA 4FD6A 3IWWA 1XBUA 3EFAA 4R7MA 4P45A 2Q4ZA 2DEAA 3N5FA 4MFQA 2PJ2A 4Y49C 2IJZA 4H89A 4C7HA 2VI7A 4X5KA 1ZG7A 1S7KA 1DE4C 1OZPA 2C27A 4MY3A 4C7IA 4CRZB 2EVNA 4LUAA 2ATRA 2Q7SA 4E0AA 4Y49B 1Q2YA 1XFOA 3D2PA 4IK2A 3KR5A 3B35A 4UA3A 3T90A 4F8ZA 4K30A 4CPAA 4EMEA 2O28A 2WPXA 4A95A 5JQ4A 5K8NA 4NJQA 1Z4EA 4PQAA 3GUXA 1WWZA 2IL4A 4KUAA 3T8WA 4EVYA 3GIUA 4PK2A 3P2HA 3KGQA 2CY2A 4UCNA 3KZWA 3NH8A 4KLWA 4BINA 3BI1A 4OC3A 1AYEA 3VH9A 3TC8A 5F49A 1PU9A 2PIZA 1TF9A 4KSAA 4MHZA 4R6TA 2EO8A 4B14A 1SQHA 1IICA 5HVHA 2GLJA 4B6ZA 5C82A 3S9NA 2BL1A 4P4BA 2WUUA 3KI9A 4MHPA 1M4GA 2Q04A 2WPWA 1XMBA 3A9LA 4Q36A 2FT0A 2PRQA 2DPSA 4J3GA 3T9YA 3TOBA 1ELLP 2AFMA 4MCRA 1PCAA 4NGNA 3H8FA 3H8EA 4FD7A 5HXDA 2PJ6A 3PB4X 3R95A 2G3TA 3KHZA 3KQZA 3PP9A 4RI1A 4DYOA 2ZENA 4BMHA 2ZOGA 5JPHA 3EO4A 2RC4A 3WT4A 1S7LA 2PRBA 5HH1A 3PBBA 1KUVA 2RB7A 2VZZA 2YNCC 4UFVA 1YX0A 5D8NA 4ZX9A 4UCMA 4A2ZA 2NMTA 4DNCA 2EK9A 5EMIA 5H84A 3TO9A 2I79A 2IMOA 2YGWA 3LODA 3CDXA 3SI0A 1JWQA 4YFJA 1F2PA 4BD9A 5G22A 4MFZA 4UEFA 3EXNA 1AMPA 2PDOA 2F8HA 1GHEA 1Z8TA 3BJ8A 3RAMA 4AVAA 3HLPA 5IB9A 4GS4A 1FT7A 3R1KA 3G8WA 1JQGA 4MJ8A 5DS0A 3I3GA 4PSXA 3B3CA 1UWYA 3TE4A 1P4NA 1H8LA 3IWEA 2C6PA 2ODFA 3PEIA 4NF1A 4NGTA 3OWCA 4JJXA 2Y0MA 3I1UA 3BHXA 4OIWA 2PJ1A 3CT9A 3FECA 2H5MA 4H2KA 1HDQA 1PYTB 1VHEA 1IOIA 3FEEA 5ELYA 3B3WA 4ZY1A 5I4MA 4GXHA 2PCUA 4M85A 1CP7A 2AFXA 2Q4YA 4PXEA 3GLJA 4AB7A 1WK4A 4NFRA 3I9SA 4Z65A 4NGRA 2C6CA 2Q51A 1IYKA 3V8IA 2PJ4A 5CPAA 3FRMA 2JEWA 2QIRA 2YNCA 1Y0YA 5CBMA 1CPXA 1CX8A 3S6FA 4B12A 2V77A 2EK8A 4MCPA 4KVME 5JM6A 5FVJA 1P0HA 1BO4A 3BLNA 4UF4A 4F9UA 1LAMA 2WZNA 5GCNA 4OP4A 2BSWA 1QSNA 2ZEEA 2HV2A 4MHNA 5LRKA 3CXQA 2K5TA 3TCVA 4PXCA 5K8MA 3HUVA 4MFKA 1BOBA 4LQGA 2NSMA 5THWA 3TOAA 3ZZIA 5BWAB 3KL9A 4KLVA 4E2AA 4P4FA 3GYAA 4FBEA 4ZGYB 4UWJA 3DLJA 5AG5A 2PC1A 1S7FA 4QB9A 5AG7A 3PBEA 3B2YA 3FJUA 1EE3P 4A33A 4WWVA 2YNEA 4A30A 4C2ZA 1YR0A 3S9MA 3JVNA 2P6FA 2X7BA 3B8GA 3DSBA 3PB7X 4KS9A 1XE4A 4IAVA 4R87A 2REEA 2Z10A 4L8AA 2PJ0A 1IYLA 4H6ZA 5F48A 4C2XA 2F5IA 2Z3OA 4ZY2A 1TXRA 3MRUA 3TX8A 2ZEDA 2GIVA 4TNUA 1NSAA 3B7IA 4OC4A 4KVXA 1S3ZA 3TFYA 3EY5A 1CG2A 1QSMA 3F0AA 4FWUA 1QSTA 1B87A 5F09A 1MJ9A 2PJ5A 5K8OA 3QNVA 2PJAA 3TO6A 4U9ZA 4RS2A 3WABA 4MHDA 2J8RA 4ONWA 2PJ3A 5LYLA 1XRYA 2GANA 3JUWA 3LWUA 4ORFA 3TT2A 4PPZA 1ELMP 3DGVA 1LRZA 1IB1E 4QVTA 2V8DA 3VWEA 1L0CA 1Z4RA 4DUKA 2OOTA 4OKOA 1ARMA 1LCPA 1MJAA 1CP6A 3FF3A 2FVGA 4XNHC 2Z11A 4CGOA 4MCSA 1QSOA 2OH1A 5D29A 2V8VA 4NSQA 2ZW5A 3VARA 2FS5A 3D68A 4R76A 5F47A 1CBXA 3L2NA 2OU2A 4XNHB 4A39A 4YRHA 5AG6A 4A94A 5I0CA 1Q2CA 2C6GA 2D4OA 1X12A 3B3TA 4HKFA 4P4IA 5G20A 2PE3A 4A38A 1TKFA 2VBQA 2XEFA 2ZEOA 4CS0B 3NE7A 2CF4A 4P44A 3WC7A 3CXSA 3SHPA 1B6BA 2Q44A 2Z3PA 2PR1A 4F9VA 4M6IA 3LMSA 4E8OA 1CPSA 2B4DB 2QVPA 4RN7A 4XPDC 1ZG8A 1ZLIA 3VATA 5LRJA 2BO9A 3D4UA 4UFWA 2AFUA 2R8VA 3KHXA 4FUUA 4W9YA 1FNOA 4PV6A 5IX3A 4OC0A 2ZW4A 3PB6X 1YLOA 5HMNA 2JEVA 2G0BA 4XPDB 2P0WA 5EC4A 2B5GB 4AG9A 4KVOE 2VEZA 4YGOA 2DF5A 2AE6A 3RNZA 4GM5A 2JDCA 1X10A 3JTKA 5EBVA 5KTAA 4U9YA 2FXFA 1ZG9A 4EFDA 1VHSA 1Z2LA 4LX9A 1Y0RA 2EWBA 4OLLA 3BXMA 3G3SA 1NSLA 4B11A 2PJBA 5IV0A 3IIBA 2EUIA 3FH4A 1S60A 5F46A 4F0XA 2D4PA 3FIXA 4PXDA 3IU2A 3PFOA 3KASA 3K2KA 5A28A 2BOAA 3D2MA 2B4DA 2Q4VA 2XEJA 1M4DA 4KOVA 2WYRA 4MMOA 4IHMA 3IWGA 3D7FA 2ZOFA 3PB9X 4MBUA 4KOXA 2ZPAA 1A2ZA 4B13A 4HNWB 1M4LA 3CXPA 2CNSA 4OC2A 1VGYA 1Z9UA 4PXBA 3FXTA 5H86A 3S6GA 3SJFA 4OC1A 3SXNA 4ZYQA 3D7GA 2GFQA 4OAEA 2HC9A 3EC4A 3S6KA 4DJLA 1FY7A 2Z0ZA 3CPXA 1MK4A 2NYQA 3MGDA 3D7HA 4QUSA 4G1PA 3D8PA 2AFZA 2JLMA 1YVOA 3QAHA 4TWEA 1I12A 1YVKA 2YNDA 2F7VA 4CRYB 4R3LA 4B5PB 7CPAA 1YMEA 1Z8XA 2POKA 4P4JA 1QMUA 2FL4A 5IB0A 5AGEA 1ZLHA 2J8NA 2PVWA 2QYVA 4IF5A 4UEZA 1RTQA 1YLEA 1Z8WA 2PJ8A 4UEEA 2OR4A 4H6UA 1YK3A 4R9MA 1R43A 1OBRA 4QC6A 2ZELA 2CTCA 3IC1A 3PRTA 4ZX8A 1Z5RA 3DDDA 4F0YA 5AG4A 2ARHA 4MHYA 1MJBA 1Z8LA 3D7DA 4B10A 4CAWA 3BJ7A 2VXKA 4WJBA 4CAFA 4XPLA 2B4BA 2FCKA 2G3AA 4HPSA 4KOSA 3KR4A 4CAVA 4JXRA 3S9LA 5DWMA 3R9GA 1VKCA 3PZJA 5J8FA 2V8HA 2PVVA 5J8CA 2I3CA 3KQXA 2HUZA 2OZHA 4B5PA 3FX6A 2P6GA 2Q7BA 4EWTA 2ZEPA 2Q0YA 3CZXA 1J4JA 3VWDA 3SJXA 1UFHA 2ZEFA 4UCPA 1LFWA 3SXOA 1N71A 3FVLA 2G9DA 4BBHA 1K4JA 4ZI6A 2XEIA 3TO7A 4UIAA 2VZYA 4A31A 4HNXB 2O4HA 2OZUA 3GY9A 4X8IA 2GU2A 4MFJA 4CAEA 3DNSA 4UIBA 4MFPA 4ONUA 4C2YA 4U5YA 1DTDA 2QJ8A 1ARLA 3H4QA 4NGQA 4CGLA 3V38A 5LYFA 1BLLE 5K8PA 1IU8A 3R9FA 2PR8A 2R1IA 3QAYA 2JDDA 2CNTA 3LD2A 5LYIA 2AFOA 2PJ7A 4M3SA 2OB0A 4R57A 2AFSA 3R9EA
chains in the Genus database with same CATH topology
4KUBA 5C88A 1Y9WA 4A32A 1RXTA 3R96A 1V0CA 4MFLA 3K9UA 3FB3A 2OZGA 4KOTA 5KTCA 2FIAA 3RYOA 2ZW6A 4NXYA 4AVBA 4NEXA 4OADA 3DR8A 1Q2DA 1ON0A 4IUSA 3N7ZA 4KORA 3PGPA 2REFA 5G1ZA 1R57A 1PUAA 4I49A 2Z3KA 3E0KA 1XF8A 3UY5A 2DXQA 3GKRA 2Z3LA 4JWPA 4B5OA 2ZW7A 3P2FA 4MI4A 1U6MA 4UFXA 5G21A 1KUYA 4AVCA 2VQYA 4CYOA 4F6AA 1M1DA 4C68A 2KCWA 2AJ6A 5CNPA 2P6EA 4JLYA 2HQYA 2Z3NA 4PK3A 3WR7A 4HNYB 1RO5A 1M4IA 2B5GA 1QSRA 3F5BA 3FBUA 2A4NA 1CJWA 4PSWA 5E96A 1NE9A 1YREA 1I21A 4CYNA 3FYNA 4FD4A 4JXQA 5DWNA 2R98A 4AG7A 1XIXA 4ZBGA 1Y9KA 2BUEA 4KZTA 1YGHA 3QB8A 2J8MA 4KOWA 2FSRA 5ISVA 2B3VA 2QECA 2ZXVA 1CM0A 3KKWA 2B3UA 2B58A 4NCZA 2CNMA 1IIDA 2GE3A 4MY0A 1S5KA 1KUXA 2BEIA 3W91A 3IGRA 4CAXA 1ZO0A 4UBRA 3C26A 3W6SA 4CYQA 2FE7A 1I1DA 4QBJA 4CGNA 2Z3MA 4CGMA 2CXAA 2PSWA 1XMTA 2WSAA 4CGPA 4XPKA 3W6XA 3IU1A 4KSFA 1NMTA 2FIWA 2I00A 3F8KA 1KZFA 3DR6A 3FNCA 1TIQA 1XEBA 4CYPA 3H5ZA 1Y7RA 4JD6A 5A27A 4KOUA 4R3KA 3ZJ0A 3D3SA 1M44A 4II9A 1S7NA 2PQ8A 2R7HA 4KOYA 5KTDA 4FD5A 3TTHA 4Q38A 4L89A 2QMLA 2DPTA 4UWIA 4FD6A 3EFAA 4MFQA 4Y49C 4H89A 4C7HA 2VI7A 4X5KA 1S7KA 1OZPA 2C27A 4MY3A 4C7IA 2EVNA 4LUAA 2ATRA 4E0AA 4Y49B 1Q2YA 3T90A 3D2PA 4UA3A 4K30A 2O28A 2WPXA 4A95A 5JQ4A 1Z4EA 1WWZA 2IL4A 4KUAA 4EVYA 4PK2A 3P2HA 2CY2A 4UCNA 4KLWA 5F49A 1PU9A 4KSAA 4B14A 1SQHA 1IICA 5C82A 2BL1A 2WUUA 1M4GA 2Q04A 2WPWA 3A9LA 4Q36A 2FT0A 2DPSA 4J3GA 3T9YA 3TOBA 4FD7A 3R95A 2G3TA 3PP9A 4RI1A 4BMHA 5JPHA 3EO4A 2RC4A 1S7LA 2PRBA 5HH1A 1KUVA 2VZZA 4UFVA 2YNCC 1YX0A 4UCMA 4A2ZA 2NMTA 4DNCA 5H84A 3TO9A 2I79A 3LODA 2YGWA 4YFJA 5G22A 4MFZA 3EXNA 2PDOA 3BJ8A 1GHEA 4AVAA 4GS4A 3R1KA 3G8WA 4MJ8A 3I3GA 4PSXA 3TE4A 1P4NA 3IWEA 4NF1A 3OWCA 4JJXA 2Y0MA 2H5MA 4M85A 2Q4YA 4AB7A 1WK4A 3I9SA 3V8IA 1IYKA 3FRMA 2QIRA 2YNCA 3S6FA 4B12A 4KVME 5FVJA 1P0HA 1BO4A 3BLNA 5GCNA 2BSWA 1QSNA 2HV2A 3CXQA 2K5TA 3TCVA 4MFKA 3TOAA 1BOBA 3ZZIA 5BWAB 4KLVA 4E2AA 3GYAA 4ZGYB 4UWJA 5AG5A 2PC1A 1S7FA 4QB9A 5AG7A 4A33A 4A30A 2YNEA 4C2ZA 1YR0A 3JVNA 2P6FA 2X7BA 3B8GA 3DSBA 4KS9A 3S6HA 1XE4A 4R87A 2REEA 2Z10A 4L8AA 4C2XA 1IYLA 4H6ZA 5F48A 2F5IA 2Z3OA 2GIVA 4KVXA 1S3ZA 3TFYA 3EY5A 1QSMA 3F0AA 1QSTA 1B87A 1MJ9A 3TO6A 4U9ZA 4RS2A 4MHDA 2J8RA 3JUWA 2GANA 4ORFA 3TT2A 1LRZA 1IB1E 4QVTA 3VWEA 1L0CA 1Z4RA 1MJAA 4XNHC 2Z11A 4CGOA 1QSOA 2OH1A 4NSQA 2ZW5A 2FS5A 5F47A 2OU2A 4XNHB 4YRHA 5AG6A 5I0CA 1Q2CA 2D4OA 4HKFA 5G20A 2VBQA 4CS0B 3NE7A 3CXSA 3SHPA 1B6BA 2Q44A 2Z3PA 2PR1A 4E8OA 2B4DB 4XPDC 4UFWA 2R8VA 4PV6A 5IX3A 2ZW4A 5HMNA 2JEVA 2G0BA 4XPDB 2P0WA 5EC4A 2B5GB 4AG9A 4KVOE 2VEZA 4YGOA 2AE6A 2JDCA 3JTKA 5EBVA 5KTAA 4U9YA 2FXFA 1VHSA 4OLLA 4LX9A 1NSLA 3G3SA 4B11A 5IV0A 2EUIA 1S60A 5F46A 4F0XA 2D4PA 3FIXA 3IU2A 5A28A 3D2MA 2B4DA 2Q4VA 1M4DA 4KOVA 3IWGA 4MBUA 4KOXA 2ZPAA 4B13A 4HNWB 3CXPA 2CNSA 4CRZB 1Z9UA 5H86A 3S6GA 3FXTA 3SXNA 4OAEA 3EC4A 3S6KA 1FY7A 2Z0ZA 1MK4A 3MGDA 4QUSA 3D8PA 2JLMA 1YVOA 3QAHA 1I12A 1YVKA 2YNDA 4CRYB 4R3LA 4B5PB 2FL4A 5IB0A 5AGEA 4IF5A 2J8NA 1YLEA 4H6UA 1YK3A 4R9MA 4QC6A 5AG4A 3DDDA 4F0YA 2ARHA 1MJBA 4B10A 4CAWA 3BJ7A 2VXKA 4CAFA 4XPLA 2B4BA 2FCKA 2G3AA 4KOSA 4CAVA 4JXRA 5DWMA 3R9GA 1VKCA 3PZJA 5J8FA 5J8CA 2HUZA 2OZHA 4B5PA 2P6GA 2Q7BA 2Q0YA 1J4JA 3VWDA 1UFHA 3SXOA 4UCPA 1N71A 4BBHA 1K4JA 3TO7A 2VZYA 4A31A 4HNXB 2OZUA 3GY9A 4MFJA 4CAEA 3DNSA 4C2YA 4MFPA 4ONUA 4U5YA 3H4QA 4CGLA 3R9FA 2PR8A 2R1IA 2JDDA 2CNTA 3LD2A 4M3SA 2OB0A 4R57A 3R9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUB A;  5C88 A;  1Y9W A;  1RXT A;  3R96 A;  1V0C A;  3K9U A;  3FB3 A;  2OZG A;  4KOT A;  5KTC A;  2FIA A;  3RYO A;  2ZW6 A;  4NXY A;  4AVB A;  4NEX A;  4OAD A;  3DR8 A;  1Q2D A;  1ON0 A;  4IUS A;  3N7Z A;  4KOR A;  3PGP A;  2REF A;  1R57 A;  1PUA A;  4I49 A;  3E0K A;  1XF8 A;  3UY5 A;  2DXQ A;  3GKR A;  4JWP A;  4B5O A;  2ZW7 A;  3P2F A;  4MI4 A;  1U6M A;  1KUY A;  4AVC A;  2VQY A;  4F6A A;  1M1D A;  2KCW A;  2AJ6 A;  5CNP A;  2P6E A;  4JLY A;  2HQY A;  4PK3 A;  3WR7 A;  4HNY B;  1RO5 A;  1M4I A;  2B5G A;  1QSR A;  3F5B A;  3FBU A;  2A4N A;  1CJW A;  4PSW A;  5E96 A;  1NE9 A;  1YRE A;  1I21 A;  3FYN A;  4FD4 A;  4JXQ A;  5DWN A;  2R98 A;  4AG7 A;  1XIX A;  4ZBG A;  1Y9K A;  2BUE A;  4KZT A;  1YGH A;  3QB8 A;  2J8M A;  4KOW A;  2FSR A;  5ISV A;  2B3V A;  2QEC A;  2ZXV A;  1CM0 A;  3KKW A;  2B3U A;  2B58 A;  4NCZ A;  2CNM A;  1IID A;  2GE3 A;  4MY0 A;  1S5K A;  1KUX A;  2BEI A;  3W91 A;  3IGR A;  4CAX A;  4UBR A;  3C26 A;  3W6S A;  2FE7 A;  1I1D A;  4QBJ A;  2PSW A;  1XMT A;  4XPK A;  3W6X A;  1NMT A;  2FIW A;  2I00 A;  3F8K A;  1KZF A;  3DR6 A;  3FNC A;  1TIQ A;  1XEB A;  1Y7R A;  4JD6 A;  4KOU A;  4R3K A;  3ZJ0 A;  3D3S A;  1M44 A;  4II9 A;  1S7N A;  2PQ8 A;  2R7H A;  4KOY A;  5KTD A;  4FD5 A;  3TTH A;  4L89 A;  2QML A;  4UWI A;  4FD6 A;  3EFA A;  4Y49 C;  4H89 A;  2VI7 A;  4X5K A;  1S7K A;  1OZP A;  2C27 A;  4MY3 A;  2EVN A;  4LUA A;  2ATR A;  4E0A A;  4Y49 B;  1Q2Y A;  3T90 A;  3D2P A;  4UA3 A;  4K30 A;  2O28 A;  2WPX A;  5JQ4 A;  1Z4E A;  1WWZ A;  2IL4 A;  4KUA A;  4EVY A;  4PK2 A;  3P2H A;  2CY2 A;  4KLW A;  5F49 A;  1PU9 A;  1SQH A;  1IIC A;  5C82 A;  2BL1 A;  1M4G A;  2Q04 A;  2WPW A;  2FT0 A;  4J3G A;  3T9Y A;  3TOB A;  4FD7 A;  3R95 A;  2G3T A;  3PP9 A;  4RI1 A;  4BMH A;  5JPH A;  3EO4 A;  2RC4 A;  1S7L A;  2PRB A;  5HH1 A;  1KUV A;  2VZZ A;  1YX0 A;  4DNC A;  2NMT A;  5H84 A;  3TO9 A;  2I79 A;  3LOD A;  4YFJ A;  3EXN A;  2PDO A;  3BJ8 A;  1GHE A;  4AVA A;  4GS4 A;  3R1K A;  3G8W A;  4MJ8 A;  3I3G A;  4PSX A;  3TE4 A;  1P4N A;  4NF1 A;  3OWC A;  4JJX A;  2Y0M A;  2H5M A;  4M85 A;  2Q4Y A;  4AB7 A;  1WK4 A;  3I9S A;  3V8I A;  1IYK A;  3FRM A;  2QIR A;  3S6F A;  4KVM E;  5FVJ A;  1P0H A;  1BO4 A;  3BLN A;  5GCN A;  2BSW A;  1QSN A;  2HV2 A;  3CXQ A;  2K5T A;  3TCV A;  3TOA A;  1BOB A;  3ZZI A;  4KLV A;  4E2A A;  3GYA A;  4UWJ A;  2PC1 A;  1S7F A;  4QB9 A;  1YR0 A;  3JVN A;  2P6F A;  2X7B A;  3B8G A;  3DSB A;  3S6H A;  1XE4 A;  4R87 A;  2REE A;  2Z10 A;  4L8A A;  1IYL A;  4H6Z A;  5F48 A;  2F5I A;  2GIV A;  4KVX A;  1S3Z A;  3TFY A;  3EY5 A;  1QSM A;  3F0A A;  1QST A;  1B87 A;  1MJ9 A;  3TO6 A;  4U9Z A;  4RS2 A;  4MHD A;  2J8R A;  3JUW A;  2GAN A;  4ORF A;  3TT2 A;  1LRZ A;  1IB1 E;  4QVT A;  3VWE A;  1L0C A;  1Z4R A;  1MJA A;  4XNH C;  2Z11 A;  1QSO A;  2OH1 A;  4NSQ A;  2ZW5 A;  2FS5 A;  5F47 A;  2OU2 A;  4XNH B;  4YRH A;  5I0C A;  1Q2C A;  2D4O A;  4HKF A;  2VBQ A;  4CS0 B;  3NE7 A;  3CXS A;  3SHP A;  1B6B A;  2Q44 A;  2PR1 A;  4E8O A;  2B4D B;  4XPD C;  2R8V A;  4PV6 A;  5IX3 A;  2ZW4 A;  5HMN A;  2JEV A;  2G0B A;  4XPD B;  2P0W A;  5EC4 A;  2B5G B;  4AG9 A;  4KVO E;  2VEZ A;  4YGO A;  2AE6 A;  2JDC A;  5EBV A;  5KTA A;  4U9Y A;  2FXF A;  1VHS A;  4OLL A;  4LX9 A;  1NSL A;  3G3S A;  5IV0 A;  2EUI A;  1S60 A;  5F46 A;  2D4P A;  3FIX A;  3D2M A;  2B4D A;  2Q4V A;  1M4D A;  4KOV A;  3IWG A;  4MBU A;  4KOX A;  2ZPA A;  4HNW B;  3CXP A;  2CNS A;  4CRZ B;  1Z9U A;  5H86 A;  3S6G A;  3FXT A;  3SXN A;  4OAE A;  3EC4 A;  3S6K A;  1FY7 A;  2Z0Z A;  1MK4 A;  3MGD A;  4QUS A;  3D8P A;  2JLM A;  1YVO A;  3QAH A;  1I12 A;  1YVK A;  4CRY B;  4R3L A;  4B5P B;  2FL4 A;  5IB0 A;  4IF5 A;  2J8N A;  1YLE A;  4H6U A;  1YK3 A;  4R9M A;  4QC6 A;  3DDD A;  4F0Y A;  2ARH A;  1MJB A;  4CAW A;  3BJ7 A;  2VXK A;  4XPL A;  2B4B A;  2FCK A;  2G3A A;  4KOS A;  4CAV A;  4JXR A;  5DWM A;  3R9G A;  1VKC A;  3PZJ A;  5J8F A;  5J8C A;  2HUZ A;  2OZH A;  4B5P A;  2P6G A;  2Q7B A;  2Q0Y A;  1J4J A;  3VWD A;  1UFH A;  3SXO A;  1N71 A;  1K4J A;  3TO7 A;  2VZY A;  4HNX B;  2OZU A;  3GY9 A;  3DNS A;  4ONU A;  4U5Y A;  3H4Q A;  3R9F A;  2PR8 A;  2R1I A;  2JDD A;  2CNT A;  3LD2 A;  4M3S A;  2OB0 A;  4R57 A;  3R9E A; 
#chains in the Genus database with same CATH topology
 1TKJ A;  4KUB A;  1KWM A;  2JBK A;  5C88 A;  1Y9W A;  4A32 A;  1RXT A;  3B3S A;  1V0C A;  3R96 A;  1XJO A;  4MFL A;  3IO1 A;  3K9U A;  4X2T A;  1GYT A;  1YQE A;  2O53 A;  3FB3 A;  3LAC A;  2OZG A;  3BI0 A;  4NJR A;  4KOT A;  5KTC A;  2IQ6 A;  1HEE A;  2FIA A;  2GRE A;  3RYO A;  3SI2 A;  5JGF A;  1BPM A;  2ZW6 A;  4NXY A;  4ZY0 A;  4AVB A;  3FMC A;  4NEX A;  4OAD A;  3DR8 A;  4YWY A;  1Q2D A;  4A37 A;  1ON0 A;  3RBU A;  4IUS A;  3NH5 A;  3N7Z A;  4KOR A;  3PGP A;  2REF A;  5G1Z A;  2C1C A;  1R57 A;  1PUA A;  3NH4 A;  3S6H A;  2ANP A;  1IY7 A;  4I49 A;  1BAV A;  2ABZ A;  2Z3K A;  2CTB A;  3E0K A;  2PJC A;  1XF8 A;  4NGP A;  3UY5 A;  2GLF A;  2DXQ A;  3GKR A;  1TKH A;  4NGM A;  2BCO A;  2Z3L A;  4JWP A;  3V7Z A;  4B5O A;  2ZW7 A;  1LAP A;  1F2O A;  3P2F A;  1U6M A;  4MI4 A;  4KSI A;  1KUY A;  4UFX A;  4X3R A;  5G21 A;  2VQY A;  5LYD A;  4AVC A;  1VIX A;  4MXU A;  4CYO A;  1F57 A;  1XOV A;  4F6A A;  1M1D A;  4C68 A;  2KCW A;  2AJ6 A;  4P10 A;  2P6E A;  4R8F A;  5CNP A;  3SJG A;  1Q7L A;  2JBJ A;  3K9T A;  4JLY A;  3IEH A;  2HQY A;  2Z3N A;  4PK3 A;  3WR7 A;  3SI1 A;  4HNY B;  3RZA A;  2HB6 A;  3B3V A;  1RO5 A;  1LAN A;  2PIY A;  4MCQ A;  1M4I A;  2B5G A;  1R3N A;  1QSR A;  2EBJ A;  3F5B A;  3FBU A;  3JRU A;  2A4N A;  4M6G A;  1CJW A;  4PSW A;  5E96 A;  1NE9 A;  1YRE A;  2CIJ A;  1I21 A;  4CYN A;  3FYN A;  4FD4 A;  4JXQ A;  5DWN A;  2R98 A;  4AG7 A;  1XIX A;  3D67 A;  4YU9 A;  4ZBG A;  3IJ3 A;  3NA6 A;  1Y9K A;  2BUE A;  2Q43 A;  4KZT A;  3IFE A;  1YGH A;  4JYW A;  3QB8 A;  3WC6 A;  3NE8 A;  2J8M A;  3FED A;  4KOW A;  1AUG A;  4P4D A;  4O23 A;  2ZEG A;  2ZEH A;  6CPA A;  2FSR A;  5ISV A;  3CPA A;  1YW6 A;  2XEG A;  2V8G A;  2B3V A;  2QEC A;  2ZXV A;  2AFW A;  1TF8 A;  5HVF A;  2ZEM A;  2J9A A;  1CM0 A;  3D66 A;  3KKW A;  2B3U A;  2B58 A;  4NCZ A;  1VHO A;  2CNM A;  1IID A;  2GE3 A;  4MY0 A;  1S5K A;  4FAI A;  1KUX A;  2BEI A;  3W91 A;  1IOF A;  3IGR A;  4JZ0 A;  4CAX A;  1ZO0 A;  4UBR A;  3C26 A;  5LRG A;  3W6S A;  4CYQ A;  1YW4 A;  1I1D A;  2FE7 A;  4QBJ A;  4M6H A;  2Z3M A;  4CGN A;  4CGM A;  4AXV A;  2CXA A;  4OC5 A;  1HDU A;  2PSW A;  3H8G A;  3PFE A;  4LQ6 A;  1XMT A;  2WSA A;  4P4E A;  4CGP A;  4P6Y A;  4XPK A;  4Q7A A;  3RO0 A;  3W6X A;  3IU1 A;  4KSF A;  3NFZ A;  4NGS A;  1NMT A;  2FIW A;  2I00 A;  3F8K A;  4OME A;  1LOK A;  3SJE A;  1Y7E A;  2RFH A;  5JH9 A;  1KZF A;  3DR6 A;  3MN8 A;  3ISZ A;  3GB0 A;  3WC5 A;  3FNC A;  4RUH A;  5HVG A;  1YSJ A;  1TIQ A;  1XEB A;  4CYP A;  3H5Z A;  1Y7R A;  4JD6 A;  5A27 A;  4K3N A;  8CPA A;  1QQ9 A;  3PB8 X;  4KOU A;  4R3K A;  1IGB A;  3ZJ0 A;  3D3S A;  1BPN A;  3ISX A;  1M44 A;  4MRI A;  4OID A;  4II9 A;  1S7N A;  2PQ8 A;  2R7H A;  4KOY A;  2PJ9 A;  5KTD A;  2VL1 A;  4FD5 A;  3TTH A;  4Q38 A;  5J1Q A;  4L89 A;  2QML A;  2DPT A;  4UWI A;  4FD6 A;  3IWW A;  1XBU A;  3EFA A;  4R7M A;  4P45 A;  2Q4Z A;  2DEA A;  3N5F A;  4MFQ A;  2PJ2 A;  4Y49 C;  2IJZ A;  4H89 A;  4C7H A;  2VI7 A;  4X5K A;  1ZG7 A;  1S7K A;  1DE4 C;  1OZP A;  2C27 A;  4MY3 A;  4C7I A;  4CRZ B;  2EVN A;  4LUA A;  2ATR A;  2Q7S A;  4E0A A;  4Y49 B;  1Q2Y A;  1XFO A;  3D2P A;  4IK2 A;  3KR5 A;  3B35 A;  4UA3 A;  3T90 A;  4F8Z A;  4K30 A;  4CPA A;  4EME A;  2O28 A;  2WPX A;  4A95 A;  5JQ4 A;  5K8N A;  4NJQ A;  1Z4E A;  4PQA A;  3GUX A;  1WWZ A;  2IL4 A;  4KUA A;  3T8W A;  4EVY A;  3GIU A;  4PK2 A;  3P2H A;  3KGQ A;  2CY2 A;  4UCN A;  3KZW A;  3NH8 A;  4KLW A;  4BIN A;  3BI1 A;  4OC3 A;  1AYE A;  3VH9 A;  3TC8 A;  5F49 A;  1PU9 A;  2PIZ A;  1TF9 A;  4KSA A;  4MHZ A;  4R6T A;  2EO8 A;  4B14 A;  1SQH A;  1IIC A;  5HVH A;  2GLJ A;  4B6Z A;  5C82 A;  3S9N A;  2BL1 A;  4P4B A;  2WUU A;  3KI9 A;  4MHP A;  1M4G A;  2Q04 A;  2WPW A;  1XMB A;  3A9L A;  4Q36 A;  2FT0 A;  2PRQ A;  2DPS A;  4J3G A;  3T9Y A;  3TOB A;  1ELL P;  2AFM A;  4MCR A;  1PCA A;  4NGN A;  3H8F A;  3H8E A;  4FD7 A;  5HXD A;  2PJ6 A;  3PB4 X;  3R95 A;  2G3T A;  3KHZ A;  3KQZ A;  3PP9 A;  4RI1 A;  4DYO A;  2ZEN A;  4BMH A;  2ZOG A;  5JPH A;  3EO4 A;  2RC4 A;  3WT4 A;  1S7L A;  2PRB A;  5HH1 A;  3PBB A;  1KUV A;  2RB7 A;  2VZZ A;  2YNC C;  4UFV A;  1YX0 A;  5D8N A;  4ZX9 A;  4UCM A;  4A2Z A;  2NMT A;  4DNC A;  2EK9 A;  5EMI A;  5H84 A;  3TO9 A;  2I79 A;  2IMO A;  2YGW A;  3LOD A;  3CDX A;  3SI0 A;  1JWQ A;  4YFJ A;  1F2P A;  4BD9 A;  5G22 A;  4MFZ A;  4UEF A;  3EXN A;  1AMP A;  2PDO A;  2F8H A;  1GHE A;  1Z8T A;  3BJ8 A;  3RAM A;  4AVA A;  3HLP A;  5IB9 A;  4GS4 A;  1FT7 A;  3R1K A;  3G8W A;  1JQG A;  4MJ8 A;  5DS0 A;  3I3G A;  4PSX A;  3B3C A;  1UWY A;  3TE4 A;  1P4N A;  1H8L A;  3IWE A;  2C6P A;  2ODF A;  3PEI A;  4NF1 A;  4NGT A;  3OWC A;  4JJX A;  2Y0M A;  3I1U A;  3BHX A;  4OIW A;  2PJ1 A;  3CT9 A;  3FEC A;  2H5M A;  4H2K A;  1HDQ A;  1PYT B;  1VHE A;  1IOI A;  3FEE A;  5ELY A;  3B3W A;  4ZY1 A;  5I4M A;  4GXH A;  2PCU A;  4M85 A;  1CP7 A;  2AFX A;  2Q4Y A;  4PXE A;  3GLJ A;  4AB7 A;  1WK4 A;  4NFR A;  3I9S A;  4Z65 A;  4NGR A;  2C6C A;  2Q51 A;  1IYK A;  3V8I A;  2PJ4 A;  5CPA A;  3FRM A;  2JEW A;  2QIR A;  2YNC A;  1Y0Y A;  5CBM A;  1CPX A;  1CX8 A;  3S6F A;  4B12 A;  2V77 A;  2EK8 A;  4MCP A;  4KVM E;  5JM6 A;  5FVJ A;  1P0H A;  1BO4 A;  3BLN A;  4UF4 A;  4F9U A;  1LAM A;  2WZN A;  5GCN A;  4OP4 A;  2BSW A;  1QSN A;  2ZEE A;  2HV2 A;  4MHN A;  5LRK A;  3CXQ A;  2K5T A;  3TCV A;  4PXC A;  5K8M A;  3HUV A;  4MFK A;  1BOB A;  4LQG A;  2NSM A;  5THW A;  3TOA A;  3ZZI A;  5BWA B;  3KL9 A;  4KLV A;  4E2A A;  4P4F A;  3GYA A;  4FBE A;  4ZGY B;  4UWJ A;  3DLJ A;  5AG5 A;  2PC1 A;  1S7F A;  4QB9 A;  5AG7 A;  3PBE A;  3B2Y A;  3FJU A;  1EE3 P;  4A33 A;  4WWV A;  2YNE A;  4A30 A;  4C2Z A;  1YR0 A;  3S9M A;  3JVN A;  2P6F A;  2X7B A;  3B8G A;  3DSB A;  3PB7 X;  4KS9 A;  1XE4 A;  4IAV A;  4R87 A;  2REE A;  2Z10 A;  4L8A A;  2PJ0 A;  1IYL A;  4H6Z A;  5F48 A;  4C2X A;  2F5I A;  2Z3O A;  4ZY2 A;  1TXR A;  3MRU A;  3TX8 A;  2ZED A;  2GIV A;  4TNU A;  1NSA A;  3B7I A;  4OC4 A;  4KVX A;  1S3Z A;  3TFY A;  3EY5 A;  1CG2 A;  1QSM A;  3F0A A;  4FWU A;  1QST A;  1B87 A;  5F09 A;  1MJ9 A;  2PJ5 A;  5K8O A;  3QNV A;  2PJA A;  3TO6 A;  4U9Z A;  4RS2 A;  3WAB A;  4MHD A;  2J8R A;  4ONW A;  2PJ3 A;  5LYL A;  1XRY A;  2GAN A;  3JUW A;  3LWU A;  4ORF A;  3TT2 A;  4PPZ A;  1ELM P;  3DGV A;  1LRZ A;  1IB1 E;  4QVT A;  2V8D A;  3VWE A;  1L0C A;  1Z4R A;  4DUK A;  2OOT A;  4OKO A;  1ARM A;  1LCP A;  1MJA A;  1CP6 A;  3FF3 A;  2FVG A;  4XNH C;  2Z11 A;  4CGO A;  4MCS A;  1QSO A;  2OH1 A;  5D29 A;  2V8V A;  4NSQ A;  2ZW5 A;  3VAR A;  2FS5 A;  3D68 A;  4R76 A;  5F47 A;  1CBX A;  3L2N A;  2OU2 A;  4XNH B;  4A39 A;  4YRH A;  5AG6 A;  4A94 A;  5I0C A;  1Q2C A;  2C6G A;  2D4O A;  1X12 A;  3B3T A;  4HKF A;  4P4I A;  5G20 A;  2PE3 A;  4A38 A;  1TKF A;  2VBQ A;  2XEF A;  2ZEO A;  4CS0 B;  3NE7 A;  2CF4 A;  4P44 A;  3WC7 A;  3CXS A;  3SHP A;  1B6B A;  2Q44 A;  2Z3P A;  2PR1 A;  4F9V A;  4M6I A;  3LMS A;  4E8O A;  1CPS A;  2B4D B;  2QVP A;  4RN7 A;  4XPD C;  1ZG8 A;  1ZLI A;  3VAT A;  5LRJ A;  2BO9 A;  3D4U A;  4UFW A;  2AFU A;  2R8V A;  3KHX A;  4FUU A;  4W9Y A;  1FNO A;  4PV6 A;  5IX3 A;  4OC0 A;  2ZW4 A;  3PB6 X;  1YLO A;  5HMN A;  2JEV A;  2G0B A;  4XPD B;  2P0W A;  5EC4 A;  2B5G B;  4AG9 A;  4KVO E;  2VEZ A;  4YGO A;  2DF5 A;  2AE6 A;  3RNZ A;  4GM5 A;  2JDC A;  1X10 A;  3JTK A;  5EBV A;  5KTA A;  4U9Y A;  2FXF A;  1ZG9 A;  4EFD A;  1VHS A;  1Z2L A;  4LX9 A;  1Y0R A;  2EWB A;  4OLL A;  3BXM A;  3G3S A;  1NSL A;  4B11 A;  2PJB A;  5IV0 A;  3IIB A;  2EUI A;  3FH4 A;  1S60 A;  5F46 A;  4F0X A;  2D4P A;  3FIX A;  4PXD A;  3IU2 A;  3PFO A;  3KAS A;  3K2K A;  5A28 A;  2BOA A;  3D2M A;  2B4D A;  2Q4V A;  2XEJ A;  1M4D A;  4KOV A;  2WYR A;  4MMO A;  4IHM A;  3IWG A;  3D7F A;  2ZOF A;  3PB9 X;  4MBU A;  4KOX A;  2ZPA A;  1A2Z A;  4B13 A;  4HNW B;  1M4L A;  3CXP A;  2CNS A;  4OC2 A;  1VGY A;  1Z9U A;  4PXB A;  3FXT A;  5H86 A;  3S6G A;  3SJF A;  4OC1 A;  3SXN A;  4ZYQ A;  3D7G A;  2GFQ A;  4OAE A;  2HC9 A;  3EC4 A;  3S6K A;  4DJL A;  1FY7 A;  2Z0Z A;  3CPX A;  1MK4 A;  2NYQ A;  3MGD A;  3D7H A;  4QUS A;  4G1P A;  3D8P A;  2AFZ A;  2JLM A;  1YVO A;  3QAH A;  4TWE A;  1I12 A;  1YVK A;  2YND A;  2F7V A;  4CRY B;  4R3L A;  4B5P B;  7CPA A;  1YME A;  1Z8X A;  2POK A;  4P4J A;  1QMU A;  2FL4 A;  5IB0 A;  5AGE A;  1ZLH A;  2J8N A;  2PVW A;  2QYV A;  4IF5 A;  4UEZ A;  1RTQ A;  1YLE A;  1Z8W A;  2PJ8 A;  4UEE A;  2OR4 A;  4H6U A;  1YK3 A;  4R9M A;  1R43 A;  1OBR A;  4QC6 A;  2ZEL A;  2CTC A;  3IC1 A;  3PRT A;  4ZX8 A;  1Z5R A;  3DDD A;  4F0Y A;  5AG4 A;  2ARH A;  4MHY A;  1MJB A;  1Z8L A;  3D7D A;  4B10 A;  4CAW A;  3BJ7 A;  2VXK A;  4WJB A;  4CAF A;  4XPL A;  2B4B A;  2FCK A;  2G3A A;  4HPS A;  4KOS A;  3KR4 A;  4CAV A;  4JXR A;  3S9L A;  5DWM A;  3R9G A;  1VKC A;  3PZJ A;  5J8F A;  2V8H A;  2PVV A;  5J8C A;  2I3C A;  3KQX A;  2HUZ A;  2OZH A;  4B5P A;  3FX6 A;  2P6G A;  2Q7B A;  4EWT A;  2ZEP A;  2Q0Y A;  3CZX A;  1J4J A;  3VWD A;  3SJX A;  1UFH A;  2ZEF A;  4UCP A;  1LFW A;  3SXO A;  1N71 A;  3FVL A;  2G9D A;  4BBH A;  1K4J A;  4ZI6 A;  2XEI A;  3TO7 A;  4UIA A;  2VZY A;  4A31 A;  4HNX B;  2O4H A;  2OZU A;  3GY9 A;  4X8I A;  2GU2 A;  4MFJ A;  4CAE A;  3DNS A;  4UIB A;  4MFP A;  4ONU A;  4C2Y A;  4U5Y A;  1DTD A;  2QJ8 A;  1ARL A;  3H4Q A;  4NGQ A;  4CGL A;  3V38 A;  5LYF A;  1BLL E;  5K8P A;  1IU8 A;  3R9F A;  2PR8 A;  2R1I A;  3QAY A;  2JDD A;  2CNT A;  3LD2 A;  5LYI A;  2AFO A;  2PJ7 A;  4M3S A;  2OB0 A;  4R57 A;  2AFS A;  3R9E A; 
#chains in the Genus database with same CATH homology
 4KUB A;  5C88 A;  1Y9W A;  4A32 A;  1RXT A;  3R96 A;  1V0C A;  4MFL A;  3K9U A;  3FB3 A;  2OZG A;  4KOT A;  5KTC A;  2FIA A;  3RYO A;  2ZW6 A;  4NXY A;  4AVB A;  4NEX A;  4OAD A;  3DR8 A;  1Q2D A;  1ON0 A;  4IUS A;  3N7Z A;  4KOR A;  3PGP A;  2REF A;  5G1Z A;  1R57 A;  1PUA A;  4I49 A;  2Z3K A;  3E0K A;  1XF8 A;  3UY5 A;  2DXQ A;  3GKR A;  2Z3L A;  4JWP A;  4B5O A;  2ZW7 A;  3P2F A;  4MI4 A;  1U6M A;  4UFX A;  5G21 A;  1KUY A;  4AVC A;  2VQY A;  4CYO A;  4F6A A;  1M1D A;  4C68 A;  2KCW A;  2AJ6 A;  5CNP A;  2P6E A;  4JLY A;  2HQY A;  2Z3N A;  4PK3 A;  3WR7 A;  4HNY B;  1RO5 A;  1M4I A;  2B5G A;  1QSR A;  3F5B A;  3FBU A;  2A4N A;  1CJW A;  4PSW A;  5E96 A;  1NE9 A;  1YRE A;  1I21 A;  4CYN A;  3FYN A;  4FD4 A;  4JXQ A;  5DWN A;  2R98 A;  4AG7 A;  1XIX A;  4ZBG A;  1Y9K A;  2BUE A;  4KZT A;  1YGH A;  3QB8 A;  2J8M A;  4KOW A;  2FSR A;  5ISV A;  2B3V A;  2QEC A;  2ZXV A;  1CM0 A;  3KKW A;  2B3U A;  2B58 A;  4NCZ A;  2CNM A;  1IID A;  2GE3 A;  4MY0 A;  1S5K A;  1KUX A;  2BEI A;  3W91 A;  3IGR A;  4CAX A;  1ZO0 A;  4UBR A;  3C26 A;  3W6S A;  4CYQ A;  2FE7 A;  1I1D A;  4QBJ A;  4CGN A;  2Z3M A;  4CGM A;  2CXA A;  2PSW A;  1XMT A;  2WSA A;  4CGP A;  4XPK A;  3W6X A;  3IU1 A;  4KSF A;  1NMT A;  2FIW A;  2I00 A;  3F8K A;  1KZF A;  3DR6 A;  3FNC A;  1TIQ A;  1XEB A;  4CYP A;  3H5Z A;  1Y7R A;  4JD6 A;  5A27 A;  4KOU A;  4R3K A;  3ZJ0 A;  3D3S A;  1M44 A;  4II9 A;  1S7N A;  2PQ8 A;  2R7H A;  4KOY A;  5KTD A;  4FD5 A;  3TTH A;  4Q38 A;  4L89 A;  2QML A;  2DPT A;  4UWI A;  4FD6 A;  3EFA A;  4MFQ A;  4Y49 C;  4H89 A;  4C7H A;  2VI7 A;  4X5K A;  1S7K A;  1OZP A;  2C27 A;  4MY3 A;  4C7I A;  2EVN A;  4LUA A;  2ATR A;  4E0A A;  4Y49 B;  1Q2Y A;  3T90 A;  3D2P A;  4UA3 A;  4K30 A;  2O28 A;  2WPX A;  4A95 A;  5JQ4 A;  1Z4E A;  1WWZ A;  2IL4 A;  4KUA A;  4EVY A;  4PK2 A;  3P2H A;  2CY2 A;  4UCN A;  4KLW A;  5F49 A;  1PU9 A;  4KSA A;  4B14 A;  1SQH A;  1IIC A;  5C82 A;  2BL1 A;  2WUU A;  1M4G A;  2Q04 A;  2WPW A;  3A9L A;  4Q36 A;  2FT0 A;  2DPS A;  4J3G A;  3T9Y A;  3TOB A;  4FD7 A;  3R95 A;  2G3T A;  3PP9 A;  4RI1 A;  4BMH A;  5JPH A;  3EO4 A;  2RC4 A;  1S7L A;  2PRB A;  5HH1 A;  1KUV A;  2VZZ A;  4UFV A;  2YNC C;  1YX0 A;  4UCM A;  4A2Z A;  2NMT A;  4DNC A;  5H84 A;  3TO9 A;  2I79 A;  3LOD A;  2YGW A;  4YFJ A;  5G22 A;  4MFZ A;  3EXN A;  2PDO A;  3BJ8 A;  1GHE A;  4AVA A;  4GS4 A;  3R1K A;  3G8W A;  4MJ8 A;  3I3G A;  4PSX A;  3TE4 A;  1P4N A;  3IWE A;  4NF1 A;  3OWC A;  4JJX A;  2Y0M A;  2H5M A;  4M85 A;  2Q4Y A;  4AB7 A;  1WK4 A;  3I9S A;  3V8I A;  1IYK A;  3FRM A;  2QIR A;  2YNC A;  3S6F A;  4B12 A;  4KVM E;  5FVJ A;  1P0H A;  1BO4 A;  3BLN A;  5GCN A;  2BSW A;  1QSN A;  2HV2 A;  3CXQ A;  2K5T A;  3TCV A;  4MFK A;  3TOA A;  1BOB A;  3ZZI A;  5BWA B;  4KLV A;  4E2A A;  3GYA A;  4ZGY B;  4UWJ A;  5AG5 A;  2PC1 A;  1S7F A;  4QB9 A;  5AG7 A;  4A33 A;  4A30 A;  2YNE A;  4C2Z A;  1YR0 A;  3JVN A;  2P6F A;  2X7B A;  3B8G A;  3DSB A;  4KS9 A;  3S6H A;  1XE4 A;  4R87 A;  2REE A;  2Z10 A;  4L8A A;  4C2X A;  1IYL A;  4H6Z A;  5F48 A;  2F5I A;  2Z3O A;  2GIV A;  4KVX A;  1S3Z A;  3TFY A;  3EY5 A;  1QSM A;  3F0A A;  1QST A;  1B87 A;  1MJ9 A;  3TO6 A;  4U9Z A;  4RS2 A;  4MHD A;  2J8R A;  3JUW A;  2GAN A;  4ORF A;  3TT2 A;  1LRZ A;  1IB1 E;  4QVT A;  3VWE A;  1L0C A;  1Z4R A;  1MJA A;  4XNH C;  2Z11 A;  4CGO A;  1QSO A;  2OH1 A;  4NSQ A;  2ZW5 A;  2FS5 A;  5F47 A;  2OU2 A;  4XNH B;  4YRH A;  5AG6 A;  5I0C A;  1Q2C A;  2D4O A;  4HKF A;  5G20 A;  2VBQ A;  4CS0 B;  3NE7 A;  3CXS A;  3SHP A;  1B6B A;  2Q44 A;  2Z3P A;  2PR1 A;  4E8O A;  2B4D B;  4XPD C;  4UFW A;  2R8V A;  4PV6 A;  5IX3 A;  2ZW4 A;  5HMN A;  2JEV A;  2G0B A;  4XPD B;  2P0W A;  5EC4 A;  2B5G B;  4AG9 A;  4KVO E;  2VEZ A;  4YGO A;  2AE6 A;  2JDC A;  3JTK A;  5EBV A;  5KTA A;  4U9Y A;  2FXF A;  1VHS A;  4OLL A;  4LX9 A;  1NSL A;  3G3S A;  4B11 A;  5IV0 A;  2EUI A;  1S60 A;  5F46 A;  4F0X A;  2D4P A;  3FIX A;  3IU2 A;  5A28 A;  3D2M A;  2B4D A;  2Q4V A;  1M4D A;  4KOV A;  3IWG A;  4MBU A;  4KOX A;  2ZPA A;  4B13 A;  4HNW B;  3CXP A;  2CNS A;  4CRZ B;  1Z9U A;  5H86 A;  3S6G A;  3FXT A;  3SXN A;  4OAE A;  3EC4 A;  3S6K A;  1FY7 A;  2Z0Z A;  1MK4 A;  3MGD A;  4QUS A;  3D8P A;  2JLM A;  1YVO A;  3QAH A;  1I12 A;  1YVK A;  2YND A;  4CRY B;  4R3L A;  4B5P B;  2FL4 A;  5IB0 A;  5AGE A;  4IF5 A;  2J8N A;  1YLE A;  4H6U A;  1YK3 A;  4R9M A;  4QC6 A;  5AG4 A;  3DDD A;  4F0Y A;  2ARH A;  1MJB A;  4B10 A;  4CAW A;  3BJ7 A;  2VXK A;  4CAF A;  4XPL A;  2B4B A;  2FCK A;  2G3A A;  4KOS A;  4CAV A;  4JXR A;  5DWM A;  3R9G A;  1VKC A;  3PZJ A;  5J8F A;  5J8C A;  2HUZ A;  2OZH A;  4B5P A;  2P6G A;  2Q7B A;  2Q0Y A;  1J4J A;  3VWD A;  1UFH A;  3SXO A;  4UCP A;  1N71 A;  4BBH A;  1K4J A;  3TO7 A;  2VZY A;  4A31 A;  4HNX B;  2OZU A;  3GY9 A;  4MFJ A;  4CAE A;  3DNS A;  4C2Y A;  4MFP A;  4ONU A;  4U5Y A;  3H4Q A;  4CGL A;  3R9F A;  2PR8 A;  2R1I A;  2JDD A;  2CNT A;  3LD2 A;  4M3S A;  2OB0 A;  4R57 A;  3R9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...