3CZXA

The crystal structure of the putative n-acetylmuramoyl-l-alanine amidase from neisseria meningitidis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
AMSKIICLTAGHSNTDPGAVNGSDREADLAQDMRNIVASILRNDYGLTVKTDGTGKGNMPLRDAVKLIRGSDVAIEFHTNAAANKTATGIEALSTPKNKRWCQVLGKAVAKKTGWKLRGEDGFKPDNAGQHSRLAYAQAGGIVFEPFFISNDTDLALFKTTKWGICRAIADAIAMELGAAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative N-acetylmuramoyl-L-alanine amidase
publication title The crystal structure of the putative N-acetylmuramoyl-L-alanine amidase from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis mc58
total genus 66
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 3czxA00
4LQ6A 1JWQA 4RN7A 5EMIA 2ODFA 2Q7SA 4BINA 4M6HA 3CZXA 1XOVA 3QAYA 4M6IA 4M6GA 3NE8A
chains in the Genus database with same CATH superfamily
2J8MA 2WUUA 2RFHA 4F0XA 3BI0A 4BD9A 3QAHA 2VZYA 2OZHA 4JD6A 4MFLA 1Z9UA 2JLMA 3P2FA 5LRJA 1M4GA 2HV2A 1QSOA 5LYFA 1TIQA 3SJFA 3KGQA 3NA6A 4ZI6A 1ZLIA 2Q44A 4JZ0A 3GYAA 1KZFA 3IEHA 3S6GA 1YMEA 1YR0A 2C6GA 4X5KA 1WWZA 3F5BA 5FVJA 4CRYB 3PRTA 4KSIA 4B6ZA 3KI9A 4NJQA 2XEFA 3T9YA 2Z3LA 2ABZA 2Z3OA 4FD7A 4MCPA 2B5GB 1XF8A 2WPWA 2ZEDA 3FF3A 4A94A 4FAIA 3GY9A 3FXTA 4R57A 3DR8A 5D8NA 2B3UA 5ELYA 5JPHA 3H5ZA 2Z3PA 3H8GA 4QC6A 4BMHA 2PJ3A 3FNCA 4CGLA 3D4UA 5E96A 1PCAA 1XE4A 4R6TA 3R9EA 3V8IA 4CAVA 1FY7A 1TF9A 1YK3A 4YFJA 2B4BA 2C6PA 1IU8A 2AFXA 5JQ4A 2OZUA 1XBUA 1I1DA 3W6SA 2F5IA 4A30A 4F6AA 2XEGA 2AFWA 2GFQA 1Y7RA 1HDQA 1CG2A 4R7MA 1CM0A 2B58A 1XRYA 4FBEA 2AFOA 1R43A 4CAXA 2PIZA 3KHZA 5HVFA 3SXOA 1Z2LA 5EBVA 2ZEMA 1S7FA 4PXDA 2WYRA 2EVNA 3N7ZA 4ZY2A 5F47A 4X8IA 1FT7A 2Q4YA 4H6ZA 5LRGA 3DSBA 4UWIA 1IOIA 1IY7A 4I49A 4TWEA 2I79A 5ISVA 2GLJA 3TT2A 4CRZB 4ONWA 5K8PA 1JQGA 3PBEA 4MBUA 2FXFA 2AFZA 3WT4A 3CDXA 3EFAA 5IB0A 3RNZA 2REFA 4LX9A 2WPXA 4PK3A 2QYVA 4KZTA 3FVLA 4XPLA 2I00A 3FRMA 2PDOA 3S9NA 4B5PB 2CTBA 4KOUA 2KCWA 4M6GA 1VIXA 1NMTA 1P4NA 2VI7A 5C82A 4KSFA 1X10A 4MFQA 2ZELA 4MHYA 4R76A 3SXNA 4B10A 3D66A 3FYNA 5G20A 4BINA 2O28A 5LYLA 2B4DA 2PJ4A 4ZY1A 4A33A 1IIDA 4UIBA 1PYTB 4OAEA 1J4JA 8CPAA 3CXPA 4UBRA 2OOTA 2IQ6A 1MJ9A 4MJ8A 2IMOA 3KHXA 4OC5A 2EK9A 2PR1A 4UIAA 4KOXA 5CBMA 2H5MA 2Z3MA 2Q7BA 3TOAA 4A2ZA 2ZEGA 4B14A 1AUGA 3DR6A 5HVGA 2OH1A 2I3CA 2AFSA 3KQZA 3QB8A 2EUIA 2F8HA 1DE4C 4CAFA 2PJ5A 2Q4VA 4E8OA 4BBHA 1L0CA 5CNPA 4KORA 4G1PA 5F09A 2JBKA 4MI4A 4CGOA 5JGFA 2PJ1A 2JBJA 3D2PA 4GM5A 3V7ZA 3K9UA 2G3AA 2OR4A 3WABA 4QVTA 1XMBA 1X12A 4NGMA 4UCNA 1ARMA 1YQEA 3IU1A 4MCRA 3BJ8A 1S3ZA 1IYKA 4PXCA 3GKRA 5DS0A 1TKJA 3I3GA 1VHSA 3JTKA 1TKHA 3SJEA 2OU2A 1RXTA 2NYQA 3R95A 5K8OA 2V8HA 1UWYA 3GB0A 2BL1A 1U6MA 2ZW6A 3GIUA 4M85A 4C7IA 2FL4A 2FS5A 3S6FA 1BPMA 3IO1A 3TO7A 1OZPA 4MXUA 3JUWA 3LACA 4B5OA 3FX6A 1CPSA 4P4EA 5F46A 1K4JA 3EC4A 2ZW5A 2V8DA 1M44A 5LRKA 4FWUA 1YSJA 4ZBGA 1XOVA 3R96A 1KWMA 2WZNA 4Y49B 4FD6A 5JM6A 1S7KA 1EE3P 2FCKA 3D67A 1QSMA 1IGBA 4KOYA 3NH4A 4MFKA 3JVNA 1KUYA 2JDCA 3B8GA 3CPAA 7CPAA 2PJCA 4WWVA 3PB7X 1F57A 1F2PA 2ZENA 4W9YA 5DWNA 3RYOA 4CPAA 4P10A 5LYDA 1JWQA 2Q04A 5AG6A 4AG7A 4LQGA 2R98A 4XNHC 2Q43A 1S7LA 2GLFA 4M6IA 3R9GA 4UCPA 3K9TA 1RTQA 2ZPAA 1UFHA 1XMTA 3CPXA 4B12A 1LOKA 1MJAA 1PU9A 5J8CA 1CBXA 4IK2A 4NGPA 3B35A 4F9UA 1XFOA 4UF4A 1BPNA 2FVGA 4PK2A 1VHEA 1M4IA 2EBJA 1RO5A 3TTHA 3EO4A 2JEVA 3B2YA 5KTDA 4OC3A 4J3GA 2ARHA 3MRUA 4XPDC 1ELLP 1V0CA 1YW6A 1ZLHA 3FB3A 3TOBA 4AXVA 2IL4A 1LFWA 5LYIA 4AG9A 4AVAA 2PVVA 2PRQA 4JXRA 2PSWA 2G9DA 4NCZA 4YU9A 1N71A 4C68A 2A4NA 4KSAA 2HUZA 2QJ8A 2CNTA 3TO9A 2B4DB 3A9LA 3KQXA 2QIRA 4Z65A 4O23A 2PJAA 2PJ0A 2ZEFA 1Z5RA 1CP7A 3P2HA 4MMOA 2R8VA 2J8NA 1XEBA 1I12A 2JDDA 2CTCA 2NMTA 1Z4RA 2ODFA 3D7DA 1R57A 1KUXA 2WSAA 3PB9X 4P4BA 2REEA 4QUSA 3GLJA 3H8FA 2BOAA 3FEEA 2RC4A 3VATA 3B3SA 1LAMA 3DNSA 3PBBA 2CXAA 3TE4A 3B3VA 2PQ8A 4NF1A 4P4IA 5DWMA 1MJBA 4KUBA 1WK4A 2BSWA 3KR5A 4DNCA 5HXDA 4PPZA 1S60A 1P0HA 2BO9A 4FD4A 3S9LA 4UCMA 1YW4A 3K2KA 2OZGA 3IFEA 3FBUA 3KZWA 2GANA 3CT9A 3BI1A 1Z8XA 4OADA 1CJWA 4C2XA 1H8LA 1QSNA 2Y0MA 5THWA 4MCQA 2Z11A 1KUVA 1BLLE 3DDDA 2HC9A 3BXMA 2HQYA 1ELMP 4KS9A 1NSLA 1VHOA 4FD5A 1VGYA 1TF8A 4LQ6A 1M1DA 4K30A 4NGRA 4PXEA 5G21A 3FJUA 4OP4A 4B13A 1IOFA 4PV6A 4DYOA 3W6XA 2CIJA 2Q0YA 2YNCC 2V8VA 3EXNA 3MN8A 4OIDA 5EC4A 5GCNA 4GS4A 1Q2YA 1QMUA 4X3RA 4CGMA 3V38A 4UFXA 1S7NA 2PE3A 4DJLA 3BHXA 3BLNA 4IAVA 2EWBA 3SJXA 3D8PA 4QBJA 2CNMA 4HKFA 3MGDA 4UEEA 2C6CA 2POKA 4KUAA 2FIAA 3VH9A 2VZZA 2AFUA 1YLEA 2YNCA 3ISXA 2C27A 5K8MA 2BEIA 5H84A 3CXSA 3RBUA 3NFZA 3RO0A 1Q2DA 1GHEA 3PEIA 4P45A 1ZO0A 3L2NA 3LWUA 4M3SA 4XPKA 3ZZIA 4EWTA 3T8WA 1ARLA 4RS2A 4UWJA 4TNUA 4CYNA 3CZXA 3QAYA 3HLPA 5HH1A 2X7BA 1AMPA 2BCOA 4II9A 4MCSA 2AE6A 2V8GA 2ZW4A 5F49A 1CPXA 2DF5A 2PCUA 3PB4X 4UEZA 3PP9A 1R3NA 3ISZA 3BJ7A 1B87A 1I21A 2O53A 2ZEOA 5C88A 3WC7A 5K8NA 2HB6A 2XEJA 3QNVA 4KOSA 3R9FA 4JYWA 2PR8A 4OC2A 4MHPA 3WR7A 5AG5A 2PJ9A 2ZXVA 1CX8A 2QECA 4PQAA 4CAEA 1HDUA 2PC1A 2Q51A 1NE9A 4RI1A 4UEFA 3PFOA 3B3CA 4R3LA 6CPAA 4B5PA 4UFWA 1YVKA 2Z0ZA 2DEAA 1Q2CA 3IJ3A 1HEEA 1Z8WA 1A2ZA 5G22A 4JXQA 4AVBA 4KVXA 2ZOGA 2DPSA 3KKWA 1YLOA 4P4JA 4MHDA 1NSAA 1QSTA 3D68A 4B11A 1TXRA 2P0WA 3SHPA 3S6HA 4E0AA 3PB6X 3VWEA 2P6FA 4Q38A 1LRZA 4NSQA 1Y9KA 1M4DA 1ZG8A 3RAMA 4P6YA 4HNWB 4AB7A 2V77A 2AJ6A 4WJBA 3CXQA 1TKFA 5CPAA 4YRHA 4A31A 3PB8X 1Z4EA 2VL1A 1ON0A 1VKCA 1BO4A 2ZW7A 3PGPA 4OMEA 4CGPA 3NH5A 3G8WA 3WC5A 2Q4ZA 2DPTA 4H89A 5J8FA 4JWPA 4CGNA 2AFMA 2PJ2A 4A95A 2EO8A 5HVHA 4CS0B 4JJXA 1LANA 4PSXA 1DTDA 3PZJA 4YWYA 3D7HA 1Y7EA 1B6BA 4OC0A 4HNYB 4E2AA 4R87A 4X2TA 3IGRA 4NXYA 2FT0A 4EMEA 3NE7A 3SI2A 2GU2A 3B3WA 4MFPA 4OKOA 1PUAA 4C2ZA 3D2MA 3KASA 3LMSA 2CY2A 4NGQA 4QB9A 2J9AA 1Q7LA 2R1IA 3C26A 2EK8A 4P4FA 4MRIA 5H86A 1XJOA 1Z8TA 3T90A 1CP6A 4EFDA 4PXBA 4Y49C 3S9MA 3TX8A 4OC4A 5JH9A 2C1CA 2P6GA 4MY0A 1F2OA 4HPSA 3JRUA 5KTAA 2D4OA 3NE8A 4R8FA 4PSWA 4R9MA 2K5TA 4OLLA 1ZG9A 3VWDA 5BWAB 4CYPA 3D7GA 4ZX9A 3ZJ0A 2OB0A 4P44A 2VQYA 3I1UA 4EVYA 1YGHA 4OC1A 3F8KA 4RUHA 3KL9A 3WC6A 3RZAA 3I9SA 4KOVA 4H2KA 4ORFA 4MFZA 3H4QA 3B7IA 4ZY0A 3N5FA 1YVOA 5A27A 4Q7AA 5D29A 3SI0A 3IWGA 2PIYA 3TC8A 3TCVA 5IB9A 1ZG7A 4F8ZA 4NGNA 5A28A 2ATRA 4DUKA 2VEZA 5AGEA 4IUSA 2QMLA 3FH4A 1AYEA 2PVWA 4NGTA 4F0YA 4L89A 1IYLA 2B5GA 2IJZA 2YGWA 3F0AA 2F7VA 2CNSA 2FSRA 5F48A 2ZEEA 1LCPA 2ZOFA 4U9ZA 2ANPA 2O4HA 3TO6A 4IHMA 1LAPA 2DXQA 4KVME 3DGVA 1IB1E 2D4PA 3IWEA 3SI1A 4ZYQA 3OWCA 4KVOE 4JLYA 3TFYA 1OBRA 4M6HA 2Z10A 4KLVA 4KOWA 5G1ZA 4C2YA 1BAVA 3H8EA 4RN7A 4U5YA 4IF5A 2Q7SA 4NGSA 5J1QA 1SQHA 1IICA 4NJRA 4C7HA 5IX3A 2PJBA 1YREA 3LODA 3SJGA 3UY5A 5I4MA 2RB7A 1QQ9A 3IIBA 3R1KA 3S6KA 5I0CA 1XIXA 1GYTA 3IC1A 2G3TA 4GXHA 4HNXB 2J8RA 4LUAA 3E0KA 3FIXA 2BUEA 3LD2A 1S5KA 3D7FA 4ZGYB 4KLWA 1YX0A 4YGOA 3DLJA 3PFEA 2NSMA 2VXKA 2PRBA 4MHZA 4Q36A 4A37A 4F9VA 2QVPA 4A32A 2P6EA 2GIVA 3IWWA 4NEXA 1QSRA 2PJ8A 3B3TA 2YNEA 3G3SA 5AG7A 4NFRA 3HUVA 4L8AA 4XNHB 5EMIA 4MHNA 4A38A 2FE7A 2G0BA 3FEDA 2JEWA 2VBQA 3FMCA 2ZEHA 4H6UA 5KTCA 2Z3NA 1BOBA 4R3KA 4AVCA 3EY5A 2GREA 1MK4A 3GUXA 5IV0A 2ZEPA 4MY3A 4ZX8A 4KOTA 2XEIA 1Z8LA 2FIWA 2R7HA 5HMNA 4K3NA 3D3SA 4U9YA 2YNDA 4UA3A 1FNOA 4FUUA 4CAWA 4A39A 2PJ6A 2CF4A 1M4LA 4UFVA 1Y0YA 3FECA 4P4DA 3W91A 2GE3A 4XPDB 3NH8A 1Y0RA 5AG4A 3VARA 1Y9WA 4OIWA 2Z3KA 2B3VA 4CYQA 4CYOA 3IU2A 3KR4A 4ONUA 2PJ7A 4MFJA
chains in the Genus database with same CATH topology
4LQ6A 1JWQA 4RN7A 5EMIA 2ODFA 2HB6A 2Q7SA 4BINA 4M6HA 1XOVA 2HC9A 3CZXA 3QAYA 4M6IA 4M6GA 4EFDA 3NE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQ6 A;  1JWQ A;  4RN7 A;  5EMI A;  2ODF A;  2Q7S A;  4BIN A;  4M6H A;  3CZX A;  1XOV A;  3QAY A;  4M6I A;  4M6G A;  3NE8 A; 
#chains in the Genus database with same CATH topology
 2J8M A;  2WUU A;  2RFH A;  4F0X A;  3BI0 A;  4BD9 A;  3QAH A;  2VZY A;  2OZH A;  4JD6 A;  4MFL A;  1Z9U A;  2JLM A;  3P2F A;  5LRJ A;  1M4G A;  2HV2 A;  1QSO A;  5LYF A;  1TIQ A;  3SJF A;  3KGQ A;  3NA6 A;  4ZI6 A;  1ZLI A;  2Q44 A;  4JZ0 A;  3GYA A;  1KZF A;  3IEH A;  3S6G A;  1YME A;  1YR0 A;  2C6G A;  4X5K A;  1WWZ A;  3F5B A;  5FVJ A;  4CRY B;  3PRT A;  4KSI A;  4B6Z A;  3KI9 A;  4NJQ A;  2XEF A;  3T9Y A;  2Z3L A;  2ABZ A;  2Z3O A;  4FD7 A;  4MCP A;  2B5G B;  1XF8 A;  2WPW A;  2ZED A;  3FF3 A;  4A94 A;  4FAI A;  3GY9 A;  3FXT A;  4R57 A;  3DR8 A;  5D8N A;  2B3U A;  5ELY A;  5JPH A;  3H5Z A;  2Z3P A;  3H8G A;  4QC6 A;  4BMH A;  2PJ3 A;  3FNC A;  4CGL A;  3D4U A;  5E96 A;  1PCA A;  1XE4 A;  4R6T A;  3R9E A;  3V8I A;  4CAV A;  1FY7 A;  1TF9 A;  1YK3 A;  4YFJ A;  2B4B A;  2C6P A;  1IU8 A;  2AFX A;  5JQ4 A;  2OZU A;  1XBU A;  1I1D A;  3W6S A;  2F5I A;  4A30 A;  4F6A A;  2XEG A;  2AFW A;  2GFQ A;  1Y7R A;  1HDQ A;  1CG2 A;  4R7M A;  1CM0 A;  2B58 A;  1XRY A;  4FBE A;  2AFO A;  1R43 A;  4CAX A;  2PIZ A;  3KHZ A;  5HVF A;  3SXO A;  1Z2L A;  5EBV A;  2ZEM A;  1S7F A;  4PXD A;  2WYR A;  2EVN A;  3N7Z A;  4ZY2 A;  5F47 A;  4X8I A;  1FT7 A;  2Q4Y A;  4H6Z A;  5LRG A;  3DSB A;  4UWI A;  1IOI A;  1IY7 A;  4I49 A;  4TWE A;  2I79 A;  5ISV A;  2GLJ A;  3TT2 A;  4CRZ B;  4ONW A;  5K8P A;  1JQG A;  3PBE A;  4MBU A;  2FXF A;  2AFZ A;  3WT4 A;  3CDX A;  3EFA A;  5IB0 A;  3RNZ A;  2REF A;  4LX9 A;  2WPX A;  4PK3 A;  2QYV A;  4KZT A;  3FVL A;  4XPL A;  2I00 A;  3FRM A;  2PDO A;  3S9N A;  4B5P B;  2CTB A;  4KOU A;  2KCW A;  4M6G A;  1VIX A;  1NMT A;  1P4N A;  2VI7 A;  5C82 A;  4KSF A;  1X10 A;  4MFQ A;  2ZEL A;  4MHY A;  4R76 A;  3SXN A;  4B10 A;  3D66 A;  3FYN A;  5G20 A;  4BIN A;  2O28 A;  5LYL A;  2B4D A;  2PJ4 A;  4ZY1 A;  4A33 A;  1IID A;  4UIB A;  1PYT B;  4OAE A;  1J4J A;  8CPA A;  3CXP A;  4UBR A;  2OOT A;  2IQ6 A;  1MJ9 A;  4MJ8 A;  2IMO A;  3KHX A;  4OC5 A;  2EK9 A;  2PR1 A;  4UIA A;  4KOX A;  5CBM A;  2H5M A;  2Z3M A;  2Q7B A;  3TOA A;  4A2Z A;  2ZEG A;  4B14 A;  1AUG A;  3DR6 A;  5HVG A;  2OH1 A;  2I3C A;  2AFS A;  3KQZ A;  3QB8 A;  2EUI A;  2F8H A;  1DE4 C;  4CAF A;  2PJ5 A;  2Q4V A;  4E8O A;  4BBH A;  1L0C A;  5CNP A;  4KOR A;  4G1P A;  5F09 A;  2JBK A;  4MI4 A;  4CGO A;  5JGF A;  2PJ1 A;  2JBJ A;  3D2P A;  4GM5 A;  3V7Z A;  3K9U A;  2G3A A;  2OR4 A;  3WAB A;  4QVT A;  1XMB A;  1X12 A;  4NGM A;  4UCN A;  1ARM A;  1YQE A;  3IU1 A;  4MCR A;  3BJ8 A;  1S3Z A;  1IYK A;  4PXC A;  3GKR A;  5DS0 A;  1TKJ A;  3I3G A;  1VHS A;  3JTK A;  1TKH A;  3SJE A;  2OU2 A;  1RXT A;  2NYQ A;  3R95 A;  5K8O A;  2V8H A;  1UWY A;  3GB0 A;  2BL1 A;  1U6M A;  2ZW6 A;  3GIU A;  4M85 A;  4C7I A;  2FL4 A;  2FS5 A;  3S6F A;  1BPM A;  3IO1 A;  3TO7 A;  1OZP A;  4MXU A;  3JUW A;  3LAC A;  4B5O A;  3FX6 A;  1CPS A;  4P4E A;  5F46 A;  1K4J A;  3EC4 A;  2ZW5 A;  2V8D A;  1M44 A;  5LRK A;  4FWU A;  1YSJ A;  4ZBG A;  1XOV A;  3R96 A;  1KWM A;  2WZN A;  4Y49 B;  4FD6 A;  5JM6 A;  1S7K A;  1EE3 P;  2FCK A;  3D67 A;  1QSM A;  1IGB A;  4KOY A;  3NH4 A;  4MFK A;  3JVN A;  1KUY A;  2JDC A;  3B8G A;  3CPA A;  7CPA A;  2PJC A;  4WWV A;  3PB7 X;  1F57 A;  1F2P A;  2ZEN A;  4W9Y A;  5DWN A;  3RYO A;  4CPA A;  4P10 A;  5LYD A;  1JWQ A;  2Q04 A;  5AG6 A;  4AG7 A;  4LQG A;  2R98 A;  4XNH C;  2Q43 A;  1S7L A;  2GLF A;  4M6I A;  3R9G A;  4UCP A;  3K9T A;  1RTQ A;  2ZPA A;  1UFH A;  1XMT A;  3CPX A;  4B12 A;  1LOK A;  1MJA A;  1PU9 A;  5J8C A;  1CBX A;  4IK2 A;  4NGP A;  3B35 A;  4F9U A;  1XFO A;  4UF4 A;  1BPN A;  2FVG A;  4PK2 A;  1VHE A;  1M4I A;  2EBJ A;  1RO5 A;  3TTH A;  3EO4 A;  2JEV A;  3B2Y A;  5KTD A;  4OC3 A;  4J3G A;  2ARH A;  3MRU A;  4XPD C;  1ELL P;  1V0C A;  1YW6 A;  1ZLH A;  3FB3 A;  3TOB A;  4AXV A;  2IL4 A;  1LFW A;  5LYI A;  4AG9 A;  4AVA A;  2PVV A;  2PRQ A;  4JXR A;  2PSW A;  2G9D A;  4NCZ A;  4YU9 A;  1N71 A;  4C68 A;  2A4N A;  4KSA A;  2HUZ A;  2QJ8 A;  2CNT A;  3TO9 A;  2B4D B;  3A9L A;  3KQX A;  2QIR A;  4Z65 A;  4O23 A;  2PJA A;  2PJ0 A;  2ZEF A;  1Z5R A;  1CP7 A;  3P2H A;  4MMO A;  2R8V A;  2J8N A;  1XEB A;  1I12 A;  2JDD A;  2CTC A;  2NMT A;  1Z4R A;  2ODF A;  3D7D A;  1R57 A;  1KUX A;  2WSA A;  3PB9 X;  4P4B A;  2REE A;  4QUS A;  3GLJ A;  3H8F A;  2BOA A;  3FEE A;  2RC4 A;  3VAT A;  3B3S A;  1LAM A;  3DNS A;  3PBB A;  2CXA A;  3TE4 A;  3B3V A;  2PQ8 A;  4NF1 A;  4P4I A;  5DWM A;  1MJB A;  4KUB A;  1WK4 A;  2BSW A;  3KR5 A;  4DNC A;  5HXD A;  4PPZ A;  1S60 A;  1P0H A;  2BO9 A;  4FD4 A;  3S9L A;  4UCM A;  1YW4 A;  3K2K A;  2OZG A;  3IFE A;  3FBU A;  3KZW A;  2GAN A;  3CT9 A;  3BI1 A;  1Z8X A;  4OAD A;  1CJW A;  4C2X A;  1H8L A;  1QSN A;  2Y0M A;  5THW A;  4MCQ A;  2Z11 A;  1KUV A;  1BLL E;  3DDD A;  2HC9 A;  3BXM A;  2HQY A;  1ELM P;  4KS9 A;  1NSL A;  1VHO A;  4FD5 A;  1VGY A;  1TF8 A;  4LQ6 A;  1M1D A;  4K30 A;  4NGR A;  4PXE A;  5G21 A;  3FJU A;  4OP4 A;  4B13 A;  1IOF A;  4PV6 A;  4DYO A;  3W6X A;  2CIJ A;  2Q0Y A;  2YNC C;  2V8V A;  3EXN A;  3MN8 A;  4OID A;  5EC4 A;  5GCN A;  4GS4 A;  1Q2Y A;  1QMU A;  4X3R A;  4CGM A;  3V38 A;  4UFX A;  1S7N A;  2PE3 A;  4DJL A;  3BHX A;  3BLN A;  4IAV A;  2EWB A;  3SJX A;  3D8P A;  4QBJ A;  2CNM A;  4HKF A;  3MGD A;  4UEE A;  2C6C A;  2POK A;  4KUA A;  2FIA A;  3VH9 A;  2VZZ A;  2AFU A;  1YLE A;  2YNC A;  3ISX A;  2C27 A;  5K8M A;  2BEI A;  5H84 A;  3CXS A;  3RBU A;  3NFZ A;  3RO0 A;  1Q2D A;  1GHE A;  3PEI A;  4P45 A;  1ZO0 A;  3L2N A;  3LWU A;  4M3S A;  4XPK A;  3ZZI A;  4EWT A;  3T8W A;  1ARL A;  4RS2 A;  4UWJ A;  4TNU A;  4CYN A;  3CZX A;  3QAY A;  3HLP A;  5HH1 A;  2X7B A;  1AMP A;  2BCO A;  4II9 A;  4MCS A;  2AE6 A;  2V8G A;  2ZW4 A;  5F49 A;  1CPX A;  2DF5 A;  2PCU A;  3PB4 X;  4UEZ A;  3PP9 A;  1R3N A;  3ISZ A;  3BJ7 A;  1B87 A;  1I21 A;  2O53 A;  2ZEO A;  5C88 A;  3WC7 A;  5K8N A;  2HB6 A;  2XEJ A;  3QNV A;  4KOS A;  3R9F A;  4JYW A;  2PR8 A;  4OC2 A;  4MHP A;  3WR7 A;  5AG5 A;  2PJ9 A;  2ZXV A;  1CX8 A;  2QEC A;  4PQA A;  4CAE A;  1HDU A;  2PC1 A;  2Q51 A;  1NE9 A;  4RI1 A;  4UEF A;  3PFO A;  3B3C A;  4R3L A;  6CPA A;  4B5P A;  4UFW A;  1YVK A;  2Z0Z A;  2DEA A;  1Q2C A;  3IJ3 A;  1HEE A;  1Z8W A;  1A2Z A;  5G22 A;  4JXQ A;  4AVB A;  4KVX A;  2ZOG A;  2DPS A;  3KKW A;  1YLO A;  4P4J A;  4MHD A;  1NSA A;  1QST A;  3D68 A;  4B11 A;  1TXR A;  2P0W A;  3SHP A;  3S6H A;  4E0A A;  3PB6 X;  3VWE A;  2P6F A;  4Q38 A;  1LRZ A;  4NSQ A;  1Y9K A;  1M4D A;  1ZG8 A;  3RAM A;  4P6Y A;  4HNW B;  4AB7 A;  2V77 A;  2AJ6 A;  4WJB A;  3CXQ A;  1TKF A;  5CPA A;  4YRH A;  4A31 A;  3PB8 X;  1Z4E A;  2VL1 A;  1ON0 A;  1VKC A;  1BO4 A;  2ZW7 A;  3PGP A;  4OME A;  4CGP A;  3NH5 A;  3G8W A;  3WC5 A;  2Q4Z A;  2DPT A;  4H89 A;  5J8F A;  4JWP A;  4CGN A;  2AFM A;  2PJ2 A;  4A95 A;  2EO8 A;  5HVH A;  4CS0 B;  4JJX A;  1LAN A;  4PSX A;  1DTD A;  3PZJ A;  4YWY A;  3D7H A;  1Y7E A;  1B6B A;  4OC0 A;  4HNY B;  4E2A A;  4R87 A;  4X2T A;  3IGR A;  4NXY A;  2FT0 A;  4EME A;  3NE7 A;  3SI2 A;  2GU2 A;  3B3W A;  4MFP A;  4OKO A;  1PUA A;  4C2Z A;  3D2M A;  3KAS A;  3LMS A;  2CY2 A;  4NGQ A;  4QB9 A;  2J9A A;  1Q7L A;  2R1I A;  3C26 A;  2EK8 A;  4P4F A;  4MRI A;  5H86 A;  1XJO A;  1Z8T A;  3T90 A;  1CP6 A;  4EFD A;  4PXB A;  4Y49 C;  3S9M A;  3TX8 A;  4OC4 A;  5JH9 A;  2C1C A;  2P6G A;  4MY0 A;  1F2O A;  4HPS A;  3JRU A;  5KTA A;  2D4O A;  3NE8 A;  4R8F A;  4PSW A;  4R9M A;  2K5T A;  4OLL A;  1ZG9 A;  3VWD A;  5BWA B;  4CYP A;  3D7G A;  4ZX9 A;  3ZJ0 A;  2OB0 A;  4P44 A;  2VQY A;  3I1U A;  4EVY A;  1YGH A;  4OC1 A;  3F8K A;  4RUH A;  3KL9 A;  3WC6 A;  3RZA A;  3I9S A;  4KOV A;  4H2K A;  4ORF A;  4MFZ A;  3H4Q A;  3B7I A;  4ZY0 A;  3N5F A;  1YVO A;  5A27 A;  4Q7A A;  5D29 A;  3SI0 A;  3IWG A;  2PIY A;  3TC8 A;  3TCV A;  5IB9 A;  1ZG7 A;  4F8Z A;  4NGN A;  5A28 A;  2ATR A;  4DUK A;  2VEZ A;  5AGE A;  4IUS A;  2QML A;  3FH4 A;  1AYE A;  2PVW A;  4NGT A;  4F0Y A;  4L89 A;  1IYL A;  2B5G A;  2IJZ A;  2YGW A;  3F0A A;  2F7V A;  2CNS A;  2FSR A;  5F48 A;  2ZEE A;  1LCP A;  2ZOF A;  4U9Z A;  2ANP A;  2O4H A;  3TO6 A;  4IHM A;  1LAP A;  2DXQ A;  4KVM E;  3DGV A;  1IB1 E;  2D4P A;  3IWE A;  3SI1 A;  4ZYQ A;  3OWC A;  4KVO E;  4JLY A;  3TFY A;  1OBR A;  4M6H A;  2Z10 A;  4KLV A;  4KOW A;  5G1Z A;  4C2Y A;  1BAV A;  3H8E A;  4RN7 A;  4U5Y A;  4IF5 A;  2Q7S A;  4NGS A;  5J1Q A;  1SQH A;  1IIC A;  4NJR A;  4C7H A;  5IX3 A;  2PJB A;  1YRE A;  3LOD A;  3SJG A;  3UY5 A;  5I4M A;  2RB7 A;  1QQ9 A;  3IIB A;  3R1K A;  3S6K A;  5I0C A;  1XIX A;  1GYT A;  3IC1 A;  2G3T A;  4GXH A;  4HNX B;  2J8R A;  4LUA A;  3E0K A;  3FIX A;  2BUE A;  3LD2 A;  1S5K A;  3D7F A;  4ZGY B;  4KLW A;  1YX0 A;  4YGO A;  3DLJ A;  3PFE A;  2NSM A;  2VXK A;  2PRB A;  4MHZ A;  4Q36 A;  4A37 A;  4F9V A;  2QVP A;  4A32 A;  2P6E A;  2GIV A;  3IWW A;  4NEX A;  1QSR A;  2PJ8 A;  3B3T A;  2YNE A;  3G3S A;  5AG7 A;  4NFR A;  3HUV A;  4L8A A;  4XNH B;  5EMI A;  4MHN A;  4A38 A;  2FE7 A;  2G0B A;  3FED A;  2JEW A;  2VBQ A;  3FMC A;  2ZEH A;  4H6U A;  5KTC A;  2Z3N A;  1BOB A;  4R3K A;  4AVC A;  3EY5 A;  2GRE A;  1MK4 A;  3GUX A;  5IV0 A;  2ZEP A;  4MY3 A;  4ZX8 A;  4KOT A;  2XEI A;  1Z8L A;  2FIW A;  2R7H A;  5HMN A;  4K3N A;  3D3S A;  4U9Y A;  2YND A;  4UA3 A;  1FNO A;  4FUU A;  4CAW A;  4A39 A;  2PJ6 A;  2CF4 A;  1M4L A;  4UFV A;  1Y0Y A;  3FEC A;  4P4D A;  3W91 A;  2GE3 A;  4XPD B;  3NH8 A;  1Y0R A;  5AG4 A;  3VAR A;  1Y9W A;  4OIW A;  2Z3K A;  2B3V A;  4CYQ A;  4CYO A;  3IU2 A;  3KR4 A;  4ONU A;  2PJ7 A;  4MFJ A; 
#chains in the Genus database with same CATH homology
 4LQ6 A;  1JWQ A;  4RN7 A;  5EMI A;  2ODF A;  2HB6 A;  2Q7S A;  4BIN A;  4M6H A;  1XOV A;  2HC9 A;  3CZX A;  3QAY A;  4M6I A;  4M6G A;  4EFD A;  3NE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...