3CZXA

The crystal structure of the putative n-acetylmuramoyl-l-alanine amidase from neisseria meningitidis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
182
structure length
182
Chain Sequence
AMSKIICLTAGHSNTDPGAVNGSDREADLAQDMRNIVASILRNDYGLTVKTDGTGKGNMPLRDAVKLIRGSDVAIEFHTNAAANKTATGIEALSTPKNKRWCQVLGKAVAKKTGWKLRGEDGFKPDNAGQHSRLAYAQAGGIVFEPFFISNDTDLALFKTTKWGICRAIADAIAMELGAAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative N-acetylmuramoyl-L-alanine amidase
publication title The crystal structure of the putative N-acetylmuramoyl-L-alanine amidase from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis mc58
molecule tags Hydrolase
total genus 66
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 3czxA00
3CZXA 4BINA 5EMIA 2ODFA 4M6GA 3QAYA 2Q7SA 1XOVA 4LQ6A 4RN7A 1JWQA 3NE8A 4M6HA 4M6IA
chains in the Genus database with same CATH superfamily
2HB6A 1R3NA 3R95A 3KL9A 4BBHA 2R7HA 3PB6X 4M6GA 2ZENA 3CT9A 5IB0A 5J8FA 3SXOA 5HVHA 5KTAA 1FY7A 1KUXA 4A95A 4B5PB 1I1DA 2BCOA 1P4NA 1S3ZA 2WPXA 5F09A 3TTHA 3ZJ0A 1YK3A 4H89A 1ZLIA 3B3SA 2PJ6A 2CY2A 2J8NA 3PGPA 5DWNA 1Q2CA 3BI1A 4P4FA 4P4BA 4KOXA 2C6GA 5EC4A 4ZYQA 1Z8XA 1Z4RA 1HDQA 3BXMA 5BWAB 4NJQA 2Q4ZA 3UY5A 4B12A 1YSJA 2O28A 2XEIA 4RS2A 4C68A 4OP4A 5K8PA 5CPAA 1HEEA 2AFSA 2BOAA 4KSAA 2Q7SA 3K2KA 2ARHA 3K9UA 4PK3A 2AFOA 5HVGA 4R76A 4AVCA 2PQ8A 4B5OA 1MJ9A 1Z8TA 1XMBA 2PJCA 4PXCA 4XPKA 3TO6A 5JQ4A 2Z3LA 3JUWA 1DTDA 1M4IA 2ZEMA 4CRZB 5F48A 4NGTA 2FIAA 4B5PA 4I49A 3WC5A 2ZEDA 7CPAA 3DR6A 5AG4A 2EUIA 2K5TA 2ZW6A 1VKCA 3W6SA 2BO9A 4XPLA 3FXTA 2ZEGA 2PC1A 1IU8A 2A4NA 4LQGA 1ZLHA 4UWJA 5IV0A 4KOTA 3R9EA 1CPXA 4Y49B 4UFVA 2IJZA 2AFUA 2Z3KA 2AFWA 1IYLA 4NGNA 3VH9A 2CNMA 4XPDC 4L89A 3B3TA 3RBUA 1YLEA 2DPSA 2NMTA 1XMTA 1XBUA 2NYQA 3GUXA 4P10A 2WUUA 1YVOA 2PDOA 1XEBA 3IWGA 4ORFA 4P4IA 3KHZA 3SI2A 1ZG7A 2PJ8A 5LYDA 4QBJA 4P6YA 1X10A 3HLPA 5E96A 2PJ3A 5H84A 1YR0A 1LFWA 2B5GB 2YNDA 3RYOA 4OADA 1RXTA 3LACA 4IHMA 2EBJA 4E2AA 4OC0A 4P4JA 1ELLP 3VWDA 3S9LA 3EFAA 4NGMA 2XEJA 1CX8A 1YVKA 2Q44A 4R7MA 1RTQA 1U6MA 4CPAA 2NSMA 4JWPA 2JLMA 4F0XA 2Q04A 1KZFA 3NH4A 4G1PA 2GFQA 4R87A 4NSQA 4YU9A 2OZGA 3MN8A 4KOSA 3QNVA 4MI4A 4JZ0A 1L0CA 2B58A 4WWVA 3TX8A 4AB7A 2P6FA 3LMSA 1BAVA 4FAIA 2GU2A 5AG6A 1Q2DA 3V7ZA 3KGQA 2ZOGA 2WSAA 1F2PA 3TO9A 5C82A 3NE7A 4NGSA 1Y0YA 3FIXA 3R9GA 4UEEA 1PYTB 1MJAA 4JYWA 2C6PA 3RNZA 4NGPA 5IX3A 5A28A 4LUAA 4PSWA 4B11A 1LANA 1CPSA 3K9TA 2VEZA 4UFWA 2Q7BA 2PR8A 4UCNA 2FVGA 1F2OA 4BINA 3MRUA 5D29A 3SJFA 2Q4VA 3FYNA 4A94A 3QB8A 4JLYA 4H2KA 4X5KA 4KORA 4CGNA 3ZZIA 3WT4A 1NE9A 1GYTA 2OOTA 3D4UA 3I1UA 2REFA 4CAFA 4UEFA 2P6EA 1Z2LA 3FB3A 3C26A 4CYPA 4KLVA 1TF8A 1TF9A 4PK2A 4OIWA 3H8FA 3ISZA 3E0KA 4PXBA 4B14A 4P4EA 1H8LA 1ZG9A 2HV2A 2PRBA 3D7DA 3RZAA 2ZXVA 3H5ZA 4CYNA 1B87A 2G3TA 4B6ZA 4X8IA 4X2TA 1IY7A 5IB9A 2PJ9A 3G8WA 1QSOA 2FCKA 4B10A 4LX9A 4UIBA 3VWEA 3A9LA 2QIRA 2B3VA 1XJOA 2HC9A 4TNUA 4U9YA 4KUAA 1N71A 3LD2A 4F0YA 4HKFA 2B4DB 3PFOA 5KTCA 4MCPA 3NFZA 2CNSA 4ZY2A 2EK8A 1XE4A 2ATRA 2IQ6A 1S7KA 2PJ4A 4MXUA 2CTBA 2ANPA 5LYLA 1NSLA 4OLLA 3PB8X 3RO0A 3IJ3A 3N7ZA 1CG2A 1S7LA 2PIYA 3S6GA 2FXFA 2ODFA 2F7VA 4MRIA 3VATA 5D8NA 1QSRA 4DYOA 4ZGYB 2ZPAA 3S6KA 1IOFA 1PUAA 4KOWA 2C6CA 3FNCA 4R8FA 3D7FA 4M85A 4BD9A 3LWUA 1IB1E 3IIBA 3BLNA 4C2YA 3TO7A 3D7HA 4M6HA 1VIXA 1M4LA 4AVAA 2ZEPA 4FD5A 1IGBA 1M1DA 2D4PA 2J9AA 3JRUA 1BPMA 2B4DA 3MGDA 4CAVA 3D66A 1LAPA 1UWYA 4X3RA 2Q4YA 3IC1A 4GS4A 1KUVA 1VHOA 4PXEA 2EO8A 4W9YA 3PB9X 4FBEA 4R57A 2VZYA 4MFQA 3P2HA 1WWZA 1Z5RA 2V8VA 2ZW7A 5EMIA 3GYAA 4R6TA 2PVVA 2R8VA 2Z0ZA 4QUSA 1LAMA 4OC4A 4RI1A 5A27A 3B2YA 2YNCA 1YW4A 1VHSA 4XNHB 5JH9A 3BI0A 1YREA 2I79A 4CGLA 3TOAA 3R1KA 3B8GA 4UA3A 3NH5A 4LQ6A 2JDCA 3IFEA 5ISVA 5LYIA 3R9FA 1GHEA 3D3SA 2FT0A 2R1IA 2DPTA 3DGVA 2I00A 3HUVA 5G21A 3FJUA 2KCWA 5J8CA 2OR4A 3EO4A 3S9NA 3PB7X 1FNOA 4H6ZA 3G3SA 4F6AA 4KOUA 2X7BA 2PR1A 5C88A 2IMOA 4EVYA 3KQXA 3NE8A 1IIDA 4R9MA 1P0HA 2Z3PA 2AE6A 2R98A 1XOVA 2JBJA 3V38A 2VXKA 1X12A 3GY9A 1PCAA 3T9YA 3WC6A 2YNEA 4F9UA 4A2ZA 4EWTA 2V8GA 3IWEA 2IL4A 4R3LA 3GIUA 3BJ8A 4MHDA 1M4DA 2VQYA 2P0WA 2RC4A 4K30A 4MJ8A 5EBVA 4NGQA 3KR4A 4UWIA 2PJ5A 2QJ8A 4KVME 3TOBA 3SJEA 4E8OA 2JEVA 1KWMA 3BHXA 3IEHA 3RAMA 4ONUA 4IUSA 1LOKA 2D4OA 1Y9KA 3TC8A 1YLOA 1VGYA 4B13A 5F47A 2WZNA 3GLJA 4H6UA 2OH1A 3CPXA 4OIDA 4UF4A 3S6FA 4Q7AA 2PJ0A 2C27A 1YW6A 2Q51A 4RUHA 2B5GA 4Z65A 1XF8A 4GXHA 5ELYA 2V8DA 2FSRA 2ZEOA 4IF5A 3CXQA 4PPZA 5HVFA 3SXNA 2ZEEA 1K4JA 1Z8LA 1MK4A 4R3KA 2I3CA 5CBMA 3NH8A 3CXSA 1Y7EA 1Z9UA 2YNCC 3KZWA 2F5IA 3TE4A 5AG7A 2Z3NA 5KTDA 4HNWB 4F8ZA 4YRHA 3F8KA 4UEZA 2J8MA 4A33A 2VZZA 3PBBA 4UFXA 4A39A 1BLLE 4P44A 3DDDA 4KS9A 1F57A 2G9DA 3EC4A 2G0BA 3SI0A 3JVNA 1YGHA 4MY0A 4A30A 4CYQA 2AFMA 4KLWA 3CPAA 4PXDA 4KOVA 4L8AA 3T8WA 1Y9WA 2QVPA 4MHPA 4GM5A 2YGWA 2ZEFA 1XRYA 3OWCA 2V8HA 4UCMA 4XPDB 1BPNA 3F0AA 3H8EA 3PP9A 3FVLA 5G22A 2AJ6A 3FH4A 2QECA 3D67A 1OBRA 4Y49C 5GCNA 4UIAA 2V77A 3D68A 4UBRA 3PBEA 3BJ7A 3IU1A 1XFOA 1XIXA 1Q7LA 4ZBGA 2FL4A 2ZW4A 4XNHC 3N5FA 1ZO0A 1CP7A 1QSMA 3D7GA 3ISXA 4EFDA 5LYFA 4NEXA 5AGEA 4NF1A 2PRQA 2VL1A 5K8MA 3LODA 3FEEA 2Y0MA 5AG5A 1I21A 2CF4A 3D2MA 2G3AA 3PZJA 4U9ZA 3TCVA 5DS0A 5LRGA 3FX6A 2B4BA 3T90A 3B3CA 4MHZA 2CNTA 1QSTA 5H86A 5I4MA 1AUGA 2OZUA 3CDXA 3DR8A 3NA6A 4ZY0A 3KKWA 3S6HA 4CAXA 2ZELA 4JJXA 1AMPA 4MFPA 6CPAA 4KVXA 4DNCA 4PQAA 4KVOE 1IYKA 2BEIA 4O23A 4AVBA 5HMNA 2O4HA 3I9SA 4MY3A 4OC1A 3SHPA 2J8RA 2PJBA 2BSWA 2Z3OA 3B3VA 4JXRA 2GLFA 3DSBA 4JXQA 4A32A 4CGMA 4CS0B 1B6BA 8CPAA 4IAVA 1RO5A 3H8GA 2JDDA 4OC2A 4ZX9A 5K8OA 1V0CA 2OZHA 1CP6A 4RN7A 4AG7A 2ZEHA 1ARLA 4C2ZA 2AFZA 1IOIA 2P6GA 2Q43A 5F46A 2QYVA 3PEIA 3B7IA 2PSWA 2JEWA 3VARA 4C7HA 5CNPA 4CAEA 2GANA 4A31A 4TWEA 4FD6A 1TKJA 4KSIA 1YMEA 1Q2YA 1Y0RA 4MFZA 2DF5A 2FIWA 5J1QA 1BOBA 4FD7A 4OAEA 4A37A 4CYOA 4KSFA 2VBQA 3B35A 2REEA 1A2ZA 5LRKA 1QMUA 1TIQA 3JTKA 3L2NA 5FVJA 2WPWA 5K8NA 1JWQA 4OKOA 2XEFA 4KOYA 4MBUA 2EK9A 1YQEA 4MHYA 2ZOFA 1NSAA 3FBUA 2FE7A 3KASA 2HQYA 3PB4X 1J4JA 2BUEA 1R43A 2EVNA 2H5MA 3KI9A 4A38A 1UFHA 1EE3P 2WYRA 4K3NA 1ON0A 3P2FA 1YX0A 4ZI6A 1ZG8A 3PFEA 2C1CA 1AYEA 5JM6A 2XEGA 1LRZA 1TKHA 4E0AA 5JPHA 4II9A 1FT7A 1Y7RA 4C2XA 1ELMP 3EXNA 3IWWA 3F5BA 1DE4C 4OC3A 3H4QA 4HNYB 4PV6A 2PCUA 1S7NA 4BMHA 4KUBA 4MHNA 3D8PA 1S5KA 5DWMA 3S9MA 2GIVA 1M4GA 1QSNA 2PVWA 2JBKA 2DEAA 1MJBA 4NCZA 4MFKA 4EMEA 1LCPA 1TKFA 3IO1A 5HH1A 4CGPA 1Z4EA 2QMLA 2RFHA 2CTCA 4FUUA 4DUKA 4ZY1A 4QC6A 1PU9A 3KHXA 4OMEA 2FS5A 3FEDA 2CXAA 3TT2A 4MCQA 2OB0A 2RB7A 3FF3A 2EWBA 1CJWA 4IK2A 4NFRA 2O53A 5G1ZA 3CXPA 2DXQA 2PJ7A 4HPSA 1HDUA 3FRMA 5THWA 3FMCA 4CRYB 4QB9A 2ZW5A 4J3GA 2Z11A 3PRTA 4PSXA 4FD4A 3R96A 4M3SA 4M6IA 4HNXB 4NGRA 4AXVA 4DJLA 5I0CA 2Z3MA 1NMTA 1JQGA 3D2PA 1R57A 3QAYA 4Q36A 2HUZA 2ABZA 4OC5A 3WR7A 4C7IA 4YGOA 3W6XA 1CM0A 5G20A 3CZXA 1WK4A 1I12A 1M44A 4Q38A 4YWYA 4KZTA 3TFYA 4MCSA 1VHEA 2B3UA 2PJAA 4MFJA 4MFLA 3W91A 3WC7A 3FECA 1SQHA 3V8IA 4F9VA 2GREA 1ARMA 1TXRA 1Z8WA 4UCPA 4CAWA 4ONWA 4AG9A 4WJBA 3KQZA 4ZX8A 2PIZA 3GB0A 2OU2A 2AFXA 4P45A 3IGRA 2BL1A 1KUYA 4YFJA 3WABA 2F8HA 1QQ9A 3DLJA 1IICA 1S7FA 5F49A 1BO4A 2Z10A 3B3WA 3QAHA 4JD6A 4P4DA 5JGFA 5HXDA 4U5YA 3SJXA 4QVTA 2PJ1A 2GE3A 4MCRA 5LRJA 2POKA 3IU2A 2CIJA 3SI1A 1CBXA 4MMOA 4NJRA 2VI7A 1S60A 4FWUA 2PE3A 3GKRA 4CGOA 2PJ2A 3DNSA 2Q0YA 3EY5A 3I3GA 4NXYA 3KR5A 2GLJA 1OZPA 3SJGA
chains in the Genus database with same CATH topology
2HB6A 3CZXA 4BINA 5EMIA 2ODFA 4M6HA 4M6GA 3QAYA 4EFDA 2Q7SA 1XOVA 4LQ6A 4RN7A 1JWQA 3NE8A 2HC9A 4M6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZX A;  4BIN A;  5EMI A;  2ODF A;  4M6G A;  3QAY A;  2Q7S A;  1XOV A;  4LQ6 A;  4RN7 A;  1JWQ A;  3NE8 A;  4M6H A;  4M6I A; 
#chains in the Genus database with same CATH topology
 2HB6 A;  1R3N A;  3R95 A;  3KL9 A;  4BBH A;  2R7H A;  3PB6 X;  4M6G A;  2ZEN A;  3CT9 A;  5IB0 A;  5J8F A;  3SXO A;  5HVH A;  5KTA A;  1FY7 A;  1KUX A;  4A95 A;  4B5P B;  1I1D A;  2BCO A;  1P4N A;  1S3Z A;  2WPX A;  5F09 A;  3TTH A;  3ZJ0 A;  1YK3 A;  4H89 A;  1ZLI A;  3B3S A;  2PJ6 A;  2CY2 A;  2J8N A;  3PGP A;  5DWN A;  1Q2C A;  3BI1 A;  4P4F A;  4P4B A;  4KOX A;  2C6G A;  5EC4 A;  4ZYQ A;  1Z8X A;  1Z4R A;  1HDQ A;  3BXM A;  5BWA B;  4NJQ A;  2Q4Z A;  3UY5 A;  4B12 A;  1YSJ A;  2O28 A;  2XEI A;  4RS2 A;  4C68 A;  4OP4 A;  5K8P A;  5CPA A;  1HEE A;  2AFS A;  2BOA A;  4KSA A;  2Q7S A;  3K2K A;  2ARH A;  3K9U A;  4PK3 A;  2AFO A;  5HVG A;  4R76 A;  4AVC A;  2PQ8 A;  4B5O A;  1MJ9 A;  1Z8T A;  1XMB A;  2PJC A;  4PXC A;  4XPK A;  3TO6 A;  5JQ4 A;  2Z3L A;  3JUW A;  1DTD A;  1M4I A;  2ZEM A;  4CRZ B;  5F48 A;  4NGT A;  2FIA A;  4B5P A;  4I49 A;  3WC5 A;  2ZED A;  7CPA A;  3DR6 A;  5AG4 A;  2EUI A;  2K5T A;  2ZW6 A;  1VKC A;  3W6S A;  2BO9 A;  4XPL A;  3FXT A;  2ZEG A;  2PC1 A;  1IU8 A;  2A4N A;  4LQG A;  1ZLH A;  4UWJ A;  5IV0 A;  4KOT A;  3R9E A;  1CPX A;  4Y49 B;  4UFV A;  2IJZ A;  2AFU A;  2Z3K A;  2AFW A;  1IYL A;  4NGN A;  3VH9 A;  2CNM A;  4XPD C;  4L89 A;  3B3T A;  3RBU A;  1YLE A;  2DPS A;  2NMT A;  1XMT A;  1XBU A;  2NYQ A;  3GUX A;  4P10 A;  2WUU A;  1YVO A;  2PDO A;  1XEB A;  3IWG A;  4ORF A;  4P4I A;  3KHZ A;  3SI2 A;  1ZG7 A;  2PJ8 A;  5LYD A;  4QBJ A;  4P6Y A;  1X10 A;  3HLP A;  5E96 A;  2PJ3 A;  5H84 A;  1YR0 A;  1LFW A;  2B5G B;  2YND A;  3RYO A;  4OAD A;  1RXT A;  3LAC A;  4IHM A;  2EBJ A;  4E2A A;  4OC0 A;  4P4J A;  1ELL P;  3VWD A;  3S9L A;  3EFA A;  4NGM A;  2XEJ A;  1CX8 A;  1YVK A;  2Q44 A;  4R7M A;  1RTQ A;  1U6M A;  4CPA A;  2NSM A;  4JWP A;  2JLM A;  4F0X A;  2Q04 A;  1KZF A;  3NH4 A;  4G1P A;  2GFQ A;  4R87 A;  4NSQ A;  4YU9 A;  2OZG A;  3MN8 A;  4KOS A;  3QNV A;  4MI4 A;  4JZ0 A;  1L0C A;  2B58 A;  4WWV A;  3TX8 A;  4AB7 A;  2P6F A;  3LMS A;  1BAV A;  4FAI A;  2GU2 A;  5AG6 A;  1Q2D A;  3V7Z A;  3KGQ A;  2ZOG A;  2WSA A;  1F2P A;  3TO9 A;  5C82 A;  3NE7 A;  4NGS A;  1Y0Y A;  3FIX A;  3R9G A;  4UEE A;  1PYT B;  1MJA A;  4JYW A;  2C6P A;  3RNZ A;  4NGP A;  5IX3 A;  5A28 A;  4LUA A;  4PSW A;  4B11 A;  1LAN A;  1CPS A;  3K9T A;  2VEZ A;  4UFW A;  2Q7B A;  2PR8 A;  4UCN A;  2FVG A;  1F2O A;  4BIN A;  3MRU A;  5D29 A;  3SJF A;  2Q4V A;  3FYN A;  4A94 A;  3QB8 A;  4JLY A;  4H2K A;  4X5K A;  4KOR A;  4CGN A;  3ZZI A;  3WT4 A;  1NE9 A;  1GYT A;  2OOT A;  3D4U A;  3I1U A;  2REF A;  4CAF A;  4UEF A;  2P6E A;  1Z2L A;  3FB3 A;  3C26 A;  4CYP A;  4KLV A;  1TF8 A;  1TF9 A;  4PK2 A;  4OIW A;  3H8F A;  3ISZ A;  3E0K A;  4PXB A;  4B14 A;  4P4E A;  1H8L A;  1ZG9 A;  2HV2 A;  2PRB A;  3D7D A;  3RZA A;  2ZXV A;  3H5Z A;  4CYN A;  1B87 A;  2G3T A;  4B6Z A;  4X8I A;  4X2T A;  1IY7 A;  5IB9 A;  2PJ9 A;  3G8W A;  1QSO A;  2FCK A;  4B10 A;  4LX9 A;  4UIB A;  3VWE A;  3A9L A;  2QIR A;  2B3V A;  1XJO A;  2HC9 A;  4TNU A;  4U9Y A;  4KUA A;  1N71 A;  3LD2 A;  4F0Y A;  4HKF A;  2B4D B;  3PFO A;  5KTC A;  4MCP A;  3NFZ A;  2CNS A;  4ZY2 A;  2EK8 A;  1XE4 A;  2ATR A;  2IQ6 A;  1S7K A;  2PJ4 A;  4MXU A;  2CTB A;  2ANP A;  5LYL A;  1NSL A;  4OLL A;  3PB8 X;  3RO0 A;  3IJ3 A;  3N7Z A;  1CG2 A;  1S7L A;  2PIY A;  3S6G A;  2FXF A;  2ODF A;  2F7V A;  4MRI A;  3VAT A;  5D8N A;  1QSR A;  4DYO A;  4ZGY B;  2ZPA A;  3S6K A;  1IOF A;  1PUA A;  4KOW A;  2C6C A;  3FNC A;  4R8F A;  3D7F A;  4M85 A;  4BD9 A;  3LWU A;  1IB1 E;  3IIB A;  3BLN A;  4C2Y A;  3TO7 A;  3D7H A;  4M6H A;  1VIX A;  1M4L A;  4AVA A;  2ZEP A;  4FD5 A;  1IGB A;  1M1D A;  2D4P A;  2J9A A;  3JRU A;  1BPM A;  2B4D A;  3MGD A;  4CAV A;  3D66 A;  1LAP A;  1UWY A;  4X3R A;  2Q4Y A;  3IC1 A;  4GS4 A;  1KUV A;  1VHO A;  4PXE A;  2EO8 A;  4W9Y A;  3PB9 X;  4FBE A;  4R57 A;  2VZY A;  4MFQ A;  3P2H A;  1WWZ A;  1Z5R A;  2V8V A;  2ZW7 A;  5EMI A;  3GYA A;  4R6T A;  2PVV A;  2R8V A;  2Z0Z A;  4QUS A;  1LAM A;  4OC4 A;  4RI1 A;  5A27 A;  3B2Y A;  2YNC A;  1YW4 A;  1VHS A;  4XNH B;  5JH9 A;  3BI0 A;  1YRE A;  2I79 A;  4CGL A;  3TOA A;  3R1K A;  3B8G A;  4UA3 A;  3NH5 A;  4LQ6 A;  2JDC A;  3IFE A;  5ISV A;  5LYI A;  3R9F A;  1GHE A;  3D3S A;  2FT0 A;  2R1I A;  2DPT A;  3DGV A;  2I00 A;  3HUV A;  5G21 A;  3FJU A;  2KCW A;  5J8C A;  2OR4 A;  3EO4 A;  3S9N A;  3PB7 X;  1FNO A;  4H6Z A;  3G3S A;  4F6A A;  4KOU A;  2X7B A;  2PR1 A;  5C88 A;  2IMO A;  4EVY A;  3KQX A;  3NE8 A;  1IID A;  4R9M A;  1P0H A;  2Z3P A;  2AE6 A;  2R98 A;  1XOV A;  2JBJ A;  3V38 A;  2VXK A;  1X12 A;  3GY9 A;  1PCA A;  3T9Y A;  3WC6 A;  2YNE A;  4F9U A;  4A2Z A;  4EWT A;  2V8G A;  3IWE A;  2IL4 A;  4R3L A;  3GIU A;  3BJ8 A;  4MHD A;  1M4D A;  2VQY A;  2P0W A;  2RC4 A;  4K30 A;  4MJ8 A;  5EBV A;  4NGQ A;  3KR4 A;  4UWI A;  2PJ5 A;  2QJ8 A;  4KVM E;  3TOB A;  3SJE A;  4E8O A;  2JEV A;  1KWM A;  3BHX A;  3IEH A;  3RAM A;  4ONU A;  4IUS A;  1LOK A;  2D4O A;  1Y9K A;  3TC8 A;  1YLO A;  1VGY A;  4B13 A;  5F47 A;  2WZN A;  3GLJ A;  4H6U A;  2OH1 A;  3CPX A;  4OID A;  4UF4 A;  3S6F A;  4Q7A A;  2PJ0 A;  2C27 A;  1YW6 A;  2Q51 A;  4RUH A;  2B5G A;  4Z65 A;  1XF8 A;  4GXH A;  5ELY A;  2V8D A;  2FSR A;  2ZEO A;  4IF5 A;  3CXQ A;  4PPZ A;  5HVF A;  3SXN A;  2ZEE A;  1K4J A;  1Z8L A;  1MK4 A;  4R3K A;  2I3C A;  5CBM A;  3NH8 A;  3CXS A;  1Y7E A;  1Z9U A;  2YNC C;  3KZW A;  2F5I A;  3TE4 A;  5AG7 A;  2Z3N A;  5KTD A;  4HNW B;  4F8Z A;  4YRH A;  3F8K A;  4UEZ A;  2J8M A;  4A33 A;  2VZZ A;  3PBB A;  4UFX A;  4A39 A;  1BLL E;  4P44 A;  3DDD A;  4KS9 A;  1F57 A;  2G9D A;  3EC4 A;  2G0B A;  3SI0 A;  3JVN A;  1YGH A;  4MY0 A;  4A30 A;  4CYQ A;  2AFM A;  4KLW A;  3CPA A;  4PXD A;  4KOV A;  4L8A A;  3T8W A;  1Y9W A;  2QVP A;  4MHP A;  4GM5 A;  2YGW A;  2ZEF A;  1XRY A;  3OWC A;  2V8H A;  4UCM A;  4XPD B;  1BPN A;  3F0A A;  3H8E A;  3PP9 A;  3FVL A;  5G22 A;  2AJ6 A;  3FH4 A;  2QEC A;  3D67 A;  1OBR A;  4Y49 C;  5GCN A;  4UIA A;  2V77 A;  3D68 A;  4UBR A;  3PBE A;  3BJ7 A;  3IU1 A;  1XFO A;  1XIX A;  1Q7L A;  4ZBG A;  2FL4 A;  2ZW4 A;  4XNH C;  3N5F A;  1ZO0 A;  1CP7 A;  1QSM A;  3D7G A;  3ISX A;  4EFD A;  5LYF A;  4NEX A;  5AGE A;  4NF1 A;  2PRQ A;  2VL1 A;  5K8M A;  3LOD A;  3FEE A;  2Y0M A;  5AG5 A;  1I21 A;  2CF4 A;  3D2M A;  2G3A A;  3PZJ A;  4U9Z A;  3TCV A;  5DS0 A;  5LRG A;  3FX6 A;  2B4B A;  3T90 A;  3B3C A;  4MHZ A;  2CNT A;  1QST A;  5H86 A;  5I4M A;  1AUG A;  2OZU A;  3CDX A;  3DR8 A;  3NA6 A;  4ZY0 A;  3KKW A;  3S6H A;  4CAX A;  2ZEL A;  4JJX A;  1AMP A;  4MFP A;  6CPA A;  4KVX A;  4DNC A;  4PQA A;  4KVO E;  1IYK A;  2BEI A;  4O23 A;  4AVB A;  5HMN A;  2O4H A;  3I9S A;  4MY3 A;  4OC1 A;  3SHP A;  2J8R A;  2PJB A;  2BSW A;  2Z3O A;  3B3V A;  4JXR A;  2GLF A;  3DSB A;  4JXQ A;  4A32 A;  4CGM A;  4CS0 B;  1B6B A;  8CPA A;  4IAV A;  1RO5 A;  3H8G A;  2JDD A;  4OC2 A;  4ZX9 A;  5K8O A;  1V0C A;  2OZH A;  1CP6 A;  4RN7 A;  4AG7 A;  2ZEH A;  1ARL A;  4C2Z A;  2AFZ A;  1IOI A;  2P6G A;  2Q43 A;  5F46 A;  2QYV A;  3PEI A;  3B7I A;  2PSW A;  2JEW A;  3VAR A;  4C7H A;  5CNP A;  4CAE A;  2GAN A;  4A31 A;  4TWE A;  4FD6 A;  1TKJ A;  4KSI A;  1YME A;  1Q2Y A;  1Y0R A;  4MFZ A;  2DF5 A;  2FIW A;  5J1Q A;  1BOB A;  4FD7 A;  4OAE A;  4A37 A;  4CYO A;  4KSF A;  2VBQ A;  3B35 A;  2REE A;  1A2Z A;  5LRK A;  1QMU A;  1TIQ A;  3JTK A;  3L2N A;  5FVJ A;  2WPW A;  5K8N A;  1JWQ A;  4OKO A;  2XEF A;  4KOY A;  4MBU A;  2EK9 A;  1YQE A;  4MHY A;  2ZOF A;  1NSA A;  3FBU A;  2FE7 A;  3KAS A;  2HQY A;  3PB4 X;  1J4J A;  2BUE A;  1R43 A;  2EVN A;  2H5M A;  3KI9 A;  4A38 A;  1UFH A;  1EE3 P;  2WYR A;  4K3N A;  1ON0 A;  3P2F A;  1YX0 A;  4ZI6 A;  1ZG8 A;  3PFE A;  2C1C A;  1AYE A;  5JM6 A;  2XEG A;  1LRZ A;  1TKH A;  4E0A A;  5JPH A;  4II9 A;  1FT7 A;  1Y7R A;  4C2X A;  1ELM P;  3EXN A;  3IWW A;  3F5B A;  1DE4 C;  4OC3 A;  3H4Q A;  4HNY B;  4PV6 A;  2PCU A;  1S7N A;  4BMH A;  4KUB A;  4MHN A;  3D8P A;  1S5K A;  5DWM A;  3S9M A;  2GIV A;  1M4G A;  1QSN A;  2PVW A;  2JBK A;  2DEA A;  1MJB A;  4NCZ A;  4MFK A;  4EME A;  1LCP A;  1TKF A;  3IO1 A;  5HH1 A;  4CGP A;  1Z4E A;  2QML A;  2RFH A;  2CTC A;  4FUU A;  4DUK A;  4ZY1 A;  4QC6 A;  1PU9 A;  3KHX A;  4OME A;  2FS5 A;  3FED A;  2CXA A;  3TT2 A;  4MCQ A;  2OB0 A;  2RB7 A;  3FF3 A;  2EWB A;  1CJW A;  4IK2 A;  4NFR A;  2O53 A;  5G1Z A;  3CXP A;  2DXQ A;  2PJ7 A;  4HPS A;  1HDU A;  3FRM A;  5THW A;  3FMC A;  4CRY B;  4QB9 A;  2ZW5 A;  4J3G A;  2Z11 A;  3PRT A;  4PSX A;  4FD4 A;  3R96 A;  4M3S A;  4M6I A;  4HNX B;  4NGR A;  4AXV A;  4DJL A;  5I0C A;  2Z3M A;  1NMT A;  1JQG A;  3D2P A;  1R57 A;  3QAY A;  4Q36 A;  2HUZ A;  2ABZ A;  4OC5 A;  3WR7 A;  4C7I A;  4YGO A;  3W6X A;  1CM0 A;  5G20 A;  3CZX A;  1WK4 A;  1I12 A;  1M44 A;  4Q38 A;  4YWY A;  4KZT A;  3TFY A;  4MCS A;  1VHE A;  2B3U A;  2PJA A;  4MFJ A;  4MFL A;  3W91 A;  3WC7 A;  3FEC A;  1SQH A;  3V8I A;  4F9V A;  2GRE A;  1ARM A;  1TXR A;  1Z8W A;  4UCP A;  4CAW A;  4ONW A;  4AG9 A;  4WJB A;  3KQZ A;  4ZX8 A;  2PIZ A;  3GB0 A;  2OU2 A;  2AFX A;  4P45 A;  3IGR A;  2BL1 A;  1KUY A;  4YFJ A;  3WAB A;  2F8H A;  1QQ9 A;  3DLJ A;  1IIC A;  1S7F A;  5F49 A;  1BO4 A;  2Z10 A;  3B3W A;  3QAH A;  4JD6 A;  4P4D A;  5JGF A;  5HXD A;  4U5Y A;  3SJX A;  4QVT A;  2PJ1 A;  2GE3 A;  4MCR A;  5LRJ A;  2POK A;  3IU2 A;  2CIJ A;  3SI1 A;  1CBX A;  4MMO A;  4NJR A;  2VI7 A;  1S60 A;  4FWU A;  2PE3 A;  3GKR A;  4CGO A;  2PJ2 A;  3DNS A;  2Q0Y A;  3EY5 A;  3I3G A;  4NXY A;  3KR5 A;  2GLJ A;  1OZP A;  3SJG A; 
#chains in the Genus database with same CATH homology
 2HB6 A;  3CZX A;  4BIN A;  5EMI A;  2ODF A;  4M6H A;  4M6G A;  3QAY A;  4EFD A;  2Q7S A;  1XOV A;  4LQ6 A;  4RN7 A;  1JWQ A;  3NE8 A;  2HC9 A;  4M6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...