3P2HA

Crystal structure of tofi in a ternary complex with an inhibitor and mta
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
184
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLGWQLPSEDEKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AHL synthase
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
molecule tags Signaling protein/inhibitor
total genus 55
structure length 184
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2hA00
3S6KA 4QB9A 2ZW4A 2Q4YA 3BLNA 4E2AA 4QC6A 1WWZA 3ZZIA 2K5TA 4L8AA 5F46A 2Z0ZA 5KTAA 1PUAA 4J3GA 5KTDA 4UA3A 5IV0A 2VQYA 4HNYB 2B3UA 2Q44A 3FNCA 4KOTA 4AB7A 2J8RA 4FD6A 5GCNA 4YGOA 2B4BA 2REFA 4PSXA 4BMHA 1KUXA 1FY7A 4F0YA 1MJAA 2D4OA 1IYLA 4XPDC 1MJBA 2D4PA 2B5GA 3DSBA 3LODA 2GE3A 1Z4RA 3FYNA 3TFYA 4KOXA 2FXFA 3TTHA 1KUYA 4ZBGA 3SXOA 1XEBA 4AVBA 4NXYA 2VZZA 1WK4A 1LRZA 3D8PA 1J4JA 2FIAA 3D2MA 3S6HA 2F5IA 2FT0A 2BSWA 4XPDB 2HUZA 4K30A 4FD5A 1QSNA 1Y9WA 3DNSA 3C26A 4XNHC 2P6EA 1I21A 3JVNA 5JQ4A 3S6GA 3DR6A 4QBJA 4KOVA 4EVYA 3SHPA 1S3ZA 5C82A 1Q2DA 1MK4A 4QVTA 2VBQA 3KKWA 3WR7A 1I12A 4KUAA 2B4DB 2FE7A 3H4QA 2JDDA 3D2PA 1SQHA 1Z9UA 4R9MA 1YX0A 1Q2YA 1CJWA 3IWGA 2REEA 4U9YA 4UWJA 4XNHB 1U6MA 5I0CA 2PQ8A 4LX9A 4PSWA 2ZPAA 1KZFA 3EO4A 2B3VA 2FIWA 2CNTA 3T90A 2FCKA 3B8GA 3W6XA 1S7LA 2FS5A 4KVXA 4AVCA 2ARHA 4B5OA 5DWNA 3IGRA 2Q4VA 1PU9A 2PR1A 1B6BA 3S6FA 2VXKA 3QB8A 4OADA 2DXQA 5KTCA 2G0BA 3RYOA 4IUSA 4KOSA 1VHSA 3P2FA 1S7FA 4L89A 2X7BA 3FXTA 2QIRA 1YVOA 2BEIA 4NEXA 3CXPA 4RS2A 3MGDA 3R95A 4MY0A 5HMNA 2ZW6A 1YR0A 5H84A 3OWCA 4RI1A 4NSQA 4OAEA 4JJXA 1GHEA 2R8VA 1S5KA 1B87A 4R3KA 4KUBA 4PV6A 1IB1E 4PK2A 2H5MA 3DDDA 1QSTA 1Y9KA 3R96A 4AVAA 4KVOE 2FL4A 3R1KA 1Q2CA 3P2HA 3TO9A 2PC1A 3SXNA 5ISVA 2B58A 2R98A 2QECA 1CM0A 4FD7A 3BJ8A 3F5BA 4MI4A 3VWDA 1R57A 2GIVA 3G3SA 4GS4A 2OZHA 2P0WA 4CAVA 5HH1A 5IX3A 3W6SA 2OH1A 1M1DA 4QUSA 3FB3A 2B4DA 1XMTA 1L0CA 2WPWA 4KOUA 3K9UA 2VI7A 1BO4A 2RC4A 5C88A 1Z4EA 3E0KA 4MHDA 1YREA 4JLYA 2B5GB 4LUAA 2ZW5A 4KOWA 2HV2A 4ONUA 5EC4A 4ORFA 2EUIA 4JXQA 1S7KA 4H6UA 2OZGA 5J8CA 1S60A 2J8MA 4R87A 5F49A 1QSRA 4JD6A 2G3TA 5F47A 1QSMA 1IYKA 4KLVA 2PRBA 1XF8A 1QSOA 2ATRA 2PSWA 2Z10A 4KVME 1BOBA 2NMTA 2BL1A 3N7ZA 3UY5A 2JDCA 1TIQA 4U5YA 2Z11A 4I49A 2J8NA 4MY3A 3R9EA 1M4DA 3LD2A 3TOBA 4B5PB 1YK3A 2JLMA 4HNXB 3TE4A 2CY2A 5EBVA 4IF5A 1YGHA 4OLLA 3FRMA 1VKCA 4H6ZA 1MJ9A 4E8OA 1M4IA 3PGPA 1M4GA 5F48A 5JPHA 4MBUA 3CXSA 4PK3A 1S7NA 4NF1A 4KLWA 2Q7BA 2A4NA 3I3GA 5H86A 4CS0B 2EVNA 1YVKA 3TT2A 1P0HA 3PP9A 4KZTA 4R57A 2PDOA 2Y0MA 1RXTA 2IL4A 4CRYB 2GANA 3R9FA 4XPLA 4XPKA 1V0CA 4FD4A 5FVJA 1Y7RA 1N71A 3R9GA 3F8KA 4CAWA 2AJ6A 4YRHA 3DR8A 2Q0YA 2FSRA 1IIDA 4NCZA 2I00A 3PZJA 3EC4A 3GYAA 3W91A 2OU2A 3I9SA 3FBUA 5CNPA 2ZW7A 4M3SA 4HKFA 4X5KA 4Y49C 2C27A 3FIXA 2HQYA 5E96A 1P4NA 2QMLA 2CNSA 2PR8A 4UBRA 5DWMA 1YLEA 2BUEA 3TOAA 3TO6A 4AG7A 2VZYA 3QAHA 1NE9A 3JUWA 3TCVA 4M85A 3BJ7A 2OZUA 1UFHA 3GY9A 2CNMA 4UWIA 4YFJA 3D3SA 4MJ8A 4CAXA 5J8FA 4E0AA 3T9YA 4HNWB 2JEVA 4Y49B 4U9ZA 4CRZB 2WPXA 2KCWA 1XIXA 5IB0A 1K4JA 3V8IA 2P6GA 2VEZA 4H89A 4DNCA 3EXNA 4B5PA 2ZXVA 1OZPA 2R7HA 2P6FA 3EY5A 4JXRA 1NSLA 2OB0A 3G8WA 3ZJ0A 4JWPA 3NE7A 2G3AA 3F0AA 1XE4A 2I79A 1KUVA 3CXQA 1IICA 1NMTA 2O28A 3EFAA 4KOYA 1I1DA 4AG9A 4KORA 3GKRA 4R3LA 4II9A 3TO7A 2R1IA 1RO5A 1M44A 2AE6A 4F6AA 2Q04A 3VWEA 1ON0A
chains in the Genus database with same CATH superfamily
4C7HA 3S6KA 4QB9A 4JZ0A 2PVVA 2ZW4A 4UCNA 1ELMP 3KHZA 3JTKA 2Q4YA 3BLNA 4E2AA 4QC6A 1WWZA 3ZZIA 2K5TA 1JQGA 2V77A 4L8AA 5F46A 2CF4A 4NGRA 4A95A 2Z0ZA 3CDXA 2ZEFA 4FUUA 4MCSA 5KTAA 3BHXA 2NYQA 5A28A 2ANPA 2PJ3A 1PUAA 5G20A 2CXAA 4J3GA 5KTDA 4UA3A 4OC1A 2ZEPA 5IV0A 3K9TA 2VQYA 2Q7SA 4HNYB 4B10A 2B3UA 2Q44A 3FNCA 1QMUA 6CPAA 2NSMA 1XMBA 2AFUA 4KOTA 4AB7A 4ZI6A 2J8RA 3NA6A 3FJUA 4FD6A 5GCNA 3SI1A 4YGOA 4M6IA 1ELLP 2B4BA 4R76A 2REFA 4KSAA 1GYTA 3H8GA 4FAIA 1XJOA 4PSXA 4BMHA 4CGLA 5LYFA 1KUXA 1FY7A 4F0YA 1MJAA 1VHEA 4ZY0A 2D4OA 4UFVA 3MN8A 1IYLA 2BOAA 4XPDC 4CGMA 3ISXA 1AUGA 1MJBA 2EK8A 3KHXA 4O23A 2D4PA 2G9DA 3BI1A 3VH9A 2B5GA 4UEZA 3DSBA 3LODA 4P6YA 3WABA 2GE3A 1Z4RA 3FYNA 3TFYA 4KOXA 5HVFA 2DF5A 2YGWA 2FXFA 4X3RA 3TTHA 5DS0A 2PJCA 1KUYA 4ZBGA 2XEIA 3TC8A 3SXOA 1XEBA 4AVBA 4NXYA 2VZZA 2FVGA 5HVHA 1WK4A 1LRZA 2CTBA 3D8PA 1ARMA 3WT4A 5AG5A 4RUHA 3HLPA 1FNOA 2PJBA 3NE8A 4DJLA 4OP4A 1J4JA 2FIAA 4NJQA 3FEEA 3D2MA 1YMEA 1ZG8A 3S6HA 2Z3MA 1HEEA 3PB6X 2F5IA 1QQ9A 2FT0A 4MHNA 2BSWA 3KASA 4IK2A 4XPDB 1EE3P 2PVWA 2HUZA 2PJ7A 4MRIA 4K30A 3BI0A 4FD5A 1QSNA 1Y9WA 3DNSA 3C26A 4XNHC 5G1ZA 2P6EA 3LACA 3TX8A 4OMEA 1I21A 3JVNA 4YU9A 5JQ4A 3S6GA 4AXVA 3S9NA 3DR6A 4QBJA 4KOVA 4EVYA 3SHPA 1F57A 1S3ZA 3PBBA 1Q2DA 5C82A 1MK4A 4FWUA 2ODFA 4QVTA 4CGNA 1BLLE 2EBJA 2VBQA 3KKWA 3SI2A 5AG4A 4MXUA 1TF8A 2Z3NA 3WR7A 4R7MA 1I12A 4KUAA 2B4DB 2FE7A 3H4QA 2JDDA 5JM6A 3D2PA 1SQHA 1Y0RA 3N5FA 3H8EA 1Z9UA 3L2NA 4R9MA 1YQEA 3FX6A 1BAVA 3WC5A 4Q7AA 4BINA 4P4BA 1YX0A 4CGOA 1Q2YA 1CJWA 2ZOFA 3IWGA 8CPAA 2REEA 2GFQA 1FT7A 3D7DA 4U9YA 4A33A 2Z3PA 1YSJA 4A94A 4UWJA 1YW4A 4XNHB 2Z3OA 1U6MA 3CPXA 5I0CA 2PQ8A 3GIUA 4LX9A 4PSWA 2ZPAA 1KZFA 2JEWA 3EO4A 3IWEA 4UCMA 2B3VA 2FIWA 2CNTA 5D29A 2FCKA 3B8GA 3T90A 3W6XA 1S7LA 2FS5A 2AFWA 4KVXA 3NH4A 4NGQA 4AVCA 2ARHA 5HXDA 4B5OA 5DWNA 1Q7LA 2Q4VA 3B3CA 3IGRA 1PU9A 2PR1A 3PB9X 4P4FA 1M4LA 4UEEA 1B6BA 4ZX9A 3S6FA 4CAEA 3FMCA 3SJFA 3SJXA 2VXKA 3QB8A 3LWUA 2I3CA 1LANA 4OADA 1CP7A 5LYIA 2DXQA 3PB7X 4TWEA 5KTCA 2G0BA 2ZEOA 3RYOA 4IUSA 4KOSA 1NSAA 1CX8A 1VHSA 1H8LA 1VIXA 3P2FA 4P10A 1Z8WA 1TF9A 2GREA 2HB6A 3CZXA 3FF3A 1S7FA 4L89A 2X7BA 3FXTA 2QIRA 4X8IA 1YVOA 2BEIA 2GLFA 4NEXA 4A2ZA 3CXPA 3IJ3A 4RS2A 1PCAA 4Q38A 3MGDA 3R95A 2ZEDA 5LRGA 4C2ZA 2XEJA 3NH8A 4MY0A 4LQGA 4MFJA 1AYEA 4GM5A 4UEFA 5K8PA 2PJ0A 2V8HA 3FEDA 2VL1A 5HMNA 2ZW6A 2EO8A 3GUXA 2WUUA 1YR0A 2PJ1A 2GU2A 2PJ5A 3QAYA 5H84A 2PIYA 4DYOA 1LAPA 3OWCA 4R8FA 4RI1A 4NSQA 2IMOA 4OAEA 3V7ZA 5D8NA 4JJXA 1GHEA 2R8VA 1S5KA 1B87A 4P4EA 4R3KA 4X2TA 4OKOA 2HC9A 3S9MA 2PJ9A 4R6TA 1YW6A 4KUBA 4OC0A 4PV6A 1IB1E 4MHYA 1TKFA 4NGSA 1HDUA 4IHMA 4PK2A 2H5MA 1Y7EA 3DDDA 1QSTA 1Y9KA 2CTCA 2RFHA 3R96A 4AVAA 4KVOE 2PJ6A 2FL4A 3R1KA 1XOVA 1Q2CA 2Z3KA 3B3VA 2XEFA 3DGVA 3P2HA 2DPTA 4F0XA 3TO9A 4CYQA 2EWBA 2PC1A 1Z8TA 3V38A 4KSFA 3SXNA 5ISVA 2XEGA 3IO1A 2B58A 2R98A 2QECA 1CM0A 1IOIA 2J9AA 4FD7A 4PPZA 4C2YA 3BJ8A 1XBUA 4UIBA 2PE3A 3F5BA 1XRYA 4YWYA 4MI4A 3KI9A 4GXHA 4FBEA 1ZO0A 3VWDA 1R57A 4F9VA 2C1CA 2GIVA 3G3SA 4GS4A 4P4IA 2OZHA 1IY7A 2P0WA 3KR4A 4CAVA 4C68A 5HH1A 4W9YA 2C6GA 5IX3A 3W6SA 3PRTA 2OH1A 1M1DA 4QUSA 2JBKA 3FB3A 4UF4A 4EWTA 4PXEA 2B4DA 1ZLHA 1XMTA 1Z5RA 1L0CA 4MFQA 1LCPA 2Q51A 1CG2A 2WPWA 4KOUA 3RZAA 3IU1A 2BCOA 3K9UA 2VI7A 3SJEA 1BPMA 1BO4A 4RN7A 4EMEA 3LMSA 4UFWA 2RC4A 1DE4C 3SJGA 4Z65A 5C88A 3KQXA 1Z4EA 3E0KA 4MHDA 1YREA 2BO9A 4JLYA 4B6ZA 4UCPA 2B5GB 2ZEGA 4LUAA 1CPSA 2ZW5A 2QYVA 4KOWA 2HV2A 3H8FA 4ONUA 4C7IA 3NFZA 5EC4A 4ORFA 2EUIA 4B11A 2O53A 4A39A 1Z2LA 4JXQA 1S7KA 1RTQA 1CBXA 2YNCC 4MFKA 3PB4X 4WJBA 4PXBA 4ZGYB 2PJ4A 3D66A 1HDQA 4MFPA 2PJAA 2AFMA 2IJZA 4H6UA 1X12A 2GLJA 3RAMA 4B13A 2OZGA 5J8CA 4OIDA 2YNEA 1IGBA 1S60A 2PRQA 2J8MA 3S9LA 4P4JA 2PJ8A 3H5ZA 4Q36A 4R87A 3KL9A 5F49A 1QSRA 4JD6A 4MFLA 2G3TA 3WC7A 5F47A 2V8GA 1QSMA 4K3NA 1IYKA 4KLVA 2PRBA 1XF8A 1QSOA 2ATRA 2PSWA 2Z10A 4KVME 1OBRA 4ZY2A 2PCUA 1BOBA 2ZEMA 4CYPA 2NMTA 1F2OA 2BL1A 3B7IA 3N7ZA 5K8MA 3UY5A 5BWAB 2JDCA 1TIQA 2PIZA 3IEHA 4U5YA 3GLJA 1LAMA 2Z11A 4KS9A 2WYRA 3NH5A 4P4DA 4I49A 2J8NA 4CPAA 3FECA 2Z3LA 3A9LA 4MY3A 4PXDA 4TNUA 3WC6A 5LYLA 1TXRA 4NGTA 3R9EA 1M4DA 4ZYQA 3LD2A 4OC2A 3PFOA 4NGNA 3CPAA 3TOBA 4B5PB 1YK3A 2C6CA 2JLMA 5AG6A 3JRUA 4HNXB 4PQAA 3PB8X 5CPAA 5G22A 2AFSA 2AFZA 3TE4A 4CYOA 5JGFA 4A37A 4A32A 2V8DA 4P44A 2QJ8A 3IFEA 4JYWA 3KR5A 4MHZA 3VATA 4UFXA 3BXMA 2CY2A 4HPSA 3RBUA 1ZG7A 5AG7A 5EBVA 4IF5A 4OC3A 1YGHA 4OLLA 1IU8A 1Y0YA 3FRMA 1VKCA 4H6ZA 1MJ9A 4E8OA 4MMOA 1M4IA 4NGPA 3PGPA 1M4GA 5F48A 2Q4ZA 5JPHA 4NFRA 4MBUA 3CXSA 4PK3A 1S7NA 4NF1A 4KLWA 5ELYA 2Q7BA 2A4NA 5I4MA 3I3GA 5H86A 2WZNA 4CS0B 2EVNA 4IAVA 1YVKA 4BBHA 4G1PA 2POKA 3TT2A 3B3SA 1P0HA 3FH4A 3PP9A 1DTDA 2DEAA 4KZTA 4PXCA 4R57A 2ZEEA 2PDOA 2Y0MA 1RXTA 1JWQA 3PBEA 2IL4A 4OC5A 3PFEA 2ZEHA 3RO0A 4CRYB 1VHOA 3FVLA 1A2ZA 2GANA 1XFOA 4XPLA 3R9FA 4XPKA 1R43A 1V0CA 3D7FA 3PEIA 4FD4A 3MRUA 5FVJA 1Y7RA 4A31A 3K2KA 3D68A 1N71A 3R9GA 3F8KA 4C2XA 4CAWA 2AJ6A 2EK9A 2Q43A 2RB7A 4YRHA 4M6GA 1ARLA 3DR8A 4MCQA 2Q0YA 2FSRA 1IOFA 1IIDA 2OR4A 4NCZA 2I00A 4OC4A 3PZJA 3EC4A 3GYAA 3D4UA 3HUVA 2OU2A 3I9SA 3FBUA 3IIBA 3RNZA 3W91A 2AFXA 5CNPA 2ZW7A 4M3SA 5THWA 5G21A 3VARA 5F09A 4HKFA 4ZX8A 5K8OA 2ABZA 4X5KA 4MCPA 2QVPA 1AMPA 5IB9A 4CYNA 5CBMA 4Y49C 2C27A 3FIXA 2HQYA 5E96A 1CP6A 2V8VA 5EMIA 1P4NA 5LRJA 2QMLA 3KZWA 4NJRA 2CNSA 2PR8A 4UBRA 5DWMA 1YLEA 2BUEA 3TOAA 3TO6A 4AG7A 2VZYA 3QAHA 1NE9A 3JUWA 3TCVA 2YNDA 4A38A 4M85A 2ZOGA 3BJ7A 4MFZA 5LYDA 2OZUA 2ZENA 3D67A 1UFHA 1Z8XA 1LFWA 3D7GA 2CNMA 3GY9A 3I1UA 1UWYA 4UWIA 3QNVA 4P45A 2C6PA 4YFJA 3D3SA 3KQZA 4MJ8A 4CAXA 5J8FA 4ZY1A 3D7HA 1R3NA 2F7VA 3B3TA 4E0AA 3T9YA 2YNCA 4HNWB 2JEVA 4MHPA 1PYTB 5J1QA 3B35A 4U9ZA 4Y49B 7CPAA 2PJ2A 1X10A 4CRZB 2WPXA 2KCWA 2CIJA 1XIXA 3IC1A 3IU2A 3KGQA 5A27A 2IQ6A 4H2KA 5IB0A 5JH9A 1K4JA 3DLJA 2P6GA 3V8IA 1BPNA 1ZLIA 2VEZA 4H89A 5AGEA 4DNCA 1VGYA 3T8WA 4CAFA 3EXNA 4DUKA 4EFDA 1LOKA 2ZXVA 4B5PA 4B14A 4F8ZA 4WWVA 1OZPA 1Z8LA 2ZELA 2JBJA 2WSAA 2R7HA 2P6FA 3EY5A 4JXRA 1TKHA 4UIAA 1NSLA 5K8NA 2OB0A 3G8WA 1F2PA 3CT9A 3ZJ0A 4KSIA 3ISZA 2DPSA 3IWWA 5LRKA 4JWPA 2AFOA 2F8HA 3B2YA 3NE7A 4LQ6A 2G3AA 3GB0A 3F0AA 1XE4A 2I79A 1KUVA 3CXQA 1IICA 1NMTA 5HVGA 2O28A 4B12A 3EFAA 3B3WA 4MCRA 4ONWA 4KOYA 1I1DA 1ZG9A 4AG9A 4BD9A 4KORA 3GKRA 4R3LA 4II9A 1CPXA 4NGMA 3TO7A 4A30A 4F9UA 3SI0A 2R1IA 4OIWA 2OOTA 1YLOA 2O4HA 4M6HA 1RO5A 1M44A 2AE6A 4CGPA 4F6AA 2Q04A 1KWMA 3VWEA 1ON0A 1TKJA
chains in the Genus database with same CATH topology
4C7HA 3S6KA 4QB9A 2ZW4A 4UCNA 3JTKA 2Q4YA 3BLNA 4E2AA 4QC6A 1WWZA 3ZZIA 2K5TA 4L8AA 5F46A 4A95A 2Z0ZA 5KTAA 5A28A 1PUAA 5G20A 2CXAA 4J3GA 5KTDA 4UA3A 5IV0A 2VQYA 4HNYB 4B10A 2B3UA 2Q44A 3FNCA 4KOTA 4AB7A 2J8RA 4FD6A 5GCNA 4YGOA 2B4BA 2REFA 4KSAA 4PSXA 4BMHA 4CGLA 1KUXA 1FY7A 4F0YA 1MJAA 2D4OA 4UFVA 1IYLA 4XPDC 4CGMA 1MJBA 2D4PA 2B5GA 3DSBA 3LODA 2GE3A 1Z4RA 3FYNA 3TFYA 4KOXA 2YGWA 2FXFA 3TTHA 1KUYA 4ZBGA 3SXOA 1XEBA 4AVBA 4NXYA 2VZZA 1WK4A 1LRZA 3D8PA 5AG5A 1J4JA 2FIAA 3D2MA 3S6HA 2Z3MA 2F5IA 2FT0A 2BSWA 4XPDB 2HUZA 4K30A 4FD5A 1QSNA 1Y9WA 3DNSA 3C26A 4XNHC 5G1ZA 2P6EA 1I21A 3JVNA 5JQ4A 3S6GA 3DR6A 4QBJA 4KOVA 4EVYA 3SHPA 1S3ZA 5C82A 1Q2DA 1MK4A 4QVTA 4CGNA 2VBQA 5AG4A 3KKWA 2Z3NA 3WR7A 1I12A 4KUAA 2B4DB 2FE7A 3H4QA 2JDDA 3D2PA 1SQHA 1Z9UA 4R9MA 1YX0A 4CGOA 1Q2YA 1CJWA 3IWGA 2REEA 4U9YA 4A33A 2Z3PA 4UWJA 4XNHB 2Z3OA 1U6MA 5I0CA 2PQ8A 4LX9A 4PSWA 2ZPAA 1KZFA 3EO4A 3IWEA 4UCMA 2B3VA 2FIWA 2CNTA 3T90A 2FCKA 3B8GA 3W6XA 1S7LA 2FS5A 4KVXA 4AVCA 2ARHA 4B5OA 5DWNA 3IGRA 2Q4VA 1PU9A 2PR1A 1B6BA 3S6FA 4CAEA 2VXKA 3QB8A 4OADA 2DXQA 5KTCA 2G0BA 3RYOA 4IUSA 4KOSA 1VHSA 3P2FA 1S7FA 4L89A 2X7BA 3FXTA 2QIRA 1YVOA 2BEIA 4NEXA 4A2ZA 3CXPA 4RS2A 4Q38A 3MGDA 3R95A 4C2ZA 4MY0A 4MFJA 5HMNA 2ZW6A 2WUUA 1YR0A 5H84A 3OWCA 4RI1A 4NSQA 4OAEA 4JJXA 1GHEA 2R8VA 1S5KA 1B87A 4R3KA 4KUBA 4PV6A 1IB1E 4PK2A 2H5MA 3DDDA 1QSTA 1Y9KA 3R96A 4AVAA 4KVOE 2FL4A 3R1KA 1Q2CA 2Z3KA 3P2HA 2DPTA 4F0XA 3TO9A 4CYQA 2PC1A 4KSFA 3SXNA 5ISVA 2B58A 2R98A 2QECA 1CM0A 4FD7A 4C2YA 3BJ8A 3F5BA 4MI4A 1ZO0A 3VWDA 1R57A 2GIVA 3G3SA 4GS4A 2OZHA 2P0WA 4CAVA 4C68A 5HH1A 5IX3A 3W6SA 2OH1A 1M1DA 4QUSA 3FB3A 2B4DA 1XMTA 1L0CA 4MFQA 2WPWA 4KOUA 3IU1A 3K9UA 2VI7A 1BO4A 4UFWA 2RC4A 5C88A 1Z4EA 3E0KA 4MHDA 1YREA 4JLYA 4UCPA 2B5GB 4LUAA 2ZW5A 4KOWA 2HV2A 4ONUA 4C7IA 5EC4A 4ORFA 2EUIA 4B11A 4JXQA 1S7KA 2YNCC 4MFKA 4ZGYB 4MFPA 4H6UA 4B13A 2OZGA 5J8CA 2YNEA 1S60A 2J8MA 3H5ZA 4Q36A 4R87A 5F49A 1QSRA 4JD6A 4MFLA 2G3TA 5F47A 1QSMA 1IYKA 4KLVA 2PRBA 1XF8A 1QSOA 2ATRA 2PSWA 2Z10A 4KVME 1BOBA 4CYPA 2NMTA 2BL1A 3N7ZA 3UY5A 5BWAB 2JDCA 1TIQA 4U5YA 2Z11A 4KS9A 4I49A 2J8NA 2Z3LA 3A9LA 4MY3A 3R9EA 1M4DA 3LD2A 3TOBA 4B5PB 1YK3A 2JLMA 5AG6A 5G22A 4HNXB 3TE4A 4CYOA 4A32A 4UFXA 2CY2A 5AG7A 5EBVA 4IF5A 1YGHA 4OLLA 3FRMA 1VKCA 4H6ZA 1MJ9A 4E8OA 1M4IA 3PGPA 1M4GA 5F48A 5JPHA 4MBUA 3CXSA 4PK3A 1S7NA 4NF1A 4KLWA 2Q7BA 2A4NA 3I3GA 5H86A 4CS0B 2EVNA 1YVKA 4BBHA 3TT2A 1P0HA 3PP9A 4KZTA 4R57A 2PDOA 2Y0MA 1RXTA 2IL4A 4CRYB 2GANA 3R9FA 4XPLA 4XPKA 1V0CA 4FD4A 5FVJA 1Y7RA 4A31A 1N71A 3R9GA 3F8KA 4C2XA 4CAWA 2AJ6A 4YRHA 3DR8A 2Q0YA 2FSRA 1IIDA 4NCZA 2I00A 3PZJA 3EC4A 3GYAA 3W91A 2OU2A 3I9SA 3FBUA 5CNPA 2ZW7A 4M3SA 5G21A 4HKFA 4X5KA 4CYNA 4Y49C 2C27A 3FIXA 2HQYA 5E96A 1P4NA 2QMLA 2CNSA 2PR8A 4UBRA 5DWMA 1YLEA 2BUEA 3TOAA 3TO6A 4AG7A 2VZYA 3QAHA 1NE9A 3JUWA 3TCVA 2YNDA 4M85A 4MFZA 3BJ7A 2OZUA 1UFHA 3GY9A 2CNMA 4UWIA 4YFJA 3D3SA 4MJ8A 4CAXA 5J8FA 4E0AA 3T9YA 2YNCA 4HNWB 2JEVA 4Y49B 4U9ZA 4CRZB 2WPXA 2KCWA 3IU2A 1XIXA 5A27A 5IB0A 1K4JA 3V8IA 2P6GA 2VEZA 4H89A 5AGEA 4DNCA 4CAFA 3EXNA 4B5PA 2ZXVA 4B14A 1OZPA 2WSAA 2R7HA 2P6FA 3EY5A 4JXRA 1NSLA 2OB0A 3G8WA 3ZJ0A 2DPSA 4JWPA 3NE7A 2G3AA 3F0AA 1XE4A 2I79A 1KUVA 3CXQA 1IICA 1NMTA 2O28A 4B12A 3EFAA 4KOYA 1I1DA 4AG9A 4KORA 3GKRA 4R3LA 4II9A 3TO7A 4A30A 2R1IA 1RO5A 1M44A 2AE6A 4CGPA 4F6AA 2Q04A 3VWEA 1ON0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6K A;  4QB9 A;  2ZW4 A;  2Q4Y A;  3BLN A;  4E2A A;  4QC6 A;  1WWZ A;  3ZZI A;  2K5T A;  4L8A A;  5F46 A;  2Z0Z A;  5KTA A;  1PUA A;  4J3G A;  5KTD A;  4UA3 A;  5IV0 A;  2VQY A;  4HNY B;  2B3U A;  2Q44 A;  3FNC A;  4KOT A;  4AB7 A;  2J8R A;  4FD6 A;  5GCN A;  4YGO A;  2B4B A;  2REF A;  4PSX A;  4BMH A;  1KUX A;  1FY7 A;  4F0Y A;  1MJA A;  2D4O A;  1IYL A;  4XPD C;  1MJB A;  2D4P A;  2B5G A;  3DSB A;  3LOD A;  2GE3 A;  1Z4R A;  3FYN A;  3TFY A;  4KOX A;  2FXF A;  3TTH A;  1KUY A;  4ZBG A;  3SXO A;  1XEB A;  4AVB A;  4NXY A;  2VZZ A;  1WK4 A;  1LRZ A;  3D8P A;  1J4J A;  2FIA A;  3D2M A;  3S6H A;  2F5I A;  2FT0 A;  2BSW A;  4XPD B;  2HUZ A;  4K30 A;  4FD5 A;  1QSN A;  1Y9W A;  3DNS A;  3C26 A;  4XNH C;  2P6E A;  1I21 A;  3JVN A;  5JQ4 A;  3S6G A;  3DR6 A;  4QBJ A;  4KOV A;  4EVY A;  3SHP A;  1S3Z A;  5C82 A;  1Q2D A;  1MK4 A;  4QVT A;  2VBQ A;  3KKW A;  3WR7 A;  1I12 A;  4KUA A;  2B4D B;  2FE7 A;  3H4Q A;  2JDD A;  3D2P A;  1SQH A;  1Z9U A;  4R9M A;  1YX0 A;  1Q2Y A;  1CJW A;  3IWG A;  2REE A;  4U9Y A;  4UWJ A;  4XNH B;  1U6M A;  5I0C A;  2PQ8 A;  4LX9 A;  4PSW A;  2ZPA A;  1KZF A;  3EO4 A;  2B3V A;  2FIW A;  2CNT A;  3T90 A;  2FCK A;  3B8G A;  3W6X A;  1S7L A;  2FS5 A;  4KVX A;  4AVC A;  2ARH A;  4B5O A;  5DWN A;  3IGR A;  2Q4V A;  1PU9 A;  2PR1 A;  1B6B A;  3S6F A;  2VXK A;  3QB8 A;  4OAD A;  2DXQ A;  5KTC A;  2G0B A;  3RYO A;  4IUS A;  4KOS A;  1VHS A;  3P2F A;  1S7F A;  4L89 A;  2X7B A;  3FXT A;  2QIR A;  1YVO A;  2BEI A;  4NEX A;  3CXP A;  4RS2 A;  3MGD A;  3R95 A;  4MY0 A;  5HMN A;  2ZW6 A;  1YR0 A;  5H84 A;  3OWC A;  4RI1 A;  4NSQ A;  4OAE A;  4JJX A;  1GHE A;  2R8V A;  1S5K A;  1B87 A;  4R3K A;  4KUB A;  4PV6 A;  1IB1 E;  4PK2 A;  2H5M A;  3DDD A;  1QST A;  1Y9K A;  3R96 A;  4AVA A;  4KVO E;  2FL4 A;  3R1K A;  1Q2C A;  3P2H A;  3TO9 A;  2PC1 A;  3SXN A;  5ISV A;  2B58 A;  2R98 A;  2QEC A;  1CM0 A;  4FD7 A;  3BJ8 A;  3F5B A;  4MI4 A;  3VWD A;  1R57 A;  2GIV A;  3G3S A;  4GS4 A;  2OZH A;  2P0W A;  4CAV A;  5HH1 A;  5IX3 A;  3W6S A;  2OH1 A;  1M1D A;  4QUS A;  3FB3 A;  2B4D A;  1XMT A;  1L0C A;  2WPW A;  4KOU A;  3K9U A;  2VI7 A;  1BO4 A;  2RC4 A;  5C88 A;  1Z4E A;  3E0K A;  4MHD A;  1YRE A;  4JLY A;  2B5G B;  4LUA A;  2ZW5 A;  4KOW A;  2HV2 A;  4ONU A;  5EC4 A;  4ORF A;  2EUI A;  4JXQ A;  1S7K A;  4H6U A;  2OZG A;  5J8C A;  1S60 A;  2J8M A;  4R87 A;  5F49 A;  1QSR A;  4JD6 A;  2G3T A;  5F47 A;  1QSM A;  1IYK A;  4KLV A;  2PRB A;  1XF8 A;  1QSO A;  2ATR A;  2PSW A;  2Z10 A;  4KVM E;  1BOB A;  2NMT A;  2BL1 A;  3N7Z A;  3UY5 A;  2JDC A;  1TIQ A;  4U5Y A;  2Z11 A;  4I49 A;  2J8N A;  4MY3 A;  3R9E A;  1M4D A;  3LD2 A;  3TOB A;  4B5P B;  1YK3 A;  2JLM A;  4HNX B;  3TE4 A;  2CY2 A;  5EBV A;  4IF5 A;  1YGH A;  4OLL A;  3FRM A;  1VKC A;  4H6Z A;  1MJ9 A;  4E8O A;  1M4I A;  3PGP A;  1M4G A;  5F48 A;  5JPH A;  4MBU A;  3CXS A;  4PK3 A;  1S7N A;  4NF1 A;  4KLW A;  2Q7B A;  2A4N A;  3I3G A;  5H86 A;  4CS0 B;  2EVN A;  1YVK A;  3TT2 A;  1P0H A;  3PP9 A;  4KZT A;  4R57 A;  2PDO A;  2Y0M A;  1RXT A;  2IL4 A;  4CRY B;  2GAN A;  3R9F A;  4XPL A;  4XPK A;  1V0C A;  4FD4 A;  5FVJ A;  1Y7R A;  1N71 A;  3R9G A;  3F8K A;  4CAW A;  2AJ6 A;  4YRH A;  3DR8 A;  2Q0Y A;  2FSR A;  1IID A;  4NCZ A;  2I00 A;  3PZJ A;  3EC4 A;  3GYA A;  3W91 A;  2OU2 A;  3I9S A;  3FBU A;  5CNP A;  2ZW7 A;  4M3S A;  4HKF A;  4X5K A;  4Y49 C;  2C27 A;  3FIX A;  2HQY A;  5E96 A;  1P4N A;  2QML A;  2CNS A;  2PR8 A;  4UBR A;  5DWM A;  1YLE A;  2BUE A;  3TOA A;  3TO6 A;  4AG7 A;  2VZY A;  3QAH A;  1NE9 A;  3JUW A;  3TCV A;  4M85 A;  3BJ7 A;  2OZU A;  1UFH A;  3GY9 A;  2CNM A;  4UWI A;  4YFJ A;  3D3S A;  4MJ8 A;  4CAX A;  5J8F A;  4E0A A;  3T9Y A;  4HNW B;  2JEV A;  4Y49 B;  4U9Z A;  4CRZ B;  2WPX A;  2KCW A;  1XIX A;  5IB0 A;  1K4J A;  3V8I A;  2P6G A;  2VEZ A;  4H89 A;  4DNC A;  3EXN A;  4B5P A;  2ZXV A;  1OZP A;  2R7H A;  2P6F A;  3EY5 A;  4JXR A;  1NSL A;  2OB0 A;  3G8W A;  3ZJ0 A;  4JWP A;  3NE7 A;  2G3A A;  3F0A A;  1XE4 A;  2I79 A;  1KUV A;  3CXQ A;  1IIC A;  1NMT A;  2O28 A;  3EFA A;  4KOY A;  1I1D A;  4AG9 A;  4KOR A;  3GKR A;  4R3L A;  4II9 A;  3TO7 A;  2R1I A;  1RO5 A;  1M44 A;  2AE6 A;  4F6A A;  2Q04 A;  3VWE A;  1ON0 A; 
#chains in the Genus database with same CATH topology
 4C7H A;  3S6K A;  4QB9 A;  4JZ0 A;  2PVV A;  2ZW4 A;  4UCN A;  1ELM P;  3KHZ A;  3JTK A;  2Q4Y A;  3BLN A;  4E2A A;  4QC6 A;  1WWZ A;  3ZZI A;  2K5T A;  1JQG A;  2V77 A;  4L8A A;  5F46 A;  2CF4 A;  4NGR A;  4A95 A;  2Z0Z A;  3CDX A;  2ZEF A;  4FUU A;  4MCS A;  5KTA A;  3BHX A;  2NYQ A;  5A28 A;  2ANP A;  2PJ3 A;  1PUA A;  5G20 A;  2CXA A;  4J3G A;  5KTD A;  4UA3 A;  4OC1 A;  2ZEP A;  5IV0 A;  3K9T A;  2VQY A;  2Q7S A;  4HNY B;  4B10 A;  2B3U A;  2Q44 A;  3FNC A;  1QMU A;  6CPA A;  2NSM A;  1XMB A;  2AFU A;  4KOT A;  4AB7 A;  4ZI6 A;  2J8R A;  3NA6 A;  3FJU A;  4FD6 A;  5GCN A;  3SI1 A;  4YGO A;  4M6I A;  1ELL P;  2B4B A;  4R76 A;  2REF A;  4KSA A;  1GYT A;  3H8G A;  4FAI A;  1XJO A;  4PSX A;  4BMH A;  4CGL A;  5LYF A;  1KUX A;  1FY7 A;  4F0Y A;  1MJA A;  1VHE A;  4ZY0 A;  2D4O A;  4UFV A;  3MN8 A;  1IYL A;  2BOA A;  4XPD C;  4CGM A;  3ISX A;  1AUG A;  1MJB A;  2EK8 A;  3KHX A;  4O23 A;  2D4P A;  2G9D A;  3BI1 A;  3VH9 A;  2B5G A;  4UEZ A;  3DSB A;  3LOD A;  4P6Y A;  3WAB A;  2GE3 A;  1Z4R A;  3FYN A;  3TFY A;  4KOX A;  5HVF A;  2DF5 A;  2YGW A;  2FXF A;  4X3R A;  3TTH A;  5DS0 A;  2PJC A;  1KUY A;  4ZBG A;  2XEI A;  3TC8 A;  3SXO A;  1XEB A;  4AVB A;  4NXY A;  2VZZ A;  2FVG A;  5HVH A;  1WK4 A;  1LRZ A;  2CTB A;  3D8P A;  1ARM A;  3WT4 A;  5AG5 A;  4RUH A;  3HLP A;  1FNO A;  2PJB A;  3NE8 A;  4DJL A;  4OP4 A;  1J4J A;  2FIA A;  4NJQ A;  3FEE A;  3D2M A;  1YME A;  1ZG8 A;  3S6H A;  2Z3M A;  1HEE A;  3PB6 X;  2F5I A;  1QQ9 A;  2FT0 A;  4MHN A;  2BSW A;  3KAS A;  4IK2 A;  4XPD B;  1EE3 P;  2PVW A;  2HUZ A;  2PJ7 A;  4MRI A;  4K30 A;  3BI0 A;  4FD5 A;  1QSN A;  1Y9W A;  3DNS A;  3C26 A;  4XNH C;  5G1Z A;  2P6E A;  3LAC A;  3TX8 A;  4OME A;  1I21 A;  3JVN A;  4YU9 A;  5JQ4 A;  3S6G A;  4AXV A;  3S9N A;  3DR6 A;  4QBJ A;  4KOV A;  4EVY A;  3SHP A;  1F57 A;  1S3Z A;  3PBB A;  1Q2D A;  5C82 A;  1MK4 A;  4FWU A;  2ODF A;  4QVT A;  4CGN A;  1BLL E;  2EBJ A;  2VBQ A;  3KKW A;  3SI2 A;  5AG4 A;  4MXU A;  1TF8 A;  2Z3N A;  3WR7 A;  4R7M A;  1I12 A;  4KUA A;  2B4D B;  2FE7 A;  3H4Q A;  2JDD A;  5JM6 A;  3D2P A;  1SQH A;  1Y0R A;  3N5F A;  3H8E A;  1Z9U A;  3L2N A;  4R9M A;  1YQE A;  3FX6 A;  1BAV A;  3WC5 A;  4Q7A A;  4BIN A;  4P4B A;  1YX0 A;  4CGO A;  1Q2Y A;  1CJW A;  2ZOF A;  3IWG A;  8CPA A;  2REE A;  2GFQ A;  1FT7 A;  3D7D A;  4U9Y A;  4A33 A;  2Z3P A;  1YSJ A;  4A94 A;  4UWJ A;  1YW4 A;  4XNH B;  2Z3O A;  1U6M A;  3CPX A;  5I0C A;  2PQ8 A;  3GIU A;  4LX9 A;  4PSW A;  2ZPA A;  1KZF A;  2JEW A;  3EO4 A;  3IWE A;  4UCM A;  2B3V A;  2FIW A;  2CNT A;  5D29 A;  2FCK A;  3B8G A;  3T90 A;  3W6X A;  1S7L A;  2FS5 A;  2AFW A;  4KVX A;  3NH4 A;  4NGQ A;  4AVC A;  2ARH A;  5HXD A;  4B5O A;  5DWN A;  1Q7L A;  2Q4V A;  3B3C A;  3IGR A;  1PU9 A;  2PR1 A;  3PB9 X;  4P4F A;  1M4L A;  4UEE A;  1B6B A;  4ZX9 A;  3S6F A;  4CAE A;  3FMC A;  3SJF A;  3SJX A;  2VXK A;  3QB8 A;  3LWU A;  2I3C A;  1LAN A;  4OAD A;  1CP7 A;  5LYI A;  2DXQ A;  3PB7 X;  4TWE A;  5KTC A;  2G0B A;  2ZEO A;  3RYO A;  4IUS A;  4KOS A;  1NSA A;  1CX8 A;  1VHS A;  1H8L A;  1VIX A;  3P2F A;  4P10 A;  1Z8W A;  1TF9 A;  2GRE A;  2HB6 A;  3CZX A;  3FF3 A;  1S7F A;  4L89 A;  2X7B A;  3FXT A;  2QIR A;  4X8I A;  1YVO A;  2BEI A;  2GLF A;  4NEX A;  4A2Z A;  3CXP A;  3IJ3 A;  4RS2 A;  1PCA A;  4Q38 A;  3MGD A;  3R95 A;  2ZED A;  5LRG A;  4C2Z A;  2XEJ A;  3NH8 A;  4MY0 A;  4LQG A;  4MFJ A;  1AYE A;  4GM5 A;  4UEF A;  5K8P A;  2PJ0 A;  2V8H A;  3FED A;  2VL1 A;  5HMN A;  2ZW6 A;  2EO8 A;  3GUX A;  2WUU A;  1YR0 A;  2PJ1 A;  2GU2 A;  2PJ5 A;  3QAY A;  5H84 A;  2PIY A;  4DYO A;  1LAP A;  3OWC A;  4R8F A;  4RI1 A;  4NSQ A;  2IMO A;  4OAE A;  3V7Z A;  5D8N A;  4JJX A;  1GHE A;  2R8V A;  1S5K A;  1B87 A;  4P4E A;  4R3K A;  4X2T A;  4OKO A;  2HC9 A;  3S9M A;  2PJ9 A;  4R6T A;  1YW6 A;  4KUB A;  4OC0 A;  4PV6 A;  1IB1 E;  4MHY A;  1TKF A;  4NGS A;  1HDU A;  4IHM A;  4PK2 A;  2H5M A;  1Y7E A;  3DDD A;  1QST A;  1Y9K A;  2CTC A;  2RFH A;  3R96 A;  4AVA A;  4KVO E;  2PJ6 A;  2FL4 A;  3R1K A;  1XOV A;  1Q2C A;  2Z3K A;  3B3V A;  2XEF A;  3DGV A;  3P2H A;  2DPT A;  4F0X A;  3TO9 A;  4CYQ A;  2EWB A;  2PC1 A;  1Z8T A;  3V38 A;  4KSF A;  3SXN A;  5ISV A;  2XEG A;  3IO1 A;  2B58 A;  2R98 A;  2QEC A;  1CM0 A;  1IOI A;  2J9A A;  4FD7 A;  4PPZ A;  4C2Y A;  3BJ8 A;  1XBU A;  4UIB A;  2PE3 A;  3F5B A;  1XRY A;  4YWY A;  4MI4 A;  3KI9 A;  4GXH A;  4FBE A;  1ZO0 A;  3VWD A;  1R57 A;  4F9V A;  2C1C A;  2GIV A;  3G3S A;  4GS4 A;  4P4I A;  2OZH A;  1IY7 A;  2P0W A;  3KR4 A;  4CAV A;  4C68 A;  5HH1 A;  4W9Y A;  2C6G A;  5IX3 A;  3W6S A;  3PRT A;  2OH1 A;  1M1D A;  4QUS A;  2JBK A;  3FB3 A;  4UF4 A;  4EWT A;  4PXE A;  2B4D A;  1ZLH A;  1XMT A;  1Z5R A;  1L0C A;  4MFQ A;  1LCP A;  2Q51 A;  1CG2 A;  2WPW A;  4KOU A;  3RZA A;  3IU1 A;  2BCO A;  3K9U A;  2VI7 A;  3SJE A;  1BPM A;  1BO4 A;  4RN7 A;  4EME A;  3LMS A;  4UFW A;  2RC4 A;  1DE4 C;  3SJG A;  4Z65 A;  5C88 A;  3KQX A;  1Z4E A;  3E0K A;  4MHD A;  1YRE A;  2BO9 A;  4JLY A;  4B6Z A;  4UCP A;  2B5G B;  2ZEG A;  4LUA A;  1CPS A;  2ZW5 A;  2QYV A;  4KOW A;  2HV2 A;  3H8F A;  4ONU A;  4C7I A;  3NFZ A;  5EC4 A;  4ORF A;  2EUI A;  4B11 A;  2O53 A;  4A39 A;  1Z2L A;  4JXQ A;  1S7K A;  1RTQ A;  1CBX A;  2YNC C;  4MFK A;  3PB4 X;  4WJB A;  4PXB A;  4ZGY B;  2PJ4 A;  3D66 A;  1HDQ A;  4MFP A;  2PJA A;  2AFM A;  2IJZ A;  4H6U A;  1X12 A;  2GLJ A;  3RAM A;  4B13 A;  2OZG A;  5J8C A;  4OID A;  2YNE A;  1IGB A;  1S60 A;  2PRQ A;  2J8M A;  3S9L A;  4P4J A;  2PJ8 A;  3H5Z A;  4Q36 A;  4R87 A;  3KL9 A;  5F49 A;  1QSR A;  4JD6 A;  4MFL A;  2G3T A;  3WC7 A;  5F47 A;  2V8G A;  1QSM A;  4K3N A;  1IYK A;  4KLV A;  2PRB A;  1XF8 A;  1QSO A;  2ATR A;  2PSW A;  2Z10 A;  4KVM E;  1OBR A;  4ZY2 A;  2PCU A;  1BOB A;  2ZEM A;  4CYP A;  2NMT A;  1F2O A;  2BL1 A;  3B7I A;  3N7Z A;  5K8M A;  3UY5 A;  5BWA B;  2JDC A;  1TIQ A;  2PIZ A;  3IEH A;  4U5Y A;  3GLJ A;  1LAM A;  2Z11 A;  4KS9 A;  2WYR A;  3NH5 A;  4P4D A;  4I49 A;  2J8N A;  4CPA A;  3FEC A;  2Z3L A;  3A9L A;  4MY3 A;  4PXD A;  4TNU A;  3WC6 A;  5LYL A;  1TXR A;  4NGT A;  3R9E A;  1M4D A;  4ZYQ A;  3LD2 A;  4OC2 A;  3PFO A;  4NGN A;  3CPA A;  3TOB A;  4B5P B;  1YK3 A;  2C6C A;  2JLM A;  5AG6 A;  3JRU A;  4HNX B;  4PQA A;  3PB8 X;  5CPA A;  5G22 A;  2AFS A;  2AFZ A;  3TE4 A;  4CYO A;  5JGF A;  4A37 A;  4A32 A;  2V8D A;  4P44 A;  2QJ8 A;  3IFE A;  4JYW A;  3KR5 A;  4MHZ A;  3VAT A;  4UFX A;  3BXM A;  2CY2 A;  4HPS A;  3RBU A;  1ZG7 A;  5AG7 A;  5EBV A;  4IF5 A;  4OC3 A;  1YGH A;  4OLL A;  1IU8 A;  1Y0Y A;  3FRM A;  1VKC A;  4H6Z A;  1MJ9 A;  4E8O A;  4MMO A;  1M4I A;  4NGP A;  3PGP A;  1M4G A;  5F48 A;  2Q4Z A;  5JPH A;  4NFR A;  4MBU A;  3CXS A;  4PK3 A;  1S7N A;  4NF1 A;  4KLW A;  5ELY A;  2Q7B A;  2A4N A;  5I4M A;  3I3G A;  5H86 A;  2WZN A;  4CS0 B;  2EVN A;  4IAV A;  1YVK A;  4BBH A;  4G1P A;  2POK A;  3TT2 A;  3B3S A;  1P0H A;  3FH4 A;  3PP9 A;  1DTD A;  2DEA A;  4KZT A;  4PXC A;  4R57 A;  2ZEE A;  2PDO A;  2Y0M A;  1RXT A;  1JWQ A;  3PBE A;  2IL4 A;  4OC5 A;  3PFE A;  2ZEH A;  3RO0 A;  4CRY B;  1VHO A;  3FVL A;  1A2Z A;  2GAN A;  1XFO A;  4XPL A;  3R9F A;  4XPK A;  1R43 A;  1V0C A;  3D7F A;  3PEI A;  4FD4 A;  3MRU A;  5FVJ A;  1Y7R A;  4A31 A;  3K2K A;  3D68 A;  1N71 A;  3R9G A;  3F8K A;  4C2X A;  4CAW A;  2AJ6 A;  2EK9 A;  2Q43 A;  2RB7 A;  4YRH A;  4M6G A;  1ARL A;  3DR8 A;  4MCQ A;  2Q0Y A;  2FSR A;  1IOF A;  1IID A;  2OR4 A;  4NCZ A;  2I00 A;  4OC4 A;  3PZJ A;  3EC4 A;  3GYA A;  3D4U A;  3HUV A;  2OU2 A;  3I9S A;  3FBU A;  3IIB A;  3RNZ A;  3W91 A;  2AFX A;  5CNP A;  2ZW7 A;  4M3S A;  5THW A;  5G21 A;  3VAR A;  5F09 A;  4HKF A;  4ZX8 A;  5K8O A;  2ABZ A;  4X5K A;  4MCP A;  2QVP A;  1AMP A;  5IB9 A;  4CYN A;  5CBM A;  4Y49 C;  2C27 A;  3FIX A;  2HQY A;  5E96 A;  1CP6 A;  2V8V A;  5EMI A;  1P4N A;  5LRJ A;  2QML A;  3KZW A;  4NJR A;  2CNS A;  2PR8 A;  4UBR A;  5DWM A;  1YLE A;  2BUE A;  3TOA A;  3TO6 A;  4AG7 A;  2VZY A;  3QAH A;  1NE9 A;  3JUW A;  3TCV A;  2YND A;  4A38 A;  4M85 A;  2ZOG A;  3BJ7 A;  4MFZ A;  5LYD A;  2OZU A;  2ZEN A;  3D67 A;  1UFH A;  1Z8X A;  1LFW A;  3D7G A;  2CNM A;  3GY9 A;  3I1U A;  1UWY A;  4UWI A;  3QNV A;  4P45 A;  2C6P A;  4YFJ A;  3D3S A;  3KQZ A;  4MJ8 A;  4CAX A;  5J8F A;  4ZY1 A;  3D7H A;  1R3N A;  2F7V A;  3B3T A;  4E0A A;  3T9Y A;  2YNC A;  4HNW B;  2JEV A;  4MHP A;  1PYT B;  5J1Q A;  3B35 A;  4U9Z A;  4Y49 B;  7CPA A;  2PJ2 A;  1X10 A;  4CRZ B;  2WPX A;  2KCW A;  2CIJ A;  1XIX A;  3IC1 A;  3IU2 A;  3KGQ A;  5A27 A;  2IQ6 A;  4H2K A;  5IB0 A;  5JH9 A;  1K4J A;  3DLJ A;  2P6G A;  3V8I A;  1BPN A;  1ZLI A;  2VEZ A;  4H89 A;  5AGE A;  4DNC A;  1VGY A;  3T8W A;  4CAF A;  3EXN A;  4DUK A;  4EFD A;  1LOK A;  2ZXV A;  4B5P A;  4B14 A;  4F8Z A;  4WWV A;  1OZP A;  1Z8L A;  2ZEL A;  2JBJ A;  2WSA A;  2R7H A;  2P6F A;  3EY5 A;  4JXR A;  1TKH A;  4UIA A;  1NSL A;  5K8N A;  2OB0 A;  3G8W A;  1F2P A;  3CT9 A;  3ZJ0 A;  4KSI A;  3ISZ A;  2DPS A;  3IWW A;  5LRK A;  4JWP A;  2AFO A;  2F8H A;  3B2Y A;  3NE7 A;  4LQ6 A;  2G3A A;  3GB0 A;  3F0A A;  1XE4 A;  2I79 A;  1KUV A;  3CXQ A;  1IIC A;  1NMT A;  5HVG A;  2O28 A;  4B12 A;  3EFA A;  3B3W A;  4MCR A;  4ONW A;  4KOY A;  1I1D A;  1ZG9 A;  4AG9 A;  4BD9 A;  4KOR A;  3GKR A;  4R3L A;  4II9 A;  1CPX A;  4NGM A;  3TO7 A;  4A30 A;  4F9U A;  3SI0 A;  2R1I A;  4OIW A;  2OOT A;  1YLO A;  2O4H A;  4M6H A;  1RO5 A;  1M44 A;  2AE6 A;  4CGP A;  4F6A A;  2Q04 A;  1KWM A;  3VWE A;  1ON0 A;  1TKJ A; 
#chains in the Genus database with same CATH homology
 4C7H A;  3S6K A;  4QB9 A;  2ZW4 A;  4UCN A;  3JTK A;  2Q4Y A;  3BLN A;  4E2A A;  4QC6 A;  1WWZ A;  3ZZI A;  2K5T A;  4L8A A;  5F46 A;  4A95 A;  2Z0Z A;  5KTA A;  5A28 A;  1PUA A;  5G20 A;  2CXA A;  4J3G A;  5KTD A;  4UA3 A;  5IV0 A;  2VQY A;  4HNY B;  4B10 A;  2B3U A;  2Q44 A;  3FNC A;  4KOT A;  4AB7 A;  2J8R A;  4FD6 A;  5GCN A;  4YGO A;  2B4B A;  2REF A;  4KSA A;  4PSX A;  4BMH A;  4CGL A;  1KUX A;  1FY7 A;  4F0Y A;  1MJA A;  2D4O A;  4UFV A;  1IYL A;  4XPD C;  4CGM A;  1MJB A;  2D4P A;  2B5G A;  3DSB A;  3LOD A;  2GE3 A;  1Z4R A;  3FYN A;  3TFY A;  4KOX A;  2YGW A;  2FXF A;  3TTH A;  1KUY A;  4ZBG A;  3SXO A;  1XEB A;  4AVB A;  4NXY A;  2VZZ A;  1WK4 A;  1LRZ A;  3D8P A;  5AG5 A;  1J4J A;  2FIA A;  3D2M A;  3S6H A;  2Z3M A;  2F5I A;  2FT0 A;  2BSW A;  4XPD B;  2HUZ A;  4K30 A;  4FD5 A;  1QSN A;  1Y9W A;  3DNS A;  3C26 A;  4XNH C;  5G1Z A;  2P6E A;  1I21 A;  3JVN A;  5JQ4 A;  3S6G A;  3DR6 A;  4QBJ A;  4KOV A;  4EVY A;  3SHP A;  1S3Z A;  5C82 A;  1Q2D A;  1MK4 A;  4QVT A;  4CGN A;  2VBQ A;  5AG4 A;  3KKW A;  2Z3N A;  3WR7 A;  1I12 A;  4KUA A;  2B4D B;  2FE7 A;  3H4Q A;  2JDD A;  3D2P A;  1SQH A;  1Z9U A;  4R9M A;  1YX0 A;  4CGO A;  1Q2Y A;  1CJW A;  3IWG A;  2REE A;  4U9Y A;  4A33 A;  2Z3P A;  4UWJ A;  4XNH B;  2Z3O A;  1U6M A;  5I0C A;  2PQ8 A;  4LX9 A;  4PSW A;  2ZPA A;  1KZF A;  3EO4 A;  3IWE A;  4UCM A;  2B3V A;  2FIW A;  2CNT A;  3T90 A;  2FCK A;  3B8G A;  3W6X A;  1S7L A;  2FS5 A;  4KVX A;  4AVC A;  2ARH A;  4B5O A;  5DWN A;  3IGR A;  2Q4V A;  1PU9 A;  2PR1 A;  1B6B A;  3S6F A;  4CAE A;  2VXK A;  3QB8 A;  4OAD A;  2DXQ A;  5KTC A;  2G0B A;  3RYO A;  4IUS A;  4KOS A;  1VHS A;  3P2F A;  1S7F A;  4L89 A;  2X7B A;  3FXT A;  2QIR A;  1YVO A;  2BEI A;  4NEX A;  4A2Z A;  3CXP A;  4RS2 A;  4Q38 A;  3MGD A;  3R95 A;  4C2Z A;  4MY0 A;  4MFJ A;  5HMN A;  2ZW6 A;  2WUU A;  1YR0 A;  5H84 A;  3OWC A;  4RI1 A;  4NSQ A;  4OAE A;  4JJX A;  1GHE A;  2R8V A;  1S5K A;  1B87 A;  4R3K A;  4KUB A;  4PV6 A;  1IB1 E;  4PK2 A;  2H5M A;  3DDD A;  1QST A;  1Y9K A;  3R96 A;  4AVA A;  4KVO E;  2FL4 A;  3R1K A;  1Q2C A;  2Z3K A;  3P2H A;  2DPT A;  4F0X A;  3TO9 A;  4CYQ A;  2PC1 A;  4KSF A;  3SXN A;  5ISV A;  2B58 A;  2R98 A;  2QEC A;  1CM0 A;  4FD7 A;  4C2Y A;  3BJ8 A;  3F5B A;  4MI4 A;  1ZO0 A;  3VWD A;  1R57 A;  2GIV A;  3G3S A;  4GS4 A;  2OZH A;  2P0W A;  4CAV A;  4C68 A;  5HH1 A;  5IX3 A;  3W6S A;  2OH1 A;  1M1D A;  4QUS A;  3FB3 A;  2B4D A;  1XMT A;  1L0C A;  4MFQ A;  2WPW A;  4KOU A;  3IU1 A;  3K9U A;  2VI7 A;  1BO4 A;  4UFW A;  2RC4 A;  5C88 A;  1Z4E A;  3E0K A;  4MHD A;  1YRE A;  4JLY A;  4UCP A;  2B5G B;  4LUA A;  2ZW5 A;  4KOW A;  2HV2 A;  4ONU A;  4C7I A;  5EC4 A;  4ORF A;  2EUI A;  4B11 A;  4JXQ A;  1S7K A;  2YNC C;  4MFK A;  4ZGY B;  4MFP A;  4H6U A;  4B13 A;  2OZG A;  5J8C A;  2YNE A;  1S60 A;  2J8M A;  3H5Z A;  4Q36 A;  4R87 A;  5F49 A;  1QSR A;  4JD6 A;  4MFL A;  2G3T A;  5F47 A;  1QSM A;  1IYK A;  4KLV A;  2PRB A;  1XF8 A;  1QSO A;  2ATR A;  2PSW A;  2Z10 A;  4KVM E;  1BOB A;  4CYP A;  2NMT A;  2BL1 A;  3N7Z A;  3UY5 A;  5BWA B;  2JDC A;  1TIQ A;  4U5Y A;  2Z11 A;  4KS9 A;  4I49 A;  2J8N A;  2Z3L A;  3A9L A;  4MY3 A;  3R9E A;  1M4D A;  3LD2 A;  3TOB A;  4B5P B;  1YK3 A;  2JLM A;  5AG6 A;  5G22 A;  4HNX B;  3TE4 A;  4CYO A;  4A32 A;  4UFX A;  2CY2 A;  5AG7 A;  5EBV A;  4IF5 A;  1YGH A;  4OLL A;  3FRM A;  1VKC A;  4H6Z A;  1MJ9 A;  4E8O A;  1M4I A;  3PGP A;  1M4G A;  5F48 A;  5JPH A;  4MBU A;  3CXS A;  4PK3 A;  1S7N A;  4NF1 A;  4KLW A;  2Q7B A;  2A4N A;  3I3G A;  5H86 A;  4CS0 B;  2EVN A;  1YVK A;  4BBH A;  3TT2 A;  1P0H A;  3PP9 A;  4KZT A;  4R57 A;  2PDO A;  2Y0M A;  1RXT A;  2IL4 A;  4CRY B;  2GAN A;  3R9F A;  4XPL A;  4XPK A;  1V0C A;  4FD4 A;  5FVJ A;  1Y7R A;  4A31 A;  1N71 A;  3R9G A;  3F8K A;  4C2X A;  4CAW A;  2AJ6 A;  4YRH A;  3DR8 A;  2Q0Y A;  2FSR A;  1IID A;  4NCZ A;  2I00 A;  3PZJ A;  3EC4 A;  3GYA A;  3W91 A;  2OU2 A;  3I9S A;  3FBU A;  5CNP A;  2ZW7 A;  4M3S A;  5G21 A;  4HKF A;  4X5K A;  4CYN A;  4Y49 C;  2C27 A;  3FIX A;  2HQY A;  5E96 A;  1P4N A;  2QML A;  2CNS A;  2PR8 A;  4UBR A;  5DWM A;  1YLE A;  2BUE A;  3TOA A;  3TO6 A;  4AG7 A;  2VZY A;  3QAH A;  1NE9 A;  3JUW A;  3TCV A;  2YND A;  4M85 A;  4MFZ A;  3BJ7 A;  2OZU A;  1UFH A;  3GY9 A;  2CNM A;  4UWI A;  4YFJ A;  3D3S A;  4MJ8 A;  4CAX A;  5J8F A;  4E0A A;  3T9Y A;  2YNC A;  4HNW B;  2JEV A;  4Y49 B;  4U9Z A;  4CRZ B;  2WPX A;  2KCW A;  3IU2 A;  1XIX A;  5A27 A;  5IB0 A;  1K4J A;  3V8I A;  2P6G A;  2VEZ A;  4H89 A;  5AGE A;  4DNC A;  4CAF A;  3EXN A;  4B5P A;  2ZXV A;  4B14 A;  1OZP A;  2WSA A;  2R7H A;  2P6F A;  3EY5 A;  4JXR A;  1NSL A;  2OB0 A;  3G8W A;  3ZJ0 A;  2DPS A;  4JWP A;  3NE7 A;  2G3A A;  3F0A A;  1XE4 A;  2I79 A;  1KUV A;  3CXQ A;  1IIC A;  1NMT A;  2O28 A;  4B12 A;  3EFA A;  4KOY A;  1I1D A;  4AG9 A;  4KOR A;  3GKR A;  4R3L A;  4II9 A;  3TO7 A;  4A30 A;  2R1I A;  1RO5 A;  1M44 A;  2AE6 A;  4CGP A;  4F6A A;  2Q04 A;  3VWE A;  1ON0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...