3P2HA

Crystal structure of tofi in a ternary complex with an inhibitor and mta
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
184
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLGWQLPSEDEKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
molecule tags Signaling protein/inhibitor
molecule keywords AHL synthase
total genus 55
structure length 184
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2hA00
4XNHC 1MK4A 3TO7A 2ATRA 5E96A 2KCWA 1KUVA 2I00A 2PSWA 2Q7BA 1Y7RA 1Y9WA 3EO4A 4JLYA 2Z10A 4QVTA 3NE7A 3VWDA 4NSQA 2FE7A 3SXNA 3R95A 1YLEA 4PV6A 4B5PA 4QBJA 2FS5A 5F48A 1ON0A 1RO5A 4KVOE 4L8AA 2I79A 1QSMA 1BOBA 3T90A 3R96A 2CNSA 3BJ8A 4H89A 3PGPA 4BMHA 1VKCA 1Q2DA 1KUXA 4M3SA 1XE4A 4YFJA 5JPHA 1M4IA 4CAWA 5KTCA 3B8GA 4LUAA 2HUZA 3CXSA 1N71A 1NSLA 2GIVA 2R98A 4AVBA 3QAHA 4LX9A 1GHEA 4PSWA 2A4NA 5F46A 2PC1A 4H6UA 4HNXB 3P2FA 5F47A 3GKRA 4UWJA 3GY9A 4NXYA 2EUIA 3D8PA 4H6ZA 4FD5A 4RS2A 4KOXA 4R9MA 1SQHA 2ZW7A 3D2MA 3I3GA 2OZGA 1QSRA 3IWGA 3T9YA 4E2AA 3D3SA 3N7ZA 4AVAA 2R8VA 2D4OA 4DNCA 3P2HA 3R9EA 1S5KA 4KOSA 3GYAA 4OAEA 1V0CA 1MJAA 2VEZA 4CRZB 5J8FA 5H84A 2GE3A 2F5IA 3FYNA 3I9SA 4FD4A 3LODA 2OU2A 1Y9KA 2B4BA 3W6SA 3TO9A 1QSNA 1XEBA 1L0CA 2ARHA 3SHPA 4NF1A 2P6EA 1S7FA 5DWNA 4ORFA 4KUAA 5IV0A 2QECA 5JQ4A 1R57A 3JVNA 4XNHB 3ZJ0A 3R9GA 1MJBA 4YRHA 4HNYB 4PK3A 4XPLA 3G8WA 3PP9A 3EC4A 1IYLA 3F8KA 4AG9A 3ZZIA 5HMNA 3S6GA 3UY5A 1Q2YA 5J8CA 5DWMA 4FD7A 3IGRA 3WR7A 4B5PB 3LD2A 1YVOA 2B4DB 3TO6A 3EFAA 2PR1A 2FXFA 2BL1A 4KOVA 3W6XA 4MI4A 1IYKA 3C26A 1UFHA 1NE9A 4PSXA 3FIXA 1XF8A 2PQ8A 2VZZA 2ZW4A 1FY7A 1QSOA 2B5GA 4UWIA 2H5MA 2JDCA 3S6FA 4X5KA 1Z4EA 2REFA 2P6GA 4QB9A 1S7LA 4KOYA 2Z11A 5I0CA 4XPDB 1XIXA 2AJ6A 2IL4A 2BSWA 4MJ8A 3S6KA 3JUWA 4IF5A 1TIQA 3FBUA 4KUBA 2NMTA 3DNSA 2VXKA 3G3SA 2B3UA 4E0AA 4KVXA 3F5BA 4NCZA 1WK4A 1U6MA 2GANA 4RI1A 2PDOA 4UA3A 2K5TA 2G3AA 3DDDA 3TFYA 3TTHA 2RC4A 5EC4A 4F0YA 1YX0A 3R9FA 2FCKA 3DR8A 3F0AA 2VQYA 1VHSA 4F6AA 4JXQA 1B87A 4R57A 4AG7A 4CRYB 1BO4A 2CNTA 3PZJA 2REEA 2P6FA 1M44A 3DSBA 4Y49B 2FIWA 4AVCA 2VI7A 2OZHA 2ZXVA 5H86A 1PU9A 3V8IA 2R7HA 2PRBA 4HNWB 3TE4A 4MY3A 1YGHA 2OZUA 2O28A 5F49A 3EXNA 2ZPAA 1M1DA 1YR0A 2WPWA 4CAXA 2BEIA 4YGOA 3E0KA 2OH1A 2B58A 2JDDA 2HV2A 2R1IA 4IUSA 4AB7A 4JJXA 5GCNA 4KLWA 4MY0A 3H4QA 5C88A 5FVJA 5KTAA 1LRZA 3BLNA 2B5GB 4I49A 4II9A 2Q44A 4R87A 1M4DA 4JXRA 2Q4VA 1MJ9A 1IB1E 4QUSA 3SXOA 3FRMA 1M4GA 1IIDA 1I12A 3BJ7A 4OLLA 1I21A 4PK2A 1CJWA 2PR8A 5KTDA 4U5YA 4R3LA 1Z4RA 2QMLA 2G0BA 1CM0A 2QIRA 2BUEA 2B4DA 2VZYA 4M85A 4HKFA 3TOAA 2HQYA 2OB0A 3TCVA 2P0WA 3K9UA 1KZFA 3FB3A 2DXQA 4E8OA 4U9ZA 3MGDA 4R3KA 4XPDC 4GS4A 1OZPA 4ONUA 2FL4A 2Z0ZA 1Z9UA 1RXTA 3QB8A 1B6BA 1S7KA 4MBUA 4CS0B 4QC6A 2FT0A 5EBVA 1WWZA 2Q4YA 4UBRA 3TT2A 1P4NA 1S60A 4L89A 2D4PA 3EY5A 4ZBGA 4KOWA 4KZTA 2EVNA 3R1KA 2Q0YA 3TOBA 4JD6A 5HH1A 2J8MA 1KUYA 4K30A 3KKWA 5IX3A 4CAVA 3W91A 5C82A 2Y0MA 1Q2CA 4KLVA 2Q04A 5ISVA 1YREA 3RYOA 3DR6A 2JLMA 4KOTA 5CNPA 1S3ZA 4EVYA 4U9YA 5IB0A 3CXPA 1QSTA 3S6HA 1K4JA 4XPKA 3D2PA 2JEVA 2X7BA 1YK3A 2J8RA 2ZW5A 2FSRA 2CNMA 3CXQA 1P0HA 4B5OA 1PUAA 1YVKA 2C27A 2FIAA 1XMTA 4FD6A 4OADA 3FXTA 1NMTA 2WPXA 1IICA 2AE6A 2ZW6A 4KOUA 2CY2A 1I1DA 4J3GA 2G3TA 3FNCA 3OWCA 4Y49C 4JWPA 4KORA 2B3VA 4MHDA 4NEXA 4KVME 2J8NA 2VBQA 1J4JA 1S7NA 3VWEA
chains in the Genus database with same CATH superfamily
4C7IA 4XNHC 4DUKA 1MK4A 3TO7A 1BPMA 5ELYA 2ATRA 4P44A 4WJBA 5E96A 2KCWA 4A32A 1KUVA 2I00A 1JQGA 2PSWA 1PCAA 2Q7BA 1Y7RA 1Y9WA 3NH8A 4OMEA 4TWEA 3EO4A 2ZENA 4JLYA 2Z10A 4QVTA 3FJUA 3NE7A 3PFOA 3SJGA 3VWDA 4NSQA 2FE7A 2ZOGA 2PRQA 2AFZA 1LFWA 3SXNA 4C2ZA 3R95A 4MHNA 4NJQA 4OC3A 5G21A 2F7VA 1TXRA 1ZLIA 4P4DA 1YLEA 4PV6A 3D66A 4B5PA 4QBJA 3KHZA 2FS5A 2Q43A 5F48A 1ON0A 1RO5A 4MHYA 4KVOE 2PJ2A 3KI9A 4L8AA 2I79A 1TKHA 3JTKA 2Z3MA 4CYPA 1QSMA 1BOBA 3T90A 4A38A 3DLJA 4UEZA 4UFXA 2PJ1A 2YNEA 2CIJA 4YWYA 2WSAA 3R96A 2CNSA 3BJ8A 4UIBA 4YU9A 4H89A 2EO8A 4MFJA 4P4JA 3PGPA 3RO0A 4BMHA 2ZEGA 1VKCA 1OBRA 1Q2DA 4A2ZA 1H8LA 1NSAA 3LMSA 2JEWA 5AG5A 3BI0A 5LRJA 1KUXA 2Q7SA 1QMUA 4M3SA 3VATA 3NFZA 4F9UA 1XE4A 4RUHA 4YFJA 5JPHA 1M4IA 2WUUA 1Z8TA 3IFEA 4CAWA 3S9NA 1FNOA 3S9LA 1IU8A 3GLJA 3V38A 2GLJA 3B8GA 4LUAA 5KTCA 2HUZA 1ZO0A 2WZNA 3CXSA 5F09A 1XOVA 1Q7LA 1N71A 3PFEA 1NSLA 2GIVA 2R98A 2EWBA 4A37A 4BINA 1CP7A 3QAHA 4AVBA 2AFMA 2AFWA 4NGRA 3CPAA 4R8FA 4LX9A 1GHEA 4CGPA 2EK8A 4PSWA 1CP6A 2A4NA 4A33A 4OC5A 2PC1A 4H6UA 5F46A 3WC6A 4HNXB 4H2KA 1DE4C 3P2FA 5F47A 1BAVA 2BCOA 3GKRA 5JM6A 4M6GA 4UWJA 3D7FA 3GY9A 4NXYA 1BLLE 2EUIA 2ZOFA 3KR5A 8CPAA 3FF3A 2OR4A 3D8PA 4H6ZA 4FD5A 4RS2A 1Y0YA 4KOXA 4R9MA 1SQHA 2ZW7A 3FEEA 3D2MA 3I3GA 5HVFA 4PXEA 1VGYA 3VARA 4NGMA 5I4MA 2OZGA 1QSRA 3N5FA 4UCPA 3SI2A 3IWGA 1QQ9A 4UEFA 1R3NA 3T9YA 4E2AA 3D7HA 2NSMA 3D3SA 3MN8A 3N7ZA 4AVAA 2BOAA 2R8VA 2D4OA 2PE3A 3IU2A 4DNCA 3P2HA 5AGEA 1S5KA 4KOSA 3DGVA 3GYAA 4OAEA 1V0CA 3R9EA 2RB7A 1MJAA 2VEZA 3HUVA 2HB6A 4CRZB 3PB7X 1A2ZA 5J8FA 1TKJA 1CG2A 1JWQA 2C6PA 4MHZA 5H84A 2GE3A 1Z5RA 2F5IA 3FYNA 3I9SA 4P4EA 3NA6A 3LODA 4FD4A 1XBUA 3H8EA 2OU2A 3WC5A 1Y9KA 2B4BA 2WYRA 3W6SA 3TO9A 1QSNA 1XEBA 2EBJA 4RN7A 4A39A 1L0CA 2XEGA 2ARHA 4EFDA 3SHPA 4NF1A 2P6EA 1S7FA 4B14A 5DWNA 1BPNA 4X3RA 4UFWA 3PBEA 4ORFA 4KUAA 3KQZA 4K3NA 1LANA 2I3CA 5IV0A 1TKFA 2QVPA 2QECA 3MRUA 4JYWA 5JQ4A 4Q38A 1R57A 1RTQA 3JVNA 4XNHB 3ZJ0A 3R9GA 1MJBA 4YRHA 2PCUA 2ZEMA 3IWEA 4HNYB 4PK3A 4XPLA 3G8WA 4CYOA 3PP9A 2IQ6A 3EC4A 2ZELA 2GLFA 2V8GA 1IGBA 1IYLA 3F8KA 4AG9A 3ZZIA 1LAPA 1YSJA 3S6GA 5HMNA 3UY5A 2FVGA 1Q2YA 5J8CA 5DWMA 4NJRA 5D29A 2PIZA 4BBHA 4FD7A 6CPAA 3IGRA 3WR7A 3B2YA 4B5PB 4B13A 3SI0A 4MFZA 3LD2A 4BD9A 1YVOA 2B4DB 2ZEHA 5LYLA 3TO6A 4GM5A 3EFAA 1PYTB 2PR1A 2FXFA 2BL1A 4KOVA 4P4FA 3W6XA 4MI4A 1YMEA 1Z8XA 1IYKA 1AYEA 3C26A 1CX8A 1UFHA 5JH9A 2Z3LA 3BHXA 3IWWA 3PBBA 1NE9A 4PSXA 3FECA 3FIXA 1XF8A 2PQ8A 2VZZA 2ZW4A 5EMIA 5G20A 1FY7A 1QSOA 2XEFA 4CPAA 2POKA 2XEJA 2G9DA 3B3VA 2QJ8A 4CGLA 3KGQA 2PJ7A 2B5GA 4UWIA 2H5MA 4P6YA 2JDCA 2ZEDA 1ZLHA 2QYVA 3S6FA 4X5KA 1Z4EA 2REFA 1FT7A 3IIBA 2P6GA 3KASA 1S7LA 3KQXA 4KOYA 2Z11A 2YNCC 1AUGA 4QB9A 4Q36A 4Z65A 5I0CA 4UIAA 1ELMP 4XPDB 4W9YA 4UCMA 4ZX8A 1XIXA 2AJ6A 1YW6A 3IC1A 4NGNA 2IL4A 3VH9A 4PXBA 4MRIA 2BSWA 4MJ8A 3S6KA 5K8OA 4ZY1A 1UWYA 2CTCA 3JUWA 3RNZA 4IF5A 4OKOA 1TIQA 1VHOA 3FBUA 4PQAA 4LQ6A 2O53A 4IK2A 4KUBA 3BXMA 2V8HA 3B7IA 2NMTA 5DS0A 3DNSA 5AG6A 5CPAA 2VXKA 3G3SA 5A28A 3CT9A 3WABA 2PJ8A 3D7GA 5JGFA 2B3UA 5K8PA 4E0AA 4KVXA 3F5BA 1GYTA 4NCZA 1LAMA 2Z3KA 4ZYQA 1WK4A 3T8WA 5J1QA 4C2XA 1U6MA 2GANA 4RI1A 3PB6X 2PDOA 2PJ5A 2K5TA 4HPSA 2C6GA 3IEHA 4UA3A 4LQGA 3TX8A 4MCRA 2ZEEA 4FAIA 1VIXA 2G3AA 4FUUA 4NGTA 3D67A 3DDDA 3NH4A 3TFYA 1HEEA 3TTHA 2RC4A 1ZG9A 3LWUA 3QAYA 5EC4A 4F0YA 1YX0A 3R9FA 2IJZA 2DPSA 3PEIA 4NGQA 4X8IA 1F2PA 2FCKA 2PJAA 3DR8A 3F0AA 3RZAA 2F8HA 2VQYA 4A94A 4PXCA 4MHPA 3FEDA 1VHSA 4F6AA 4JXQA 1B87A 2IMOA 2JBJA 4R57A 4AG7A 4CRYB 5LYFA 4CAFA 1BO4A 2CNTA 3JRUA 2REEA 2P6FA 3PB8X 3PZJA 1M44A 4FBEA 3DSBA 3RAMA 2AFXA 3GIUA 4Y49B 2FIWA 4AVCA 3ISXA 2CTBA 4KSAA 2VI7A 1CPSA 4OC0A 3VWEA 2OZHA 2ZXVA 1Y7EA 1PU9A 5H86A 3V8IA 4GXHA 2R7HA 2PRBA 3CPXA 4HNWB 3TE4A 4MY3A 1YGHA 3IO1A 2V8VA 2OZUA 1CBXA 2O28A 2PJCA 3D68A 4NGPA 3EXNA 2ZPAA 5F49A 1M1DA 4MCPA 4P45A 5AG4A 1R43A 1YR0A 2WPWA 4OIDA 4CAXA 4NGSA 4ZI6A 5K8MA 2BEIA 4YGOA 3E0KA 2OH1A 2B58A 2Z3PA 2JDDA 3IU1A 2HV2A 2R1IA 4IUSA 4TNUA 4ZY2A 4AB7A 4JJXA 5GCNA 4KLWA 4MY0A 1XFOA 3H4QA 3WC7A 1TF9A 4O23A 5FVJA 5C88A 1IOIA 5KTAA 1LRZA 3BLNA 2B5GB 1LCPA 4I49A 4II9A 4F8ZA 2Q44A 2AFSA 4R87A 1F2OA 5D8NA 1M4DA 2ZEOA 3SI1A 4JXRA 4CAEA 4MCQA 2GREA 2Q4VA 3S9MA 4OC2A 2ZEFA 4X2TA 4ONWA 2PIYA 1MJ9A 4A95A 1IB1E 1Z2LA 3H8FA 4QUSA 1M4GA 3FRMA 1IIDA 1I12A 3BJ7A 4OLLA 1I21A 3LACA 4PK2A 1CJWA 2PR8A 5KTDA 5G1ZA 4U5YA 1F57A 4R3LA 1Z4RA 2QMLA 2G0BA 1CM0A 2C6CA 2QIRA 3B3WA 2BUEA 2B4DA 5LYDA 2DPTA 2VZYA 5HVHA 5LRGA 4EWTA 4M85A 4HKFA 3TOAA 3SXOA 2HQYA 2OB0A 4OC4A 3TCVA 4A30A 2V8DA 2P0WA 1AMPA 3K9UA 3GUXA 4ZX9A 1KZFA 3FB3A 2DXQA 2PJ6A 3B3SA 4U9ZA 4E8OA 4ZY0A 2O4HA 3MGDA 4R3KA 4CGMA 4XPDC 4GS4A 1OZPA 4OC1A 4OP4A 3FH4A 4ONUA 4UCNA 1Z8LA 2FL4A 2CF4A 2GFQA 3KL9A 2Z0ZA 2CXAA 2PJ9A 4CYNA 4KSFA 4F9VA 1Z9UA 1VHEA 3B3TA 4MXUA 1RXTA 4IAVA 1XMBA 3PB9X 3SJFA 3WT4A 4CGOA 4B6ZA 3QB8A 3KZWA 1B6BA 4R7MA 2HC9A 5IB9A 5HVGA 1S7KA 4MBUA 1ELLP 4CS0B 4QC6A 2FT0A 5EBVA 3B35A 3ISZA 4CYQA 1WWZA 4MFPA 2Q4YA 1ARMA 1HDUA 3PB4X 2ODFA 4UBRA 1P4NA 3TT2A 1YLOA 1S60A 4G1PA 4L89A 2D4PA 4WWVA 3H5ZA 4UF4A 1LOKA 3EY5A 2ANPA 4ZBGA 2RFHA 4A31A 3D4UA 4KOWA 4KZTA 2PVVA 5K8NA 2EVNA 4DYOA 3R1KA 4NFRA 5BWAB 2Q0YA 3TOBA 4JD6A 5HH1A 1IY7A 4EMEA 2ZEPA 2J8MA 4IHMA 4MFQA 1KUYA 2DF5A 4K30A 4CGNA 4P4BA 3KKWA 3K2KA 5IX3A 4CAVA 3W91A 5CBMA 3CDXA 5LRKA 3HLPA 4FWUA 2PJBA 3B3CA 5C82A 3KHXA 2Z3NA 4JZ0A 5HXDA 1M4LA 1ZG8A 2NYQA 3FMCA 2Y0MA 1Q2CA 2AFUA 2PJ3A 2VL1A 2AFOA 4KLVA 4MFKA 3SJXA 1XJOA 4C7HA 1DTDA 5AG7A 3QNVA 3RBUA 2Q04A 1X10A 1ZG7A 4B12A 5ISVA 1YREA 3RYOA 3DR6A 1Z8WA 2JLMA 4KOTA 5CNPA 3FX6A 2V77A 3NH5A 1S3ZA 4EVYA 4B10A 4U9YA 5IB0A 1X12A 2YNCA 1Y0RA 3K9TA 3CXPA 1QSTA 3S6HA 4MCSA 1K4JA 4DJLA 1EE3P 4XPKA 3D2PA 2JEVA 4PPZA 3GB0A 2X7BA 2BO9A 1YK3A 3KR4A 5THWA 2DEAA 3NE8A 4B11A 7CPAA 5G22A 1YW4A 2J8RA 2ZW5A 2FSRA 4R76A 3D7DA 4UEEA 4AXVA 2CNMA 1ARLA 4C2YA 1TF8A 2J9AA 2EK9A 3CXQA 1P0HA 3FVLA 4KSIA 4B5OA 1IOFA 4ZGYB 4F0XA 2Q51A 1PUAA 1YVKA 4Q7AA 2C27A 4P4IA 2FIAA 1XMTA 2Z3OA 4MMOA 5A27A 4UFVA 3I1UA 3CZXA 1CPXA 1YQEA 4FD6A 4OADA 3FXTA 1NMTA 3PRTA 4MFLA 2JBKA 2YGWA 4M6HA 5LYIA 2PVWA 4P10A 2WPXA 1IICA 2AE6A 4PXDA 4R6TA 2ZW6A 2Q4ZA 4KOUA 2CY2A 1I1DA 4J3GA 4C68A 4KS9A 1XRYA 3TC8A 2C1CA 2G3TA 2PJ0A 3FNCA 3OWCA 4Y49C 2OOTA 4JWPA 3A9LA 4KORA 4OIWA 2B3VA 3BI1A 4MHDA 4NEXA 4KVME 2PJ4A 2YNDA 2J8NA 4M6IA 2XEIA 2VBQA 1KWMA 2GU2A 3L2NA 3V7ZA 2ABZA 1J4JA 1HDQA 3H8GA 3SJEA 1S7NA 3IJ3A
chains in the Genus database with same CATH topology
4C7IA 4XNHC 1MK4A 3TO7A 2ATRA 5E96A 2KCWA 4A32A 1KUVA 2I00A 2PSWA 2Q7BA 1Y7RA 1Y9WA 3EO4A 4JLYA 2Z10A 4QVTA 3NE7A 3VWDA 4NSQA 2FE7A 4C2ZA 3SXNA 3R95A 5G21A 1YLEA 4PV6A 4B5PA 4QBJA 2FS5A 5F48A 1ON0A 1RO5A 4KVOE 4L8AA 2I79A 3JTKA 2Z3MA 4CYPA 1QSMA 1BOBA 3T90A 4UFXA 2YNEA 2WSAA 3R96A 2CNSA 3BJ8A 4H89A 4MFJA 3PGPA 4BMHA 1VKCA 1Q2DA 4A2ZA 5AG5A 1KUXA 4M3SA 1XE4A 4YFJA 5JPHA 1M4IA 2WUUA 4CAWA 5KTCA 3B8GA 4LUAA 2HUZA 1ZO0A 3CXSA 1N71A 1NSLA 2GIVA 2R98A 4AVBA 3QAHA 4LX9A 1GHEA 4CGPA 4PSWA 2A4NA 4A33A 5F46A 2PC1A 4H6UA 4HNXB 3P2FA 5F47A 3GKRA 4UWJA 3GY9A 4NXYA 2EUIA 3D8PA 4H6ZA 4FD5A 4RS2A 4KOXA 4R9MA 1SQHA 2ZW7A 3D2MA 3I3GA 2OZGA 1QSRA 4UCPA 3IWGA 3T9YA 4E2AA 3D3SA 3N7ZA 4AVAA 2R8VA 2D4OA 3IU2A 4DNCA 3P2HA 5AGEA 1S5KA 4KOSA 3GYAA 4OAEA 3R9EA 1V0CA 1MJAA 2VEZA 4CRZB 5J8FA 5H84A 2GE3A 2F5IA 3FYNA 3I9SA 4FD4A 3LODA 2OU2A 1Y9KA 2B4BA 3W6SA 3TO9A 1QSNA 1XEBA 1L0CA 2ARHA 3SHPA 4NF1A 2P6EA 1S7FA 4B14A 5DWNA 4UFWA 4ORFA 4KUAA 5IV0A 2QECA 5JQ4A 4Q38A 1R57A 3JVNA 4XNHB 3ZJ0A 3R9GA 1MJBA 4YRHA 3IWEA 4HNYB 4PK3A 4XPLA 3G8WA 4CYOA 3PP9A 3EC4A 1IYLA 3F8KA 4AG9A 3ZZIA 5HMNA 3S6GA 3UY5A 1Q2YA 5J8CA 5DWMA 4BBHA 4FD7A 3IGRA 3WR7A 4B5PB 4B13A 4MFZA 3LD2A 1YVOA 2B4DB 3TO6A 3EFAA 2PR1A 2FXFA 2BL1A 4KOVA 3W6XA 4MI4A 1IYKA 3C26A 1UFHA 2Z3LA 1NE9A 4PSXA 3FIXA 1XF8A 2PQ8A 2VZZA 2ZW4A 5G20A 1FY7A 1QSOA 4CGLA 2B5GA 4UWIA 2H5MA 2JDCA 3S6FA 4X5KA 1Z4EA 2REFA 2P6GA 4QB9A 1S7LA 4KOYA 2Z11A 2YNCC 4Q36A 5I0CA 4XPDB 4UCMA 1XIXA 2AJ6A 2IL4A 2BSWA 4MJ8A 3S6KA 3JUWA 4IF5A 1TIQA 3FBUA 4KUBA 2NMTA 3DNSA 5AG6A 2VXKA 3G3SA 5A28A 2B3UA 4E0AA 4KVXA 3F5BA 4NCZA 2Z3KA 1WK4A 4C2XA 1U6MA 2GANA 4RI1A 2PDOA 4UA3A 2K5TA 2G3AA 3DDDA 3TFYA 3TTHA 2RC4A 5EC4A 4F0YA 1YX0A 3R9FA 2DPSA 2FCKA 3DR8A 3F0AA 2VQYA 1VHSA 4F6AA 4JXQA 1B87A 4R57A 4AG7A 4CRYB 4CAFA 1BO4A 2CNTA 3PZJA 2REEA 2P6FA 1M44A 3DSBA 4Y49B 2FIWA 4AVCA 4KSAA 2VI7A 2OZHA 2ZXVA 5H86A 1PU9A 3V8IA 2R7HA 2PRBA 4HNWB 3TE4A 4MY3A 1YGHA 2OZUA 2O28A 5F49A 3EXNA 2ZPAA 1M1DA 5AG4A 1YR0A 2WPWA 4CAXA 2BEIA 4YGOA 3E0KA 2OH1A 2B58A 2Z3PA 2JDDA 3IU1A 2HV2A 2R1IA 4IUSA 4AB7A 4JJXA 5GCNA 4KLWA 4MY0A 3H4QA 5C88A 5FVJA 5KTAA 1LRZA 3BLNA 2B5GB 4I49A 4II9A 2Q44A 4R87A 1M4DA 4JXRA 4CAEA 2Q4VA 1MJ9A 4A95A 1IB1E 4QUSA 3SXOA 3FRMA 1M4GA 1IIDA 1I12A 3BJ7A 4OLLA 1I21A 4PK2A 1CJWA 2PR8A 5KTDA 5G1ZA 4U5YA 4R3LA 1Z4RA 2QMLA 2G0BA 1CM0A 2QIRA 2BUEA 2B4DA 2DPTA 2VZYA 4M85A 4HKFA 3TOAA 2HQYA 2OB0A 3TCVA 4A30A 2P0WA 3K9UA 1KZFA 3FB3A 2DXQA 4E8OA 4U9ZA 3MGDA 4R3KA 4CGMA 4XPDC 4GS4A 1OZPA 4ONUA 4UCNA 2FL4A 4CYNA 2Z0ZA 2CXAA 4KSFA 1Z9UA 1RXTA 4CGOA 3QB8A 1B6BA 1S7KA 4MBUA 4CS0B 4QC6A 2FT0A 5EBVA 4CYQA 1WWZA 4MFPA 2Q4YA 4UBRA 3TT2A 1P4NA 1S60A 4L89A 2D4PA 3H5ZA 3EY5A 4ZBGA 4A31A 4KOWA 4KZTA 2EVNA 5BWAB 3R1KA 2Q0YA 3TOBA 4JD6A 5HH1A 2J8MA 4MFQA 1KUYA 4K30A 4CGNA 3KKWA 5IX3A 4CAVA 3W91A 5C82A 2Z3NA 2Y0MA 1Q2CA 4KLVA 4MFKA 4C7HA 5AG7A 2Q04A 4B12A 5ISVA 1YREA 3RYOA 3DR6A 2JLMA 4KOTA 5CNPA 1S3ZA 4EVYA 4B10A 4U9YA 5IB0A 2YNCA 3CXPA 1QSTA 3S6HA 1K4JA 4XPKA 3D2PA 2JEVA 2X7BA 1YK3A 4B11A 5G22A 2J8RA 2ZW5A 2FSRA 2CNMA 4C2YA 3CXQA 1P0HA 4B5OA 4ZGYB 4F0XA 1PUAA 1YVKA 2C27A 2FIAA 1XMTA 2Z3OA 5A27A 4UFVA 4FD6A 4OADA 3FXTA 1NMTA 4MFLA 2YGWA 2WPXA 1IICA 2AE6A 2ZW6A 4KOUA 2CY2A 1I1DA 4J3GA 4C68A 4KS9A 2G3TA 3FNCA 3OWCA 4Y49C 4JWPA 4KORA 3A9LA 2B3VA 4MHDA 4NEXA 4KVME 2YNDA 2J8NA 2VBQA 1J4JA 1S7NA 3VWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNH C;  1MK4 A;  3TO7 A;  2ATR A;  5E96 A;  2KCW A;  1KUV A;  2I00 A;  2PSW A;  2Q7B A;  1Y7R A;  1Y9W A;  3EO4 A;  4JLY A;  2Z10 A;  4QVT A;  3NE7 A;  3VWD A;  4NSQ A;  2FE7 A;  3SXN A;  3R95 A;  1YLE A;  4PV6 A;  4B5P A;  4QBJ A;  2FS5 A;  5F48 A;  1ON0 A;  1RO5 A;  4KVO E;  4L8A A;  2I79 A;  1QSM A;  1BOB A;  3T90 A;  3R96 A;  2CNS A;  3BJ8 A;  4H89 A;  3PGP A;  4BMH A;  1VKC A;  1Q2D A;  1KUX A;  4M3S A;  1XE4 A;  4YFJ A;  5JPH A;  1M4I A;  4CAW A;  5KTC A;  3B8G A;  4LUA A;  2HUZ A;  3CXS A;  1N71 A;  1NSL A;  2GIV A;  2R98 A;  4AVB A;  3QAH A;  4LX9 A;  1GHE A;  4PSW A;  2A4N A;  5F46 A;  2PC1 A;  4H6U A;  4HNX B;  3P2F A;  5F47 A;  3GKR A;  4UWJ A;  3GY9 A;  4NXY A;  2EUI A;  3D8P A;  4H6Z A;  4FD5 A;  4RS2 A;  4KOX A;  4R9M A;  1SQH A;  2ZW7 A;  3D2M A;  3I3G A;  2OZG A;  1QSR A;  3IWG A;  3T9Y A;  4E2A A;  3D3S A;  3N7Z A;  4AVA A;  2R8V A;  2D4O A;  4DNC A;  3P2H A;  3R9E A;  1S5K A;  4KOS A;  3GYA A;  4OAE A;  1V0C A;  1MJA A;  2VEZ A;  4CRZ B;  5J8F A;  5H84 A;  2GE3 A;  2F5I A;  3FYN A;  3I9S A;  4FD4 A;  3LOD A;  2OU2 A;  1Y9K A;  2B4B A;  3W6S A;  3TO9 A;  1QSN A;  1XEB A;  1L0C A;  2ARH A;  3SHP A;  4NF1 A;  2P6E A;  1S7F A;  5DWN A;  4ORF A;  4KUA A;  5IV0 A;  2QEC A;  5JQ4 A;  1R57 A;  3JVN A;  4XNH B;  3ZJ0 A;  3R9G A;  1MJB A;  4YRH A;  4HNY B;  4PK3 A;  4XPL A;  3G8W A;  3PP9 A;  3EC4 A;  1IYL A;  3F8K A;  4AG9 A;  3ZZI A;  5HMN A;  3S6G A;  3UY5 A;  1Q2Y A;  5J8C A;  5DWM A;  4FD7 A;  3IGR A;  3WR7 A;  4B5P B;  3LD2 A;  1YVO A;  2B4D B;  3TO6 A;  3EFA A;  2PR1 A;  2FXF A;  2BL1 A;  4KOV A;  3W6X A;  4MI4 A;  1IYK A;  3C26 A;  1UFH A;  1NE9 A;  4PSX A;  3FIX A;  1XF8 A;  2PQ8 A;  2VZZ A;  2ZW4 A;  1FY7 A;  1QSO A;  2B5G A;  4UWI A;  2H5M A;  2JDC A;  3S6F A;  4X5K A;  1Z4E A;  2REF A;  2P6G A;  4QB9 A;  1S7L A;  4KOY A;  2Z11 A;  5I0C A;  4XPD B;  1XIX A;  2AJ6 A;  2IL4 A;  2BSW A;  4MJ8 A;  3S6K A;  3JUW A;  4IF5 A;  1TIQ A;  3FBU A;  4KUB A;  2NMT A;  3DNS A;  2VXK A;  3G3S A;  2B3U A;  4E0A A;  4KVX A;  3F5B A;  4NCZ A;  1WK4 A;  1U6M A;  2GAN A;  4RI1 A;  2PDO A;  4UA3 A;  2K5T A;  2G3A A;  3DDD A;  3TFY A;  3TTH A;  2RC4 A;  5EC4 A;  4F0Y A;  1YX0 A;  3R9F A;  2FCK A;  3DR8 A;  3F0A A;  2VQY A;  1VHS A;  4F6A A;  4JXQ A;  1B87 A;  4R57 A;  4AG7 A;  4CRY B;  1BO4 A;  2CNT A;  3PZJ A;  2REE A;  2P6F A;  1M44 A;  3DSB A;  4Y49 B;  2FIW A;  4AVC A;  2VI7 A;  2OZH A;  2ZXV A;  5H86 A;  1PU9 A;  3V8I A;  2R7H A;  2PRB A;  4HNW B;  3TE4 A;  4MY3 A;  1YGH A;  2OZU A;  2O28 A;  5F49 A;  3EXN A;  2ZPA A;  1M1D A;  1YR0 A;  2WPW A;  4CAX A;  2BEI A;  4YGO A;  3E0K A;  2OH1 A;  2B58 A;  2JDD A;  2HV2 A;  2R1I A;  4IUS A;  4AB7 A;  4JJX A;  5GCN A;  4KLW A;  4MY0 A;  3H4Q A;  5C88 A;  5FVJ A;  5KTA A;  1LRZ A;  3BLN A;  2B5G B;  4I49 A;  4II9 A;  2Q44 A;  4R87 A;  1M4D A;  4JXR A;  2Q4V A;  1MJ9 A;  1IB1 E;  4QUS A;  3SXO A;  3FRM A;  1M4G A;  1IID A;  1I12 A;  3BJ7 A;  4OLL A;  1I21 A;  4PK2 A;  1CJW A;  2PR8 A;  5KTD A;  4U5Y A;  4R3L A;  1Z4R A;  2QML A;  2G0B A;  1CM0 A;  2QIR A;  2BUE A;  2B4D A;  2VZY A;  4M85 A;  4HKF A;  3TOA A;  2HQY A;  2OB0 A;  3TCV A;  2P0W A;  3K9U A;  1KZF A;  3FB3 A;  2DXQ A;  4E8O A;  4U9Z A;  3MGD A;  4R3K A;  4XPD C;  4GS4 A;  1OZP A;  4ONU A;  2FL4 A;  2Z0Z A;  1Z9U A;  1RXT A;  3QB8 A;  1B6B A;  1S7K A;  4MBU A;  4CS0 B;  4QC6 A;  2FT0 A;  5EBV A;  1WWZ A;  2Q4Y A;  4UBR A;  3TT2 A;  1P4N A;  1S60 A;  4L89 A;  2D4P A;  3EY5 A;  4ZBG A;  4KOW A;  4KZT A;  2EVN A;  3R1K A;  2Q0Y A;  3TOB A;  4JD6 A;  5HH1 A;  2J8M A;  1KUY A;  4K30 A;  3KKW A;  5IX3 A;  4CAV A;  3W91 A;  5C82 A;  2Y0M A;  1Q2C A;  4KLV A;  2Q04 A;  5ISV A;  1YRE A;  3RYO A;  3DR6 A;  2JLM A;  4KOT A;  5CNP A;  1S3Z A;  4EVY A;  4U9Y A;  5IB0 A;  3CXP A;  1QST A;  3S6H A;  1K4J A;  4XPK A;  3D2P A;  2JEV A;  2X7B A;  1YK3 A;  2J8R A;  2ZW5 A;  2FSR A;  2CNM A;  3CXQ A;  1P0H A;  4B5O A;  1PUA A;  1YVK A;  2C27 A;  2FIA A;  1XMT A;  4FD6 A;  4OAD A;  3FXT A;  1NMT A;  2WPX A;  1IIC A;  2AE6 A;  2ZW6 A;  4KOU A;  2CY2 A;  1I1D A;  4J3G A;  2G3T A;  3FNC A;  3OWC A;  4Y49 C;  4JWP A;  4KOR A;  2B3V A;  4MHD A;  4NEX A;  4KVM E;  2J8N A;  2VBQ A;  1J4J A;  1S7N A;  3VWE A; 
#chains in the Genus database with same CATH topology
 4C7I A;  4XNH C;  4DUK A;  1MK4 A;  3TO7 A;  1BPM A;  5ELY A;  2ATR A;  4P44 A;  4WJB A;  5E96 A;  2KCW A;  4A32 A;  1KUV A;  2I00 A;  1JQG A;  2PSW A;  1PCA A;  2Q7B A;  1Y7R A;  1Y9W A;  3NH8 A;  4OME A;  4TWE A;  3EO4 A;  2ZEN A;  4JLY A;  2Z10 A;  4QVT A;  3FJU A;  3NE7 A;  3PFO A;  3SJG A;  3VWD A;  4NSQ A;  2FE7 A;  2ZOG A;  2PRQ A;  2AFZ A;  1LFW A;  3SXN A;  4C2Z A;  3R95 A;  4MHN A;  4NJQ A;  4OC3 A;  5G21 A;  2F7V A;  1TXR A;  1ZLI A;  4P4D A;  1YLE A;  4PV6 A;  3D66 A;  4B5P A;  4QBJ A;  3KHZ A;  2FS5 A;  2Q43 A;  5F48 A;  1ON0 A;  1RO5 A;  4MHY A;  4KVO E;  2PJ2 A;  3KI9 A;  4L8A A;  2I79 A;  1TKH A;  3JTK A;  2Z3M A;  4CYP A;  1QSM A;  1BOB A;  3T90 A;  4A38 A;  3DLJ A;  4UEZ A;  4UFX A;  2PJ1 A;  2YNE A;  2CIJ A;  4YWY A;  2WSA A;  3R96 A;  2CNS A;  3BJ8 A;  4UIB A;  4YU9 A;  4H89 A;  2EO8 A;  4MFJ A;  4P4J A;  3PGP A;  3RO0 A;  4BMH A;  2ZEG A;  1VKC A;  1OBR A;  1Q2D A;  4A2Z A;  1H8L A;  1NSA A;  3LMS A;  2JEW A;  5AG5 A;  3BI0 A;  5LRJ A;  1KUX A;  2Q7S A;  1QMU A;  4M3S A;  3VAT A;  3NFZ A;  4F9U A;  1XE4 A;  4RUH A;  4YFJ A;  5JPH A;  1M4I A;  2WUU A;  1Z8T A;  3IFE A;  4CAW A;  3S9N A;  1FNO A;  3S9L A;  1IU8 A;  3GLJ A;  3V38 A;  2GLJ A;  3B8G A;  4LUA A;  5KTC A;  2HUZ A;  1ZO0 A;  2WZN A;  3CXS A;  5F09 A;  1XOV A;  1Q7L A;  1N71 A;  3PFE A;  1NSL A;  2GIV A;  2R98 A;  2EWB A;  4A37 A;  4BIN A;  1CP7 A;  3QAH A;  4AVB A;  2AFM A;  2AFW A;  4NGR A;  3CPA A;  4R8F A;  4LX9 A;  1GHE A;  4CGP A;  2EK8 A;  4PSW A;  1CP6 A;  2A4N A;  4A33 A;  4OC5 A;  2PC1 A;  4H6U A;  5F46 A;  3WC6 A;  4HNX B;  4H2K A;  1DE4 C;  3P2F A;  5F47 A;  1BAV A;  2BCO A;  3GKR A;  5JM6 A;  4M6G A;  4UWJ A;  3D7F A;  3GY9 A;  4NXY A;  1BLL E;  2EUI A;  2ZOF A;  3KR5 A;  8CPA A;  3FF3 A;  2OR4 A;  3D8P A;  4H6Z A;  4FD5 A;  4RS2 A;  1Y0Y A;  4KOX A;  4R9M A;  1SQH A;  2ZW7 A;  3FEE A;  3D2M A;  3I3G A;  5HVF A;  4PXE A;  1VGY A;  3VAR A;  4NGM A;  5I4M A;  2OZG A;  1QSR A;  3N5F A;  4UCP A;  3SI2 A;  3IWG A;  1QQ9 A;  4UEF A;  1R3N A;  3T9Y A;  4E2A A;  3D7H A;  2NSM A;  3D3S A;  3MN8 A;  3N7Z A;  4AVA A;  2BOA A;  2R8V A;  2D4O A;  2PE3 A;  3IU2 A;  4DNC A;  3P2H A;  5AGE A;  1S5K A;  4KOS A;  3DGV A;  3GYA A;  4OAE A;  1V0C A;  3R9E A;  2RB7 A;  1MJA A;  2VEZ A;  3HUV A;  2HB6 A;  4CRZ B;  3PB7 X;  1A2Z A;  5J8F A;  1TKJ A;  1CG2 A;  1JWQ A;  2C6P A;  4MHZ A;  5H84 A;  2GE3 A;  1Z5R A;  2F5I A;  3FYN A;  3I9S A;  4P4E A;  3NA6 A;  3LOD A;  4FD4 A;  1XBU A;  3H8E A;  2OU2 A;  3WC5 A;  1Y9K A;  2B4B A;  2WYR A;  3W6S A;  3TO9 A;  1QSN A;  1XEB A;  2EBJ A;  4RN7 A;  4A39 A;  1L0C A;  2XEG A;  2ARH A;  4EFD A;  3SHP A;  4NF1 A;  2P6E A;  1S7F A;  4B14 A;  5DWN A;  1BPN A;  4X3R A;  4UFW A;  3PBE A;  4ORF A;  4KUA A;  3KQZ A;  4K3N A;  1LAN A;  2I3C A;  5IV0 A;  1TKF A;  2QVP A;  2QEC A;  3MRU A;  4JYW A;  5JQ4 A;  4Q38 A;  1R57 A;  1RTQ A;  3JVN A;  4XNH B;  3ZJ0 A;  3R9G A;  1MJB A;  4YRH A;  2PCU A;  2ZEM A;  3IWE A;  4HNY B;  4PK3 A;  4XPL A;  3G8W A;  4CYO A;  3PP9 A;  2IQ6 A;  3EC4 A;  2ZEL A;  2GLF A;  2V8G A;  1IGB A;  1IYL A;  3F8K A;  4AG9 A;  3ZZI A;  1LAP A;  1YSJ A;  3S6G A;  5HMN A;  3UY5 A;  2FVG A;  1Q2Y A;  5J8C A;  5DWM A;  4NJR A;  5D29 A;  2PIZ A;  4BBH A;  4FD7 A;  6CPA A;  3IGR A;  3WR7 A;  3B2Y A;  4B5P B;  4B13 A;  3SI0 A;  4MFZ A;  3LD2 A;  4BD9 A;  1YVO A;  2B4D B;  2ZEH A;  5LYL A;  3TO6 A;  4GM5 A;  3EFA A;  1PYT B;  2PR1 A;  2FXF A;  2BL1 A;  4KOV A;  4P4F A;  3W6X A;  4MI4 A;  1YME A;  1Z8X A;  1IYK A;  1AYE A;  3C26 A;  1CX8 A;  1UFH A;  5JH9 A;  2Z3L A;  3BHX A;  3IWW A;  3PBB A;  1NE9 A;  4PSX A;  3FEC A;  3FIX A;  1XF8 A;  2PQ8 A;  2VZZ A;  2ZW4 A;  5EMI A;  5G20 A;  1FY7 A;  1QSO A;  2XEF A;  4CPA A;  2POK A;  2XEJ A;  2G9D A;  3B3V A;  2QJ8 A;  4CGL A;  3KGQ A;  2PJ7 A;  2B5G A;  4UWI A;  2H5M A;  4P6Y A;  2JDC A;  2ZED A;  1ZLH A;  2QYV A;  3S6F A;  4X5K A;  1Z4E A;  2REF A;  1FT7 A;  3IIB A;  2P6G A;  3KAS A;  1S7L A;  3KQX A;  4KOY A;  2Z11 A;  2YNC C;  1AUG A;  4QB9 A;  4Q36 A;  4Z65 A;  5I0C A;  4UIA A;  1ELM P;  4XPD B;  4W9Y A;  4UCM A;  4ZX8 A;  1XIX A;  2AJ6 A;  1YW6 A;  3IC1 A;  4NGN A;  2IL4 A;  3VH9 A;  4PXB A;  4MRI A;  2BSW A;  4MJ8 A;  3S6K A;  5K8O A;  4ZY1 A;  1UWY A;  2CTC A;  3JUW A;  3RNZ A;  4IF5 A;  4OKO A;  1TIQ A;  1VHO A;  3FBU A;  4PQA A;  4LQ6 A;  2O53 A;  4IK2 A;  4KUB A;  3BXM A;  2V8H A;  3B7I A;  2NMT A;  5DS0 A;  3DNS A;  5AG6 A;  5CPA A;  2VXK A;  3G3S A;  5A28 A;  3CT9 A;  3WAB A;  2PJ8 A;  3D7G A;  5JGF A;  2B3U A;  5K8P A;  4E0A A;  4KVX A;  3F5B A;  1GYT A;  4NCZ A;  1LAM A;  2Z3K A;  4ZYQ A;  1WK4 A;  3T8W A;  5J1Q A;  4C2X A;  1U6M A;  2GAN A;  4RI1 A;  3PB6 X;  2PDO A;  2PJ5 A;  2K5T A;  4HPS A;  2C6G A;  3IEH A;  4UA3 A;  4LQG A;  3TX8 A;  4MCR A;  2ZEE A;  4FAI A;  1VIX A;  2G3A A;  4FUU A;  4NGT A;  3D67 A;  3DDD A;  3NH4 A;  3TFY A;  1HEE A;  3TTH A;  2RC4 A;  1ZG9 A;  3LWU A;  3QAY A;  5EC4 A;  4F0Y A;  1YX0 A;  3R9F A;  2IJZ A;  2DPS A;  3PEI A;  4NGQ A;  4X8I A;  1F2P A;  2FCK A;  2PJA A;  3DR8 A;  3F0A A;  3RZA A;  2F8H A;  2VQY A;  4A94 A;  4PXC A;  4MHP A;  3FED A;  1VHS A;  4F6A A;  4JXQ A;  1B87 A;  2IMO A;  2JBJ A;  4R57 A;  4AG7 A;  4CRY B;  5LYF A;  4CAF A;  1BO4 A;  2CNT A;  3JRU A;  2REE A;  2P6F A;  3PB8 X;  3PZJ A;  1M44 A;  4FBE A;  3DSB A;  3RAM A;  2AFX A;  3GIU A;  4Y49 B;  2FIW A;  4AVC A;  3ISX A;  2CTB A;  4KSA A;  2VI7 A;  1CPS A;  4OC0 A;  3VWE A;  2OZH A;  2ZXV A;  1Y7E A;  1PU9 A;  5H86 A;  3V8I A;  4GXH A;  2R7H A;  2PRB A;  3CPX A;  4HNW B;  3TE4 A;  4MY3 A;  1YGH A;  3IO1 A;  2V8V A;  2OZU A;  1CBX A;  2O28 A;  2PJC A;  3D68 A;  4NGP A;  3EXN A;  2ZPA A;  5F49 A;  1M1D A;  4MCP A;  4P45 A;  5AG4 A;  1R43 A;  1YR0 A;  2WPW A;  4OID A;  4CAX A;  4NGS A;  4ZI6 A;  5K8M A;  2BEI A;  4YGO A;  3E0K A;  2OH1 A;  2B58 A;  2Z3P A;  2JDD A;  3IU1 A;  2HV2 A;  2R1I A;  4IUS A;  4TNU A;  4ZY2 A;  4AB7 A;  4JJX A;  5GCN A;  4KLW A;  4MY0 A;  1XFO A;  3H4Q A;  3WC7 A;  1TF9 A;  4O23 A;  5FVJ A;  5C88 A;  1IOI A;  5KTA A;  1LRZ A;  3BLN A;  2B5G B;  1LCP A;  4I49 A;  4II9 A;  4F8Z A;  2Q44 A;  2AFS A;  4R87 A;  1F2O A;  5D8N A;  1M4D A;  2ZEO A;  3SI1 A;  4JXR A;  4CAE A;  4MCQ A;  2GRE A;  2Q4V A;  3S9M A;  4OC2 A;  2ZEF A;  4X2T A;  4ONW A;  2PIY A;  1MJ9 A;  4A95 A;  1IB1 E;  1Z2L A;  3H8F A;  4QUS A;  1M4G A;  3FRM A;  1IID A;  1I12 A;  3BJ7 A;  4OLL A;  1I21 A;  3LAC A;  4PK2 A;  1CJW A;  2PR8 A;  5KTD A;  5G1Z A;  4U5Y A;  1F57 A;  4R3L A;  1Z4R A;  2QML A;  2G0B A;  1CM0 A;  2C6C A;  2QIR A;  3B3W A;  2BUE A;  2B4D A;  5LYD A;  2DPT A;  2VZY A;  5HVH A;  5LRG A;  4EWT A;  4M85 A;  4HKF A;  3TOA A;  3SXO A;  2HQY A;  2OB0 A;  4OC4 A;  3TCV A;  4A30 A;  2V8D A;  2P0W A;  1AMP A;  3K9U A;  3GUX A;  4ZX9 A;  1KZF A;  3FB3 A;  2DXQ A;  2PJ6 A;  3B3S A;  4U9Z A;  4E8O A;  4ZY0 A;  2O4H A;  3MGD A;  4R3K A;  4CGM A;  4XPD C;  4GS4 A;  1OZP A;  4OC1 A;  4OP4 A;  3FH4 A;  4ONU A;  4UCN A;  1Z8L A;  2FL4 A;  2CF4 A;  2GFQ A;  3KL9 A;  2Z0Z A;  2CXA A;  2PJ9 A;  4CYN A;  4KSF A;  4F9V A;  1Z9U A;  1VHE A;  3B3T A;  4MXU A;  1RXT A;  4IAV A;  1XMB A;  3PB9 X;  3SJF A;  3WT4 A;  4CGO A;  4B6Z A;  3QB8 A;  3KZW A;  1B6B A;  4R7M A;  2HC9 A;  5IB9 A;  5HVG A;  1S7K A;  4MBU A;  1ELL P;  4CS0 B;  4QC6 A;  2FT0 A;  5EBV A;  3B35 A;  3ISZ A;  4CYQ A;  1WWZ A;  4MFP A;  2Q4Y A;  1ARM A;  1HDU A;  3PB4 X;  2ODF A;  4UBR A;  1P4N A;  3TT2 A;  1YLO A;  1S60 A;  4G1P A;  4L89 A;  2D4P A;  4WWV A;  3H5Z A;  4UF4 A;  1LOK A;  3EY5 A;  2ANP A;  4ZBG A;  2RFH A;  4A31 A;  3D4U A;  4KOW A;  4KZT A;  2PVV A;  5K8N A;  2EVN A;  4DYO A;  3R1K A;  4NFR A;  5BWA B;  2Q0Y A;  3TOB A;  4JD6 A;  5HH1 A;  1IY7 A;  4EME A;  2ZEP A;  2J8M A;  4IHM A;  4MFQ A;  1KUY A;  2DF5 A;  4K30 A;  4CGN A;  4P4B A;  3KKW A;  3K2K A;  5IX3 A;  4CAV A;  3W91 A;  5CBM A;  3CDX A;  5LRK A;  3HLP A;  4FWU A;  2PJB A;  3B3C A;  5C82 A;  3KHX A;  2Z3N A;  4JZ0 A;  5HXD A;  1M4L A;  1ZG8 A;  2NYQ A;  3FMC A;  2Y0M A;  1Q2C A;  2AFU A;  2PJ3 A;  2VL1 A;  2AFO A;  4KLV A;  4MFK A;  3SJX A;  1XJO A;  4C7H A;  1DTD A;  5AG7 A;  3QNV A;  3RBU A;  2Q04 A;  1X10 A;  1ZG7 A;  4B12 A;  5ISV A;  1YRE A;  3RYO A;  3DR6 A;  1Z8W A;  2JLM A;  4KOT A;  5CNP A;  3FX6 A;  2V77 A;  3NH5 A;  1S3Z A;  4EVY A;  4B10 A;  4U9Y A;  5IB0 A;  1X12 A;  2YNC A;  1Y0R A;  3K9T A;  3CXP A;  1QST A;  3S6H A;  4MCS A;  1K4J A;  4DJL A;  1EE3 P;  4XPK A;  3D2P A;  2JEV A;  4PPZ A;  3GB0 A;  2X7B A;  2BO9 A;  1YK3 A;  3KR4 A;  5THW A;  2DEA A;  3NE8 A;  4B11 A;  7CPA A;  5G22 A;  1YW4 A;  2J8R A;  2ZW5 A;  2FSR A;  4R76 A;  3D7D A;  4UEE A;  4AXV A;  2CNM A;  1ARL A;  4C2Y A;  1TF8 A;  2J9A A;  2EK9 A;  3CXQ A;  1P0H A;  3FVL A;  4KSI A;  4B5O A;  1IOF A;  4ZGY B;  4F0X A;  2Q51 A;  1PUA A;  1YVK A;  4Q7A A;  2C27 A;  4P4I A;  2FIA A;  1XMT A;  2Z3O A;  4MMO A;  5A27 A;  4UFV A;  3I1U A;  3CZX A;  1CPX A;  1YQE A;  4FD6 A;  4OAD A;  3FXT A;  1NMT A;  3PRT A;  4MFL A;  2JBK A;  2YGW A;  4M6H A;  5LYI A;  2PVW A;  4P10 A;  2WPX A;  1IIC A;  2AE6 A;  4PXD A;  4R6T A;  2ZW6 A;  2Q4Z A;  4KOU A;  2CY2 A;  1I1D A;  4J3G A;  4C68 A;  4KS9 A;  1XRY A;  3TC8 A;  2C1C A;  2G3T A;  2PJ0 A;  3FNC A;  3OWC A;  4Y49 C;  2OOT A;  4JWP A;  3A9L A;  4KOR A;  4OIW A;  2B3V A;  3BI1 A;  4MHD A;  4NEX A;  4KVM E;  2PJ4 A;  2YND A;  2J8N A;  4M6I A;  2XEI A;  2VBQ A;  1KWM A;  2GU2 A;  3L2N A;  3V7Z A;  2ABZ A;  1J4J A;  1HDQ A;  3H8G A;  3SJE A;  1S7N A;  3IJ3 A; 
#chains in the Genus database with same CATH homology
 4C7I A;  4XNH C;  1MK4 A;  3TO7 A;  2ATR A;  5E96 A;  2KCW A;  4A32 A;  1KUV A;  2I00 A;  2PSW A;  2Q7B A;  1Y7R A;  1Y9W A;  3EO4 A;  4JLY A;  2Z10 A;  4QVT A;  3NE7 A;  3VWD A;  4NSQ A;  2FE7 A;  4C2Z A;  3SXN A;  3R95 A;  5G21 A;  1YLE A;  4PV6 A;  4B5P A;  4QBJ A;  2FS5 A;  5F48 A;  1ON0 A;  1RO5 A;  4KVO E;  4L8A A;  2I79 A;  3JTK A;  2Z3M A;  4CYP A;  1QSM A;  1BOB A;  3T90 A;  4UFX A;  2YNE A;  2WSA A;  3R96 A;  2CNS A;  3BJ8 A;  4H89 A;  4MFJ A;  3PGP A;  4BMH A;  1VKC A;  1Q2D A;  4A2Z A;  5AG5 A;  1KUX A;  4M3S A;  1XE4 A;  4YFJ A;  5JPH A;  1M4I A;  2WUU A;  4CAW A;  5KTC A;  3B8G A;  4LUA A;  2HUZ A;  1ZO0 A;  3CXS A;  1N71 A;  1NSL A;  2GIV A;  2R98 A;  4AVB A;  3QAH A;  4LX9 A;  1GHE A;  4CGP A;  4PSW A;  2A4N A;  4A33 A;  5F46 A;  2PC1 A;  4H6U A;  4HNX B;  3P2F A;  5F47 A;  3GKR A;  4UWJ A;  3GY9 A;  4NXY A;  2EUI A;  3D8P A;  4H6Z A;  4FD5 A;  4RS2 A;  4KOX A;  4R9M A;  1SQH A;  2ZW7 A;  3D2M A;  3I3G A;  2OZG A;  1QSR A;  4UCP A;  3IWG A;  3T9Y A;  4E2A A;  3D3S A;  3N7Z A;  4AVA A;  2R8V A;  2D4O A;  3IU2 A;  4DNC A;  3P2H A;  5AGE A;  1S5K A;  4KOS A;  3GYA A;  4OAE A;  3R9E A;  1V0C A;  1MJA A;  2VEZ A;  4CRZ B;  5J8F A;  5H84 A;  2GE3 A;  2F5I A;  3FYN A;  3I9S A;  4FD4 A;  3LOD A;  2OU2 A;  1Y9K A;  2B4B A;  3W6S A;  3TO9 A;  1QSN A;  1XEB A;  1L0C A;  2ARH A;  3SHP A;  4NF1 A;  2P6E A;  1S7F A;  4B14 A;  5DWN A;  4UFW A;  4ORF A;  4KUA A;  5IV0 A;  2QEC A;  5JQ4 A;  4Q38 A;  1R57 A;  3JVN A;  4XNH B;  3ZJ0 A;  3R9G A;  1MJB A;  4YRH A;  3IWE A;  4HNY B;  4PK3 A;  4XPL A;  3G8W A;  4CYO A;  3PP9 A;  3EC4 A;  1IYL A;  3F8K A;  4AG9 A;  3ZZI A;  5HMN A;  3S6G A;  3UY5 A;  1Q2Y A;  5J8C A;  5DWM A;  4BBH A;  4FD7 A;  3IGR A;  3WR7 A;  4B5P B;  4B13 A;  4MFZ A;  3LD2 A;  1YVO A;  2B4D B;  3TO6 A;  3EFA A;  2PR1 A;  2FXF A;  2BL1 A;  4KOV A;  3W6X A;  4MI4 A;  1IYK A;  3C26 A;  1UFH A;  2Z3L A;  1NE9 A;  4PSX A;  3FIX A;  1XF8 A;  2PQ8 A;  2VZZ A;  2ZW4 A;  5G20 A;  1FY7 A;  1QSO A;  4CGL A;  2B5G A;  4UWI A;  2H5M A;  2JDC A;  3S6F A;  4X5K A;  1Z4E A;  2REF A;  2P6G A;  4QB9 A;  1S7L A;  4KOY A;  2Z11 A;  2YNC C;  4Q36 A;  5I0C A;  4XPD B;  4UCM A;  1XIX A;  2AJ6 A;  2IL4 A;  2BSW A;  4MJ8 A;  3S6K A;  3JUW A;  4IF5 A;  1TIQ A;  3FBU A;  4KUB A;  2NMT A;  3DNS A;  5AG6 A;  2VXK A;  3G3S A;  5A28 A;  2B3U A;  4E0A A;  4KVX A;  3F5B A;  4NCZ A;  2Z3K A;  1WK4 A;  4C2X A;  1U6M A;  2GAN A;  4RI1 A;  2PDO A;  4UA3 A;  2K5T A;  2G3A A;  3DDD A;  3TFY A;  3TTH A;  2RC4 A;  5EC4 A;  4F0Y A;  1YX0 A;  3R9F A;  2DPS A;  2FCK A;  3DR8 A;  3F0A A;  2VQY A;  1VHS A;  4F6A A;  4JXQ A;  1B87 A;  4R57 A;  4AG7 A;  4CRY B;  4CAF A;  1BO4 A;  2CNT A;  3PZJ A;  2REE A;  2P6F A;  1M44 A;  3DSB A;  4Y49 B;  2FIW A;  4AVC A;  4KSA A;  2VI7 A;  2OZH A;  2ZXV A;  5H86 A;  1PU9 A;  3V8I A;  2R7H A;  2PRB A;  4HNW B;  3TE4 A;  4MY3 A;  1YGH A;  2OZU A;  2O28 A;  5F49 A;  3EXN A;  2ZPA A;  1M1D A;  5AG4 A;  1YR0 A;  2WPW A;  4CAX A;  2BEI A;  4YGO A;  3E0K A;  2OH1 A;  2B58 A;  2Z3P A;  2JDD A;  3IU1 A;  2HV2 A;  2R1I A;  4IUS A;  4AB7 A;  4JJX A;  5GCN A;  4KLW A;  4MY0 A;  3H4Q A;  5C88 A;  5FVJ A;  5KTA A;  1LRZ A;  3BLN A;  2B5G B;  4I49 A;  4II9 A;  2Q44 A;  4R87 A;  1M4D A;  4JXR A;  4CAE A;  2Q4V A;  1MJ9 A;  4A95 A;  1IB1 E;  4QUS A;  3SXO A;  3FRM A;  1M4G A;  1IID A;  1I12 A;  3BJ7 A;  4OLL A;  1I21 A;  4PK2 A;  1CJW A;  2PR8 A;  5KTD A;  5G1Z A;  4U5Y A;  4R3L A;  1Z4R A;  2QML A;  2G0B A;  1CM0 A;  2QIR A;  2BUE A;  2B4D A;  2DPT A;  2VZY A;  4M85 A;  4HKF A;  3TOA A;  2HQY A;  2OB0 A;  3TCV A;  4A30 A;  2P0W A;  3K9U A;  1KZF A;  3FB3 A;  2DXQ A;  4E8O A;  4U9Z A;  3MGD A;  4R3K A;  4CGM A;  4XPD C;  4GS4 A;  1OZP A;  4ONU A;  4UCN A;  2FL4 A;  4CYN A;  2Z0Z A;  2CXA A;  4KSF A;  1Z9U A;  1RXT A;  4CGO A;  3QB8 A;  1B6B A;  1S7K A;  4MBU A;  4CS0 B;  4QC6 A;  2FT0 A;  5EBV A;  4CYQ A;  1WWZ A;  4MFP A;  2Q4Y A;  4UBR A;  3TT2 A;  1P4N A;  1S60 A;  4L89 A;  2D4P A;  3H5Z A;  3EY5 A;  4ZBG A;  4A31 A;  4KOW A;  4KZT A;  2EVN A;  5BWA B;  3R1K A;  2Q0Y A;  3TOB A;  4JD6 A;  5HH1 A;  2J8M A;  4MFQ A;  1KUY A;  4K30 A;  4CGN A;  3KKW A;  5IX3 A;  4CAV A;  3W91 A;  5C82 A;  2Z3N A;  2Y0M A;  1Q2C A;  4KLV A;  4MFK A;  4C7H A;  5AG7 A;  2Q04 A;  4B12 A;  5ISV A;  1YRE A;  3RYO A;  3DR6 A;  2JLM A;  4KOT A;  5CNP A;  1S3Z A;  4EVY A;  4B10 A;  4U9Y A;  5IB0 A;  2YNC A;  3CXP A;  1QST A;  3S6H A;  1K4J A;  4XPK A;  3D2P A;  2JEV A;  2X7B A;  1YK3 A;  4B11 A;  5G22 A;  2J8R A;  2ZW5 A;  2FSR A;  2CNM A;  4C2Y A;  3CXQ A;  1P0H A;  4B5O A;  4ZGY B;  4F0X A;  1PUA A;  1YVK A;  2C27 A;  2FIA A;  1XMT A;  2Z3O A;  5A27 A;  4UFV A;  4FD6 A;  4OAD A;  3FXT A;  1NMT A;  4MFL A;  2YGW A;  2WPX A;  1IIC A;  2AE6 A;  2ZW6 A;  4KOU A;  2CY2 A;  1I1D A;  4J3G A;  4C68 A;  4KS9 A;  2G3T A;  3FNC A;  3OWC A;  4Y49 C;  4JWP A;  4KOR A;  3A9L A;  2B3V A;  4MHD A;  4NEX A;  4KVM E;  2YND A;  2J8N A;  2VBQ A;  1J4J A;  1S7N A;  3VWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...