3P2HA

Crystal structure of tofi in a ternary complex with an inhibitor and mta
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
184
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLGWQLPSEDEKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AHL synthase
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
molecule tags Signaling protein/inhibitor
total genus 55
structure length 184
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2hA00
5GCNA 3EY5A 2P0WA 2KCWA 1QSRA 3FB3A 2VQYA 5DWNA 1YVKA 1J4JA 4JWPA 4XNHB 1Q2YA 2BUEA 4UBRA 3JVNA 5HH1A 2EUIA 1KUVA 4R87A 4XPDB 1YX0A 5H84A 2CNSA 4GS4A 2FIAA 1XMTA 1MK4A 4NXYA 3LD2A 1S7KA 1M4IA 3W6SA 2ZPAA 2ARHA 4AG7A 1YGHA 2Q7BA 3IWGA 4KOVA 2X7BA 2FS5A 3PP9A 3ZZIA 2OH1A 4PK2A 2GANA 1UFHA 4F6AA 4FD4A 4M85A 2ZW7A 1XE4A 4CRYB 4JJXA 3T90A 4KOUA 3SXOA 4MY0A 2PDOA 5EC4A 5JPHA 4HKFA 5FVJA 2VXKA 2OZHA 2I79A 3K9UA 1MJ9A 1XEBA 2B5GB 5DWMA 2J8NA 2FE7A 4FD5A 4XPKA 5KTDA 1U6MA 3E0KA 1WK4A 4HNXB 2HV2A 3R9FA 2D4OA 1M44A 2AJ6A 4E8OA 3S6KA 3T9YA 4IUSA 2ZW4A 3G8WA 4X5KA 4IF5A 3BJ7A 3LODA 2H5MA 2PRBA 3FRMA 5C88A 1N71A 2HUZA 2R98A 4AVCA 4OADA 3EXNA 4M3SA 2B4DA 1Z9UA 3TTHA 2R1IA 3CXSA 2PSWA 2QMLA 3D2MA 5KTAA 4PK3A 4QBJA 3R1KA 3EC4A 3OWCA 3BLNA 2DXQA 5F46A 2BSWA 2FSRA 4MHDA 4KOTA 4KOWA 3S6HA 1S7NA 4II9A 1YVOA 1QSMA 5ISVA 1IB1E 1V0CA 4KUBA 1S60A 4Y49C 1YLEA 1OZPA 3DNSA 3CXQA 4KOXA 2IL4A 1Y7RA 2B58A 5J8FA 2PR1A 3G3SA 1PU9A 4PSWA 5F49A 4AB7A 5I0CA 3D8PA 2JLMA 1BO4A 2P6GA 1IYKA 4AVBA 2OB0A 3WR7A 3BJ8A 4L8AA 1M4DA 3F5BA 3RYOA 1SQHA 3QAHA 3VWDA 3TFYA 4HNYB 3R9GA 3W6XA 4CAWA 4ZBGA 2NMTA 5E96A 2AE6A 2A4NA 4U9ZA 3FBUA 4KORA 4LX9A 2PC1A 4ORFA 4KZTA 4NSQA 3R95A 3PZJA 2OZUA 5C82A 2G3AA 4K30A 4NCZA 4JLYA 2B3VA 3I9SA 4E0AA 3CXPA 4R3LA 2PQ8A 2C27A 4B5PB 4LUAA 3F8KA 4CRZB 4AVAA 1FY7A 1KZFA 3TO6A 4RS2A 1XF8A 4H6ZA 3S6GA 3GY9A 3W91A 1VHSA 3P2FA 5EBVA 4FD7A 3SXNA 2CY2A 1Y9WA 2CNMA 3N7ZA 2D4PA 4CAXA 1Q2DA 2ZXVA 4CS0B 4PV6A 1NE9A 4YRHA 2QECA 1CM0A 2B3UA 3B8GA 3JUWA 4I49A 4MI4A 5CNPA 1Z4RA 2Z11A 3NE7A 3MGDA 2G0BA 3TCVA 3D2PA 4F0YA 1IICA 4YGOA 3TT2A 1M1DA 4MBUA 1QSOA 1TIQA 4B5OA 4NF1A 1B6BA 4QUSA 1P4NA 1P0HA 3I3GA 1S3ZA 2FXFA 1XIXA 1S5KA 2HQYA 4R9MA 1NSLA 2GE3A 1LRZA 1QSNA 2FT0A 5IX3A 4E2AA 4ONUA 2PR8A 2P6EA 3FXTA 2Q04A 4QVTA 4Y49B 1GHEA 4UWJA 3TE4A 3EFAA 4J3GA 3TOAA 4R57A 3ZJ0A 4H89A 1Q2CA 1I12A 3GYAA 3FNCA 4L89A 1RXTA 2Q4VA 4MJ8A 2VZZA 2REEA 2WPXA 4QC6A 3V8IA 4QB9A 4PSXA 3TO7A 2B5GA 4KUAA 2ATRA 4UWIA 1ON0A 1VKCA 1CJWA 1KUXA 3DDDA 4XNHC 4FD6A 3F0AA 4KVOE 1B87A 2CNTA 4NEXA 1IIDA 1IYLA 2OU2A 4XPDC 2B4DB 2ZW6A 4KOSA 3D3SA 1Y9KA 3KKWA 2OZGA 1L0CA 1BOBA 3DSBA 4KLVA 4HNWB 3R96A 4H6UA 3DR8A 4DNCA 3DR6A 2K5TA 3R9EA 4KOYA 2G3TA 1I21A 2GIVA 5H86A 2ZW5A 4JXRA 1YK3A 4U9YA 2VI7A 1YREA 5F48A 5IB0A 4BMHA 4UA3A 1MJAA 1K4JA 3GKRA 4KVME 4RI1A 2JEVA 3S6FA 5KTCA 5J8CA 3UY5A 3IGRA 2J8MA 2QIRA 4KVXA 2FIWA 2Z10A 5JQ4A 4CAVA 2Y0MA 2I00A 4EVYA 3FIXA 2BL1A 5HMNA 4KLWA 4JXQA 2Z0ZA 2Q0YA 2P6FA 1QSTA 3P2HA 4OAEA 1S7LA 2BEIA 3SHPA 1I1DA 2FCKA 2FL4A 4R3KA 2O28A 4OLLA 2R7HA 3FYNA 1KUYA 2B4BA 1RO5A 1R57A 1YR0A 5IV0A 1PUAA 2WPWA 1S7FA 4XPLA 3QB8A 5F47A 4JD6A 4MY3A 2REFA 1NMTA 2VEZA 3C26A 2JDCA 3H4QA 3TO9A 2JDDA 3EO4A 4AG9A 4U5YA 1MJBA 4YFJA 2J8RA 2RC4A 3TOBA 1M4GA 3PGPA 2Q44A 2EVNA 2Q4YA 3VWEA 2R8VA 1Z4EA 2VBQA 2F5IA 4B5PA 1WWZA 2VZYA
chains in the Genus database with same CATH superfamily
5GCNA 3EY5A 5LRKA 2CXAA 2P0WA 2KCWA 1QSRA 2ZEMA 3CPXA 2Z3MA 3FB3A 4MFKA 4C7IA 2VQYA 3DLJA 4MCQA 4NGTA 4F9UA 5DWNA 1YVKA 1J4JA 4MFZA 4LQGA 4JWPA 1TXRA 4XNHB 5IB9A 4PQAA 4PXCA 3B3WA 1Q2YA 2NSMA 2BUEA 5F46A 2ZEEA 4UBRA 3JVNA 5HH1A 3B3SA 2EUIA 2PJ8A 1KUVA 4R87A 3IWEA 3IFEA 4X8IA 4JYWA 2ZENA 1YX0A 4XPDB 2PVWA 1YLOA 1BPMA 1GYTA 5H84A 4B14A 2ZELA 8CPAA 3KR4A 1LAPA 1VHOA 4NGQA 2CNSA 4RN7A 1TF8A 4GS4A 4WJBA 5HXDA 3S9LA 2FIAA 4OC5A 4OC3A 1XMTA 1MK4A 3KHXA 3WABA 5G1ZA 4NXYA 3LD2A 5AG4A 2AFWA 1S7KA 1M4IA 3W6SA 2ZPAA 2ARHA 4AG7A 1YGHA 2O4HA 5LYDA 2Q7BA 3SJGA 4OMEA 3VATA 4DUKA 3IWGA 4KOVA 5F09A 3PB7X 2I3CA 1CP6A 2PJ3A 5A28A 1XFOA 2AFXA 2X7BA 1QQ9A 2ZEOA 2FS5A 3PP9A 3ZZIA 2OH1A 2DPTA 3RNZA 3IJ3A 4PK2A 4W9YA 1YW4A 3WC6A 1LFWA 3SJFA 3KHZA 2GANA 3NE8A 4P10A 4B11A 4C2YA 5I4MA 1UFHA 4F6AA 4FD4A 3S9MA 1Q7LA 2GLFA 3K9TA 2XEGA 4M85A 2ZW7A 4P4JA 1XE4A 4OIWA 4CRYB 4JJXA 2AFZA 3B35A 3T90A 4KOUA 3NH5A 3SXOA 3A9LA 1X10A 4MY0A 2PDOA 2Z3KA 5EC4A 5JPHA 1OBRA 4HKFA 4R8FA 5FVJA 2IQ6A 1YSJA 3NH4A 2Q7SA 2VXKA 3HUVA 4TNUA 2OZHA 2I79A 3K9UA 1Z5RA 1MJ9A 1XEBA 1M4LA 1UWYA 2B5GB 1HEEA 2NYQA 4NFRA 2YNDA 5DWMA 3TX8A 4F0XA 2PJ9A 5J1QA 2J8NA 1EE3P 2FVGA 2GREA 2FE7A 3HLPA 4FD5A 4XPKA 5AG5A 5KTDA 1U6MA 3E0KA 1WK4A 4HNXB 3V7ZA 5CBMA 5LRGA 3SI1A 2HV2A 3R9FA 2D4OA 1M44A 5K8NA 2AJ6A 4E8OA 3FF3A 3S6KA 3PFOA 2EWBA 4ZX8A 4IUSA 3T9YA 4UCNA 3VARA 4UEEA 4CPAA 2O53A 2ZW4A 3QAYA 1YW6A 3G8WA 4CYOA 4R6TA 4X5KA 1LCPA 4G1PA 4EFDA 4IF5A 3V38A 1CPXA 4R7MA 3BJ7A 3LODA 2H5MA 2PRBA 3D68A 1NSAA 3FRMA 3L2NA 1N71A 2JBKA 4PPZA 5C88A 2HUZA 3PRTA 4A37A 2G9DA 3IC1A 4P4FA 4UEFA 2R98A 4AVCA 4OADA 4UFVA 3EXNA 3KQXA 3B3TA 2B4DA 4M3SA 5K8OA 1HDQA 2PJ4A 2PJ6A 1XMBA 1Z9UA 2CTBA 2PJ0A 2Z3OA 3TTHA 4A2ZA 2BCOA 5JH9A 2V8GA 1R43A 4AXVA 3BI1A 1BAVA 4X2TA 2R1IA 3IU1A 3CXSA 2IMOA 2PSWA 3DGVA 4FBEA 2QMLA 4MHNA 3D2MA 4UF4A 1ZG7A 1AUGA 4Q7AA 2ZOFA 4PK3A 1ARMA 4UIBA 3R1KA 4QBJA 5KTAA 1DE4C 4WWVA 2EO8A 4NGPA 2ZEFA 3BI0A 3EC4A 3BLNA 2DXQA 3MN8A 3OWCA 2BSWA 2FSRA 4BINA 4MHDA 4FAIA 1ZO0A 4KOTA 3WT4A 4KOWA 2YGWA 4ZX9A 3S6HA 1S7NA 3PEIA 1YVOA 2ZEGA 1QSMA 4II9A 3NFZA 4PXEA 4OP4A 3D7DA 5ISVA 1IB1E 2F7VA 2BOAA 1XJOA 7CPAA 1V0CA 2AFMA 1S60A 3PFEA 4KUBA 4Y49C 4B12A 1YLEA 3WC7A 5HVHA 1OZPA 3DNSA 3CXQA 2JEWA 4YU9A 4FWUA 4KOXA 2IL4A 1Y7RA 2WZNA 1XRYA 2ZOGA 2B58A 5J8FA 2PR1A 4C2XA 3G3SA 5D8NA 1PU9A 4PSWA 3KL9A 3FX6A 5F49A 4AB7A 5I0CA 1TKFA 4JZ0A 4O23A 3D8PA 3I1UA 2JLMA 4A38A 1BO4A 2DF5A 2F8HA 5AG6A 2P6GA 4KSAA 1IYKA 4MCRA 4AVBA 2OB0A 3WR7A 2GU2A 3BJ8A 4MCPA 4KSFA 4L8AA 1M4DA 3F5BA 3RYOA 2DPSA 1SQHA 3QAHA 3ISZA 4OC4A 3VWDA 4C68A 3H8GA 3KQZA 4MXUA 4HNYB 3R9GA 1IGBA 3TFYA 3RAMA 3W6XA 4CAWA 4ZI6A 4ZBGA 4P4EA 2NMTA 3GLJA 4B6ZA 5E96A 2AE6A 3D7GA 2A4NA 3PB4X 2PCUA 2OR4A 1CG2A 4U9ZA 2AFSA 3FBUA 2EBJA 2J9AA 3LMSA 4KORA 4LX9A 1H8LA 3TC8A 3CDXA 2PC1A 4ORFA 2YNCC 4KZTA 4NSQA 4UCPA 5LYLA 3RO0A 1Y7EA 4ZY0A 3BXMA 3R95A 3FJUA 3PZJA 2V8VA 3SJXA 2PE3A 1BLLE 4RUHA 4P4IA 2OZUA 4MCSA 2G3AA 5C82A 4K30A 4C7HA 4NCZA 4JLYA 1AYEA 2B3VA 3I9SA 1Z8LA 4E0AA 4CGPA 3CZXA 3CXPA 4R3LA 3RZAA 2PQ8A 3D4UA 5K8MA 1XOVA 1ELLP 2C27A 5THWA 4LUAA 4B5PB 3F8KA 3FH4A 4P4DA 4CRZB 2CTCA 2ANPA 3K2KA 1FY7A 1KZFA 3TO6A 4AVAA 4RS2A 1ARLA 1XF8A 3BHXA 2PJAA 4H6ZA 3D67A 4UFXA 3S6GA 2QVPA 1ZLIA 3GY9A 5AG7A 3W91A 1VHSA 3P2FA 5EBVA 1DTDA 4FD7A 4Q36A 3SXNA 2CY2A 3GUXA 2C6CA 2AFOA 1Y9WA 4IHMA 2CNMA 3N7ZA 2D4PA 3IIBA 3KZWA 4PXDA 2HB6A 4CAXA 4ZGYB 1Q2DA 2ZXVA 4NGSA 2Q51A 4CS0B 4PV6A 1NE9A 1CBXA 3IU2A 4YRHA 4IAVA 2QECA 1YQEA 1CM0A 1RTQA 2B3UA 2PRQA 4A32A 3B8GA 3JUWA 1Z8XA 4M6IA 1CX8A 4I49A 1JQGA 4MI4A 1Z4RA 2Z11A 3NE7A 5CNPA 3T8WA 3MGDA 2PIZA 3GIUA 2G0BA 4F9VA 3TCVA 4MRIA 3D2PA 5LYFA 1IOFA 1Y0YA 3WC5A 4F0YA 1IICA 4YGOA 3SI2A 3TT2A 4Q38A 1M1DA 1PYTB 2CIJA 3N5FA 4MBUA 4OC0A 4A33A 4Z65A 1QSOA 1TIQA 3FVLA 4B5OA 4M6HA 5D29A 4X3RA 4A39A 4NF1A 1B6BA 4C2ZA 2CF4A 4QUSA 1P4NA 1R3NA 1P0HA 1IOIA 1S3ZA 3I3GA 2PIYA 4ONWA 4CAFA 3D7HA 4MHYA 2FXFA 1XIXA 1F2PA 4UEZA 1S5KA 2HQYA 5LRJA 4B13A 4OC1A 4R9MA 1A2ZA 2Z3PA 4KS9A 1NSLA 2GE3A 2V77A 3CPAA 2GLJA 1LRZA 4CGOA 1HDUA 1QSNA 2FT0A 5IX3A 3B2YA 2XEFA 1CPSA 1KWMA 1ZLHA 4E2AA 4UFWA 4ONUA 1FT7A 2PR8A 2P6EA 3FXTA 3PB8X 5ELYA 3IWWA 5A27A 2Z3NA 3ISXA 2Q04A 3KASA 3FEEA 1GHEA 4QVTA 4UWJA 4Y49B 1VHEA 1Z2LA 3TE4A 1IU8A 2ZEDA 2V8DA 3EFAA 3RBUA 5HVGA 4J3GA 4MMOA 1PCAA 3TOAA 1TKJA 1X12A 4R57A 4P45A 3ZJ0A 4H89A 1Q2CA 5JM6A 3H5ZA 2V8HA 1I12A 3GYAA 3FNCA 4HPSA 4L89A 4EWTA 1RXTA 3LWUA 5K8PA 4MFQA 3B3CA 1VIXA 2Q4VA 4MJ8A 3PB6X 2Z3LA 2ZEPA 2VZZA 2REEA 2WPXA 4ZY2A 4PXBA 2QJ8A 4GM5A 4QC6A 2RB7A 3V8IA 4QB9A 4A94A 3IEHA 4PSXA 3TO7A 2B5GA 4KUAA 2ATRA 2C6PA 4UWIA 1ON0A 1VKCA 3PBEA 1CJWA 1KUXA 3DDDA 2PJ7A 4XNHC 1VGYA 5G21A 4FD6A 3F0AA 4KVOE 4DJLA 1B87A 1YMEA 2ODFA 2CNTA 4LQ6A 4NEXA 1IIDA 5HVFA 2RFHA 4CGLA 4ZY1A 1IYLA 2OU2A 4XPDC 2B4DB 2ZW6A 2C6GA 3JRUA 4KOSA 5JGFA 3D3SA 2EK9A 4R76A 3SJEA 2PJBA 1FNOA 3D66A 1Y9KA 2ZEHA 3KKWA 4OIDA 1TF9A 2HC9A 2OZGA 3JTKA 1Y0RA 4KSIA 1L0CA 1BOBA 2JBJA 3DSBA 3PBBA 4KLVA 4HNWB 4P44A 3R96A 4M6GA 3MRUA 3NH8A 1F2OA 4H6UA 3DR8A 3IO1A 4DNCA 3DR6A 2XEIA 4NGMA 1LANA 2EK8A 4GXHA 5LYIA 2K5TA 4MFJA 3R9EA 4KOYA 1F57A 1JWQA 2ABZA 5AGEA 5BWAB 2G3TA 1I21A 2WUUA 2GIVA 5H86A 4CGMA 2QYVA 2ZW5A 4JXRA 3VH9A 1YK3A 4U9YA 2VI7A 5DS0A 1YREA 5F48A 5IB0A 4BMHA 4F8ZA 4UA3A 1MJAA 1K4JA 4A30A 2WYRA 3GKRA 3B3VA 4NJQA 4NGNA 4CGNA 4KVME 4RI1A 3LACA 2JEVA 4K3NA 4ZYQA 3KI9A 3FECA 3S6FA 5KTCA 2DEAA 3FMCA 5J8CA 3UY5A 3FEDA 4BBHA 3IGRA 1AMPA 1ZG8A 2J8MA 2QIRA 3NA6A 4KVXA 4MFPA 2FIWA 2Z10A 5JQ4A 4TWEA 4CAVA 1Z8TA 2Y0MA 2I00A 2Q43A 2VL1A 4EVYA 6CPAA 3FIXA 2WSAA 4BD9A 2PVVA 2BL1A 5G22A 5HMNA 4KLWA 2PJ2A 4JXQA 2Z0ZA 2Q0YA 2P6FA 1QSTA 3P2HA 4P6YA 3GB0A 4MHZA 2Q4ZA 4H2KA 4OAEA 4CYQA 4UIAA 1S7LA 2BEIA 3B7IA 4P4BA 4A95A 4NJRA 3S9NA 2PJCA 3CT9A 3SHPA 4DYOA 1CP7A 1I1DA 3D7FA 3H8FA 2FCKA 2FL4A 2XEJA 4R3KA 4CYPA 2O28A 2PJ1A 4OLLA 4CYNA 1TKHA 2IJZA 2R7HA 4UCMA 3FYNA 1KUYA 1QMUA 4IK2A 4B10A 2B4BA 1RO5A 2YNEA 3H8EA 1IY7A 1R57A 1YR0A 5IV0A 1PUAA 4MFLA 2WPWA 1S7FA 4XPLA 3QB8A 4YWYA 3SI0A 5F47A 1BPNA 2POKA 4JD6A 4MY3A 4EMEA 2REFA 4NGRA 1NMTA 2VEZA 2YNCA 2AFUA 3C26A 2JDCA 3H4QA 5EMIA 2OOTA 3TO9A 2JDDA 3EO4A 4OKOA 4AG9A 3KGQA 1ELMP 1MJBA 1Z8WA 4U5YA 1XBUA 5CPAA 2J8RA 4YFJA 2RC4A 4MHPA 3TOBA 1M4GA 2C1CA 3PGPA 3QNVA 4FUUA 2GFQA 4CAEA 2Q44A 2BO9A 2EVNA 2Q4YA 3VWEA 2R8VA 3KR5A 1Z4EA 2PJ5A 2VBQA 4A31A 2F5IA 1ZG9A 4B5PA 5G20A 1LAMA 1LOKA 1WWZA 2VZYA 3PB9X 4OC2A
chains in the Genus database with same CATH topology
5GCNA 3EY5A 2CXAA 2P0WA 2KCWA 1QSRA 2Z3MA 3FB3A 4MFKA 4C7IA 2VQYA 5DWNA 1YVKA 1J4JA 4MFZA 4JWPA 4XNHB 1Q2YA 2BUEA 4UBRA 3JVNA 5HH1A 2EUIA 1KUVA 4R87A 3IWEA 4XPDB 1YX0A 5H84A 4B14A 2CNSA 4GS4A 2FIAA 1XMTA 1MK4A 5G1ZA 4NXYA 3LD2A 5AG4A 1S7KA 1M4IA 3W6SA 2ZPAA 2ARHA 4AG7A 1YGHA 2Q7BA 3IWGA 4KOVA 5A28A 2X7BA 2FS5A 3PP9A 3ZZIA 2OH1A 2DPTA 4PK2A 2GANA 4B11A 4C2YA 1UFHA 4F6AA 4FD4A 4M85A 2ZW7A 1XE4A 4CRYB 4JJXA 3T90A 4KOUA 3SXOA 3A9LA 4MY0A 2PDOA 2Z3KA 5EC4A 5JPHA 4HKFA 5FVJA 2VXKA 2OZHA 2I79A 3K9UA 1MJ9A 1XEBA 2B5GB 5DWMA 2YNDA 4F0XA 2J8NA 2FE7A 4FD5A 4XPKA 5AG5A 5KTDA 1U6MA 3E0KA 1WK4A 4HNXB 2HV2A 3R9FA 2D4OA 1M44A 2AJ6A 4E8OA 3S6KA 3T9YA 4IUSA 4UCNA 2ZW4A 3G8WA 4CYOA 4X5KA 4IF5A 3BJ7A 3LODA 2H5MA 2PRBA 3FRMA 5C88A 1N71A 2HUZA 2R98A 4AVCA 4OADA 4UFVA 3EXNA 4M3SA 2B4DA 1Z9UA 2Z3OA 3TTHA 4A2ZA 2R1IA 3IU1A 3CXSA 2PSWA 2QMLA 3D2MA 4C7HA 5KTAA 4PK3A 4QBJA 3R1KA 3EC4A 3OWCA 3BLNA 2DXQA 5F46A 2BSWA 2FSRA 4MHDA 1ZO0A 4KOTA 4KOWA 2YGWA 3S6HA 1S7NA 4II9A 1YVOA 1QSMA 5ISVA 1IB1E 1V0CA 4KUBA 1S60A 4Y49C 4B12A 1YLEA 1OZPA 3DNSA 3CXQA 4KOXA 2IL4A 1Y7RA 2B58A 5J8FA 2PR1A 4C2XA 3G3SA 1PU9A 4PSWA 5F49A 4AB7A 5I0CA 3D8PA 2JLMA 1BO4A 5AG6A 2P6GA 4KSAA 1IYKA 4AVBA 2OB0A 3WR7A 3BJ8A 4KSFA 4L8AA 1M4DA 3F5BA 3RYOA 2DPSA 1SQHA 3QAHA 4C68A 3VWDA 3TFYA 4HNYB 3R9GA 3W6XA 4CAWA 4ZBGA 2NMTA 5E96A 2AE6A 2A4NA 4U9ZA 3FBUA 4KORA 4LX9A 2PC1A 4ORFA 2YNCC 4KZTA 4NSQA 4UCPA 3R95A 3PZJA 2OZUA 5C82A 2G3AA 4K30A 4NCZA 4JLYA 2B3VA 3I9SA 4E0AA 4CGPA 3CXPA 4R3LA 2PQ8A 2C27A 4B5PB 4LUAA 3F8KA 4CRZB 4AVAA 1FY7A 1KZFA 3TO6A 4RS2A 1XF8A 4H6ZA 4UFXA 3S6GA 3GY9A 5AG7A 3W91A 1VHSA 3P2FA 5EBVA 4Q36A 4FD7A 3SXNA 2CY2A 1Y9WA 2CNMA 3N7ZA 2D4PA 4CAXA 4ZGYB 1Q2DA 2ZXVA 4CS0B 4PV6A 1NE9A 3IU2A 4YRHA 2QECA 1CM0A 2B3UA 4A32A 3B8GA 3JUWA 4I49A 4MI4A 5CNPA 1Z4RA 2Z11A 3NE7A 3MGDA 2G0BA 3TCVA 3D2PA 4F0YA 1IICA 4YGOA 3TT2A 4Q38A 1M1DA 4MBUA 4A33A 1QSOA 1TIQA 4B5OA 4C2ZA 4NF1A 1B6BA 4QUSA 1P4NA 1P0HA 3I3GA 1S3ZA 4CAFA 2FXFA 1XIXA 1S5KA 2HQYA 4B13A 4R9MA 2Z3PA 4KS9A 1NSLA 2GE3A 1LRZA 4CGOA 1QSNA 2FT0A 5IX3A 4E2AA 4UFWA 4ONUA 2PR8A 2P6EA 3FXTA 5A27A 2Z3NA 2Q04A 4QVTA 4Y49B 1GHEA 4UWJA 3TE4A 3EFAA 4J3GA 3TOAA 4R57A 3ZJ0A 4H89A 1Q2CA 3H5ZA 1I12A 3GYAA 3FNCA 4L89A 1RXTA 4MFQA 2Q4VA 4MJ8A 2Z3LA 2VZZA 2REEA 2WPXA 4QC6A 3V8IA 4QB9A 4PSXA 3TO7A 2B5GA 4KUAA 2ATRA 4UWIA 1ON0A 1VKCA 1CJWA 1KUXA 3DDDA 4XNHC 5G21A 4FD6A 3F0AA 4KVOE 1B87A 2CNTA 4NEXA 1IIDA 4CGLA 1IYLA 2OU2A 4XPDC 2B4DB 2ZW6A 4KOSA 3D3SA 1Y9KA 3KKWA 2OZGA 3JTKA 1L0CA 1BOBA 3DSBA 4KLVA 4HNWB 3R96A 4H6UA 3DR8A 4DNCA 3DR6A 2K5TA 4MFJA 3R9EA 4KOYA 5BWAB 5AGEA 2G3TA 1I21A 2WUUA 2GIVA 5H86A 4CGMA 2ZW5A 4JXRA 1YK3A 4U9YA 2VI7A 1YREA 5F48A 5IB0A 4BMHA 4UA3A 1MJAA 1K4JA 4A30A 3GKRA 4CGNA 4KVME 4RI1A 2JEVA 3S6FA 5KTCA 5J8CA 3UY5A 4BBHA 3IGRA 2J8MA 2QIRA 4KVXA 4MFPA 2FIWA 2Z10A 5JQ4A 4CAVA 2Y0MA 2I00A 4EVYA 3FIXA 2WSAA 2BL1A 5G22A 5HMNA 4KLWA 4JXQA 2Z0ZA 2Q0YA 2P6FA 1QSTA 3P2HA 4OAEA 4CYQA 1S7LA 2BEIA 4A95A 3SHPA 1I1DA 2FCKA 2FL4A 4R3KA 4CYPA 2O28A 4OLLA 4CYNA 2R7HA 4UCMA 3FYNA 1KUYA 4B10A 2B4BA 1RO5A 2YNEA 1R57A 1YR0A 5IV0A 1PUAA 4MFLA 2WPWA 1S7FA 4XPLA 3QB8A 5F47A 4JD6A 4MY3A 2REFA 1NMTA 2VEZA 2YNCA 3C26A 2JDCA 3H4QA 3TO9A 2JDDA 3EO4A 4AG9A 4U5YA 1MJBA 4YFJA 2J8RA 2RC4A 3TOBA 1M4GA 3PGPA 4CAEA 2Q44A 2EVNA 2Q4YA 3VWEA 2R8VA 1Z4EA 2VBQA 4A31A 2F5IA 4B5PA 5G20A 1WWZA 2VZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GCN A;  3EY5 A;  2P0W A;  2KCW A;  1QSR A;  3FB3 A;  2VQY A;  5DWN A;  1YVK A;  1J4J A;  4JWP A;  4XNH B;  1Q2Y A;  2BUE A;  4UBR A;  3JVN A;  5HH1 A;  2EUI A;  1KUV A;  4R87 A;  4XPD B;  1YX0 A;  5H84 A;  2CNS A;  4GS4 A;  2FIA A;  1XMT A;  1MK4 A;  4NXY A;  3LD2 A;  1S7K A;  1M4I A;  3W6S A;  2ZPA A;  2ARH A;  4AG7 A;  1YGH A;  2Q7B A;  3IWG A;  4KOV A;  2X7B A;  2FS5 A;  3PP9 A;  3ZZI A;  2OH1 A;  4PK2 A;  2GAN A;  1UFH A;  4F6A A;  4FD4 A;  4M85 A;  2ZW7 A;  1XE4 A;  4CRY B;  4JJX A;  3T90 A;  4KOU A;  3SXO A;  4MY0 A;  2PDO A;  5EC4 A;  5JPH A;  4HKF A;  5FVJ A;  2VXK A;  2OZH A;  2I79 A;  3K9U A;  1MJ9 A;  1XEB A;  2B5G B;  5DWM A;  2J8N A;  2FE7 A;  4FD5 A;  4XPK A;  5KTD A;  1U6M A;  3E0K A;  1WK4 A;  4HNX B;  2HV2 A;  3R9F A;  2D4O A;  1M44 A;  2AJ6 A;  4E8O A;  3S6K A;  3T9Y A;  4IUS A;  2ZW4 A;  3G8W A;  4X5K A;  4IF5 A;  3BJ7 A;  3LOD A;  2H5M A;  2PRB A;  3FRM A;  5C88 A;  1N71 A;  2HUZ A;  2R98 A;  4AVC A;  4OAD A;  3EXN A;  4M3S A;  2B4D A;  1Z9U A;  3TTH A;  2R1I A;  3CXS A;  2PSW A;  2QML A;  3D2M A;  5KTA A;  4PK3 A;  4QBJ A;  3R1K A;  3EC4 A;  3OWC A;  3BLN A;  2DXQ A;  5F46 A;  2BSW A;  2FSR A;  4MHD A;  4KOT A;  4KOW A;  3S6H A;  1S7N A;  4II9 A;  1YVO A;  1QSM A;  5ISV A;  1IB1 E;  1V0C A;  4KUB A;  1S60 A;  4Y49 C;  1YLE A;  1OZP A;  3DNS A;  3CXQ A;  4KOX A;  2IL4 A;  1Y7R A;  2B58 A;  5J8F A;  2PR1 A;  3G3S A;  1PU9 A;  4PSW A;  5F49 A;  4AB7 A;  5I0C A;  3D8P A;  2JLM A;  1BO4 A;  2P6G A;  1IYK A;  4AVB A;  2OB0 A;  3WR7 A;  3BJ8 A;  4L8A A;  1M4D A;  3F5B A;  3RYO A;  1SQH A;  3QAH A;  3VWD A;  3TFY A;  4HNY B;  3R9G A;  3W6X A;  4CAW A;  4ZBG A;  2NMT A;  5E96 A;  2AE6 A;  2A4N A;  4U9Z A;  3FBU A;  4KOR A;  4LX9 A;  2PC1 A;  4ORF A;  4KZT A;  4NSQ A;  3R95 A;  3PZJ A;  2OZU A;  5C82 A;  2G3A A;  4K30 A;  4NCZ A;  4JLY A;  2B3V A;  3I9S A;  4E0A A;  3CXP A;  4R3L A;  2PQ8 A;  2C27 A;  4B5P B;  4LUA A;  3F8K A;  4CRZ B;  4AVA A;  1FY7 A;  1KZF A;  3TO6 A;  4RS2 A;  1XF8 A;  4H6Z A;  3S6G A;  3GY9 A;  3W91 A;  1VHS A;  3P2F A;  5EBV A;  4FD7 A;  3SXN A;  2CY2 A;  1Y9W A;  2CNM A;  3N7Z A;  2D4P A;  4CAX A;  1Q2D A;  2ZXV A;  4CS0 B;  4PV6 A;  1NE9 A;  4YRH A;  2QEC A;  1CM0 A;  2B3U A;  3B8G A;  3JUW A;  4I49 A;  4MI4 A;  5CNP A;  1Z4R A;  2Z11 A;  3NE7 A;  3MGD A;  2G0B A;  3TCV A;  3D2P A;  4F0Y A;  1IIC A;  4YGO A;  3TT2 A;  1M1D A;  4MBU A;  1QSO A;  1TIQ A;  4B5O A;  4NF1 A;  1B6B A;  4QUS A;  1P4N A;  1P0H A;  3I3G A;  1S3Z A;  2FXF A;  1XIX A;  1S5K A;  2HQY A;  4R9M A;  1NSL A;  2GE3 A;  1LRZ A;  1QSN A;  2FT0 A;  5IX3 A;  4E2A A;  4ONU A;  2PR8 A;  2P6E A;  3FXT A;  2Q04 A;  4QVT A;  4Y49 B;  1GHE A;  4UWJ A;  3TE4 A;  3EFA A;  4J3G A;  3TOA A;  4R57 A;  3ZJ0 A;  4H89 A;  1Q2C A;  1I12 A;  3GYA A;  3FNC A;  4L89 A;  1RXT A;  2Q4V A;  4MJ8 A;  2VZZ A;  2REE A;  2WPX A;  4QC6 A;  3V8I A;  4QB9 A;  4PSX A;  3TO7 A;  2B5G A;  4KUA A;  2ATR A;  4UWI A;  1ON0 A;  1VKC A;  1CJW A;  1KUX A;  3DDD A;  4XNH C;  4FD6 A;  3F0A A;  4KVO E;  1B87 A;  2CNT A;  4NEX A;  1IID A;  1IYL A;  2OU2 A;  4XPD C;  2B4D B;  2ZW6 A;  4KOS A;  3D3S A;  1Y9K A;  3KKW A;  2OZG A;  1L0C A;  1BOB A;  3DSB A;  4KLV A;  4HNW B;  3R96 A;  4H6U A;  3DR8 A;  4DNC A;  3DR6 A;  2K5T A;  3R9E A;  4KOY A;  2G3T A;  1I21 A;  2GIV A;  5H86 A;  2ZW5 A;  4JXR A;  1YK3 A;  4U9Y A;  2VI7 A;  1YRE A;  5F48 A;  5IB0 A;  4BMH A;  4UA3 A;  1MJA A;  1K4J A;  3GKR A;  4KVM E;  4RI1 A;  2JEV A;  3S6F A;  5KTC A;  5J8C A;  3UY5 A;  3IGR A;  2J8M A;  2QIR A;  4KVX A;  2FIW A;  2Z10 A;  5JQ4 A;  4CAV A;  2Y0M A;  2I00 A;  4EVY A;  3FIX A;  2BL1 A;  5HMN A;  4KLW A;  4JXQ A;  2Z0Z A;  2Q0Y A;  2P6F A;  1QST A;  3P2H A;  4OAE A;  1S7L A;  2BEI A;  3SHP A;  1I1D A;  2FCK A;  2FL4 A;  4R3K A;  2O28 A;  4OLL A;  2R7H A;  3FYN A;  1KUY A;  2B4B A;  1RO5 A;  1R57 A;  1YR0 A;  5IV0 A;  1PUA A;  2WPW A;  1S7F A;  4XPL A;  3QB8 A;  5F47 A;  4JD6 A;  4MY3 A;  2REF A;  1NMT A;  2VEZ A;  3C26 A;  2JDC A;  3H4Q A;  3TO9 A;  2JDD A;  3EO4 A;  4AG9 A;  4U5Y A;  1MJB A;  4YFJ A;  2J8R A;  2RC4 A;  3TOB A;  1M4G A;  3PGP A;  2Q44 A;  2EVN A;  2Q4Y A;  3VWE A;  2R8V A;  1Z4E A;  2VBQ A;  2F5I A;  4B5P A;  1WWZ A;  2VZY A; 
#chains in the Genus database with same CATH topology
 5GCN A;  3EY5 A;  5LRK A;  2CXA A;  2P0W A;  2KCW A;  1QSR A;  2ZEM A;  3CPX A;  2Z3M A;  3FB3 A;  4MFK A;  4C7I A;  2VQY A;  3DLJ A;  4MCQ A;  4NGT A;  4F9U A;  5DWN A;  1YVK A;  1J4J A;  4MFZ A;  4LQG A;  4JWP A;  1TXR A;  4XNH B;  5IB9 A;  4PQA A;  4PXC A;  3B3W A;  1Q2Y A;  2NSM A;  2BUE A;  5F46 A;  2ZEE A;  4UBR A;  3JVN A;  5HH1 A;  3B3S A;  2EUI A;  2PJ8 A;  1KUV A;  4R87 A;  3IWE A;  3IFE A;  4X8I A;  4JYW A;  2ZEN A;  1YX0 A;  4XPD B;  2PVW A;  1YLO A;  1BPM A;  1GYT A;  5H84 A;  4B14 A;  2ZEL A;  8CPA A;  3KR4 A;  1LAP A;  1VHO A;  4NGQ A;  2CNS A;  4RN7 A;  1TF8 A;  4GS4 A;  4WJB A;  5HXD A;  3S9L A;  2FIA A;  4OC5 A;  4OC3 A;  1XMT A;  1MK4 A;  3KHX A;  3WAB A;  5G1Z A;  4NXY A;  3LD2 A;  5AG4 A;  2AFW A;  1S7K A;  1M4I A;  3W6S A;  2ZPA A;  2ARH A;  4AG7 A;  1YGH A;  2O4H A;  5LYD A;  2Q7B A;  3SJG A;  4OME A;  3VAT A;  4DUK A;  3IWG A;  4KOV A;  5F09 A;  3PB7 X;  2I3C A;  1CP6 A;  2PJ3 A;  5A28 A;  1XFO A;  2AFX A;  2X7B A;  1QQ9 A;  2ZEO A;  2FS5 A;  3PP9 A;  3ZZI A;  2OH1 A;  2DPT A;  3RNZ A;  3IJ3 A;  4PK2 A;  4W9Y A;  1YW4 A;  3WC6 A;  1LFW A;  3SJF A;  3KHZ A;  2GAN A;  3NE8 A;  4P10 A;  4B11 A;  4C2Y A;  5I4M A;  1UFH A;  4F6A A;  4FD4 A;  3S9M A;  1Q7L A;  2GLF A;  3K9T A;  2XEG A;  4M85 A;  2ZW7 A;  4P4J A;  1XE4 A;  4OIW A;  4CRY B;  4JJX A;  2AFZ A;  3B35 A;  3T90 A;  4KOU A;  3NH5 A;  3SXO A;  3A9L A;  1X10 A;  4MY0 A;  2PDO A;  2Z3K A;  5EC4 A;  5JPH A;  1OBR A;  4HKF A;  4R8F A;  5FVJ A;  2IQ6 A;  1YSJ A;  3NH4 A;  2Q7S A;  2VXK A;  3HUV A;  4TNU A;  2OZH A;  2I79 A;  3K9U A;  1Z5R A;  1MJ9 A;  1XEB A;  1M4L A;  1UWY A;  2B5G B;  1HEE A;  2NYQ A;  4NFR A;  2YND A;  5DWM A;  3TX8 A;  4F0X A;  2PJ9 A;  5J1Q A;  2J8N A;  1EE3 P;  2FVG A;  2GRE A;  2FE7 A;  3HLP A;  4FD5 A;  4XPK A;  5AG5 A;  5KTD A;  1U6M A;  3E0K A;  1WK4 A;  4HNX B;  3V7Z A;  5CBM A;  5LRG A;  3SI1 A;  2HV2 A;  3R9F A;  2D4O A;  1M44 A;  5K8N A;  2AJ6 A;  4E8O A;  3FF3 A;  3S6K A;  3PFO A;  2EWB A;  4ZX8 A;  4IUS A;  3T9Y A;  4UCN A;  3VAR A;  4UEE A;  4CPA A;  2O53 A;  2ZW4 A;  3QAY A;  1YW6 A;  3G8W A;  4CYO A;  4R6T A;  4X5K A;  1LCP A;  4G1P A;  4EFD A;  4IF5 A;  3V38 A;  1CPX A;  4R7M A;  3BJ7 A;  3LOD A;  2H5M A;  2PRB A;  3D68 A;  1NSA A;  3FRM A;  3L2N A;  1N71 A;  2JBK A;  4PPZ A;  5C88 A;  2HUZ A;  3PRT A;  4A37 A;  2G9D A;  3IC1 A;  4P4F A;  4UEF A;  2R98 A;  4AVC A;  4OAD A;  4UFV A;  3EXN A;  3KQX A;  3B3T A;  2B4D A;  4M3S A;  5K8O A;  1HDQ A;  2PJ4 A;  2PJ6 A;  1XMB A;  1Z9U A;  2CTB A;  2PJ0 A;  2Z3O A;  3TTH A;  4A2Z A;  2BCO A;  5JH9 A;  2V8G A;  1R43 A;  4AXV A;  3BI1 A;  1BAV A;  4X2T A;  2R1I A;  3IU1 A;  3CXS A;  2IMO A;  2PSW A;  3DGV A;  4FBE A;  2QML A;  4MHN A;  3D2M A;  4UF4 A;  1ZG7 A;  1AUG A;  4Q7A A;  2ZOF A;  4PK3 A;  1ARM A;  4UIB A;  3R1K A;  4QBJ A;  5KTA A;  1DE4 C;  4WWV A;  2EO8 A;  4NGP A;  2ZEF A;  3BI0 A;  3EC4 A;  3BLN A;  2DXQ A;  3MN8 A;  3OWC A;  2BSW A;  2FSR A;  4BIN A;  4MHD A;  4FAI A;  1ZO0 A;  4KOT A;  3WT4 A;  4KOW A;  2YGW A;  4ZX9 A;  3S6H A;  1S7N A;  3PEI A;  1YVO A;  2ZEG A;  1QSM A;  4II9 A;  3NFZ A;  4PXE A;  4OP4 A;  3D7D A;  5ISV A;  1IB1 E;  2F7V A;  2BOA A;  1XJO A;  7CPA A;  1V0C A;  2AFM A;  1S60 A;  3PFE A;  4KUB A;  4Y49 C;  4B12 A;  1YLE A;  3WC7 A;  5HVH A;  1OZP A;  3DNS A;  3CXQ A;  2JEW A;  4YU9 A;  4FWU A;  4KOX A;  2IL4 A;  1Y7R A;  2WZN A;  1XRY A;  2ZOG A;  2B58 A;  5J8F A;  2PR1 A;  4C2X A;  3G3S A;  5D8N A;  1PU9 A;  4PSW A;  3KL9 A;  3FX6 A;  5F49 A;  4AB7 A;  5I0C A;  1TKF A;  4JZ0 A;  4O23 A;  3D8P A;  3I1U A;  2JLM A;  4A38 A;  1BO4 A;  2DF5 A;  2F8H A;  5AG6 A;  2P6G A;  4KSA A;  1IYK A;  4MCR A;  4AVB A;  2OB0 A;  3WR7 A;  2GU2 A;  3BJ8 A;  4MCP A;  4KSF A;  4L8A A;  1M4D A;  3F5B A;  3RYO A;  2DPS A;  1SQH A;  3QAH A;  3ISZ A;  4OC4 A;  3VWD A;  4C68 A;  3H8G A;  3KQZ A;  4MXU A;  4HNY B;  3R9G A;  1IGB A;  3TFY A;  3RAM A;  3W6X A;  4CAW A;  4ZI6 A;  4ZBG A;  4P4E A;  2NMT A;  3GLJ A;  4B6Z A;  5E96 A;  2AE6 A;  3D7G A;  2A4N A;  3PB4 X;  2PCU A;  2OR4 A;  1CG2 A;  4U9Z A;  2AFS A;  3FBU A;  2EBJ A;  2J9A A;  3LMS A;  4KOR A;  4LX9 A;  1H8L A;  3TC8 A;  3CDX A;  2PC1 A;  4ORF A;  2YNC C;  4KZT A;  4NSQ A;  4UCP A;  5LYL A;  3RO0 A;  1Y7E A;  4ZY0 A;  3BXM A;  3R95 A;  3FJU A;  3PZJ A;  2V8V A;  3SJX A;  2PE3 A;  1BLL E;  4RUH A;  4P4I A;  2OZU A;  4MCS A;  2G3A A;  5C82 A;  4K30 A;  4C7H A;  4NCZ A;  4JLY A;  1AYE A;  2B3V A;  3I9S A;  1Z8L A;  4E0A A;  4CGP A;  3CZX A;  3CXP A;  4R3L A;  3RZA A;  2PQ8 A;  3D4U A;  5K8M A;  1XOV A;  1ELL P;  2C27 A;  5THW A;  4LUA A;  4B5P B;  3F8K A;  3FH4 A;  4P4D A;  4CRZ B;  2CTC A;  2ANP A;  3K2K A;  1FY7 A;  1KZF A;  3TO6 A;  4AVA A;  4RS2 A;  1ARL A;  1XF8 A;  3BHX A;  2PJA A;  4H6Z A;  3D67 A;  4UFX A;  3S6G A;  2QVP A;  1ZLI A;  3GY9 A;  5AG7 A;  3W91 A;  1VHS A;  3P2F A;  5EBV A;  1DTD A;  4FD7 A;  4Q36 A;  3SXN A;  2CY2 A;  3GUX A;  2C6C A;  2AFO A;  1Y9W A;  4IHM A;  2CNM A;  3N7Z A;  2D4P A;  3IIB A;  3KZW A;  4PXD A;  2HB6 A;  4CAX A;  4ZGY B;  1Q2D A;  2ZXV A;  4NGS A;  2Q51 A;  4CS0 B;  4PV6 A;  1NE9 A;  1CBX A;  3IU2 A;  4YRH A;  4IAV A;  2QEC A;  1YQE A;  1CM0 A;  1RTQ A;  2B3U A;  2PRQ A;  4A32 A;  3B8G A;  3JUW A;  1Z8X A;  4M6I A;  1CX8 A;  4I49 A;  1JQG A;  4MI4 A;  1Z4R A;  2Z11 A;  3NE7 A;  5CNP A;  3T8W A;  3MGD A;  2PIZ A;  3GIU A;  2G0B A;  4F9V A;  3TCV A;  4MRI A;  3D2P A;  5LYF A;  1IOF A;  1Y0Y A;  3WC5 A;  4F0Y A;  1IIC A;  4YGO A;  3SI2 A;  3TT2 A;  4Q38 A;  1M1D A;  1PYT B;  2CIJ A;  3N5F A;  4MBU A;  4OC0 A;  4A33 A;  4Z65 A;  1QSO A;  1TIQ A;  3FVL A;  4B5O A;  4M6H A;  5D29 A;  4X3R A;  4A39 A;  4NF1 A;  1B6B A;  4C2Z A;  2CF4 A;  4QUS A;  1P4N A;  1R3N A;  1P0H A;  1IOI A;  1S3Z A;  3I3G A;  2PIY A;  4ONW A;  4CAF A;  3D7H A;  4MHY A;  2FXF A;  1XIX A;  1F2P A;  4UEZ A;  1S5K A;  2HQY A;  5LRJ A;  4B13 A;  4OC1 A;  4R9M A;  1A2Z A;  2Z3P A;  4KS9 A;  1NSL A;  2GE3 A;  2V77 A;  3CPA A;  2GLJ A;  1LRZ A;  4CGO A;  1HDU A;  1QSN A;  2FT0 A;  5IX3 A;  3B2Y A;  2XEF A;  1CPS A;  1KWM A;  1ZLH A;  4E2A A;  4UFW A;  4ONU A;  1FT7 A;  2PR8 A;  2P6E A;  3FXT A;  3PB8 X;  5ELY A;  3IWW A;  5A27 A;  2Z3N A;  3ISX A;  2Q04 A;  3KAS A;  3FEE A;  1GHE A;  4QVT A;  4UWJ A;  4Y49 B;  1VHE A;  1Z2L A;  3TE4 A;  1IU8 A;  2ZED A;  2V8D A;  3EFA A;  3RBU A;  5HVG A;  4J3G A;  4MMO A;  1PCA A;  3TOA A;  1TKJ A;  1X12 A;  4R57 A;  4P45 A;  3ZJ0 A;  4H89 A;  1Q2C A;  5JM6 A;  3H5Z A;  2V8H A;  1I12 A;  3GYA A;  3FNC A;  4HPS A;  4L89 A;  4EWT A;  1RXT A;  3LWU A;  5K8P A;  4MFQ A;  3B3C A;  1VIX A;  2Q4V A;  4MJ8 A;  3PB6 X;  2Z3L A;  2ZEP A;  2VZZ A;  2REE A;  2WPX A;  4ZY2 A;  4PXB A;  2QJ8 A;  4GM5 A;  4QC6 A;  2RB7 A;  3V8I A;  4QB9 A;  4A94 A;  3IEH A;  4PSX A;  3TO7 A;  2B5G A;  4KUA A;  2ATR A;  2C6P A;  4UWI A;  1ON0 A;  1VKC A;  3PBE A;  1CJW A;  1KUX A;  3DDD A;  2PJ7 A;  4XNH C;  1VGY A;  5G21 A;  4FD6 A;  3F0A A;  4KVO E;  4DJL A;  1B87 A;  1YME A;  2ODF A;  2CNT A;  4LQ6 A;  4NEX A;  1IID A;  5HVF A;  2RFH A;  4CGL A;  4ZY1 A;  1IYL A;  2OU2 A;  4XPD C;  2B4D B;  2ZW6 A;  2C6G A;  3JRU A;  4KOS A;  5JGF A;  3D3S A;  2EK9 A;  4R76 A;  3SJE A;  2PJB A;  1FNO A;  3D66 A;  1Y9K A;  2ZEH A;  3KKW A;  4OID A;  1TF9 A;  2HC9 A;  2OZG A;  3JTK A;  1Y0R A;  4KSI A;  1L0C A;  1BOB A;  2JBJ A;  3DSB A;  3PBB A;  4KLV A;  4HNW B;  4P44 A;  3R96 A;  4M6G A;  3MRU A;  3NH8 A;  1F2O A;  4H6U A;  3DR8 A;  3IO1 A;  4DNC A;  3DR6 A;  2XEI A;  4NGM A;  1LAN A;  2EK8 A;  4GXH A;  5LYI A;  2K5T A;  4MFJ A;  3R9E A;  4KOY A;  1F57 A;  1JWQ A;  2ABZ A;  5AGE A;  5BWA B;  2G3T A;  1I21 A;  2WUU A;  2GIV A;  5H86 A;  4CGM A;  2QYV A;  2ZW5 A;  4JXR A;  3VH9 A;  1YK3 A;  4U9Y A;  2VI7 A;  5DS0 A;  1YRE A;  5F48 A;  5IB0 A;  4BMH A;  4F8Z A;  4UA3 A;  1MJA A;  1K4J A;  4A30 A;  2WYR A;  3GKR A;  3B3V A;  4NJQ A;  4NGN A;  4CGN A;  4KVM E;  4RI1 A;  3LAC A;  2JEV A;  4K3N A;  4ZYQ A;  3KI9 A;  3FEC A;  3S6F A;  5KTC A;  2DEA A;  3FMC A;  5J8C A;  3UY5 A;  3FED A;  4BBH A;  3IGR A;  1AMP A;  1ZG8 A;  2J8M A;  2QIR A;  3NA6 A;  4KVX A;  4MFP A;  2FIW A;  2Z10 A;  5JQ4 A;  4TWE A;  4CAV A;  1Z8T A;  2Y0M A;  2I00 A;  2Q43 A;  2VL1 A;  4EVY A;  6CPA A;  3FIX A;  2WSA A;  4BD9 A;  2PVV A;  2BL1 A;  5G22 A;  5HMN A;  4KLW A;  2PJ2 A;  4JXQ A;  2Z0Z A;  2Q0Y A;  2P6F A;  1QST A;  3P2H A;  4P6Y A;  3GB0 A;  4MHZ A;  2Q4Z A;  4H2K A;  4OAE A;  4CYQ A;  4UIA A;  1S7L A;  2BEI A;  3B7I A;  4P4B A;  4A95 A;  4NJR A;  3S9N A;  2PJC A;  3CT9 A;  3SHP A;  4DYO A;  1CP7 A;  1I1D A;  3D7F A;  3H8F A;  2FCK A;  2FL4 A;  2XEJ A;  4R3K A;  4CYP A;  2O28 A;  2PJ1 A;  4OLL A;  4CYN A;  1TKH A;  2IJZ A;  2R7H A;  4UCM A;  3FYN A;  1KUY A;  1QMU A;  4IK2 A;  4B10 A;  2B4B A;  1RO5 A;  2YNE A;  3H8E A;  1IY7 A;  1R57 A;  1YR0 A;  5IV0 A;  1PUA A;  4MFL A;  2WPW A;  1S7F A;  4XPL A;  3QB8 A;  4YWY A;  3SI0 A;  5F47 A;  1BPN A;  2POK A;  4JD6 A;  4MY3 A;  4EME A;  2REF A;  4NGR A;  1NMT A;  2VEZ A;  2YNC A;  2AFU A;  3C26 A;  2JDC A;  3H4Q A;  5EMI A;  2OOT A;  3TO9 A;  2JDD A;  3EO4 A;  4OKO A;  4AG9 A;  3KGQ A;  1ELM P;  1MJB A;  1Z8W A;  4U5Y A;  1XBU A;  5CPA A;  2J8R A;  4YFJ A;  2RC4 A;  4MHP A;  3TOB A;  1M4G A;  2C1C A;  3PGP A;  3QNV A;  4FUU A;  2GFQ A;  4CAE A;  2Q44 A;  2BO9 A;  2EVN A;  2Q4Y A;  3VWE A;  2R8V A;  3KR5 A;  1Z4E A;  2PJ5 A;  2VBQ A;  4A31 A;  2F5I A;  1ZG9 A;  4B5P A;  5G20 A;  1LAM A;  1LOK A;  1WWZ A;  2VZY A;  3PB9 X;  4OC2 A; 
#chains in the Genus database with same CATH homology
 5GCN A;  3EY5 A;  2CXA A;  2P0W A;  2KCW A;  1QSR A;  2Z3M A;  3FB3 A;  4MFK A;  4C7I A;  2VQY A;  5DWN A;  1YVK A;  1J4J A;  4MFZ A;  4JWP A;  4XNH B;  1Q2Y A;  2BUE A;  4UBR A;  3JVN A;  5HH1 A;  2EUI A;  1KUV A;  4R87 A;  3IWE A;  4XPD B;  1YX0 A;  5H84 A;  4B14 A;  2CNS A;  4GS4 A;  2FIA A;  1XMT A;  1MK4 A;  5G1Z A;  4NXY A;  3LD2 A;  5AG4 A;  1S7K A;  1M4I A;  3W6S A;  2ZPA A;  2ARH A;  4AG7 A;  1YGH A;  2Q7B A;  3IWG A;  4KOV A;  5A28 A;  2X7B A;  2FS5 A;  3PP9 A;  3ZZI A;  2OH1 A;  2DPT A;  4PK2 A;  2GAN A;  4B11 A;  4C2Y A;  1UFH A;  4F6A A;  4FD4 A;  4M85 A;  2ZW7 A;  1XE4 A;  4CRY B;  4JJX A;  3T90 A;  4KOU A;  3SXO A;  3A9L A;  4MY0 A;  2PDO A;  2Z3K A;  5EC4 A;  5JPH A;  4HKF A;  5FVJ A;  2VXK A;  2OZH A;  2I79 A;  3K9U A;  1MJ9 A;  1XEB A;  2B5G B;  5DWM A;  2YND A;  4F0X A;  2J8N A;  2FE7 A;  4FD5 A;  4XPK A;  5AG5 A;  5KTD A;  1U6M A;  3E0K A;  1WK4 A;  4HNX B;  2HV2 A;  3R9F A;  2D4O A;  1M44 A;  2AJ6 A;  4E8O A;  3S6K A;  3T9Y A;  4IUS A;  4UCN A;  2ZW4 A;  3G8W A;  4CYO A;  4X5K A;  4IF5 A;  3BJ7 A;  3LOD A;  2H5M A;  2PRB A;  3FRM A;  5C88 A;  1N71 A;  2HUZ A;  2R98 A;  4AVC A;  4OAD A;  4UFV A;  3EXN A;  4M3S A;  2B4D A;  1Z9U A;  2Z3O A;  3TTH A;  4A2Z A;  2R1I A;  3IU1 A;  3CXS A;  2PSW A;  2QML A;  3D2M A;  4C7H A;  5KTA A;  4PK3 A;  4QBJ A;  3R1K A;  3EC4 A;  3OWC A;  3BLN A;  2DXQ A;  5F46 A;  2BSW A;  2FSR A;  4MHD A;  1ZO0 A;  4KOT A;  4KOW A;  2YGW A;  3S6H A;  1S7N A;  4II9 A;  1YVO A;  1QSM A;  5ISV A;  1IB1 E;  1V0C A;  4KUB A;  1S60 A;  4Y49 C;  4B12 A;  1YLE A;  1OZP A;  3DNS A;  3CXQ A;  4KOX A;  2IL4 A;  1Y7R A;  2B58 A;  5J8F A;  2PR1 A;  4C2X A;  3G3S A;  1PU9 A;  4PSW A;  5F49 A;  4AB7 A;  5I0C A;  3D8P A;  2JLM A;  1BO4 A;  5AG6 A;  2P6G A;  4KSA A;  1IYK A;  4AVB A;  2OB0 A;  3WR7 A;  3BJ8 A;  4KSF A;  4L8A A;  1M4D A;  3F5B A;  3RYO A;  2DPS A;  1SQH A;  3QAH A;  4C68 A;  3VWD A;  3TFY A;  4HNY B;  3R9G A;  3W6X A;  4CAW A;  4ZBG A;  2NMT A;  5E96 A;  2AE6 A;  2A4N A;  4U9Z A;  3FBU A;  4KOR A;  4LX9 A;  2PC1 A;  4ORF A;  2YNC C;  4KZT A;  4NSQ A;  4UCP A;  3R95 A;  3PZJ A;  2OZU A;  5C82 A;  2G3A A;  4K30 A;  4NCZ A;  4JLY A;  2B3V A;  3I9S A;  4E0A A;  4CGP A;  3CXP A;  4R3L A;  2PQ8 A;  2C27 A;  4B5P B;  4LUA A;  3F8K A;  4CRZ B;  4AVA A;  1FY7 A;  1KZF A;  3TO6 A;  4RS2 A;  1XF8 A;  4H6Z A;  4UFX A;  3S6G A;  3GY9 A;  5AG7 A;  3W91 A;  1VHS A;  3P2F A;  5EBV A;  4Q36 A;  4FD7 A;  3SXN A;  2CY2 A;  1Y9W A;  2CNM A;  3N7Z A;  2D4P A;  4CAX A;  4ZGY B;  1Q2D A;  2ZXV A;  4CS0 B;  4PV6 A;  1NE9 A;  3IU2 A;  4YRH A;  2QEC A;  1CM0 A;  2B3U A;  4A32 A;  3B8G A;  3JUW A;  4I49 A;  4MI4 A;  5CNP A;  1Z4R A;  2Z11 A;  3NE7 A;  3MGD A;  2G0B A;  3TCV A;  3D2P A;  4F0Y A;  1IIC A;  4YGO A;  3TT2 A;  4Q38 A;  1M1D A;  4MBU A;  4A33 A;  1QSO A;  1TIQ A;  4B5O A;  4C2Z A;  4NF1 A;  1B6B A;  4QUS A;  1P4N A;  1P0H A;  3I3G A;  1S3Z A;  4CAF A;  2FXF A;  1XIX A;  1S5K A;  2HQY A;  4B13 A;  4R9M A;  2Z3P A;  4KS9 A;  1NSL A;  2GE3 A;  1LRZ A;  4CGO A;  1QSN A;  2FT0 A;  5IX3 A;  4E2A A;  4UFW A;  4ONU A;  2PR8 A;  2P6E A;  3FXT A;  5A27 A;  2Z3N A;  2Q04 A;  4QVT A;  4Y49 B;  1GHE A;  4UWJ A;  3TE4 A;  3EFA A;  4J3G A;  3TOA A;  4R57 A;  3ZJ0 A;  4H89 A;  1Q2C A;  3H5Z A;  1I12 A;  3GYA A;  3FNC A;  4L89 A;  1RXT A;  4MFQ A;  2Q4V A;  4MJ8 A;  2Z3L A;  2VZZ A;  2REE A;  2WPX A;  4QC6 A;  3V8I A;  4QB9 A;  4PSX A;  3TO7 A;  2B5G A;  4KUA A;  2ATR A;  4UWI A;  1ON0 A;  1VKC A;  1CJW A;  1KUX A;  3DDD A;  4XNH C;  5G21 A;  4FD6 A;  3F0A A;  4KVO E;  1B87 A;  2CNT A;  4NEX A;  1IID A;  4CGL A;  1IYL A;  2OU2 A;  4XPD C;  2B4D B;  2ZW6 A;  4KOS A;  3D3S A;  1Y9K A;  3KKW A;  2OZG A;  3JTK A;  1L0C A;  1BOB A;  3DSB A;  4KLV A;  4HNW B;  3R96 A;  4H6U A;  3DR8 A;  4DNC A;  3DR6 A;  2K5T A;  4MFJ A;  3R9E A;  4KOY A;  5BWA B;  5AGE A;  2G3T A;  1I21 A;  2WUU A;  2GIV A;  5H86 A;  4CGM A;  2ZW5 A;  4JXR A;  1YK3 A;  4U9Y A;  2VI7 A;  1YRE A;  5F48 A;  5IB0 A;  4BMH A;  4UA3 A;  1MJA A;  1K4J A;  4A30 A;  3GKR A;  4CGN A;  4KVM E;  4RI1 A;  2JEV A;  3S6F A;  5KTC A;  5J8C A;  3UY5 A;  4BBH A;  3IGR A;  2J8M A;  2QIR A;  4KVX A;  4MFP A;  2FIW A;  2Z10 A;  5JQ4 A;  4CAV A;  2Y0M A;  2I00 A;  4EVY A;  3FIX A;  2WSA A;  2BL1 A;  5G22 A;  5HMN A;  4KLW A;  4JXQ A;  2Z0Z A;  2Q0Y A;  2P6F A;  1QST A;  3P2H A;  4OAE A;  4CYQ A;  1S7L A;  2BEI A;  4A95 A;  3SHP A;  1I1D A;  2FCK A;  2FL4 A;  4R3K A;  4CYP A;  2O28 A;  4OLL A;  4CYN A;  2R7H A;  4UCM A;  3FYN A;  1KUY A;  4B10 A;  2B4B A;  1RO5 A;  2YNE A;  1R57 A;  1YR0 A;  5IV0 A;  1PUA A;  4MFL A;  2WPW A;  1S7F A;  4XPL A;  3QB8 A;  5F47 A;  4JD6 A;  4MY3 A;  2REF A;  1NMT A;  2VEZ A;  2YNC A;  3C26 A;  2JDC A;  3H4Q A;  3TO9 A;  2JDD A;  3EO4 A;  4AG9 A;  4U5Y A;  1MJB A;  4YFJ A;  2J8R A;  2RC4 A;  3TOB A;  1M4G A;  3PGP A;  4CAE A;  2Q44 A;  2EVN A;  2Q4Y A;  3VWE A;  2R8V A;  1Z4E A;  2VBQ A;  4A31 A;  2F5I A;  4B5P A;  5G20 A;  1WWZ A;  2VZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...