3P2HA

Crystal structure of tofi in a ternary complex with an inhibitor and mta
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
184
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLGWQLPSEDEKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords AHL synthase
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
total genus 55
structure length 184
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2hA00
4II9A 3IWGA 2B3UA 2OH1A 5DWNA 4NF1A 3W91A 3TO7A 2ZW4A 3D2MA 2R1IA 2OZHA 2F5IA 4R3KA 4DNCA 2D4PA 2P0WA 4XPDC 3JUWA 5J8CA 4AVCA 1K4JA 1MJ9A 3GY9A 3V8IA 3SHPA 1Y7RA 2REFA 5JPHA 2CNMA 3G3SA 4B5PA 3NE7A 3D3SA 2ATRA 4XPKA 2I79A 4NCZA 5H84A 4JJXA 3ZJ0A 1MJAA 4BMHA 1TIQA 3RYOA 5F46A 5EC4A 4FD4A 4AVBA 4KOYA 1YVOA 4F6AA 2PQ8A 5IX3A 4KVME 3R9GA 4QBJA 2PDOA 4ORFA 2R98A 3TT2A 1S7LA 3WR7A 1KUXA 2H5MA 4OLLA 4U5YA 3EXNA 1U6MA 4AG9A 3F0AA 4KOUA 2Z10A 1QSTA 2IL4A 2J8MA 3DR6A 1N71A 2OZUA 1KUYA 4ONUA 5E96A 2ZW7A 3SXNA 4PV6A 1CJWA 3FIXA 1V0CA 3C26A 4F0YA 1Q2YA 1XIXA 5GCNA 4MI4A 5KTAA 5IV0A 1J4JA 2FIWA 1LRZA 2FT0A 2KCWA 1GHEA 2OU2A 1BO4A 3BJ8A 4MBUA 1P0HA 3LD2A 4IF5A 1IIDA 4HNXB 4LUAA 2BL1A 2A4NA 4B5PB 3S6HA 4Y49B 1KUVA 4QVTA 1S5KA 1S7KA 1YLEA 2B58A 1Z4RA 4MY3A 3BLNA 3B8GA 2NMTA 2PSWA 2AJ6A 4U9ZA 3TOAA 1CM0A 2Q4YA 3EC4A 4YGOA 5KTDA 2B4BA 4E8OA 5C82A 1M4IA 5IB0A 4CAWA 4RI1A 1VHSA 4XNHC 1I21A 2BUEA 4ZBGA 3TO9A 2R8VA 4UWIA 2Z0ZA 4MJ8A 3VWDA 4HNWB 3TTHA 4CRZB 5J8FA 1M4GA 2Q04A 3EO4A 2HQYA 2FL4A 2BSWA 3TOBA 1M44A 2CNSA 1PUAA 1M1DA 1NMTA 2FIAA 5F49A 4CAVA 2O28A 2VI7A 5KTCA 2PR1A 4KZTA 1Y9WA 1QSOA 1MK4A 3R9EA 2G3TA 2PRBA 4KOVA 1S7NA 4RS2A 2B4DA 2G0BA 4PSXA 4XPLA 2AE6A 2Q4VA 3F5BA 3R96A 2B5GB 3BJ7A 2OB0A 2VZYA 4KVXA 3I9SA 4HKFA 4CRYB 4JXQA 1PU9A 3TO6A 3W6XA 3P2HA 4H6ZA 1B87A 2R7HA 1P4NA 2WPXA 3DDDA 3IGRA 1IYLA 4QB9A 2B3VA 4YFJA 4MY0A 2CY2A 2QIRA 3CXSA 5DWMA 4J3GA 3TFYA 1QSNA 1S3ZA 2WPWA 3FNCA 1YR0A 2FCKA 2P6EA 1Q2DA 2PR8A 2BEIA 2QMLA 1XEBA 2P6GA 3LODA 2JDCA 3QAHA 4OAEA 3CXPA 1Z4EA 3DR8A 4CAXA 3D2PA 4PK2A 5ISVA 1YVKA 1YGHA 1RO5A 2ZW5A 4CS0B 2B4DB 4XPDB 3P2FA 3T90A 5EBVA 2OZGA 2Z11A 1MJBA 4H6UA 4R57A 1QSRA 4OADA 4KLWA 2K5TA 3R95A 4FD6A 4NSQA 4JWPA 4L8AA 2PC1A 4GS4A 4K30A 1QSMA 1YX0A 3PZJA 2VXKA 2GIVA 4QUSA 2EVNA 3FRMA 1OZPA 1XE4A 1NE9A 2D4OA 3S6GA 4L89A 4X5KA 4LX9A 1Q2CA 3JVNA 3UY5A 4NXYA 1WWZA 4KUAA 3DSBA 4KORA 2VBQA 4H89A 2J8RA 4AB7A 2ZPAA 1YREA 4R3LA 4E0AA 4MHDA 1KZFA 4B5OA 4Y49C 3N7ZA 3TE4A 4U9YA 1IYKA 2JLMA 4HNYB 3SXOA 2FSRA 3GKRA 3T9YA 4JLYA 2X7BA 4KVOE 3ZZIA 3OWCA 1RXTA 4KUBA 3PP9A 5CNPA 1ON0A 2Q7BA 4PK3A 5FVJA 5HMNA 2RC4A 2REEA 1XF8A 3E0KA 4NEXA 3MGDA 2FE7A 4E2AA 3FBUA 2HUZA 4FD7A 3S6KA 2Q0YA 3KKWA 3CXQA 2FS5A 2EUIA 4R9MA 3VWEA 2C27A 1I12A 5HH1A 5JQ4A 2HV2A 4R87A 2Q44A 3EFAA 4KOSA 1IB1E 2QECA 3R1KA 4FD5A 5F47A 2VEZA 2JDDA 4JD6A 5F48A 2GANA 1Y9KA 2ZW6A 4I49A 4XNHB 4KOXA 3FXTA 3FYNA 2P6FA 2ZXVA 2FXFA 1B6BA 4UA3A 3D8PA 4AVAA 4KOTA 1WK4A 3F8KA 1NSLA 2Y0MA 4AG7A 4IUSA 5H86A 3EY5A 3H4QA 1XMTA 2G3AA 4QC6A 3I3GA 3DNSA 3R9FA 1I1DA 1S60A 4M3SA 4M85A 1VKCA 1L0CA 4JXRA 3GYAA 2GE3A 1R57A 3QB8A 1YK3A 2VZZA 4YRHA 2B5GA 1Z9UA 2ARHA 1IICA 2VQYA 2CNTA 4KLVA 4UWJA 1M4DA 1FY7A 2I00A 3TCVA 2DXQA 3G8WA 1BOBA 4PSWA 4UBRA 5C88A 2J8NA 2JEVA 3W6SA 4KOWA 3K9UA 5I0CA 1UFHA 3S6FA 1SQHA 3FB3A 3PGPA 1S7FA 4EVYA
chains in the Genus database with same CATH superfamily
2YNCC 2DEAA 1LCPA 1X10A 4II9A 3H8FA 3IWGA 2B3UA 2OH1A 2Z3KA 4NF1A 4NGRA 5DWNA 3W91A 4B6ZA 3QNVA 3IFEA 2ZW4A 3D2MA 3TO7A 2R1IA 3DGVA 3FF3A 2OZHA 4DJLA 2F5IA 4R3KA 4X8IA 4R76A 4C7HA 4DNCA 4EFDA 1ZO0A 2D4PA 2P0WA 4XPDC 2AFZA 2QJ8A 3JUWA 2EBJA 4UFWA 5J8CA 4GM5A 4AVCA 1K4JA 1MJ9A 3GY9A 3V8IA 2XEGA 1LAPA 3CZXA 1Y7RA 2REFA 3SHPA 2CNMA 5JPHA 1DTDA 1JQGA 3BI1A 3G3SA 1HDUA 3WC7A 4ZI6A 2Z3OA 4B5PA 1VIXA 3NE7A 3D3SA 2ATRA 2WZNA 3FH4A 4XPKA 2I79A 1X12A 4P4BA 4NCZA 3MRUA 4UEEA 4NGMA 5H84A 2PVWA 3D67A 1YQEA 4JJXA 3ZJ0A 4OC1A 1MJAA 2VL1A 4KSAA 4Q7AA 4BMHA 1TIQA 4R7MA 1ELLP 4A39A 3RYOA 5F46A 5EC4A 3IEHA 4FD4A 4LQ6A 4AVBA 4C2XA 5HVFA 4KOYA 1YVOA 4F6AA 2PQ8A 4KS9A 3B3WA 1BAVA 5IX3A 1ZLIA 4KVME 2PJ1A 3R9GA 2PRQA 4P44A 2AFUA 2QYVA 2YNDA 4G1PA 3RNZA 4QBJA 2PDOA 4PXEA 5CPAA 5CBMA 3CT9A 5IB9A 4ORFA 3RBUA 2PJBA 2R98A 3D7HA 3TT2A 3SJEA 1ARLA 1A2ZA 1S7LA 3WR7A 2I3CA 1KUXA 2H5MA 4OLLA 4U5YA 3SJFA 3EXNA 4MFQA 1U6MA 4MHYA 3WC5A 4UFXA 2C6GA 4UFVA 4AG9A 3VATA 2EK8A 2GFQA 3F0AA 4CAFA 4UF4A 1F2OA 1BPMA 4X3RA 4KOUA 4EWTA 2Z3LA 2Z10A 1QSTA 3FVLA 2IL4A 2J8MA 4P6YA 2GU2A 3DR6A 1KWMA 1N71A 4OIDA 2OZUA 4R8FA 1KUYA 4ONUA 5E96A 2ZW7A 3BXMA 3SXNA 5LRGA 2ZELA 5LRKA 4PV6A 1CJWA 4OC3A 2PJAA 3NFZA 3FIXA 1V0CA 2Z3MA 1IY7A 1VHEA 2C6PA 2XEIA 3C26A 4F0YA 4B13A 1Q2YA 1XIXA 3B7IA 5GCNA 4B11A 4C2YA 4MCSA 3LMSA 1Y7EA 1ZG8A 4CYNA 4MI4A 5KTAA 5IV0A 3PGPA 1J4JA 1PYTB 2FIWA 5LYDA 1LRZA 2FT0A 2KCWA 2OOTA 1GHEA 4P45A 2OU2A 1BO4A 3BJ8A 4MBUA 1P0HA 3LD2A 4IF5A 1IIDA 4HNXB 1VGYA 4LUAA 3SJGA 2ZEPA 3KZWA 2ZENA 5THWA 3H8EA 2PJCA 2BL1A 2PJ8A 2A4NA 4B5PB 3S6HA 2Q51A 4UCNA 1CG2A 3KHZA 2CIJA 4MFZA 4NGQA 4OIWA 2BOAA 1BLLE 4Y49B 4CYPA 1ARMA 1Z2LA 2V8DA 5J1QA 4FWUA 2IJZA 3JTKA 1KUVA 4QVTA 1H8LA 2PJ3A 1S5KA 2EWBA 5G1ZA 1S7KA 1YLEA 3D7GA 1EE3P 2B58A 1Z4RA 3PFEA 1LANA 4MY3A 3BLNA 2ZEDA 3B8GA 2IQ6A 2NMTA 3NA6A 2PSWA 7CPAA 3WT4A 2AJ6A 4U9ZA 5AG7A 3TOAA 3IWEA 2PCUA 1CM0A 2HC9A 2Q4YA 2Q7SA 3EC4A 3KHXA 4MCQA 4MXUA 4MFLA 3PB4X 4YGOA 3VH9A 4B10A 5KTDA 3GB0A 2B4BA 4E8OA 2PJ2A 3KL9A 5C82A 1M4IA 4MMOA 2JBJA 4CAWA 5IB0A 4RI1A 2O4HA 3ISZA 3KGQA 1IOFA 1Z8WA 1Y0RA 4Q38A 1JWQA 1VHSA 1QQ9A 2ZOFA 1I21A 4XNHC 6CPAA 2ZEGA 1YLOA 4CGOA 3GUXA 1R3NA 5K8NA 2BUEA 4UIBA 4C2ZA 4M6GA 4ONWA 4ZBGA 3B35A 3TO9A 2Q4ZA 2R8VA 4MCPA 4UWIA 2Z0ZA 4MJ8A 2V8VA 3VWDA 4HNWB 3TTHA 1Z8LA 3KI9A 4CRZB 3PB7X 5J8FA 4P10A 1M4GA 2Q04A 4IK2A 3EO4A 2ABZA 1IGBA 2HQYA 2FL4A 2BSWA 3TOBA 1M44A 2CNSA 4CPAA 1PUAA 5D8NA 4NGSA 2PJ0A 1M1DA 1NMTA 2YNCA 2RFHA 4BD9A 2FIAA 5F49A 4CAVA 1LFWA 2PJ6A 2O28A 2VI7A 3KASA 5KTCA 2PR1A 5K8PA 1ZG9A 4KZTA 1Y9WA 1QSOA 5AGEA 1MK4A 3R9EA 1YW6A 2G3TA 4NJQA 2PRBA 4KOVA 4ZY1A 4YWYA 4PXCA 1YMEA 1ELMP 1S7NA 4RS2A 3RAMA 2OR4A 3PEIA 1ZLHA 2B4DA 2PJ9A 1FNOA 2G0BA 4TWEA 4PSXA 4A95A 1CPXA 3TC8A 4UCPA 4XPLA 4NJRA 2AE6A 4P4FA 2Q4VA 3F5BA 4JZ0A 3R96A 2B5GB 3BJ7A 1NSAA 2OB0A 2VZYA 4KVXA 4KSFA 1TF9A 3I9SA 5F09A 2BCOA 3NH5A 1TKFA 4HKFA 4CRYB 4JXQA 4ZGYB 1CBXA 1XOVA 2F8HA 1HDQA 1PU9A 4OC4A 4CYOA 4B12A 1CP7A 4PQAA 2WSAA 3TO6A 3W6XA 3MN8A 3P2HA 4H6ZA 1B87A 2R7HA 4BINA 1P4NA 3B3SA 5A28A 1BPNA 2WPXA 4P4EA 3DDDA 3IGRA 4F9UA 1IYLA 5HVGA 4QB9A 2B3VA 4CGLA 4YFJA 1R43A 5DS0A 4M6IA 4CGPA 4EMEA 4MY0A 5I4MA 1XRYA 3LACA 2PJ7A 2WYRA 5G20A 2CY2A 3LWUA 2QIRA 3CXSA 3QAYA 1CPSA 2ANPA 3JRUA 3KR4A 4MHZA 3IWWA 4CGMA 5DWMA 4J3GA 3S9LA 1QSNA 3TFYA 3N5FA 1S3ZA 3L2NA 2WPWA 3FNCA 4Q36A 2Z3NA 1YR0A 2FCKA 2P6EA 1Q2DA 2PR8A 2BEIA 2QMLA 3BI0A 1XEBA 3GLJA 2P6GA 2ZEHA 2PJ4A 3A9LA 4A37A 5A27A 1Z5RA 3LODA 2JDCA 3QAHA 4LQGA 4OAEA 4O23A 3IO1A 3IJ3A 3CXPA 2G9DA 1LAMA 4RN7A 2AFXA 1Z4EA 2F7VA 3DR8A 4CAXA 4ZYQA 3B3CA 3D2PA 4MCRA 4PK2A 2GREA 1ZG7A 4NGTA 3S9MA 5JGFA 4UCMA 3SI1A 4CGNA 4NGNA 4IAVA 5ISVA 3NH8A 3D4UA 1AMPA 3WABA 5JM6A 1YVKA 2PJ5A 1YGHA 4GXHA 2PVVA 1RO5A 2AFMA 2ZW5A 4CS0B 4DUKA 3IU1A 2IMOA 3PB9X 2JBKA 3D66A 4NFRA 4OC2A 4UEZA 1XBUA 2B4DB 3VARA 4XPDB 3PFOA 4A2ZA 1M4LA 3FMCA 3P2FA 3FJUA 3T90A 5EBVA 2OZGA 2Z11A 1MJBA 2Q43A 1TKJA 3D68A 1GYTA 4H6UA 4FAIA 4R57A 1QSRA 4OADA 4KLWA 3K9TA 4W9YA 5G21A 2K5TA 3R95A 4FD6A 4NSQA 4P4DA 4A31A 4JWPA 5LYIA 1IOIA 4L8AA 4FBEA 2PC1A 2RB7A 1F2PA 2V8HA 4GS4A 4K30A 1PCAA 1QSMA 4KSIA 4C7IA 8CPAA 1YX0A 3PZJA 3D7FA 4OKOA 2VXKA 4R6TA 2GIVA 4MHNA 4QUSA 2V8GA 2EVNA 1Q7LA 1AYEA 3FRMA 4M6HA 1OZPA 3PB6X 1XE4A 3SI0A 1NE9A 5BWAB 2D4OA 1Z8XA 3RZAA 3S6GA 3KQXA 4L89A 4X5KA 1CP6A 4ZX8A 4CAEA 5HXDA 2Z3PA 4LX9A 3CPXA 1Q2CA 3JVNA 3UY5A 4RUHA 4NXYA 2CTCA 1WWZA 4KUAA 3DSBA 3IC1A 1QMUA 2AFSA 2PE3A 1XFOA 4KORA 4JYWA 4IHMA 2ZEEA 2GLJA 3I1UA 3PRTA 3H8GA 2VBQA 4H89A 2YNEA 2DPSA 5JH9A 2J8RA 4A32A 1TXRA 4AB7A 2ZPAA 1YREA 4R3LA 3WC6A 4E0AA 1YSJA 4MHDA 1KZFA 2J9AA 4B5OA 3D7DA 3PB8X 4Y49C 2AFWA 4BBHA 3N7ZA 1XJOA 2PIYA 2XEFA 3TE4A 2EO8A 1TF8A 3PBBA 4UIAA 2V77A 4U9YA 1IYKA 3H5ZA 2JLMA 3B3TA 4HNYB 1F57A 2GLFA 3SXOA 3IIBA 2FSRA 3GKRA 3TX8A 4OC0A 3T9YA 4JLYA 4WJBA 2X7BA 4KVOE 3ZZIA 4X2TA 3OWCA 4C68A 4B14A 3FEDA 3NE8A 4TNUA 1RXTA 2ZEMA 3V38A 4KUBA 2ZOGA 3PP9A 5CNPA 1ON0A 2Q7BA 5K8MA 4PK3A 5FVJA 1FT7A 3FX6A 5HMNA 2RC4A 2REEA 4WWVA 1XF8A 3HLPA 3BHXA 3NH4A 5G22A 3V7ZA 3E0KA 3K2KA 2HB6A 3S9NA 4NEXA 3MGDA 2FE7A 4E2AA 3FBUA 3SJXA 2HUZA 4FD7A 3S6KA 5AG5A 2QVPA 2Q0YA 3KKWA 2JEWA 3CXQA 2FS5A 2EUIA 5LYLA 2ZEOA 4R9MA 3KQZA 3VWEA 2C27A 1I12A 3B2YA 5HH1A 5JQ4A 2HV2A 4R87A 1DE4C 2Q44A 4PXDA 3EFAA 5D29A 1UWYA 1Y0YA 3ISXA 4KOSA 5AG6A 4A33A 4A30A 1IB1E 2QECA 3R1KA 4FD5A 5HVHA 2CTBA 2VEZA 3FEEA 2C6CA 5F47A 4F0XA 2JDDA 4F9VA 4JD6A 5F48A 4P4JA 4CYQA 2GANA 3CPAA 1Y9KA 1Z8TA 2ZW6A 4I49A 2CXAA 3DLJA 4PPZA 4KOXA 4XNHB 3FXTA 4A94A 3FYNA 4OP4A 2P6FA 3T8WA 4FUUA 2ZXVA 2FXFA 3B3VA 1B6BA 4UA3A 2AFOA 4AXVA 3D8PA 4AVAA 2POKA 4KOTA 1WK4A 3F8KA 2YGWA 1NSLA 4OC5A 2DF5A 4ZY2A 3IU2A 2WUUA 2Y0MA 4IUSA 4AG7A 2NSMA 5H86A 4ZX9A 3SI2A 5K8OA 3EY5A 3H4QA 4MRIA 1XMTA 2G3AA 4NGPA 4QC6A 3I3GA 3DNSA 3R9FA 1XMBA 4ZY0A 1I1DA 1S60A 2FVGA 4MFJA 4M3SA 2O53A 1TKHA 4M85A 2C1CA 1YW4A 1VKCA 4YU9A 1L0CA 5ELYA 4JXRA 4MHPA 3GYAA 2DPTA 1LOKA 1R57A 2BO9A 4DYOA 4A38A 3QB8A 5EMIA 4F8ZA 1YK3A 4OMEA 3RO0A 2VZZA 1HEEA 4YRHA 2B5GA 3KR5A 1Z9UA 2ARHA 2ZEFA 2CF4A 1OBRA 1IICA 4P4IA 2VQYA 1VHOA 2CNTA 5LYFA 4H2KA 4KLVA 4UWJA 4K3NA 1IU8A 1M4DA 3FECA 1FY7A 2PIZA 2I00A 4MFPA 3TCVA 2DXQA 3G8WA 4HPSA 1BOBA 2NYQA 4UEFA 4Z65A 2EK9A 3HUVA 4PSWA 4UBRA 1RTQA 5C88A 2J8NA 2JEVA 3CDXA 3W6SA 4KOWA 5AG4A 1CX8A 3K9UA 5LRJA 5I0CA 1UFHA 3S6FA 1SQHA 2ODFA 1AUGA 2XEJA 3FB3A 3GIUA 3PBEA 2GE3A 4PXBA 1S7FA 4EVYA 4MFKA
chains in the Genus database with same CATH topology
2YNCC 4II9A 3IWGA 2B3UA 2OH1A 2Z3KA 4NF1A 5DWNA 3W91A 3TO7A 2ZW4A 3D2MA 2R1IA 2OZHA 2F5IA 4R3KA 4C7HA 4DNCA 1ZO0A 2D4PA 2P0WA 4XPDC 3JUWA 4UFWA 5J8CA 4AVCA 1K4JA 1MJ9A 3GY9A 3V8IA 3SHPA 1Y7RA 2REFA 5JPHA 2CNMA 3G3SA 2Z3OA 4B5PA 3NE7A 3D3SA 2ATRA 4XPKA 2I79A 4NCZA 5H84A 4JJXA 3ZJ0A 1MJAA 4KSAA 4BMHA 1TIQA 3RYOA 5F46A 5EC4A 4FD4A 4AVBA 4C2XA 4KOYA 1YVOA 4F6AA 2PQ8A 4KS9A 5IX3A 4KVME 3R9GA 5A27A 2YNDA 4QBJA 2PDOA 4ORFA 2R98A 3TT2A 1S7LA 3WR7A 1KUXA 2H5MA 4OLLA 4U5YA 3EXNA 4MFQA 1U6MA 4UFXA 4UFVA 4AG9A 4CAFA 3F0AA 4KOUA 2Z3LA 2Z10A 1QSTA 2IL4A 2J8MA 3DR6A 1N71A 2OZUA 1KUYA 4ONUA 5E96A 2ZW7A 3SXNA 4PV6A 1CJWA 3FIXA 1V0CA 2Z3MA 3C26A 4F0YA 4B13A 1Q2YA 1XIXA 5GCNA 4B11A 4C2YA 4CYNA 4MI4A 5KTAA 5IV0A 1J4JA 2FIWA 1LRZA 2FT0A 2KCWA 1GHEA 2OU2A 1BO4A 3BJ8A 4MBUA 1P0HA 3LD2A 4IF5A 1IIDA 4HNXB 4LUAA 2BL1A 2A4NA 4B5PB 3S6HA 4UCNA 4MFZA 4Y49B 4CYPA 3JTKA 1KUVA 4QVTA 1S5KA 5G1ZA 1S7KA 1YLEA 2B58A 1Z4RA 4MY3A 3BLNA 3B8GA 2NMTA 2PSWA 2AJ6A 4U9ZA 5AG7A 3TOAA 3IWEA 1CM0A 2Q4YA 3EC4A 4YGOA 4MFLA 4B10A 5KTDA 2B4BA 4E8OA 5C82A 1M4IA 5IB0A 4CAWA 4RI1A 4Q38A 1VHSA 4XNHC 1I21A 4CGOA 2BUEA 4C2ZA 4ZBGA 3TO9A 2R8VA 4UWIA 2Z0ZA 4MJ8A 3VWDA 4HNWB 3TTHA 4CRZB 5J8FA 1M4GA 2Q04A 3EO4A 2HQYA 2FL4A 2BSWA 3TOBA 1M44A 2CNSA 1PUAA 1M1DA 1NMTA 2YNCA 2FIAA 5F49A 4CAVA 2O28A 2VI7A 5KTCA 2PR1A 4KZTA 1Y9WA 1QSOA 5AGEA 1MK4A 3R9EA 2G3TA 2PRBA 4KOVA 1S7NA 4RS2A 2B4DA 2G0BA 4PSXA 4A95A 4UCPA 4XPLA 2AE6A 2Q4VA 3F5BA 3R96A 2B5GB 3BJ7A 2OB0A 2VZYA 4KVXA 4KSFA 3I9SA 4HKFA 4CRYB 4JXQA 4ZGYB 1PU9A 4CYOA 4B12A 3TO6A 2WSAA 3W6XA 3P2HA 4H6ZA 1B87A 2R7HA 1P4NA 5A28A 2WPXA 3DDDA 3IGRA 1IYLA 4QB9A 2B3VA 4CGLA 4YFJA 4CGPA 4MY0A 5G20A 2CY2A 2QIRA 3CXSA 4CGMA 5DWMA 4J3GA 3TFYA 1QSNA 1S3ZA 2WPWA 3FNCA 4Q36A 2Z3NA 1YR0A 2FCKA 2P6EA 1Q2DA 2PR8A 2BEIA 2QMLA 1XEBA 2P6GA 3A9LA 3LODA 2JDCA 3QAHA 4OAEA 3CXPA 1Z4EA 3DR8A 4CAXA 3D2PA 4PK2A 4UCMA 4CGNA 5ISVA 1YVKA 1YGHA 1RO5A 2ZW5A 4CS0B 3IU1A 2B4DB 4XPDB 4A2ZA 3P2FA 3T90A 5EBVA 2OZGA 2Z11A 1MJBA 4H6UA 4R57A 1QSRA 4OADA 4KLWA 5G21A 2K5TA 3R95A 4FD6A 4NSQA 4A31A 4JWPA 4L8AA 2PC1A 4GS4A 4K30A 1QSMA 4C7IA 1YX0A 3PZJA 2VXKA 2GIVA 4QUSA 2EVNA 3FRMA 1OZPA 1XE4A 1NE9A 5BWAB 2D4OA 3S6GA 4L89A 4X5KA 4CAEA 2Z3PA 4LX9A 1Q2CA 3JVNA 3UY5A 4NXYA 1WWZA 4KUAA 3DSBA 4KORA 2VBQA 4H89A 2YNEA 2DPSA 2J8RA 4A32A 4AB7A 2ZPAA 1YREA 4R3LA 4E0AA 4MHDA 1KZFA 4B5OA 4Y49C 4BBHA 3N7ZA 3TE4A 4U9YA 1IYKA 3H5ZA 2JLMA 4HNYB 3SXOA 2FSRA 3GKRA 3T9YA 4JLYA 2X7BA 4KVOE 3ZZIA 3OWCA 4C68A 4B14A 1RXTA 4KUBA 3PP9A 5CNPA 1ON0A 2Q7BA 4PK3A 5FVJA 5HMNA 2RC4A 2REEA 1XF8A 5G22A 3E0KA 4NEXA 3MGDA 2FE7A 4E2AA 3FBUA 2HUZA 4FD7A 3S6KA 5AG5A 2Q0YA 3KKWA 3CXQA 2FS5A 2EUIA 4R9MA 3VWEA 2C27A 1I12A 5HH1A 5JQ4A 2HV2A 4R87A 2Q44A 3EFAA 4A33A 4KOSA 5AG6A 4A30A 1IB1E 2QECA 3R1KA 4FD5A 5F47A 2VEZA 4F0XA 2JDDA 4JD6A 5F48A 4CYQA 2GANA 1Y9KA 2ZW6A 4I49A 2CXAA 4XNHB 4KOXA 3FXTA 3FYNA 2P6FA 2ZXVA 2FXFA 1B6BA 4UA3A 3D8PA 4AVAA 4KOTA 1WK4A 3F8KA 2YGWA 1NSLA 3IU2A 2WUUA 2Y0MA 4IUSA 4AG7A 5H86A 3EY5A 3H4QA 1XMTA 2G3AA 4QC6A 3I3GA 3DNSA 3R9FA 1I1DA 1S60A 4MFJA 4M3SA 4M85A 1VKCA 1L0CA 4JXRA 3GYAA 2DPTA 2GE3A 1R57A 3QB8A 1YK3A 2VZZA 4YRHA 2B5GA 1Z9UA 2ARHA 1IICA 2VQYA 2CNTA 4KLVA 4UWJA 1M4DA 1FY7A 2I00A 4MFPA 3TCVA 2DXQA 3G8WA 1BOBA 4PSWA 4UBRA 5C88A 2J8NA 2JEVA 3W6SA 4KOWA 5AG4A 3K9UA 5I0CA 1UFHA 3S6FA 1SQHA 3FB3A 3PGPA 1S7FA 4EVYA 4MFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II9 A;  3IWG A;  2B3U A;  2OH1 A;  5DWN A;  4NF1 A;  3W91 A;  3TO7 A;  2ZW4 A;  3D2M A;  2R1I A;  2OZH A;  2F5I A;  4R3K A;  4DNC A;  2D4P A;  2P0W A;  4XPD C;  3JUW A;  5J8C A;  4AVC A;  1K4J A;  1MJ9 A;  3GY9 A;  3V8I A;  3SHP A;  1Y7R A;  2REF A;  5JPH A;  2CNM A;  3G3S A;  4B5P A;  3NE7 A;  3D3S A;  2ATR A;  4XPK A;  2I79 A;  4NCZ A;  5H84 A;  4JJX A;  3ZJ0 A;  1MJA A;  4BMH A;  1TIQ A;  3RYO A;  5F46 A;  5EC4 A;  4FD4 A;  4AVB A;  4KOY A;  1YVO A;  4F6A A;  2PQ8 A;  5IX3 A;  4KVM E;  3R9G A;  4QBJ A;  2PDO A;  4ORF A;  2R98 A;  3TT2 A;  1S7L A;  3WR7 A;  1KUX A;  2H5M A;  4OLL A;  4U5Y A;  3EXN A;  1U6M A;  4AG9 A;  3F0A A;  4KOU A;  2Z10 A;  1QST A;  2IL4 A;  2J8M A;  3DR6 A;  1N71 A;  2OZU A;  1KUY A;  4ONU A;  5E96 A;  2ZW7 A;  3SXN A;  4PV6 A;  1CJW A;  3FIX A;  1V0C A;  3C26 A;  4F0Y A;  1Q2Y A;  1XIX A;  5GCN A;  4MI4 A;  5KTA A;  5IV0 A;  1J4J A;  2FIW A;  1LRZ A;  2FT0 A;  2KCW A;  1GHE A;  2OU2 A;  1BO4 A;  3BJ8 A;  4MBU A;  1P0H A;  3LD2 A;  4IF5 A;  1IID A;  4HNX B;  4LUA A;  2BL1 A;  2A4N A;  4B5P B;  3S6H A;  4Y49 B;  1KUV A;  4QVT A;  1S5K A;  1S7K A;  1YLE A;  2B58 A;  1Z4R A;  4MY3 A;  3BLN A;  3B8G A;  2NMT A;  2PSW A;  2AJ6 A;  4U9Z A;  3TOA A;  1CM0 A;  2Q4Y A;  3EC4 A;  4YGO A;  5KTD A;  2B4B A;  4E8O A;  5C82 A;  1M4I A;  5IB0 A;  4CAW A;  4RI1 A;  1VHS A;  4XNH C;  1I21 A;  2BUE A;  4ZBG A;  3TO9 A;  2R8V A;  4UWI A;  2Z0Z A;  4MJ8 A;  3VWD A;  4HNW B;  3TTH A;  4CRZ B;  5J8F A;  1M4G A;  2Q04 A;  3EO4 A;  2HQY A;  2FL4 A;  2BSW A;  3TOB A;  1M44 A;  2CNS A;  1PUA A;  1M1D A;  1NMT A;  2FIA A;  5F49 A;  4CAV A;  2O28 A;  2VI7 A;  5KTC A;  2PR1 A;  4KZT A;  1Y9W A;  1QSO A;  1MK4 A;  3R9E A;  2G3T A;  2PRB A;  4KOV A;  1S7N A;  4RS2 A;  2B4D A;  2G0B A;  4PSX A;  4XPL A;  2AE6 A;  2Q4V A;  3F5B A;  3R96 A;  2B5G B;  3BJ7 A;  2OB0 A;  2VZY A;  4KVX A;  3I9S A;  4HKF A;  4CRY B;  4JXQ A;  1PU9 A;  3TO6 A;  3W6X A;  3P2H A;  4H6Z A;  1B87 A;  2R7H A;  1P4N A;  2WPX A;  3DDD A;  3IGR A;  1IYL A;  4QB9 A;  2B3V A;  4YFJ A;  4MY0 A;  2CY2 A;  2QIR A;  3CXS A;  5DWM A;  4J3G A;  3TFY A;  1QSN A;  1S3Z A;  2WPW A;  3FNC A;  1YR0 A;  2FCK A;  2P6E A;  1Q2D A;  2PR8 A;  2BEI A;  2QML A;  1XEB A;  2P6G A;  3LOD A;  2JDC A;  3QAH A;  4OAE A;  3CXP A;  1Z4E A;  3DR8 A;  4CAX A;  3D2P A;  4PK2 A;  5ISV A;  1YVK A;  1YGH A;  1RO5 A;  2ZW5 A;  4CS0 B;  2B4D B;  4XPD B;  3P2F A;  3T90 A;  5EBV A;  2OZG A;  2Z11 A;  1MJB A;  4H6U A;  4R57 A;  1QSR A;  4OAD A;  4KLW A;  2K5T A;  3R95 A;  4FD6 A;  4NSQ A;  4JWP A;  4L8A A;  2PC1 A;  4GS4 A;  4K30 A;  1QSM A;  1YX0 A;  3PZJ A;  2VXK A;  2GIV A;  4QUS A;  2EVN A;  3FRM A;  1OZP A;  1XE4 A;  1NE9 A;  2D4O A;  3S6G A;  4L89 A;  4X5K A;  4LX9 A;  1Q2C A;  3JVN A;  3UY5 A;  4NXY A;  1WWZ A;  4KUA A;  3DSB A;  4KOR A;  2VBQ A;  4H89 A;  2J8R A;  4AB7 A;  2ZPA A;  1YRE A;  4R3L A;  4E0A A;  4MHD A;  1KZF A;  4B5O A;  4Y49 C;  3N7Z A;  3TE4 A;  4U9Y A;  1IYK A;  2JLM A;  4HNY B;  3SXO A;  2FSR A;  3GKR A;  3T9Y A;  4JLY A;  2X7B A;  4KVO E;  3ZZI A;  3OWC A;  1RXT A;  4KUB A;  3PP9 A;  5CNP A;  1ON0 A;  2Q7B A;  4PK3 A;  5FVJ A;  5HMN A;  2RC4 A;  2REE A;  1XF8 A;  3E0K A;  4NEX A;  3MGD A;  2FE7 A;  4E2A A;  3FBU A;  2HUZ A;  4FD7 A;  3S6K A;  2Q0Y A;  3KKW A;  3CXQ A;  2FS5 A;  2EUI A;  4R9M A;  3VWE A;  2C27 A;  1I12 A;  5HH1 A;  5JQ4 A;  2HV2 A;  4R87 A;  2Q44 A;  3EFA A;  4KOS A;  1IB1 E;  2QEC A;  3R1K A;  4FD5 A;  5F47 A;  2VEZ A;  2JDD A;  4JD6 A;  5F48 A;  2GAN A;  1Y9K A;  2ZW6 A;  4I49 A;  4XNH B;  4KOX A;  3FXT A;  3FYN A;  2P6F A;  2ZXV A;  2FXF A;  1B6B A;  4UA3 A;  3D8P A;  4AVA A;  4KOT A;  1WK4 A;  3F8K A;  1NSL A;  2Y0M A;  4AG7 A;  4IUS A;  5H86 A;  3EY5 A;  3H4Q A;  1XMT A;  2G3A A;  4QC6 A;  3I3G A;  3DNS A;  3R9F A;  1I1D A;  1S60 A;  4M3S A;  4M85 A;  1VKC A;  1L0C A;  4JXR A;  3GYA A;  2GE3 A;  1R57 A;  3QB8 A;  1YK3 A;  2VZZ A;  4YRH A;  2B5G A;  1Z9U A;  2ARH A;  1IIC A;  2VQY A;  2CNT A;  4KLV A;  4UWJ A;  1M4D A;  1FY7 A;  2I00 A;  3TCV A;  2DXQ A;  3G8W A;  1BOB A;  4PSW A;  4UBR A;  5C88 A;  2J8N A;  2JEV A;  3W6S A;  4KOW A;  3K9U A;  5I0C A;  1UFH A;  3S6F A;  1SQH A;  3FB3 A;  3PGP A;  1S7F A;  4EVY A; 
#chains in the Genus database with same CATH topology
 2YNC C;  2DEA A;  1LCP A;  1X10 A;  4II9 A;  3H8F A;  3IWG A;  2B3U A;  2OH1 A;  2Z3K A;  4NF1 A;  4NGR A;  5DWN A;  3W91 A;  4B6Z A;  3QNV A;  3IFE A;  2ZW4 A;  3D2M A;  3TO7 A;  2R1I A;  3DGV A;  3FF3 A;  2OZH A;  4DJL A;  2F5I A;  4R3K A;  4X8I A;  4R76 A;  4C7H A;  4DNC A;  4EFD A;  1ZO0 A;  2D4P A;  2P0W A;  4XPD C;  2AFZ A;  2QJ8 A;  3JUW A;  2EBJ A;  4UFW A;  5J8C A;  4GM5 A;  4AVC A;  1K4J A;  1MJ9 A;  3GY9 A;  3V8I A;  2XEG A;  1LAP A;  3CZX A;  1Y7R A;  2REF A;  3SHP A;  2CNM A;  5JPH A;  1DTD A;  1JQG A;  3BI1 A;  3G3S A;  1HDU A;  3WC7 A;  4ZI6 A;  2Z3O A;  4B5P A;  1VIX A;  3NE7 A;  3D3S A;  2ATR A;  2WZN A;  3FH4 A;  4XPK A;  2I79 A;  1X12 A;  4P4B A;  4NCZ A;  3MRU A;  4UEE A;  4NGM A;  5H84 A;  2PVW A;  3D67 A;  1YQE A;  4JJX A;  3ZJ0 A;  4OC1 A;  1MJA A;  2VL1 A;  4KSA A;  4Q7A A;  4BMH A;  1TIQ A;  4R7M A;  1ELL P;  4A39 A;  3RYO A;  5F46 A;  5EC4 A;  3IEH A;  4FD4 A;  4LQ6 A;  4AVB A;  4C2X A;  5HVF A;  4KOY A;  1YVO A;  4F6A A;  2PQ8 A;  4KS9 A;  3B3W A;  1BAV A;  5IX3 A;  1ZLI A;  4KVM E;  2PJ1 A;  3R9G A;  2PRQ A;  4P44 A;  2AFU A;  2QYV A;  2YND A;  4G1P A;  3RNZ A;  4QBJ A;  2PDO A;  4PXE A;  5CPA A;  5CBM A;  3CT9 A;  5IB9 A;  4ORF A;  3RBU A;  2PJB A;  2R98 A;  3D7H A;  3TT2 A;  3SJE A;  1ARL A;  1A2Z A;  1S7L A;  3WR7 A;  2I3C A;  1KUX A;  2H5M A;  4OLL A;  4U5Y A;  3SJF A;  3EXN A;  4MFQ A;  1U6M A;  4MHY A;  3WC5 A;  4UFX A;  2C6G A;  4UFV A;  4AG9 A;  3VAT A;  2EK8 A;  2GFQ A;  3F0A A;  4CAF A;  4UF4 A;  1F2O A;  1BPM A;  4X3R A;  4KOU A;  4EWT A;  2Z3L A;  2Z10 A;  1QST A;  3FVL A;  2IL4 A;  2J8M A;  4P6Y A;  2GU2 A;  3DR6 A;  1KWM A;  1N71 A;  4OID A;  2OZU A;  4R8F A;  1KUY A;  4ONU A;  5E96 A;  2ZW7 A;  3BXM A;  3SXN A;  5LRG A;  2ZEL A;  5LRK A;  4PV6 A;  1CJW A;  4OC3 A;  2PJA A;  3NFZ A;  3FIX A;  1V0C A;  2Z3M A;  1IY7 A;  1VHE A;  2C6P A;  2XEI A;  3C26 A;  4F0Y A;  4B13 A;  1Q2Y A;  1XIX A;  3B7I A;  5GCN A;  4B11 A;  4C2Y A;  4MCS A;  3LMS A;  1Y7E A;  1ZG8 A;  4CYN A;  4MI4 A;  5KTA A;  5IV0 A;  3PGP A;  1J4J A;  1PYT B;  2FIW A;  5LYD A;  1LRZ A;  2FT0 A;  2KCW A;  2OOT A;  1GHE A;  4P45 A;  2OU2 A;  1BO4 A;  3BJ8 A;  4MBU A;  1P0H A;  3LD2 A;  4IF5 A;  1IID A;  4HNX B;  1VGY A;  4LUA A;  3SJG A;  2ZEP A;  3KZW A;  2ZEN A;  5THW A;  3H8E A;  2PJC A;  2BL1 A;  2PJ8 A;  2A4N A;  4B5P B;  3S6H A;  2Q51 A;  4UCN A;  1CG2 A;  3KHZ A;  2CIJ A;  4MFZ A;  4NGQ A;  4OIW A;  2BOA A;  1BLL E;  4Y49 B;  4CYP A;  1ARM A;  1Z2L A;  2V8D A;  5J1Q A;  4FWU A;  2IJZ A;  3JTK A;  1KUV A;  4QVT A;  1H8L A;  2PJ3 A;  1S5K A;  2EWB A;  5G1Z A;  1S7K A;  1YLE A;  3D7G A;  1EE3 P;  2B58 A;  1Z4R A;  3PFE A;  1LAN A;  4MY3 A;  3BLN A;  2ZED A;  3B8G A;  2IQ6 A;  2NMT A;  3NA6 A;  2PSW A;  7CPA A;  3WT4 A;  2AJ6 A;  4U9Z A;  5AG7 A;  3TOA A;  3IWE A;  2PCU A;  1CM0 A;  2HC9 A;  2Q4Y A;  2Q7S A;  3EC4 A;  3KHX A;  4MCQ A;  4MXU A;  4MFL A;  3PB4 X;  4YGO A;  3VH9 A;  4B10 A;  5KTD A;  3GB0 A;  2B4B A;  4E8O A;  2PJ2 A;  3KL9 A;  5C82 A;  1M4I A;  4MMO A;  2JBJ A;  4CAW A;  5IB0 A;  4RI1 A;  2O4H A;  3ISZ A;  3KGQ A;  1IOF A;  1Z8W A;  1Y0R A;  4Q38 A;  1JWQ A;  1VHS A;  1QQ9 A;  2ZOF A;  1I21 A;  4XNH C;  6CPA A;  2ZEG A;  1YLO A;  4CGO A;  3GUX A;  1R3N A;  5K8N A;  2BUE A;  4UIB A;  4C2Z A;  4M6G A;  4ONW A;  4ZBG A;  3B35 A;  3TO9 A;  2Q4Z A;  2R8V A;  4MCP A;  4UWI A;  2Z0Z A;  4MJ8 A;  2V8V A;  3VWD A;  4HNW B;  3TTH A;  1Z8L A;  3KI9 A;  4CRZ B;  3PB7 X;  5J8F A;  4P10 A;  1M4G A;  2Q04 A;  4IK2 A;  3EO4 A;  2ABZ A;  1IGB A;  2HQY A;  2FL4 A;  2BSW A;  3TOB A;  1M44 A;  2CNS A;  4CPA A;  1PUA A;  5D8N A;  4NGS A;  2PJ0 A;  1M1D A;  1NMT A;  2YNC A;  2RFH A;  4BD9 A;  2FIA A;  5F49 A;  4CAV A;  1LFW A;  2PJ6 A;  2O28 A;  2VI7 A;  3KAS A;  5KTC A;  2PR1 A;  5K8P A;  1ZG9 A;  4KZT A;  1Y9W A;  1QSO A;  5AGE A;  1MK4 A;  3R9E A;  1YW6 A;  2G3T A;  4NJQ A;  2PRB A;  4KOV A;  4ZY1 A;  4YWY A;  4PXC A;  1YME A;  1ELM P;  1S7N A;  4RS2 A;  3RAM A;  2OR4 A;  3PEI A;  1ZLH A;  2B4D A;  2PJ9 A;  1FNO A;  2G0B A;  4TWE A;  4PSX A;  4A95 A;  1CPX A;  3TC8 A;  4UCP A;  4XPL A;  4NJR A;  2AE6 A;  4P4F A;  2Q4V A;  3F5B A;  4JZ0 A;  3R96 A;  2B5G B;  3BJ7 A;  1NSA A;  2OB0 A;  2VZY A;  4KVX A;  4KSF A;  1TF9 A;  3I9S A;  5F09 A;  2BCO A;  3NH5 A;  1TKF A;  4HKF A;  4CRY B;  4JXQ A;  4ZGY B;  1CBX A;  1XOV A;  2F8H A;  1HDQ A;  1PU9 A;  4OC4 A;  4CYO A;  4B12 A;  1CP7 A;  4PQA A;  2WSA A;  3TO6 A;  3W6X A;  3MN8 A;  3P2H A;  4H6Z A;  1B87 A;  2R7H A;  4BIN A;  1P4N A;  3B3S A;  5A28 A;  1BPN A;  2WPX A;  4P4E A;  3DDD A;  3IGR A;  4F9U A;  1IYL A;  5HVG A;  4QB9 A;  2B3V A;  4CGL A;  4YFJ A;  1R43 A;  5DS0 A;  4M6I A;  4CGP A;  4EME A;  4MY0 A;  5I4M A;  1XRY A;  3LAC A;  2PJ7 A;  2WYR A;  5G20 A;  2CY2 A;  3LWU A;  2QIR A;  3CXS A;  3QAY A;  1CPS A;  2ANP A;  3JRU A;  3KR4 A;  4MHZ A;  3IWW A;  4CGM A;  5DWM A;  4J3G A;  3S9L A;  1QSN A;  3TFY A;  3N5F A;  1S3Z A;  3L2N A;  2WPW A;  3FNC A;  4Q36 A;  2Z3N A;  1YR0 A;  2FCK A;  2P6E A;  1Q2D A;  2PR8 A;  2BEI A;  2QML A;  3BI0 A;  1XEB A;  3GLJ A;  2P6G A;  2ZEH A;  2PJ4 A;  3A9L A;  4A37 A;  5A27 A;  1Z5R A;  3LOD A;  2JDC A;  3QAH A;  4LQG A;  4OAE A;  4O23 A;  3IO1 A;  3IJ3 A;  3CXP A;  2G9D A;  1LAM A;  4RN7 A;  2AFX A;  1Z4E A;  2F7V A;  3DR8 A;  4CAX A;  4ZYQ A;  3B3C A;  3D2P A;  4MCR A;  4PK2 A;  2GRE A;  1ZG7 A;  4NGT A;  3S9M A;  5JGF A;  4UCM A;  3SI1 A;  4CGN A;  4NGN A;  4IAV A;  5ISV A;  3NH8 A;  3D4U A;  1AMP A;  3WAB A;  5JM6 A;  1YVK A;  2PJ5 A;  1YGH A;  4GXH A;  2PVV A;  1RO5 A;  2AFM A;  2ZW5 A;  4CS0 B;  4DUK A;  3IU1 A;  2IMO A;  3PB9 X;  2JBK A;  3D66 A;  4NFR A;  4OC2 A;  4UEZ A;  1XBU A;  2B4D B;  3VAR A;  4XPD B;  3PFO A;  4A2Z A;  1M4L A;  3FMC A;  3P2F A;  3FJU A;  3T90 A;  5EBV A;  2OZG A;  2Z11 A;  1MJB A;  2Q43 A;  1TKJ A;  3D68 A;  1GYT A;  4H6U A;  4FAI A;  4R57 A;  1QSR A;  4OAD A;  4KLW A;  3K9T A;  4W9Y A;  5G21 A;  2K5T A;  3R95 A;  4FD6 A;  4NSQ A;  4P4D A;  4A31 A;  4JWP A;  5LYI A;  1IOI A;  4L8A A;  4FBE A;  2PC1 A;  2RB7 A;  1F2P A;  2V8H A;  4GS4 A;  4K30 A;  1PCA A;  1QSM A;  4KSI A;  4C7I A;  8CPA A;  1YX0 A;  3PZJ A;  3D7F A;  4OKO A;  2VXK A;  4R6T A;  2GIV A;  4MHN A;  4QUS A;  2V8G A;  2EVN A;  1Q7L A;  1AYE A;  3FRM A;  4M6H A;  1OZP A;  3PB6 X;  1XE4 A;  3SI0 A;  1NE9 A;  5BWA B;  2D4O A;  1Z8X A;  3RZA A;  3S6G A;  3KQX A;  4L89 A;  4X5K A;  1CP6 A;  4ZX8 A;  4CAE A;  5HXD A;  2Z3P A;  4LX9 A;  3CPX A;  1Q2C A;  3JVN A;  3UY5 A;  4RUH A;  4NXY A;  2CTC A;  1WWZ A;  4KUA A;  3DSB A;  3IC1 A;  1QMU A;  2AFS A;  2PE3 A;  1XFO A;  4KOR A;  4JYW A;  4IHM A;  2ZEE A;  2GLJ A;  3I1U A;  3PRT A;  3H8G A;  2VBQ A;  4H89 A;  2YNE A;  2DPS A;  5JH9 A;  2J8R A;  4A32 A;  1TXR A;  4AB7 A;  2ZPA A;  1YRE A;  4R3L A;  3WC6 A;  4E0A A;  1YSJ A;  4MHD A;  1KZF A;  2J9A A;  4B5O A;  3D7D A;  3PB8 X;  4Y49 C;  2AFW A;  4BBH A;  3N7Z A;  1XJO A;  2PIY A;  2XEF A;  3TE4 A;  2EO8 A;  1TF8 A;  3PBB A;  4UIA A;  2V77 A;  4U9Y A;  1IYK A;  3H5Z A;  2JLM A;  3B3T A;  4HNY B;  1F57 A;  2GLF A;  3SXO A;  3IIB A;  2FSR A;  3GKR A;  3TX8 A;  4OC0 A;  3T9Y A;  4JLY A;  4WJB A;  2X7B A;  4KVO E;  3ZZI A;  4X2T A;  3OWC A;  4C68 A;  4B14 A;  3FED A;  3NE8 A;  4TNU A;  1RXT A;  2ZEM A;  3V38 A;  4KUB A;  2ZOG A;  3PP9 A;  5CNP A;  1ON0 A;  2Q7B A;  5K8M A;  4PK3 A;  5FVJ A;  1FT7 A;  3FX6 A;  5HMN A;  2RC4 A;  2REE A;  4WWV A;  1XF8 A;  3HLP A;  3BHX A;  3NH4 A;  5G22 A;  3V7Z A;  3E0K A;  3K2K A;  2HB6 A;  3S9N A;  4NEX A;  3MGD A;  2FE7 A;  4E2A A;  3FBU A;  3SJX A;  2HUZ A;  4FD7 A;  3S6K A;  5AG5 A;  2QVP A;  2Q0Y A;  3KKW A;  2JEW A;  3CXQ A;  2FS5 A;  2EUI A;  5LYL A;  2ZEO A;  4R9M A;  3KQZ A;  3VWE A;  2C27 A;  1I12 A;  3B2Y A;  5HH1 A;  5JQ4 A;  2HV2 A;  4R87 A;  1DE4 C;  2Q44 A;  4PXD A;  3EFA A;  5D29 A;  1UWY A;  1Y0Y A;  3ISX A;  4KOS A;  5AG6 A;  4A33 A;  4A30 A;  1IB1 E;  2QEC A;  3R1K A;  4FD5 A;  5HVH A;  2CTB A;  2VEZ A;  3FEE A;  2C6C A;  5F47 A;  4F0X A;  2JDD A;  4F9V A;  4JD6 A;  5F48 A;  4P4J A;  4CYQ A;  2GAN A;  3CPA A;  1Y9K A;  1Z8T A;  2ZW6 A;  4I49 A;  2CXA A;  3DLJ A;  4PPZ A;  4KOX A;  4XNH B;  3FXT A;  4A94 A;  3FYN A;  4OP4 A;  2P6F A;  3T8W A;  4FUU A;  2ZXV A;  2FXF A;  3B3V A;  1B6B A;  4UA3 A;  2AFO A;  4AXV A;  3D8P A;  4AVA A;  2POK A;  4KOT A;  1WK4 A;  3F8K A;  2YGW A;  1NSL A;  4OC5 A;  2DF5 A;  4ZY2 A;  3IU2 A;  2WUU A;  2Y0M A;  4IUS A;  4AG7 A;  2NSM A;  5H86 A;  4ZX9 A;  3SI2 A;  5K8O A;  3EY5 A;  3H4Q A;  4MRI A;  1XMT A;  2G3A A;  4NGP A;  4QC6 A;  3I3G A;  3DNS A;  3R9F A;  1XMB A;  4ZY0 A;  1I1D A;  1S60 A;  2FVG A;  4MFJ A;  4M3S A;  2O53 A;  1TKH A;  4M85 A;  2C1C A;  1YW4 A;  1VKC A;  4YU9 A;  1L0C A;  5ELY A;  4JXR A;  4MHP A;  3GYA A;  2DPT A;  1LOK A;  1R57 A;  2BO9 A;  4DYO A;  4A38 A;  3QB8 A;  5EMI A;  4F8Z A;  1YK3 A;  4OME A;  3RO0 A;  2VZZ A;  1HEE A;  4YRH A;  2B5G A;  3KR5 A;  1Z9U A;  2ARH A;  2ZEF A;  2CF4 A;  1OBR A;  1IIC A;  4P4I A;  2VQY A;  1VHO A;  2CNT A;  5LYF A;  4H2K A;  4KLV A;  4UWJ A;  4K3N A;  1IU8 A;  1M4D A;  3FEC A;  1FY7 A;  2PIZ A;  2I00 A;  4MFP A;  3TCV A;  2DXQ A;  3G8W A;  4HPS A;  1BOB A;  2NYQ A;  4UEF A;  4Z65 A;  2EK9 A;  3HUV A;  4PSW A;  4UBR A;  1RTQ A;  5C88 A;  2J8N A;  2JEV A;  3CDX A;  3W6S A;  4KOW A;  5AG4 A;  1CX8 A;  3K9U A;  5LRJ A;  5I0C A;  1UFH A;  3S6F A;  1SQH A;  2ODF A;  1AUG A;  2XEJ A;  3FB3 A;  3GIU A;  3PBE A;  2GE3 A;  4PXB A;  1S7F A;  4EVY A;  4MFK A; 
#chains in the Genus database with same CATH homology
 2YNC C;  4II9 A;  3IWG A;  2B3U A;  2OH1 A;  2Z3K A;  4NF1 A;  5DWN A;  3W91 A;  3TO7 A;  2ZW4 A;  3D2M A;  2R1I A;  2OZH A;  2F5I A;  4R3K A;  4C7H A;  4DNC A;  1ZO0 A;  2D4P A;  2P0W A;  4XPD C;  3JUW A;  4UFW A;  5J8C A;  4AVC A;  1K4J A;  1MJ9 A;  3GY9 A;  3V8I A;  3SHP A;  1Y7R A;  2REF A;  5JPH A;  2CNM A;  3G3S A;  2Z3O A;  4B5P A;  3NE7 A;  3D3S A;  2ATR A;  4XPK A;  2I79 A;  4NCZ A;  5H84 A;  4JJX A;  3ZJ0 A;  1MJA A;  4KSA A;  4BMH A;  1TIQ A;  3RYO A;  5F46 A;  5EC4 A;  4FD4 A;  4AVB A;  4C2X A;  4KOY A;  1YVO A;  4F6A A;  2PQ8 A;  4KS9 A;  5IX3 A;  4KVM E;  3R9G A;  5A27 A;  2YND A;  4QBJ A;  2PDO A;  4ORF A;  2R98 A;  3TT2 A;  1S7L A;  3WR7 A;  1KUX A;  2H5M A;  4OLL A;  4U5Y A;  3EXN A;  4MFQ A;  1U6M A;  4UFX A;  4UFV A;  4AG9 A;  4CAF A;  3F0A A;  4KOU A;  2Z3L A;  2Z10 A;  1QST A;  2IL4 A;  2J8M A;  3DR6 A;  1N71 A;  2OZU A;  1KUY A;  4ONU A;  5E96 A;  2ZW7 A;  3SXN A;  4PV6 A;  1CJW A;  3FIX A;  1V0C A;  2Z3M A;  3C26 A;  4F0Y A;  4B13 A;  1Q2Y A;  1XIX A;  5GCN A;  4B11 A;  4C2Y A;  4CYN A;  4MI4 A;  5KTA A;  5IV0 A;  1J4J A;  2FIW A;  1LRZ A;  2FT0 A;  2KCW A;  1GHE A;  2OU2 A;  1BO4 A;  3BJ8 A;  4MBU A;  1P0H A;  3LD2 A;  4IF5 A;  1IID A;  4HNX B;  4LUA A;  2BL1 A;  2A4N A;  4B5P B;  3S6H A;  4UCN A;  4MFZ A;  4Y49 B;  4CYP A;  3JTK A;  1KUV A;  4QVT A;  1S5K A;  5G1Z A;  1S7K A;  1YLE A;  2B58 A;  1Z4R A;  4MY3 A;  3BLN A;  3B8G A;  2NMT A;  2PSW A;  2AJ6 A;  4U9Z A;  5AG7 A;  3TOA A;  3IWE A;  1CM0 A;  2Q4Y A;  3EC4 A;  4YGO A;  4MFL A;  4B10 A;  5KTD A;  2B4B A;  4E8O A;  5C82 A;  1M4I A;  5IB0 A;  4CAW A;  4RI1 A;  4Q38 A;  1VHS A;  4XNH C;  1I21 A;  4CGO A;  2BUE A;  4C2Z A;  4ZBG A;  3TO9 A;  2R8V A;  4UWI A;  2Z0Z A;  4MJ8 A;  3VWD A;  4HNW B;  3TTH A;  4CRZ B;  5J8F A;  1M4G A;  2Q04 A;  3EO4 A;  2HQY A;  2FL4 A;  2BSW A;  3TOB A;  1M44 A;  2CNS A;  1PUA A;  1M1D A;  1NMT A;  2YNC A;  2FIA A;  5F49 A;  4CAV A;  2O28 A;  2VI7 A;  5KTC A;  2PR1 A;  4KZT A;  1Y9W A;  1QSO A;  5AGE A;  1MK4 A;  3R9E A;  2G3T A;  2PRB A;  4KOV A;  1S7N A;  4RS2 A;  2B4D A;  2G0B A;  4PSX A;  4A95 A;  4UCP A;  4XPL A;  2AE6 A;  2Q4V A;  3F5B A;  3R96 A;  2B5G B;  3BJ7 A;  2OB0 A;  2VZY A;  4KVX A;  4KSF A;  3I9S A;  4HKF A;  4CRY B;  4JXQ A;  4ZGY B;  1PU9 A;  4CYO A;  4B12 A;  3TO6 A;  2WSA A;  3W6X A;  3P2H A;  4H6Z A;  1B87 A;  2R7H A;  1P4N A;  5A28 A;  2WPX A;  3DDD A;  3IGR A;  1IYL A;  4QB9 A;  2B3V A;  4CGL A;  4YFJ A;  4CGP A;  4MY0 A;  5G20 A;  2CY2 A;  2QIR A;  3CXS A;  4CGM A;  5DWM A;  4J3G A;  3TFY A;  1QSN A;  1S3Z A;  2WPW A;  3FNC A;  4Q36 A;  2Z3N A;  1YR0 A;  2FCK A;  2P6E A;  1Q2D A;  2PR8 A;  2BEI A;  2QML A;  1XEB A;  2P6G A;  3A9L A;  3LOD A;  2JDC A;  3QAH A;  4OAE A;  3CXP A;  1Z4E A;  3DR8 A;  4CAX A;  3D2P A;  4PK2 A;  4UCM A;  4CGN A;  5ISV A;  1YVK A;  1YGH A;  1RO5 A;  2ZW5 A;  4CS0 B;  3IU1 A;  2B4D B;  4XPD B;  4A2Z A;  3P2F A;  3T90 A;  5EBV A;  2OZG A;  2Z11 A;  1MJB A;  4H6U A;  4R57 A;  1QSR A;  4OAD A;  4KLW A;  5G21 A;  2K5T A;  3R95 A;  4FD6 A;  4NSQ A;  4A31 A;  4JWP A;  4L8A A;  2PC1 A;  4GS4 A;  4K30 A;  1QSM A;  4C7I A;  1YX0 A;  3PZJ A;  2VXK A;  2GIV A;  4QUS A;  2EVN A;  3FRM A;  1OZP A;  1XE4 A;  1NE9 A;  5BWA B;  2D4O A;  3S6G A;  4L89 A;  4X5K A;  4CAE A;  2Z3P A;  4LX9 A;  1Q2C A;  3JVN A;  3UY5 A;  4NXY A;  1WWZ A;  4KUA A;  3DSB A;  4KOR A;  2VBQ A;  4H89 A;  2YNE A;  2DPS A;  2J8R A;  4A32 A;  4AB7 A;  2ZPA A;  1YRE A;  4R3L A;  4E0A A;  4MHD A;  1KZF A;  4B5O A;  4Y49 C;  4BBH A;  3N7Z A;  3TE4 A;  4U9Y A;  1IYK A;  3H5Z A;  2JLM A;  4HNY B;  3SXO A;  2FSR A;  3GKR A;  3T9Y A;  4JLY A;  2X7B A;  4KVO E;  3ZZI A;  3OWC A;  4C68 A;  4B14 A;  1RXT A;  4KUB A;  3PP9 A;  5CNP A;  1ON0 A;  2Q7B A;  4PK3 A;  5FVJ A;  5HMN A;  2RC4 A;  2REE A;  1XF8 A;  5G22 A;  3E0K A;  4NEX A;  3MGD A;  2FE7 A;  4E2A A;  3FBU A;  2HUZ A;  4FD7 A;  3S6K A;  5AG5 A;  2Q0Y A;  3KKW A;  3CXQ A;  2FS5 A;  2EUI A;  4R9M A;  3VWE A;  2C27 A;  1I12 A;  5HH1 A;  5JQ4 A;  2HV2 A;  4R87 A;  2Q44 A;  3EFA A;  4A33 A;  4KOS A;  5AG6 A;  4A30 A;  1IB1 E;  2QEC A;  3R1K A;  4FD5 A;  5F47 A;  2VEZ A;  4F0X A;  2JDD A;  4JD6 A;  5F48 A;  4CYQ A;  2GAN A;  1Y9K A;  2ZW6 A;  4I49 A;  2CXA A;  4XNH B;  4KOX A;  3FXT A;  3FYN A;  2P6F A;  2ZXV A;  2FXF A;  1B6B A;  4UA3 A;  3D8P A;  4AVA A;  4KOT A;  1WK4 A;  3F8K A;  2YGW A;  1NSL A;  3IU2 A;  2WUU A;  2Y0M A;  4IUS A;  4AG7 A;  5H86 A;  3EY5 A;  3H4Q A;  1XMT A;  2G3A A;  4QC6 A;  3I3G A;  3DNS A;  3R9F A;  1I1D A;  1S60 A;  4MFJ A;  4M3S A;  4M85 A;  1VKC A;  1L0C A;  4JXR A;  3GYA A;  2DPT A;  2GE3 A;  1R57 A;  3QB8 A;  1YK3 A;  2VZZ A;  4YRH A;  2B5G A;  1Z9U A;  2ARH A;  1IIC A;  2VQY A;  2CNT A;  4KLV A;  4UWJ A;  1M4D A;  1FY7 A;  2I00 A;  4MFP A;  3TCV A;  2DXQ A;  3G8W A;  1BOB A;  4PSW A;  4UBR A;  5C88 A;  2J8N A;  2JEV A;  3W6S A;  4KOW A;  5AG4 A;  3K9U A;  5I0C A;  1UFH A;  3S6F A;  1SQH A;  3FB3 A;  3PGP A;  1S7F A;  4EVY A;  4MFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...